The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
80
|
structure length |
80
|
Chain Sequence |
LYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The molecular basis of N-end rule recognition.
pubmed doi rcsb |
| molecule keywords |
ATP-dependent Clp protease adapter protein clpS
|
| molecule tags |
Peptide binding protein
|
| source organism |
Caulobacter vibrioides
|
| total genus |
24
|
| structure length |
80
|
| sequence length |
80
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-07-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02617 | ClpS | ATP-dependent Clp protease adaptor protein ClpS |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ribosomal Protein L30; Chain: A, | Ribosomal Protein L30; Chain: A, |
#chains in the Genus database with same CATH superfamily 1R6Q C; 4YKA A; 3G1B A; 3O2B A; 3G3P A; 1MBX C; 3O2H A; 3DNJ A; 1RQV A; 2W9R A; 3GW1 A; 3GQ1 A; 1MBV B; 1R6O C; 4YJX A; 3G19 A; 1DD4 A; 2WA9 A; 1RQU A; 1MG9 A; 1MBU C; 3O2O A; 1RQS A; 1LZW A; 1CTF A; 3GQ0 A; 3O1F B; 2WA8 A; 1DD3 A; 4YJM A; 3O1F A; #chains in the Genus database with same CATH topology 3I55 W; 3OW2 V; 3CCE W; 2ZJQ W; 1MWT A; 1MBX C; 1MWU A; 1RQV A; 3CC2 W; 4WFA W; 1VQ4 W; 1W2B V; 1DD4 A; 1S72 W; 1Q86 X; 4UY8 Z; 4U67 W; 1YJW W; 1VQO W; 1YIT W; 1VQL W; 4DKI A; 4IO9 W; 3CCR W; 4WF9 W; 1YIJ W; 3GQ0 A; 3O1F B; 2WA8 A; 4YJM A; 5HL7 W; 3G71 W; 3O1F A; 2ZJP W; 3CC4 W; 1K9M X; 1KQS V; 4YKA A; 3G3P A; 3CPW V; 1VQ8 W; 4BL2 A; 1YHQ W; 4WCE W; 5JVG W; 1M90 X; 1Q81 X; 1VQ5 W; 1M1K X; 5CA3 A; 1VQ9 W; 4YJX A; 1NJI X; 3CCV W; 3D3I A; 2WA9 A; 1RQU A; 2QA4 W; 3O2O A; 1YJN W; 3W7T A; 2OTJ W; 4WFB W; 1VQQ A; 1YI2 W; 1KD1 X; 3I56 W; 1MWS A; 1K73 X; 3J7Z Z; 3CF5 W; 3DLL W; 4IOC W; 3W7X A; 3PIO W; 3G1B A; 3ZG5 A; 1N8R X; 1VQP W; 5M19 A; 5M18 A; 3CCU W; 5DM7 W; 3DNJ A; 2QEX W; 3CCS W; 3CCL W; 4WFN W; 1VQN W; 2W9R A; 3GW1 A; 2ZJR W; 1MBV B; 3CC7 W; 3G4S W; 3W7S A; 1VQ6 W; 5JVH W; 3W7W A; 1MWR A; 1JJ2 V; 1VQK W; 1MBU C; 3CCJ W; 1RQS A; 5GAE a; 3CME W; 3CD6 W; 5GAD a; 4BL3 A; 4CJN A; 5GW7 A; 1VQ7 W; 3O2B A; 3PIP W; 1DD3 A; 2OTL W; 3W7U A; 1R6Q C; 3CXC V; 4IOA W; 3CCQ W; 3O2H A; 3GQ1 A; 1VQM W; 1R6O C; 5M1A A; 3G19 A; 1Q82 X; 5GAH a; 1BXY A; 5GAG a; 3CCM W; 1Q7Y X; 1MG9 A; 1QVF V; 4CPK A; 3ZG0 A; 3G6E W; 1YJ9 W; 3CMA W; 5DM6 W; 1LZW A; 1CTF A; 1QVG V; 1KC8 X; 3ZFZ A; 1K8A X; #chains in the Genus database with same CATH homology 1R6Q C; 4YKA A; 3G1B A; 3O2B A; 3G3P A; 1MBX C; 3O2H A; 3DNJ A; 1RQV A; 2W9R A; 3GW1 A; 3GQ1 A; 1MBV B; 1R6O C; 4YJX A; 3G19 A; 1DD4 A; 2WA9 A; 1RQU A; 1MG9 A; 1MBU C; 3O2O A; 1RQS A; 1LZW A; 1CTF A; 3GQ0 A; 3O1F B; 2WA8 A; 1DD3 A; 4YJM A; 3O1F A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
