1DD3A

Crystal structure of ribosomal protein l12 from thermotoga maritima
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd3A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd3A02
2W9RA 1RQVA 3O1FA 2WA9A 1RQSA 1CTFA 1DD3A 3G19A 3O2HA 4YJXA 1MBVB 1LZWA 3O1FB 3GQ1A 3O2OA 3O2BA 4YJMA 3GW1A 1MBXC 1R6OC 1R6QC 3G3PA 1RQUA 3GQ0A 1MG9A 2WA8A 4YKAA 3G1BA 1MBUC 1DD4A 3DNJA
chains in the Genus database with same CATH superfamily
3MTUE 2FYUE 4KT0J 3L75G 3A5TA 3W68A 3MGNA 3L71G 4N78D 2FYUJ 3R2PA 3V2RA 2HPCB 1L0NG 3KPEA 4YXWH 4N3YB 3PIOW 1JY3N 1K9MX 3H1LG 3O2BA 1LJ2A 1BE3G 3G1BA 2W6BA 1JY3P 5AVYB 1MKMA 2AEFA 1ZN5A 2IDBA 3PLNA 4EOTA 1X22A 4U3FD 1VQLP 5AW4B 1Q90D 1SQPG 3JCUH 2HLOA 1KILA 4IFDK 1NKZB 1NHLA 2OTJP 1H0TA 3MP7B 4I7ZC 4I7ZB 3G3PA 5AVZB 3U1AA 1EXIA 4DT0A 1VQMW 2QJYC 2QSIA 1NTZK 4Y99B 2KS1A 1HUCA 2FBWC 1FU1A 3O1FA 2OQQA 2J59M 1YJWP 1NU1K 1M90Q 3U1CA 4GDOA 3RK2C 3RK2B 2MJZA 3W7SA 3AEBC 1KC8Q 4EI2A 3CCVW 3L72G 2Y0CA 1LTJB 2H88C 4JQ0D 1BGYG 2K9JB 5APWA 3P8CE 5DJTB 2GUVA 1M8OB 2HYNA 4D6TD 1KQLA 3H32A 1QEXA 2ZFCA 2W8ZA 3ZG5A 2YKQA 1N73B 1R5LA 2I1JA 5CBNA 1HBWA 3BRVB 1VQ6P 1IK9A 3BCCE 5B66E 1SQXK 3F89A 5KKZC 2LXCB 5AW0B 3T97A 3VMXA 1J1EC 1J1EB 1KYOH 3BCCJ 3D6ZA 1GMJA 3CXHI 1PZQA 2Y0EA 1NTMD 2FFDA 1KB9I 1IFJA 1KILB 1LTSC 5CJ0A 2FY8A 1IO4A 2XNXA 2XNDH 4PD4D 2WT7A 5M19A 4PV1D 2KS1B 2BCCD 1ZRTD 1L0NK 4GOEA 2B87A 3CCUP 4BL3A 1DX7A 1YI2W 1KFMA 5GAHa 2IBZD 3S1KA 1ZMEC 2KLVA 3C9IA 1VF5D 3V4QA 4DKIA 1SFCB 1QVFO 2ZYDA 3E7KA 1GDTA 1KILE 1SQPK 2OYOA 4ZNCA 3HUSB 5KTBA 1KV4A 4O9BA 2QJKB 1R6QC 3SWYA 1W2EA 1M57D 1YTZT 3SWKA 4PV1C 1JCDA 1NOHA 1IFMA 1N8RQ 1YJNP 1IK7A 1L0LG 3Q3DA 1G2CA 1M1JA 1M1KX 3AE7C 3VN0A 1VDFA 1P84H 1WRGA 4WWIA 1VF5C 2QA4W 2A45G 3CF5W 3T97B 1NTKD 1AJYA 2KXPB 1VQKP 1S72P 4YTPC 1FBMA 3V4WA 1JMBA 1BSHA 4WBAA 2FFDC 3CLQA 1L4AA 4K35A 1MBUC 1SQVG 2L91A 1OMIA 3L70G 5CCGA 1PGOA 4M3LA 2WA9A 2N1TA 2O1JA 1DD3A 1RY3A 2W6JH 1U57A 1G1IA 4GODA 4RESB 1H8AA 1ZLLA 1NTZE 3M06A 3HD7D 4NPDA 1FS0E 5KAIH 3ZG0A 3G6EW 1WMKA 3BCCG 3D70A 1NU1E 1LT9A 4IFFA 2A06E 1YBKA 1NTZJ 3TF5A 1FDMA 1LTTC 3TGUE 3VYIA 1OXZA 3ITKA 1NU1J 2PGDA 4QMAA 1KZUB 3V5BA 1MV8A 1ZR2A 3JCUE 1CZQA 3TGUJ 4H13D 1T3JA 1JY3O 3V2NA 1SQQD 5BU5A 1Q86X 1N7SD 3L37A 3HTKB 2N1TD 2A45I 1JY2N 4ZKPA 3Q5RA 1G2CB 1M1JC 1M1JB 5AW2B 2FXOA 4Z1MH 3QH9A 3A0BH 2E43A 1JY2P 1VQMP 1SQXE 2WSEH 3Q5PA 3CXHD 5AVSB 1URQD 1X79B 1VL2A 1Q7YX 1KB9D 3C8VA 1PPJE 3ZDMA 2Z4EA 1L4AB 1SQXJ 3L75E 1FZBA 1OZHA 4D6TG 4YXDC 2UWJE 3L71E 5CCGC 5AW6B 2O1KA 3CCVP 1N7SC 2SPZA 1AVOA 1AQTA 2N1TB 2N1TC 1LZWA 1L0LK 5BVZA 3L75J 4NPFX 2OYHB 2JJLA 3L71J 5AW7B 2XZRA 4H0LD 5GW7A 5M1AA 5M1BA 5APQA 2C9LY 1VQ7W 4UY8Z 3G4SW 2B9BA 1LT9C 1LT9B 3H1LE 1W5CE 1IFIA 2ZJPW 1BE3E 5EFWB 2H8PD 3QWOC 1VQNW 1CI6B 3A3YB 1YIJP 2FXMA 1RE4A 1QL1A 1KYOE 1PL5A 3H1LJ 3CCEW 3TYYA 3TK1A 1BSNA 5APYA 3D6YA 1BE3J 1SQPE 1MWUA 2KLUA 1SQVK 4HB1A 3RK3E 4ZKUA 1OW6A 3IR9A 4YJMA 2BEQD 1SQPJ 4H0LC 4H0LB 4H44B 3GHGB 2IBZG 1YQ3C 1EC5A 1S2EA 2P7JA 2Q1KA 4L73A 2WPQA 3EQ2A 1LP1A 1ZXGA 5CA3A 1J2JB 3VOPA 1W2BV 1OFCX 3CX5E 3TGUG 3L72E 1FDIA 2QE7H 2YXQB 1ZV8A 3CWBD 1YI2P 5AW8B 1BGYE 3DNJA 3EFFK 3N7NA 1YHQW 3L72J 5M18A 1DEEG 1IZNB 2QRXA 2PRRA 2H7HA 4U7JA 1Q81Q 3D3IA 1BGYJ 5CCHD 2WSCH 4MN4C 2HFED 3I55W 2K9YA 4GT1A 3IN6A 2I1KA 1FAVA 1IFPA 2YMKA 5H2FH 1QVFV 1IC2A 1P84E 3EFGA 1RQSA 2Q5UA 3L73D 1MWSA 1RE4C 1X9VA 1Q82Q 1GW4A 1YTZI 5B5EH 5KLVD 2FXPA 1DIPA 2C0WA 1PPJG 2LKMA 2E76D 2W9RA 4PD4H 2QA4P 1SQBG 5KJ7D 3GLMA 2NRGA 1X0TA 1XTCC 3J7ZZ 2ZYGA 2KZIA 1M7LA 2AXTH 2KNCA 1JO5A 3VP8A 1SLQA 1NH4A 2E75D 5CBOA 4L76A 3KDPB 1OIPA 5KAIE 1LP1B 4IO9W 3H1IE 5K5GB 3L74G 3AEFC 3CCSW 3P8CD 1NTMK 4LC1A 1VQ5W 4JBZA 4W7ZA 3AE5C 3H1IJ 2E76C 3L36A 3G6EP 3FGAD 1SQQG 2C0XA 2FKWB 4DCKA 5APUA 1KD1X 1EQ7A 4RKUJ 3H1KD 3L4FA 2MKVA 2IPPA 3H1HE 2E75C 2E75B 2QM8A 2WSFJ 2RN0A 4EDFA 2QJYB 1L0LE 3B71A 3EWKA 3RGUA 4IFMA 1PP9E 2OTKE 2ZT9D 2RH0A 3H1HJ 3O2OA 1FZFA 2O01N 3AECC 1L0LJ 3A0BE 2WWWA 1PP9J 4BRYA 2Y9YA 2HG5D 3I5CA 3K5BA 3N4XA 4JF7A 3HE4A 1YITW 1BCCG 4N78E 4IOAW 1JY2O 1T3UA 2ZAEB 3A2AA 2P1JA 1EZVD 1GK4A 3FWNA 2WSEJ 3M0DC 1MFZA 1SQVE 2KNCB 3L70E 5L8RJ 1VPCA 2ZT9C 2ZT9B 3HRNA 1SQVJ 1NTKK 5GTIH 3L70J 4DJGA 4OWFA 1KYOI 5KAFH 3B8EB 3CMEP 1Z56A 2OYIA 2ZJSE 4YKAA 5KKZB 4IL6H 2PAJA 3PP5A 1PFIA 2WPRA 3I56W 1T2KD 1VQ7P 1SQBK 3G4SP 3GQ1A 2HODA 1JJ2V 4WY4D 1FDOA 1W2BO 1Q7YQ 1OVUA 5AVXB 2M0BA 2Y0DA 1VQNP 1H0TB 2JEEA 1HGZA 4DZOA 3CCEP 3GW6A 2M3BA 1U7JA 3O1FB 1S3JA 1OVVA 1ZOYC 2K88A 1NJIQ 3H1IG 3S4RA 2WSSH 2YO2A 5CHXA 3CWBG 2JP3A 5AW9B 3VMAA 3JSVC 3CX5H 3O6QA 1T2KC 3HE4B 4WY4C 1MBVB 1SQQK 1USEA 3WUUA 4XE5B 4D6TE 2P2UA 1NTZD 1QL2A 2R5DA 1LTGC 1FC2C 3LIDA 1EDJA 1E5WA 5APVA 4PV1B 1P84I 3LIEA 3H1HG 2A06D 3H32B 4R4MA 4D6TJ 3PH0A 5CJ4A 3WUVA 4OH8B 1LTIC 2K3RA 3TNUA 1PP9G 1YHQP 3ZFZA 3HD7A 5H2FE 2WSCJ 1ZR4A 5AVVB 5DM6W 3AEGC 2OYIC 2OYIB 1VF5B 3SFEC 1S5LH 3P7KA 3U59A 3L35A 4NPEA 1HGVA 1NTME 3CI9A 5B5EE 1NWQA 3NXSA 3PTZA 1QGKB 2IZ1A 2HODB 1K8AQ 2FFDB 4PD4E 1KQGB 2KSEA 1NTMJ 4TLFA 3OA7A 4L75A 2WT7B 4DOJA 2AXTE 3WUTA 1N7SA 1BDCA 1USDA 3GF3A 5C39A 2NPSD 1RE3A 1SQXD 2IBZE 2B87B 1KFNA 2JR8A 5AVUB 3F5HA 4BWNA 4C7RA 2XV5A 2KI7B 3USSA 2W83C 1KORA 3L71D 4CPGA 3O6QB 1URQA 1M90X 4U3FG 3BASA 3FXEA 2OTLW 3B5ND 1VQOW 2AXCA 1JNMA 1KC8X 2WSFH 1VQQA 3CCSP 3CCLW 1L0ND 1N7LA 1VQPW 2BEZF 5AW1B 1OVRA 2XDJA 3H1LD 5HL7W 3TNUB 3HD7C 3HD7B 4I2LC 1NTKE 2FYNC 2WITA 1SQPD 1NAFA 4KJMA 2V4HA 3RK3D 2IX7C 1K9MQ 2ZVNB 1IFNA 1NTKJ 4C7NA 4L74A 4EYYQ 3TDKA 2JDIH 3SSUA 4GIFA 4AYCA 4H13C 4H13B 1S1CX 1SQBE 2C9NY 3FWLA 2QEXW 2YKOA 1HJBA 3CC7W 1N7SB 3PRJA 3MIWA 1RE3C 1SQBJ 3NTNA 1YITP 3GW1A 1SS1A 3VP9A 2CPBA 3KZIH 5E79H 4IOCW 3L72D 3O8ZA 5GTIE 5TISH 2R3CA 1EDKA 5KAFE 3CCQW 5KLVK 1MWTA 1H89A 2R32A 3L74E 2WMMA 2E74D 1JEKA 1A02F 1PGPA 2FYZA 4IL6E 2R5BA 5GAGa 2ITAA 1NTMG 1URQC 1URQB 4PJ0H 1MUUA 4KHXA 3A0HH 5AW5B 3WU2H 3GQ0A 2WPVB 4N6JA 3L74J 3CL3D 3VMYA 4EIJA 2O01H 5KLIC 5KLIB 3RL0D 1SQQE 1NYHA 2QG4A 3CC4W 1GL2D 4W80A 2WVRA 5CCHA 2D2CD 2BCCG 1GTWA 5GAEa 2Z5HA 2J5UA 5APXA 3H1JD 3I56P 1SQQJ 1SP4A 4UB8E 3H25A 1OW7A 2DW3A 1AA0A 2N9YB 1HWTC 2YKPA 1N8RX 4HYTB 2E74C 1YQ4C 4BXLA 2FYUD 2VRSA 1JMMA 4HJGH 1JOCA 3A7OA 3RL0C 2QIWA 3GF7A 2CK3H 1BCCE 5KJ7A 4U67W 1GL2C 2JKVA 3AE9C 2D2CC 2ZJQW 1KQFB 1EDIA 2Q9IA 2KOGA 4R4LA 1OW8A 3VTPC 3CCRW 1BCCJ 2B89A 3M9HA 4WF9W 3D71A 3IAOA 2KUBA 4B86A 4TT3H 1NTKG 3VMZA 4K3AA 1K73X 1KMIZ 2YXRB 1JUNA 4JPZB 3CCMW 3IFMA 4A7PA 1N2DC 2P58A 1S5LE 4PD4I 1BXYA 1Y8AA 2Y9ZA 1CTFA 2E5YA 2OARA 2IBZI 1JTHA 5CCHC 3M0DA 1D7MA 4WFBW 5DJUB 1LTJA 3G71W 3M91A 2M8RA 3SWFA 1R5SA 1KQSO 1HJ0A 2IYOA 4HKZH 3DLLW 2KSJA 2O3JA 4OGQD 3CWBE 1M1KQ 2W27A 1SQVD 1BDDA 3L70D 3MUDA 3M9BA 2E76B 2JO1A 1N73A 3CC2W 5KJ7C 3CWBJ 4JYBA 3BVHA 3KYQA 1YYCA 1JM0A 2XKMA 2AEJA 5APTA 3RK2D 3AE3C 4W7YA 3BCCD 4AUWA 1NO4A 2OTLP 1VQOP 2WPSA 3CPWO 2BASA 2RKLA 1HF9A 2IZ0A 3NFQA 3OJAB 5BU8B 1LNQA 3CCLP 4OGQC 4OGQB 1VQPP 1K04A 1E79H 4IOIH 3LW5H 3L73E 3M0AA 1S9KE 5KLVE 1NKNA 3G3ZA 2KYVA 1EDLA 4HH2A 2RMZA 1FZEA 1GW3A 2KB7P 3C1LA 4LGDE 1QX8A 4Y99C 2IFMA 5GADa 1FZGA 3L73J 2R3SA 3OW2O 1XTGB 2YNYA 4WY4A 2ZVOB 5KLVJ 4BL2A 1JTHB 1AFOA 1VQ8W 1LTJC 1SFCA 3H6PA 3M9QA 3KZIE 3HUSA 5E79E 5TISE 1Q86Q 1HH0A 2QJPC 2QJPB 2QEXP 1KILD 1DEBA 3CC7P 3RBXA 3V6IA 3CMAW 1FZCA 3B4SA 2IYPA 4PJ0E 3MUDC 1YIJW 4U3FE 3A0HE 1N73C 2GA1A 3AE2C 3WU2E 3BRTB 3MZWB 3KQGA 3CCQP 1CW5A 3H1KE 3Q5SA 2N9BA 2P67A 2E42A 3H1JG 4U3FJ 2K37A 3NMDA 2P10A 5AW3B 2O01J 3H1KJ 3CCJW 3MHVA 1SFCD 2POHA 3V2QA 2Q6QA 1FJPA 2FYUG 4UB8H 1Q81X 4UB6H 1KILC 3CC4P 3CX5I 4ASVA 1AVYA 4WCEW 2HR3A 3W7XA 1WT6A 2PP6A 1R8EA 3CXHH 3HE5A 3AE4C 4BRYB 4YPCA 1EXJA 1T8ZA 1KB9H 1EZVE 4OVNF 1M56D 1PIXA 4WY4B 3CD6W 3UIAA 1Q82X 1GZLA 2E5TA 2Q3EA 2V7QH 1VQ9W 4WFAW 1FJKA 1DD4A 1SVFA 3AEEC 2NPSA 1NU1D 1SFCC 1T6AA 3E1RA 5GTHH 4IL6X 3SFDC 1QVGO 3HUSC 4GKGA 1HVVA 5AVTB 3TGUD 1MWRA 1TU3F 2XU6A 2I8DA 2KZJA 2QJKC 1MBXC 2YO3A 1YJ9W 4ZMDA 3L73G 3CCRP 1X8YA 2W90A 4Y28J 2M3EA 1IFDA 5KLVG 1FZCC 1FZCB 4XFJA 3P32A 3WMM0 1VQ4W 3I55P 3HTKA 3B5NA 1GK6A 4XA4A 3II6A 5AVRB 1H88A 5AVQB 3CCMP 2W6AA 4RO0A 2BCCE 3P8MC 1ZRTE 3OAKA 3W67A 2CPSA 3O2HA 4YJXA 1MZ9A 2BCCJ 1ZP0C 2KK7A 5DM7W 1MG9A 4WB4A 2Q7CA 1PPJD 4RJTA 1DH3A 1LTAC 3HE5B 3L75D 1SQBD 3G71P 2WZ7A 3AE6C 1LGHB 1K73Q 2OYHA 4GOFA 1Y47A 3Q2YA 5AVWB 3Q1MA 3PIPW 2PFXA 2H89C 3S9OA 2L5GB 3H1KG 2NZ2A 4C46A 1VQLW 1VQ5P 3AE1C 2OTJW 1KQSV 2NPSC 1CI6A 2NPSB 2G3AA 4JYCA 3L74D 2ZXEB 1G1JA 1HTLC 2LR2A 1S5LX 2FYUK 3CC2P 3W7TA 3E1IA 1BE3D 1J1DC 1J1DB 3TSIA 1RQUA 1KYOD 1LTBC 1L4AD 2FYNB 1YJWW 2M5AA 1KTMA 2R44A 5CCGD 1CSBA 3RBZA 1RF0A 3GHGA 1UIIA 3LW5J 3B5NC 3B5NB 1EZVG 1GU4A 2Z5IA 5JVHW 3FX0A 2LXBA 1PGJA 1K05A 3CPWV 1GL2A 3MD0A 1N86A 2A45H 3JC22 2ZJRW 2H43A 4I1LA 3G19A 3R4YA 3ABVC 1LT1A 3V2PA 1GU5A 1U7MA 1KD1Q 4AQRD 2GM4A 3CX5D 1AV1A 2YMYA 2JWDA 1L4AC 2WA8A 3KXDA 1LWUA 3G9RA 1VQ6W 1VQ8P 1BGYD 3OW2V 1BCCD 3AEAC 1S4XA 4WFNW 3RK3C 2J58A 3RK3B 3CMEW 1RH5B 1PV3A 3AEDC 1OWAA 3W7WA 2YIUC 2YIUB 1Q2NA 2OYHC 1NJIX 2ZXXA 1AQ5A 1PGQA 4H44D 1L0NE 2IFNA 1RHZB 1FE6A 4LLHA 2KIKA 3AE8C 5B66H 3GG2A 3CMAP 1L0NJ 1P84D 4WVZA 2QM7A 5APSA 1RF1A 5JVGW 3PHLA 1KN7A 2WQYC 4UB6E 4I6MC 1JCCA 1UIXA 3CCUW 2GUSA 1EZVI 1NGMB 2M5AB 2E74B 4ASWA 3CXHE 1FOSF 3CCJP 1KB9E 1RF0C 4H44C 3GHGC 4C7NB 1NTZG 4CPKA 2HPCA 3RL0B 1OX3A 1GL2B 1NU1G 3RL0g 2D2CB 2JWAA 3IF4A 2A06G 2G8YA 1GD2E 2B88A 1A02J 2OGUA 1ZW0A 3H1ID 1K8AX 2ZYAA 1JB0J 1NAYA 3CD6P 3CXCV 5GTHE 2V7QJ 1YJNW 1IJDB 1L2PA 1VQ9P 1LWUC 1LWUB 1RQVA 3PJSK 1Y9BA 2AEMA 2QVAA 1R6OC 3KHUA 1VQKW 1FOSE 1QLED 1S72W 3BATA 3H1HD 3GMAA 1YJ9P 1L0LD 3W7UA 1PP9D 1QVGV 3FXDA 3H1JE 5TJHA 5CMZA 2WTYA 1VQ4P 1SQXG 1MFTA 4CJNA 1S9KD 2Q3IA 1RF1C 1RF1B 1FZAA 2KP8A 2K1AA 3H1JJ 2K9JA 1NVOA
chains in the Genus database with same CATH topology
3EWKA 1KTMA 2YMKA 4KT0J 1NGMB 3AE9C 2D2CC 2ZT9D 4XFJA 2E74B 3AE2C 3GF3A 1RQSA 1KQFB 3O1FB 1KILE 3O2OA 4R4LA 1OW8A 3LW5J 3Q5SA 3AECC 1ZOYC 3GW1A 4H44C 3AE3C 1R6QC 1PL5A 3D71A 3IAOA 2P10A 2FXPA 1K05A 2JP3A 4PV1C 4H13D 1DIPA 2O01J 3D6YA 4TT3H 1ZRTE 1HF9A 2E76D 2W9RA 3RK3E 3O6QA 1IK7A 1KORA 2D2CB 3RL0g 3GLMA 2E74D 3G19A 3O2HA 1KMIZ 1OW6A 2G8YA 4OGQC 3R4YA 4OGQB 1K04A 1MBVB 4YJXA 3ABVC 3O2BA 4YJMA 3Q3DA 2WSEJ 2BEQD 3AE7C 4H0LC 1ZP0C 4H0LB 4H44B 3Q5RA 1R8EA 1JB0J 1YQ3C 3GQ0A 2WPVB 5KKZC 1MG9A 2WA8A 2V7QJ 5L8RJ 3G1BA 1VF5C 5KLIC 3AE4C 2E75D 4PV1B 1MKMA 1EXJA 3T97B 1CTFA 1NYHA 3G9RA 4Z1MH 2ZT9C 2IDBA 2ZT9B 1AJYA 3AEAC 2BEZF 3D6ZA 1RQVA 1GMJA 3AE6C 4R4MA 4YTPC 1Q90D 2D2CD 1PV3A 3AEDC 1Y9BA 1PIXA 3Q5PA 2YIUC 2J5UA 3AEFC 3Q2YA 1VL2A 3Q1MA 2WSCJ 1FDIA 3B71A 3C8VA 1R6OC 4H44D 4I7ZC 2H89C 4I7ZB 3S9OA 3G3PA 4YKAA 1EXIA 3AE5C 2FYNC 1OW7A 2NZ2A 3AEGC 3H25A 2QJYC 1VF5B 2QSIA 1MBUC 2E76C 3AE8C 1OMIA 1DD4A 3SFEC 3GMAA 4PV1D 3DNJA 3AEEC 2FBWC 4YXDC 3AE1C 2E74C 3O1FA 1YQ4C 2OQQA 2WA9A 1HJ0A 2G3AA 1DD3A 3FGAD 4IL6X 3SFDC 1U57A 1LZWA 3GQ1A 1TU3F 2QJPC 1S5LX 4OGQD 4U7JA 4GDOA 2QJKC 1MBXC 1FDOA 4RKUJ 1KQGB 1RQUA 2MKVA 4H0LD 3AEBC 2E75C 2E75B 1WMKA 4H13C 4H13B 2QIWA 2WQYC 2WSFJ 2K9YA 4Y28J 3D70A 1S1CX 3GF7A 5M1BA 1ZMEC 3IN6A 1VF5D 1UIXA 2H88C 2E76B 2JO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9R A;  1RQV A;  3O1F A;  2WA9 A;  1RQS A;  1CTF A;  1DD3 A;  3G19 A;  3O2H A;  4YJX A;  1MBV B;  1LZW A;  3O1F B;  3GQ1 A;  3O2O A;  3O2B A;  4YJM A;  3GW1 A;  1MBX C;  1R6O C;  1R6Q C;  3G3P A;  1RQU A;  3GQ0 A;  1MG9 A;  2WA8 A;  4YKA A;  3G1B A;  1MBU C;  1DD4 A;  3DNJ A; 
#chains in the Genus database with same CATH topology
 3MTU E;  2FYU E;  4KT0 J;  3L75 G;  3A5T A;  3W68 A;  3MGN A;  3L71 G;  4N78 D;  2FYU J;  3R2P A;  3V2R A;  2HPC B;  1L0N G;  3KPE A;  4YXW H;  4N3Y B;  3PIO W;  1JY3 N;  1K9M X;  3H1L G;  3O2B A;  1LJ2 A;  1BE3 G;  3G1B A;  2W6B A;  1JY3 P;  5AVY B;  1MKM A;  2AEF A;  1ZN5 A;  2IDB A;  3PLN A;  4EOT A;  1X22 A;  4U3F D;  1VQL P;  5AW4 B;  1Q90 D;  1SQP G;  3JCU H;  2HLO A;  1KIL A;  4IFD K;  1NKZ B;  1NHL A;  2OTJ P;  1H0T A;  3MP7 B;  4I7Z C;  4I7Z B;  3G3P A;  5AVZ B;  3U1A A;  1EXI A;  4DT0 A;  1VQM W;  2QJY C;  2QSI A;  1NTZ K;  4Y99 B;  2KS1 A;  1HUC A;  2FBW C;  1FU1 A;  3O1F A;  2OQQ A;  2J59 M;  1YJW P;  1NU1 K;  1M90 Q;  3U1C A;  4GDO A;  3RK2 C;  3RK2 B;  2MJZ A;  3W7S A;  3AEB C;  1KC8 Q;  4EI2 A;  3CCV W;  3L72 G;  2Y0C A;  1LTJ B;  2H88 C;  4JQ0 D;  1BGY G;  2K9J B;  5APW A;  3P8C E;  5DJT B;  2GUV A;  1M8O B;  2HYN A;  4D6T D;  1KQL A;  3H32 A;  1QEX A;  2ZFC A;  2W8Z A;  3ZG5 A;  2YKQ A;  1N73 B;  1R5L A;  2I1J A;  5CBN A;  1HBW A;  3BRV B;  1VQ6 P;  1IK9 A;  3BCC E;  5B66 E;  1SQX K;  3F89 A;  5KKZ C;  2LXC B;  5AW0 B;  3T97 A;  3VMX A;  1J1E C;  1J1E B;  1KYO H;  3BCC J;  3D6Z A;  1GMJ A;  3CXH I;  1PZQ A;  2Y0E A;  1NTM D;  2FFD A;  1KB9 I;  1IFJ A;  1KIL B;  1LTS C;  5CJ0 A;  2FY8 A;  1IO4 A;  2XNX A;  2XND H;  4PD4 D;  2WT7 A;  5M19 A;  4PV1 D;  2KS1 B;  2BCC D;  1ZRT D;  1L0N K;  4GOE A;  2B87 A;  3CCU P;  4BL3 A;  1DX7 A;  1YI2 W;  1KFM A;  5GAH a;  2IBZ D;  3S1K A;  1ZME C;  2KLV A;  3C9I A;  1VF5 D;  3V4Q A;  4DKI A;  1SFC B;  1QVF O;  2ZYD A;  3E7K A;  1GDT A;  1KIL E;  1SQP K;  2OYO A;  4ZNC A;  3HUS B;  5KTB A;  1KV4 A;  4O9B A;  2QJK B;  1R6Q C;  3SWY A;  1W2E A;  1M57 D;  1YTZ T;  3SWK A;  4PV1 C;  1JCD A;  1NOH A;  1IFM A;  1N8R Q;  1YJN P;  1IK7 A;  1L0L G;  3Q3D A;  1G2C A;  1M1J A;  1M1K X;  3AE7 C;  3VN0 A;  1VDF A;  1P84 H;  1WRG A;  4WWI A;  1VF5 C;  2QA4 W;  2A45 G;  3CF5 W;  3T97 B;  1NTK D;  1AJY A;  2KXP B;  1VQK P;  1S72 P;  4YTP C;  1FBM A;  3V4W A;  1JMB A;  1BSH A;  4WBA A;  2FFD C;  3CLQ A;  1L4A A;  4K35 A;  1MBU C;  1SQV G;  2L91 A;  1OMI A;  3L70 G;  5CCG A;  1PGO A;  4M3L A;  2WA9 A;  2N1T A;  2O1J A;  1DD3 A;  1RY3 A;  2W6J H;  1U57 A;  1G1I A;  4GOD A;  4RES B;  1H8A A;  1ZLL A;  1NTZ E;  3M06 A;  3HD7 D;  4NPD A;  1FS0 E;  5KAI H;  3ZG0 A;  3G6E W;  1WMK A;  3BCC G;  3D70 A;  1NU1 E;  1LT9 A;  4IFF A;  2A06 E;  1YBK A;  1NTZ J;  3TF5 A;  1FDM A;  1LTT C;  3TGU E;  3VYI A;  1OXZ A;  3ITK A;  1NU1 J;  2PGD A;  4QMA A;  1KZU B;  3V5B A;  1MV8 A;  1ZR2 A;  3JCU E;  1CZQ A;  3TGU J;  4H13 D;  1T3J A;  1JY3 O;  3V2N A;  1SQQ D;  5BU5 A;  1Q86 X;  1N7S D;  3L37 A;  3HTK B;  2N1T D;  2A45 I;  1JY2 N;  4ZKP A;  3Q5R A;  1G2C B;  1M1J C;  1M1J B;  5AW2 B;  2FXO A;  4Z1M H;  3QH9 A;  3A0B H;  2E43 A;  1JY2 P;  1VQM P;  1SQX E;  2WSE H;  3Q5P A;  3CXH D;  5AVS B;  1URQ D;  1X79 B;  1VL2 A;  1Q7Y X;  1KB9 D;  3C8V A;  1PPJ E;  3ZDM A;  2Z4E A;  1L4A B;  1SQX J;  3L75 E;  1FZB A;  1OZH A;  4D6T G;  4YXD C;  2UWJ E;  3L71 E;  5CCG C;  5AW6 B;  2O1K A;  3CCV P;  1N7S C;  2SPZ A;  1AVO A;  1AQT A;  2N1T B;  2N1T C;  1LZW A;  1L0L K;  5BVZ A;  3L75 J;  4NPF X;  2OYH B;  2JJL A;  3L71 J;  5AW7 B;  2XZR A;  4H0L D;  5GW7 A;  5M1A A;  5M1B A;  5APQ A;  2C9L Y;  1VQ7 W;  4UY8 Z;  3G4S W;  2B9B A;  1LT9 C;  1LT9 B;  3H1L E;  1W5C E;  1IFI A;  2ZJP W;  1BE3 E;  5EFW B;  2H8P D;  3QWO C;  1VQN W;  1CI6 B;  3A3Y B;  1YIJ P;  2FXM A;  1RE4 A;  1QL1 A;  1KYO E;  1PL5 A;  3H1L J;  3CCE W;  3TYY A;  3TK1 A;  1BSN A;  5APY A;  3D6Y A;  1BE3 J;  1SQP E;  1MWU A;  2KLU A;  1SQV K;  4HB1 A;  3RK3 E;  4ZKU A;  1OW6 A;  3IR9 A;  4YJM A;  2BEQ D;  1SQP J;  4H0L C;  4H0L B;  4H44 B;  3GHG B;  2IBZ G;  1YQ3 C;  1EC5 A;  1S2E A;  2P7J A;  2Q1K A;  4L73 A;  2WPQ A;  3EQ2 A;  1LP1 A;  1ZXG A;  5CA3 A;  1J2J B;  3VOP A;  1W2B V;  1OFC X;  3CX5 E;  3TGU G;  3L72 E;  1FDI A;  2QE7 H;  2YXQ B;  1ZV8 A;  3CWB D;  1YI2 P;  5AW8 B;  1BGY E;  3DNJ A;  3EFF K;  3N7N A;  1YHQ W;  3L72 J;  5M18 A;  1DEE G;  1IZN B;  2QRX A;  2PRR A;  2H7H A;  4U7J A;  1Q81 Q;  3D3I A;  1BGY J;  5CCH D;  2WSC H;  4MN4 C;  2HFE D;  3I55 W;  2K9Y A;  4GT1 A;  3IN6 A;  2I1K A;  1FAV A;  1IFP A;  2YMK A;  5H2F H;  1QVF V;  1IC2 A;  1P84 E;  3EFG A;  1RQS A;  2Q5U A;  3L73 D;  1MWS A;  1RE4 C;  1X9V A;  1Q82 Q;  1GW4 A;  1YTZ I;  5B5E H;  5KLV D;  2FXP A;  1DIP A;  2C0W A;  1PPJ G;  2LKM A;  2E76 D;  2W9R A;  4PD4 H;  2QA4 P;  1SQB G;  5KJ7 D;  3GLM A;  2NRG A;  1X0T A;  1XTC C;  3J7Z Z;  2ZYG A;  2KZI A;  1M7L A;  2AXT H;  2KNC A;  1JO5 A;  3VP8 A;  1SLQ A;  1NH4 A;  2E75 D;  5CBO A;  4L76 A;  3KDP B;  1OIP A;  5KAI E;  1LP1 B;  4IO9 W;  3H1I E;  5K5G B;  3L74 G;  3AEF C;  3CCS W;  3P8C D;  1NTM K;  4LC1 A;  1VQ5 W;  4JBZ A;  4W7Z A;  3AE5 C;  3H1I J;  2E76 C;  3L36 A;  3G6E P;  3FGA D;  1SQQ G;  2C0X A;  2FKW B;  4DCK A;  5APU A;  1KD1 X;  1EQ7 A;  4RKU J;  3H1K D;  3L4F A;  2MKV A;  2IPP A;  3H1H E;  2E75 C;  2E75 B;  2QM8 A;  2WSF J;  2RN0 A;  4EDF A;  2QJY B;  1L0L E;  3B71 A;  3EWK A;  3RGU A;  4IFM A;  1PP9 E;  2OTK E;  2ZT9 D;  2RH0 A;  3H1H J;  3O2O A;  1FZF A;  2O01 N;  3AEC C;  1L0L J;  3A0B E;  2WWW A;  1PP9 J;  4BRY A;  2Y9Y A;  2HG5 D;  3I5C A;  3K5B A;  3N4X A;  4JF7 A;  3HE4 A;  1YIT W;  1BCC G;  4N78 E;  4IOA W;  1JY2 O;  1T3U A;  2ZAE B;  3A2A A;  2P1J A;  1EZV D;  1GK4 A;  3FWN A;  2WSE J;  3M0D C;  1MFZ A;  1SQV E;  2KNC B;  3L70 E;  5L8R J;  1VPC A;  2ZT9 C;  2ZT9 B;  3HRN A;  1SQV J;  1NTK K;  5GTI H;  3L70 J;  4DJG A;  4OWF A;  1KYO I;  5KAF H;  3B8E B;  3CME P;  1Z56 A;  2OYI A;  2ZJS E;  4YKA A;  5KKZ B;  4IL6 H;  2PAJ A;  3PP5 A;  1PFI A;  2WPR A;  3I56 W;  1T2K D;  1VQ7 P;  1SQB K;  3G4S P;  3GQ1 A;  2HOD A;  1JJ2 V;  4WY4 D;  1FDO A;  1W2B O;  1Q7Y Q;  1OVU A;  5AVX B;  2M0B A;  2Y0D A;  1VQN P;  1H0T B;  2JEE A;  1HGZ A;  4DZO A;  3CCE P;  3GW6 A;  2M3B A;  1U7J A;  3O1F B;  1S3J A;  1OVV A;  1ZOY C;  2K88 A;  1NJI Q;  3H1I G;  3S4R A;  2WSS H;  2YO2 A;  5CHX A;  3CWB G;  2JP3 A;  5AW9 B;  3VMA A;  3JSV C;  3CX5 H;  3O6Q A;  1T2K C;  3HE4 B;  4WY4 C;  1MBV B;  1SQQ K;  1USE A;  3WUU A;  4XE5 B;  4D6T E;  2P2U A;  1NTZ D;  1QL2 A;  2R5D A;  1LTG C;  1FC2 C;  3LID A;  1EDJ A;  1E5W A;  5APV A;  4PV1 B;  1P84 I;  3LIE A;  3H1H G;  2A06 D;  3H32 B;  4R4M A;  4D6T J;  3PH0 A;  5CJ4 A;  3WUV A;  4OH8 B;  1LTI C;  2K3R A;  3TNU A;  1PP9 G;  1YHQ P;  3ZFZ A;  3HD7 A;  5H2F E;  2WSC J;  1ZR4 A;  5AVV B;  5DM6 W;  3AEG C;  2OYI C;  2OYI B;  1VF5 B;  3SFE C;  1S5L H;  3P7K A;  3U59 A;  3L35 A;  4NPE A;  1HGV A;  1NTM E;  3CI9 A;  5B5E E;  1NWQ A;  3NXS A;  3PTZ A;  1QGK B;  2IZ1 A;  2HOD B;  1K8A Q;  2FFD B;  4PD4 E;  1KQG B;  2KSE A;  1NTM J;  4TLF A;  3OA7 A;  4L75 A;  2WT7 B;  4DOJ A;  2AXT E;  3WUT A;  1N7S A;  1BDC A;  1USD A;  3GF3 A;  5C39 A;  2NPS D;  1RE3 A;  1SQX D;  2IBZ E;  2B87 B;  1KFN A;  2JR8 A;  5AVU B;  3F5H A;  4BWN A;  4C7R A;  2XV5 A;  2KI7 B;  3USS A;  2W83 C;  1KOR A;  3L71 D;  4CPG A;  3O6Q B;  1URQ A;  1M90 X;  4U3F G;  3BAS A;  3FXE A;  2OTL W;  3B5N D;  1VQO W;  2AXC A;  1JNM A;  1KC8 X;  2WSF H;  1VQQ A;  3CCS P;  3CCL W;  1L0N D;  1N7L A;  1VQP W;  2BEZ F;  5AW1 B;  1OVR A;  2XDJ A;  3H1L D;  5HL7 W;  3TNU B;  3HD7 C;  3HD7 B;  4I2L C;  1NTK E;  2FYN C;  2WIT A;  1SQP D;  1NAF A;  4KJM A;  2V4H A;  3RK3 D;  2IX7 C;  1K9M Q;  2ZVN B;  1IFN A;  1NTK J;  4C7N A;  4L74 A;  4EYY Q;  3TDK A;  2JDI H;  3SSU A;  4GIF A;  4AYC A;  4H13 C;  4H13 B;  1S1C X;  1SQB E;  2C9N Y;  3FWL A;  2QEX W;  2YKO A;  1HJB A;  3CC7 W;  1N7S B;  3PRJ A;  3MIW A;  1RE3 C;  1SQB J;  3NTN A;  1YIT P;  3GW1 A;  1SS1 A;  3VP9 A;  2CPB A;  3KZI H;  5E79 H;  4IOC W;  3L72 D;  3O8Z A;  5GTI E;  5TIS H;  2R3C A;  1EDK A;  5KAF E;  3CCQ W;  5KLV K;  1MWT A;  1H89 A;  2R32 A;  3L74 E;  2WMM A;  2E74 D;  1JEK A;  1A02 F;  1PGP A;  2FYZ A;  4IL6 E;  2R5B A;  5GAG a;  2ITA A;  1NTM G;  1URQ C;  1URQ B;  4PJ0 H;  1MUU A;  4KHX A;  3A0H H;  5AW5 B;  3WU2 H;  3GQ0 A;  2WPV B;  4N6J A;  3L74 J;  3CL3 D;  3VMY A;  4EIJ A;  2O01 H;  5KLI C;  5KLI B;  3RL0 D;  1SQQ E;  1NYH A;  2QG4 A;  3CC4 W;  1GL2 D;  4W80 A;  2WVR A;  5CCH A;  2D2C D;  2BCC G;  1GTW A;  5GAE a;  2Z5H A;  2J5U A;  5APX A;  3H1J D;  3I56 P;  1SQQ J;  1SP4 A;  4UB8 E;  3H25 A;  1OW7 A;  2DW3 A;  1AA0 A;  2N9Y B;  1HWT C;  2YKP A;  1N8R X;  4HYT B;  2E74 C;  1YQ4 C;  4BXL A;  2FYU D;  2VRS A;  1JMM A;  4HJG H;  1JOC A;  3A7O A;  3RL0 C;  2QIW A;  3GF7 A;  2CK3 H;  1BCC E;  5KJ7 A;  4U67 W;  1GL2 C;  2JKV A;  3AE9 C;  2D2C C;  2ZJQ W;  1KQF B;  1EDI A;  2Q9I A;  2KOG A;  4R4L A;  1OW8 A;  3VTP C;  3CCR W;  1BCC J;  2B89 A;  3M9H A;  4WF9 W;  3D71 A;  3IAO A;  2KUB A;  4B86 A;  4TT3 H;  1NTK G;  3VMZ A;  4K3A A;  1K73 X;  1KMI Z;  2YXR B;  1JUN A;  4JPZ B;  3CCM W;  3IFM A;  4A7P A;  1N2D C;  2P58 A;  1S5L E;  4PD4 I;  1BXY A;  1Y8A A;  2Y9Z A;  1CTF A;  2E5Y A;  2OAR A;  2IBZ I;  1JTH A;  5CCH C;  3M0D A;  1D7M A;  4WFB W;  5DJU B;  1LTJ A;  3G71 W;  3M91 A;  2M8R A;  3SWF A;  1R5S A;  1KQS O;  1HJ0 A;  2IYO A;  4HKZ H;  3DLL W;  2KSJ A;  2O3J A;  4OGQ D;  3CWB E;  1M1K Q;  2W27 A;  1SQV D;  1BDD A;  3L70 D;  3MUD A;  3M9B A;  2E76 B;  2JO1 A;  1N73 A;  3CC2 W;  5KJ7 C;  3CWB J;  4JYB A;  3BVH A;  3KYQ A;  1YYC A;  1JM0 A;  2XKM A;  2AEJ A;  5APT A;  3RK2 D;  3AE3 C;  4W7Y A;  3BCC D;  4AUW A;  1NO4 A;  2OTL P;  1VQO P;  2WPS A;  3CPW O;  2BAS A;  2RKL A;  1HF9 A;  2IZ0 A;  3NFQ A;  3OJA B;  5BU8 B;  1LNQ A;  3CCL P;  4OGQ C;  4OGQ B;  1VQP P;  1K04 A;  1E79 H;  4IOI H;  3LW5 H;  3L73 E;  3M0A A;  1S9K E;  5KLV E;  1NKN A;  3G3Z A;  2KYV A;  1EDL A;  4HH2 A;  2RMZ A;  1FZE A;  1GW3 A;  2KB7 P;  3C1L A;  4LGD E;  1QX8 A;  4Y99 C;  2IFM A;  5GAD a;  1FZG A;  3L73 J;  2R3S A;  3OW2 O;  1XTG B;  2YNY A;  4WY4 A;  2ZVO B;  5KLV J;  4BL2 A;  1JTH B;  1AFO A;  1VQ8 W;  1LTJ C;  1SFC A;  3H6P A;  3M9Q A;  3KZI E;  3HUS A;  5E79 E;  5TIS E;  1Q86 Q;  1HH0 A;  2QJP C;  2QJP B;  2QEX P;  1KIL D;  1DEB A;  3CC7 P;  3RBX A;  3V6I A;  3CMA W;  1FZC A;  3B4S A;  2IYP A;  4PJ0 E;  3MUD C;  1YIJ W;  4U3F E;  3A0H E;  1N73 C;  2GA1 A;  3AE2 C;  3WU2 E;  3BRT B;  3MZW B;  3KQG A;  3CCQ P;  1CW5 A;  3H1K E;  3Q5S A;  2N9B A;  2P67 A;  2E42 A;  3H1J G;  4U3F J;  2K37 A;  3NMD A;  2P10 A;  5AW3 B;  2O01 J;  3H1K J;  3CCJ W;  3MHV A;  1SFC D;  2POH A;  3V2Q A;  2Q6Q A;  1FJP A;  2FYU G;  4UB8 H;  1Q81 X;  4UB6 H;  1KIL C;  3CC4 P;  3CX5 I;  4ASV A;  1AVY A;  4WCE W;  2HR3 A;  3W7X A;  1WT6 A;  2PP6 A;  1R8E A;  3CXH H;  3HE5 A;  3AE4 C;  4BRY B;  4YPC A;  1EXJ A;  1T8Z A;  1KB9 H;  1EZV E;  4OVN F;  1M56 D;  1PIX A;  4WY4 B;  3CD6 W;  3UIA A;  1Q82 X;  1GZL A;  2E5T A;  2Q3E A;  2V7Q H;  1VQ9 W;  4WFA W;  1FJK A;  1DD4 A;  1SVF A;  3AEE C;  2NPS A;  1NU1 D;  1SFC C;  1T6A A;  3E1R A;  5GTH H;  4IL6 X;  3SFD C;  1QVG O;  3HUS C;  4GKG A;  1HVV A;  5AVT B;  3TGU D;  1MWR A;  1TU3 F;  2XU6 A;  2I8D A;  2KZJ A;  2QJK C;  1MBX C;  2YO3 A;  1YJ9 W;  4ZMD A;  3L73 G;  3CCR P;  1X8Y A;  2W90 A;  4Y28 J;  2M3E A;  1IFD A;  5KLV G;  1FZC C;  1FZC B;  4XFJ A;  3P32 A;  3WMM 0;  1VQ4 W;  3I55 P;  3HTK A;  3B5N A;  1GK6 A;  4XA4 A;  3II6 A;  5AVR B;  1H88 A;  5AVQ B;  3CCM P;  2W6A A;  4RO0 A;  2BCC E;  3P8M C;  1ZRT E;  3OAK A;  3W67 A;  2CPS A;  3O2H A;  4YJX A;  1MZ9 A;  2BCC J;  1ZP0 C;  2KK7 A;  5DM7 W;  1MG9 A;  4WB4 A;  2Q7C A;  1PPJ D;  4RJT A;  1DH3 A;  1LTA C;  3HE5 B;  3L75 D;  1SQB D;  3G71 P;  2WZ7 A;  3AE6 C;  1LGH B;  1K73 Q;  2OYH A;  4GOF A;  1Y47 A;  3Q2Y A;  5AVW B;  3Q1M A;  3PIP W;  2PFX A;  2H89 C;  3S9O A;  2L5G B;  3H1K G;  2NZ2 A;  4C46 A;  1VQL W;  1VQ5 P;  3AE1 C;  2OTJ W;  1KQS V;  2NPS C;  1CI6 A;  2NPS B;  2G3A A;  4JYC A;  3L74 D;  2ZXE B;  1G1J A;  1HTL C;  2LR2 A;  1S5L X;  2FYU K;  3CC2 P;  3W7T A;  3E1I A;  1BE3 D;  1J1D C;  1J1D B;  3TSI A;  1RQU A;  1KYO D;  1LTB C;  1L4A D;  2FYN B;  1YJW W;  2M5A A;  1KTM A;  2R44 A;  5CCG D;  1CSB A;  3RBZ A;  1RF0 A;  3GHG A;  1UII A;  3LW5 J;  3B5N C;  3B5N B;  1EZV G;  1GU4 A;  2Z5I A;  5JVH W;  3FX0 A;  2LXB A;  1PGJ A;  1K05 A;  3CPW V;  1GL2 A;  3MD0 A;  1N86 A;  2A45 H;  3JC2 2;  2ZJR W;  2H43 A;  4I1L A;  3G19 A;  3R4Y A;  3ABV C;  1LT1 A;  3V2P A;  1GU5 A;  1U7M A;  1KD1 Q;  4AQR D;  2GM4 A;  3CX5 D;  1AV1 A;  2YMY A;  2JWD A;  1L4A C;  2WA8 A;  3KXD A;  1LWU A;  3G9R A;  1VQ6 W;  1VQ8 P;  1BGY D;  3OW2 V;  1BCC D;  3AEA C;  1S4X A;  4WFN W;  3RK3 C;  2J58 A;  3RK3 B;  3CME W;  1RH5 B;  1PV3 A;  3AED C;  1OWA A;  3W7W A;  2YIU C;  2YIU B;  1Q2N A;  2OYH C;  1NJI X;  2ZXX A;  1AQ5 A;  1PGQ A;  4H44 D;  1L0N E;  2IFN A;  1RHZ B;  1FE6 A;  4LLH A;  2KIK A;  3AE8 C;  5B66 H;  3GG2 A;  3CMA P;  1L0N J;  1P84 D;  4WVZ A;  2QM7 A;  5APS A;  1RF1 A;  5JVG W;  3PHL A;  1KN7 A;  2WQY C;  4UB6 E;  4I6M C;  1JCC A;  1UIX A;  3CCU W;  2GUS A;  1EZV I;  1NGM B;  2M5A B;  2E74 B;  4ASW A;  3CXH E;  1FOS F;  3CCJ P;  1KB9 E;  1RF0 C;  4H44 C;  3GHG C;  4C7N B;  1NTZ G;  4CPK A;  2HPC A;  3RL0 B;  1OX3 A;  1GL2 B;  1NU1 G;  3RL0 g;  2D2C B;  2JWA A;  3IF4 A;  2A06 G;  2G8Y A;  1GD2 E;  2B88 A;  1A02 J;  2OGU A;  1ZW0 A;  3H1I D;  1K8A X;  2ZYA A;  1JB0 J;  1NAY A;  3CD6 P;  3CXC V;  5GTH E;  2V7Q J;  1YJN W;  1IJD B;  1L2P A;  1VQ9 P;  1LWU C;  1LWU B;  1RQV A;  3PJS K;  1Y9B A;  2AEM A;  2QVA A;  1R6O C;  3KHU A;  1VQK W;  1FOS E;  1QLE D;  1S72 W;  3BAT A;  3H1H D;  3GMA A;  1YJ9 P;  1L0L D;  3W7U A;  1PP9 D;  1QVG V;  3FXD A;  3H1J E;  5TJH A;  5CMZ A;  2WTY A;  1VQ4 P;  1SQX G;  1MFT A;  4CJN A;  1S9K D;  2Q3I A;  1RF1 C;  1RF1 B;  1FZA A;  2KP8 A;  2K1A A;  3H1J J;  2K9J A;  1NVO A; 
#chains in the Genus database with same CATH homology
 3EWK A;  1KTM A;  2YMK A;  4KT0 J;  1NGM B;  3AE9 C;  2D2C C;  2ZT9 D;  4XFJ A;  2E74 B;  3AE2 C;  3GF3 A;  1RQS A;  1KQF B;  3O1F B;  1KIL E;  3O2O A;  4R4L A;  1OW8 A;  3LW5 J;  3Q5S A;  3AEC C;  1ZOY C;  3GW1 A;  4H44 C;  3AE3 C;  1R6Q C;  1PL5 A;  3D71 A;  3IAO A;  2P10 A;  2FXP A;  1K05 A;  2JP3 A;  4PV1 C;  4H13 D;  1DIP A;  2O01 J;  3D6Y A;  4TT3 H;  1ZRT E;  1HF9 A;  2E76 D;  2W9R A;  3RK3 E;  3O6Q A;  1IK7 A;  1KOR A;  2D2C B;  3RL0 g;  3GLM A;  2E74 D;  3G19 A;  3O2H A;  1KMI Z;  1OW6 A;  2G8Y A;  4OGQ C;  3R4Y A;  4OGQ B;  1K04 A;  1MBV B;  4YJX A;  3ABV C;  3O2B A;  4YJM A;  3Q3D A;  2WSE J;  2BEQ D;  3AE7 C;  4H0L C;  1ZP0 C;  4H0L B;  4H44 B;  3Q5R A;  1R8E A;  1JB0 J;  1YQ3 C;  3GQ0 A;  2WPV B;  5KKZ C;  1MG9 A;  2WA8 A;  2V7Q J;  5L8R J;  3G1B A;  1VF5 C;  5KLI C;  3AE4 C;  2E75 D;  4PV1 B;  1MKM A;  1EXJ A;  3T97 B;  1CTF A;  1NYH A;  3G9R A;  4Z1M H;  2ZT9 C;  2IDB A;  2ZT9 B;  1AJY A;  3AEA C;  2BEZ F;  3D6Z A;  1RQV A;  1GMJ A;  3AE6 C;  4R4M A;  4YTP C;  1Q90 D;  2D2C D;  1PV3 A;  3AED C;  1Y9B A;  1PIX A;  3Q5P A;  2YIU C;  2J5U A;  3AEF C;  3Q2Y A;  1VL2 A;  3Q1M A;  2WSC J;  1FDI A;  3B71 A;  3C8V A;  1R6O C;  4H44 D;  4I7Z C;  2H89 C;  4I7Z B;  3S9O A;  3G3P A;  4YKA A;  1EXI A;  3AE5 C;  2FYN C;  1OW7 A;  2NZ2 A;  3AEG C;  3H25 A;  2QJY C;  1VF5 B;  2QSI A;  1MBU C;  2E76 C;  3AE8 C;  1OMI A;  1DD4 A;  3SFE C;  3GMA A;  4PV1 D;  3DNJ A;  3AEE C;  2FBW C;  4YXD C;  3AE1 C;  2E74 C;  3O1F A;  1YQ4 C;  2OQQ A;  2WA9 A;  1HJ0 A;  2G3A A;  1DD3 A;  3FGA D;  4IL6 X;  3SFD C;  1U57 A;  1LZW A;  3GQ1 A;  1TU3 F;  2QJP C;  1S5L X;  4OGQ D;  4U7J A;  4GDO A;  2QJK C;  1MBX C;  1FDO A;  4RKU J;  1KQG B;  1RQU A;  2MKV A;  4H0L D;  3AEB C;  2E75 C;  2E75 B;  1WMK A;  4H13 C;  4H13 B;  2QIW A;  2WQY C;  2WSF J;  2K9Y A;  4Y28 J;  3D70 A;  1S1C X;  3GF7 A;  5M1B A;  1ZME C;  3IN6 A;  1VF5 D;  1UIX A;  2H88 C;  2E76 B;  2JO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...