1DD3A

Crystal structure of ribosomal protein l12 from thermotoga maritima
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd3A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd3A02
1R6QC 4YKAA 3DNJA 2WA8A 1RQVA 1MG9A 3O2OA 1MBUC 3G3PA 3O2HA 3G19A 1RQUA 3O1FA 1R6OC 1DD3A 3GW1A 1CTFA 3GQ1A 3GQ0A 1RQSA 2W9RA 3O2BA 3G1BA 1MBXC 1MBVB 4YJMA 1LZWA 4YJXA 3O1FB 1DD4A 2WA9A
chains in the Genus database with same CATH superfamily
2PRRA 3RK3D 2N1TA 2JEEA 2K37A 3D6ZA 2K9YA 1OVRA 1EZVI 1KB9I 2RH0A 4DT0A 4RKUJ 5KJ7D 1NTZJ 1VQMW 2ZAEB 3L35A 2FXOA 3CC2P 1NTKK 4TT3H 2E42A 2HODA 1XTCC 1BE3J 3GF7A 1JNMA 2YXRB 3KZIH 3AEBC 3S4RA 3BASA 1J1EB 3AEGC 3CWBD 4OGQD 4U3FD 3L72G 1FU1A 3RL0g 3PRJA 5KLIC 2FYNB 2Q3IA 2BCCJ 1QVFO 1P84H 1MBXC 5KAIH 1UIXA 1L4AA 2FYUD 1FJPA 3V2NA 4YKAA 2FXPA 2E43A 3AE4C 2K1AA 1Y47A 4HYTB 4I2LC 2KZJA 1RF1B 5DM6W 1SQPE 1VQ7W 3O6QB 3NTNA 1K9MX 2P2UA 4GDOA 1M8OB 1MV8A 5E79E 2G3AA 3CD6W 1X9VA 3V2QA 1EZVD 5K5GB 1L4AC 1VQQA 1KB9D 1G1IA 1FC2C 1VQ5W 5GTHE 3V6IA 2Y9YA 2IZ1A 3CCLW 3B71A 3CC4P 3WMM0 3G4SP 1M1JB 2QM8A 5KLVD 1YJWW 3A3YB 3L73D 1VQLP 2V7QJ 4YJXA 3G71P 2ZJQW 2Q1KA 4JYBA 5CBOA 1VQ8P 2A06E 2AEFA 2WA8A 3LIEA 5GAEa 1YI2W 2NPSD 1E5WA 4PV1D 1H0TB 5DJTB 5AW8B 2QJKB 3HE5B 1SQVG 1T2KD 2AEMA 1R6OC 1LJ2A 4Y28J 4PJ0E 1W2EA 5AW3B 1J1EC 2I1KA 4IL6X 2FYNC 1NTKJ 1ZN5A 3H1JJ 1PZQA 1U7JA 1RHZB 3A0HE 1LWUA 1KYOH 4N3YB 1YQ3C 2UWJE 3L72D 2M0BA 5APWA 5BVZA 3E7KA 1X22A 1LTIC 3Q3DA 5APVA 3SSUA 1BGYJ 1EDKA 1LWUC 3C9IA 3GQ0A 3JCUH 1H0TA 1KD1X 3HD7A 1PIXA 3OAKA 1ZRTD 2RN0A 3HE5A 1S3JA 1S72P 3TF5A 5AVQB 3BCCE 4EIJA 1LTJA 3I55P 3CCRW 1M1JC 3EFGA 1LTGC 4NPEA 1LP1B 4ZKUA 2OGUA 4JYCA 3BVHA 3M9BA 2QJKC 2KSJA 1MWUA 3CX5H 2Z5HA 5CJ4A 5DJUB 3H1HE 3E1RA 1Y9BA 4I7ZB 5APTA 1S2EA 3NXSA 3TGUJ 1SFCB 1M90Q 1R8EA 1SQVD 3CXCV 3KQGA 1S9KD 3CC2W 2JDIH 3CCUP 2HLOA 1R6QC 4R4MA 1W2BV 1JTHB 1KQFB 1N7SB 5AW7B 4I1LA 4LC1A 3RL0D 1T3UA 1NHLA 4L73A 5TISE 1NTMK 2BCCD 1XTGB 1NJIX 4YTPC 1GK4A 3ITKA 1LP1A 1QL1A 5B5EE 4C7NB 2P7JA 2AXTE 1BGYG 3CMAP 2JR8A 4DOJA 1AFOA 1HGZA 5AVRB 5M1AA 4BWNA 4IFMA 1VPCA 1OZHA 2KUBA 3AE5C 3L75E 1M7LA 2E5TA 2P10A 3H1LE 5AW2B 1SFCA 2XNDH 3CC4W 2OARA 1JEKA 2NPSA 5AVYB 3VN0A 1OMIA 3GHGA 2A45I 5AVXB 1VQLW 1N7SA 4N78E 4IFFA 2O3JA 3G71W 1VQ8W 3M0DC 1MWSA 5BU5A 2E76D 4I7ZC 1QL2A 2IBZE 4JPZB 1SFCC 3TGUG 1OWAA 2K88A 1M57D 1SQXG 3UIAA 1PPJG 4IL6E 3USSA 4W7YA 3A0HH 2O01N 1N7SC 3A2AA 3HE4B 1NTKD 1VDFA 3NFQA 3WU2E 1H88A 2KS1B 1NOHA 4ASVA 3A0BE 1HBWA 4LLHA 3H25A 2CPBA 4R4LA 3SFDC 3AEEC 3G6EP 1NTMJ 3SWKA 3FX0A 2BEQD 4KJMA 4BRYB 1M90X 2OYIB 4WCEW 1SS1A 1OVUA 1YHQW 4AUWA 3CXHI 1PP9G 1BXYA 4IOIH 3VP8A 1SLQA 1JB0J 1BGYD 1JO5A 2E74B 4PD4I 1DD3A 4CPKA 1OW7A 1L0LG 4GIFA 3F5HA 3L74J 1YTZI 2N9BA 3AEDC 3KZIE 4D6TE 2HG5D 1OVVA 1GK6A 1YIJP 2HPCA 1S72W 3I55W 3TNUA 3PHLA 1P84E 5KAIE 1GU5A 1SQPK 2W6BA 1PV3A 4Z1MH 3O2BA 1AVYA 4L74A 2KS1A 4OVNF 4H0LB 4DZOA 3AE2C 4H44B 5AW1B 2W6JH 3CI9A 2WPQA 1VQ6P 3ABVC 1IK9A 2M8RA 4KHXA 1CTFA 3TGUD 1CI6B 1FZCA 1IO4A 3CCUW 3WUVA 3KDPB 3P7KA 1L0NE 5AVZB 1PPJD 4BXLA 1OFCX 3FWNA 3B5NB 2IPPA 2ZT9D 2YKOA 2YMYA 3FWLA 2ZYAA 2O01J 1NTMG 5TJHA 1VF5D 1BSNA 2OTLP 2B87A 2OYIC 1OX3A 3RK3E 1KORA 1BCCG 2C0WA 4DCKA 1LZWA 1KQLA 3D3IA 3ZG5A 2OTJP 3T97A 3CMAW 3TYYA 1AV1A 2E74C 1J2JB 1IFIA 3EWKA 1PP9D 1A02F 3CL3D 2N1TB 1NYHA 2FYUG 1L0LD 1RE3A 3CWBE 5AVVB 2KP8A 4XFJA 1GL2B 2LXCB 1KYOE 2W27A 1SQQJ 3WUTA 1VQNP 3S9OA 2FKWB 3BRVB 4TLFA 1SQPJ 4H44C 1NAYA 1VQKP 4IL6H 1ZLLA 1VL2A 2QIWA 3JCUE 1RH5B 3KHUA 1NO4A 1MZ9A 1IFNA 3L71J 3AE1C 1H8AA 3L70E 3HUSA 1EZVE 3B5NC 2MKVA 1JY2O 2K3RA 2KZIA 2PAJA 1KB9E 1GD2E 3AE7C 3MD0A 2KOGA 3CCVW 4IOCW 5CHXA 5H2FH 5KLVE 3C8VA 3MTUE 3G3PA 1JY2P 5M19A 4W7ZA 1N2DC 2KSEA 2MJZA 3L73E 1LT1A 1SP4A 2POHA 1GL2A 1NTMD 1K73X 3CX5E 3H1IE 3HUSC 1JUNA 1FDMA 1BCCD 1Y8AA 3GLMA 1IK7A 2D2CD 4GOFA 3PTZA 1RQVA 2HYNA 1JM0A 3H1KG 1FOSF 5GAGa 1QVGO 1KILB 2N1TC 2WWWA 1LGHB 3L37A 3Q5RA 4GKGA 1KD1Q 2WVRA 1GL2C 1YIJW 2E75D 1SQQG 4ZNCA 1EXJA 1EXIA 2ZFCA 3L72E 1NAFA 2ZJSE 4RJTA 1HF9A 1OW8A 4BL3A 4OH8B 1GMJA 1LWUB 4W80A 2KXPB 1MWTA 3KXDA 2KYVA 5CMZA 3L71G 5CCHD 1VQ6W 3NMDA 3MUDA 3RK2D 3O2HA 4JQ0D 3BCCJ 2QA4P 1T8ZA 3HRNA 1ZRTE 1MWRA 1FDIA 2IX7C 3CPWV 4I6MC 4HJGH 1GZLA 3VOPA 1FZEA 1KILA 2WSCJ 4QMAA 2I1JA 2KLVA 2W6AA 3K5BA 2IYPA 3HD7B 1NTZG 1NJIQ 3MUDC 3QWOC 2OTLW 3GW6A 4H13D 2M3EA 3MHVA 5APSA 3TDKA 1LTJB 3H1HJ 1BE3G 3RK3B 4EYYQ 4DKIA 2OTJW 1KILC 3W68A 1SQVE 1N86A 2BCCG 1S9KE 3CCSP 3H1KD 3JSVC 2Y0DA 1WT6A 2P58A 3R2PA 2R5BA 2ZXXA 1FS0E 1HJ0A 3PP5A 3Q2YA 2LXBA 2B89A 1M1KX 1KQSO 1FZBA 2PFXA 3V5BA 4OGQB 3JC22 3ZG0A 1UIIA 3G9RA 3VTPC 5BU8B 4UB8H 1SQQD 3P8MC 1VQNW 1JY3O 2Z5IA 2JWDA 1J1DC 2Q5UA 4AQRD 4HKZH 1MBVB 2Q7CA 4GT1A 1VQKW 1JY3P 2WSFJ 3VP9A 1KB9H 4AYCA 1W5CE 3LW5J 3L75J 3H1LJ 3VYIA 3L71D 2JJLA 1D7MA 4LGDE 2WPRA 4WFBW 5KJ7A 1Q2NA 1X79B 4JBZA 3HD7C 5AVSB 1LTJC 4WFNW 3RK3C 3OA7A 1HJBA 1NTZD 3WUUA 1NTKG 4IFDK 3H1JG 1L0NK 1HUCA 1BE3D 2NPSB 4PV1B 5KJ7C 1NH4A 3VMAA 2XZRA 3B8EB 4UB6E 3GHGB 5GTIH 1TU3F 2NZ2A 2IFMA 3GQ1A 1T3JA 4OGQC 2OYOA 1URQD 2L91A 4ZMDA 1K8AQ 2JO1A 2A45G 1LTBC 2IDBA 3II6A 3W7TA 2Y0CA 4WF9W 1VQOP 5CCHA 2P1JA 5HL7W 3LIDA 4HH2A 5APUA 2WSEH 1QLED 3E1IA 3Q5PA 4D6TJ 3H1LG 2O1JA 5AVTB 2CK3H 1S4XA 2QA4W 1MUUA 2WMMA 3G4SW 4KT0J 3CC7P 1WRGA 3CCMP 3G1BA 3CF5W 2WQYC 2ITAA 4U7JA 2W83C 1K04A 5KTBA 3BRTB 1FZAA 1SQBK 1EC5A 2IBZG 3N7NA 1AQ5A 3OW2O 3OJAB 2HPCB 3W7UA 2IYOA 2WSSH 2NPSC 4PV1C 3TNUB 1VQ4P 3GHGC 4WY4D 1T2KC 4C7RA 3AE8C 3W7WA 1S5LX 1LTSC 2H89C 3H1JD 1L0NJ 4XE5B 2PGDA 1MG9A 3VMXA 2QJYC 3CCSW 3G19A 1SQXE 2QE7H 1YQ4C 1PPJE 5KAFH 3P32A 2WPVB 2WITA 1JCCA 4YPCA 2M5AA 2K9JB 2IFNA 2IBZI 5H2FE 3H32A 1PGJA 3RL0B 1FZCB 1KILE 4NPFX 2KNCA 4OWFA 2KK7A 4BL2A 1FE6A 1LTAC 1NU1E 2QVAA 4WBAA 1KFNA 2KLUA 1PP9E 2B87B 5AVUB 1JOCA 3V2RA 4ZKPA 3CWBJ 2G8YA 2Y0EA 1K8AX 3M91A 2AXCA 2RKLA 3H1LD 4B86A 3T97B 1L0LE 3IF4A 2Z4EA 3U59A 2V7QH 4N78D 1Q82Q 1ZMEC 1EDLA 3U1CA 2K9JA 1SQBJ 2LR2A 1VQ7P 2IBZD 1K05A 4UB6H 1K73Q 3W7SA 1L4AD 2QJPC 2XV5A 4WWIA 3CXHD 3G3ZA 2E76B 1OIPA 1ZXGA 4EI2A 3L70J 1URQA 1KC8Q 2BEZF 2FFDA 1OW6A 3P8CD 4PD4D 3H6PA 2H8PD 1USDA 1MKMA 4YXWH 3L73J 3RL0C 2P67A 1FZCC 3O1FB 2HFED 5AW4B 1URQC 3H1IJ 1GTWA 4WFAW 3HUSB 1VQOW 3FGAD 4M3LA 1N7LA 2A45H 1SQVK 3GF3A 3L74G 1BCCE 1PFIA 1ZOYC 3I56P 1NKNA 2W90A 4U3FE 3D71A 3L36A 2WSFH 2W8ZA 4RESB 4MN4C 1ZP0C 3M9HA 3L72J 3CC7W 3CCMW 2FYUE 4Y99C 1SVFA 4UB8E 5JVHW 1LNQA 1KV4A 2XU6A 1GU4A 1RE3C 1SQBG 4WY4A 1S1CX 2FXMA 2OTKE 1IFJA 3FXDA 3O1FA 2E76C 1RF0A 1VQ4W 1R5SA 1RQSA 1RE4A 3L70G 3CCJP 3CXHH 1KYOI 1N73A 2R44A 2SPZA 1CSBA 1NKZB 4PD4H 4YXDC 3AEAC 3AEFC 1Q82X 1YITP 3MIWA 3R4YA 2KI7B 2B9BA 1N8RQ 1RF0C 1M1KQ 3G6EW 2V4HA 1RE4C 2ZYGA 3H1IG 2ZT9B 1CW5A 4GOEA 1IJDB 2B88A 1HH0A 1VF5B 1KC8X 2OYHB 2YO2A 1Q81Q 3U1AA 1VQ9P 3RBZA 1SQVJ 3L74D 1AJYA 1YJ9P 3M0AA 1Q90D 5GTIE 5CA3A 2IZ0A 3H1KE 2WT7A 2R32A 1IFPA 1KYOD 1SQPG 3CX5I 4ASWA 5GADa 3EQ2A 3SFEC 2QEXP 1SQQE 1LT9B 1FDOA 1J1DB 4C46A 4RO0A 2H43A 1BDCA 3Q1MA 3VMZA 2YMKA 1SQBD 4XA4A 2ZYDA 1FZGA 2JWAA 3V4WA 3V2PA 5GAHa 2OYHA 1EQ7A 3L70D 3L71E 2A06G 5B66H 3ZDMA 1U57A 2ZT9C 1GW3A 3D70A 3O8ZA 2R3SA 1SFCD 2FBWC 1VF5C 2OYHC 3CX5D 1KTMA 3H1ID 2HR3A 2M3BA 1YBKA 1VQPP 1QVGV 1NTZE 2GUSA 1LT9A 2NRGA 1N7SD 3IAOA 3AE9C 2Y9ZA 1SQXK 1QVFV 1BE3E 2W9RA 3B4SA 4N6JA 3KYQA 3CMEP 3I56W 2D2CB 1RF1A 1N8RX 3IR9A 2N9YB 3O6QA 4WVZA 1W2BO 1AA0A 2BCCE 5KAFE 2YKQA 2GA1A 5APQA 3PLNA 3PIPW 1JCDA 1LT9C 2E75B 1Q81X 1ZR2A 1SQPD 4L76A 1KMIZ 1NU1K 5JVGW 1PGQA 3GMAA 1NWQA 1IFDA 1RF1C 4GODA 2WZ7A 2KB7P 1M1JA 1YHQP 2J59M 4HB1A 1S5LH 3BCCG 4UY8Z 1MFTA 2VRSA 1Q7YQ 3CCQP 3J7ZZ 1KZUB 1L0LK 3CCJW 2E5YA 2Q6QA 1DD4A 3RK2B 1FJKA 1BDDA 1YJNP 1YITW 2O01H 2A06D 3H1HG 4K35A 1H89A 1QEXA 2H7HA 1NVOA 1IZNB 3AE6C 1Q86Q 5CJ0A 1ZV8A 3C1LA 3CCEP 4H13B 2PP6A 5M1BA 1VQ9W 2D2CC 3VMYA 3N4XA 2QJYB 2GUVA 1NTKE 1YJ9W 3H1JE 1SQXJ 4K3AA 3A5TA 1KQSV 2XNXA 3Q5SA 3ZFZA 1OXZA 1JY2N 2E75C 2C0XA 5AW5B 4U67W 3F89A 2QEXW 2E74D 5AW6B 2YIUB 5E79H 1NU1J 3L75G 5DM7W 1BGYE 2XDJA 2M5AB 1KN7A 5EFWB 1PP9J 1RQUA 3H32B 3BCCD 3PJSK 2YNYA 5GTHH 5CCHC 3AECC 3TK1A 1HTLC 3RK2C 1BSHA 2FYUK 1L0LJ 3M0DA 1DEEG 4A7PA 1DX7A 2KNCB 4H0LD 3DNJA 2C9NY 4H44D 5APXA 3GW1A 1JTHA 1HWTC 1QX8A 1Q7YX 1JJ2V 1A02J 3EFFK 3H1HD 2FYZA 3S1KA 3FXEA 2J5UA 3V4QA 2FY8A 3M06A 4NPDA 1PL5A 4PJ0H 4H13C 2Q9IA 1E79H 2QJPB 2AEJA 1VQPW 3TSIA 1MBUC 3TGUE 4IO9W 2WTYA 3B5ND 4CJNA 5KLVK 2ZVNB 3CXHE 5CCGD 5C39A 2I8DA 4C7NA 2DW3A 3CMEW 5KKZB 3P8CE 3GG2A 1DH3A 4PD4E 3AE3C 1U7MA 2YKPA 3CCVP 1Q86X 3MP7B 1PGPA 1URQB 3CLQA 3M9QA 2FFDB 2YIUC 4EOTA 1JMBA 4IOAW 1VQMP 1NU1G 2C9LY 4D6TG 1BCCJ 2N1TD 1MFZA 3PIOW 1ZR4A 4U3FJ 1GL2D 2L5GB 3A7OA 2QM7A 3L75D 3CCQW 2LKMA 1YTZT 1RY3A 1HGVA 2KIKA 3MGNA 1SQQK 2WSCH 2FYUJ 1LTTC 2XKMA 4Y99B 3IFMA 1YJNW 5AVWB 3OW2V 1FZFA 1FAVA 3HE4A 1KQGB 1EDIA 2RMZA 2J58A 4EDFA 2ZJRW 1DEBA 2R3CA 1L0NG 5CBNA 1JY3N 1P84I 3CD6P 3RBXA 1AVOA 4CPGA 3O2OA 3CCEW 2ZXEB 1VQ5P 4BRYA 5KKZC 5AW0B 2OYIA 3CCLP 1CZQA 4WY4B 5KLVJ 1YJWP 1SQXD 5TISH 3SWYA 5B66E 1R5LA 5GW7A 2CPSA 3RGUA 2WA9A 2H88C 1Z56A 2QG4A 4DJGA 1G2CB 2YXQB 1FBMA 3MZWB 1G1JA 2FFDC 1YI2P 1N73B 3I5CA 1NTME 5B5EH 1NTZK 4O9BA 2AXTH 1KILD 1X8YA 1IC2A 4YJMA 1T6AA 1M56D 4L75A 1YYCA 3CWBG 1DIPA 1NU1D 2R5DA 4U3FG 1JMMA 1EDJA 3DLLW 4D6TD 1K9MQ 1PGOA 1KFMA 3IN6A 4WB4A 1QGKB 1USEA 2ZVOB 3LW5H 3HTKB 3H1KJ 3L74E 2OQQA 2QRXA 2JP3A 2O1KA 1P84D 2GM4A 3PH0A 5KLIB 1NGMB 3QH9A 4JF7A 3W67A 2YO3A 2WPSA 3BATA 5AW9B 1CI6A 1FOSE 5APYA 3SWFA 2QSIA 2HODB 1HVVA 4H0LC 3KPEA 3B5NA 1G2CA 5CCGA 2WT7B 1AQTA 2BASA 1EZVG 1L2PA 1S5LE 2WSEJ 1SQBE 1GDTA 1L0ND 3W7XA 1IFMA 4WY4C 3CCRP 1ZW0A 3L4FA 2Q3EA 5KLVG 2JKVA 1X0TA 3WU2H 1L4AB 3L73G 1WMKA 3HD7D 3A0BH 5L8RJ 3CPWO 5CCGC 2ZJPW 1GW4A 3HTKA 5M18A 1N73C 3D6YA
chains in the Genus database with same CATH topology
2QJKC 3Q5PA 2H88C 4H44B 2WSFJ 2E76D 2WA8A 4I7ZC 1VL2A 3Q5SA 4PV1D 2QIWA 2G8YA 2E75C 3LW5J 3D6ZA 3O2HA 2K9YA 1ZP0C 1Y9BA 3ABVC 1R6OC 4I7ZB 3T97B 3AE1C 1CTFA 1ZRTE 4KT0J 4RKUJ 2YIUC 4Y28J 1FDIA 2E75B 1R8EA 3G1BA 2E74D 1KMIZ 2MKVA 3SFEC 2WQYC 4TT3H 4YJMA 3GMAA 4U7JA 2WSCJ 4IL6X 1FDOA 3AE7C 1R6QC 1DIPA 2FYNC 3GF7A 1K04A 4R4MA 3AEBC 1ZMEC 1S1CX 2ZT9D 3Q1MA 1KQFB 3AEGC 2YMKA 3C8VA 3IN6A 4OGQD 3RL0g 3G3PA 5KLIC 2O01J 1RQUA 1YQ3C 2OQQA 3H25A 3O1FA 2JP3A 2E76C 1K05A 1VF5D 4R4LA 4H13D 1RQSA 3SFDC 3AEEC 4PV1C 3AECC 4YTPC 3RK3E 1KORA 2QJPC 1NGMB 1MBXC 1UIXA 2BEQD 1LZWA 2E76B 1DD4A 3AE8C 4PV1B 3Q3DA 1S5LX 2BEZF 3GLMA 1IK7A 1OW6A 2D2CD 2H89C 4H0LD 3DNJA 4YKAA 1RQVA 2E74C 2FXPA 1MG9A 4YXDC 3AE4C 2QSIA 3AEAC 3AEFC 2QJYC 1JB0J 1U57A 4H44D 3EWKA 1TU3F 3G19A 4H0LC 2NZ2A 3R4YA 2E74B 1YQ4C 1DD3A 1KQGB 3GW1A 2ZT9C 3GQ1A 4GDOA 2WPVB 3GQ0A 1OW7A 1MKMA 3Q5RA 4OGQC 1HJ0A 3Q2YA 1NYHA 3AEDC 2J5UA 3D70A 3AE6C 2WSEJ 2G3AA 1PIXA 2E75D 2FBWC 2ZT9B 1VF5C 1PL5A 3O1FB 3AE5C 4H13C 1EXJA 2JO1A 4OGQB 4XFJA 1KTMA 1EXIA 2P10A 3G9RA 2IDBA 3O2OA 3FGAD 1MBUC 1VF5B 4H13B 1KILE 3S9OA 1HF9A 3B71A 5KKZC 1OW8A 3GF3A 3IAOA 5M1BA 2D2CC 3AE9C 1WMKA 1PV3A 4Z1MH 2W9RA 3O2BA 1OMIA 4H44C 1GMJA 1ZOYC 5L8RJ 1AJYA 2WA9A 2V7QJ 1MBVB 2D2CB 4H0LB 4YJXA 1Q90D 3AE3C 3AE2C 3D6YA 3O6QA 3D71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6Q C;  4YKA A;  3DNJ A;  2WA8 A;  1RQV A;  1MG9 A;  3O2O A;  1MBU C;  3G3P A;  3O2H A;  3G19 A;  1RQU A;  3O1F A;  1R6O C;  1DD3 A;  3GW1 A;  1CTF A;  3GQ1 A;  3GQ0 A;  1RQS A;  2W9R A;  3O2B A;  3G1B A;  1MBX C;  1MBV B;  4YJM A;  1LZW A;  4YJX A;  3O1F B;  1DD4 A;  2WA9 A; 
#chains in the Genus database with same CATH topology
 2PRR A;  3RK3 D;  2N1T A;  2JEE A;  2K37 A;  3D6Z A;  2K9Y A;  1OVR A;  1EZV I;  1KB9 I;  2RH0 A;  4DT0 A;  4RKU J;  5KJ7 D;  1NTZ J;  1VQM W;  2ZAE B;  3L35 A;  2FXO A;  3CC2 P;  1NTK K;  4TT3 H;  2E42 A;  2HOD A;  1XTC C;  1BE3 J;  3GF7 A;  1JNM A;  2YXR B;  3KZI H;  3AEB C;  3S4R A;  3BAS A;  1J1E B;  3AEG C;  3CWB D;  4OGQ D;  4U3F D;  3L72 G;  1FU1 A;  3RL0 g;  3PRJ A;  5KLI C;  2FYN B;  2Q3I A;  2BCC J;  1QVF O;  1P84 H;  1MBX C;  5KAI H;  1UIX A;  1L4A A;  2FYU D;  1FJP A;  3V2N A;  4YKA A;  2FXP A;  2E43 A;  3AE4 C;  2K1A A;  1Y47 A;  4HYT B;  4I2L C;  2KZJ A;  1RF1 B;  5DM6 W;  1SQP E;  1VQ7 W;  3O6Q B;  3NTN A;  1K9M X;  2P2U A;  4GDO A;  1M8O B;  1MV8 A;  5E79 E;  2G3A A;  3CD6 W;  1X9V A;  3V2Q A;  1EZV D;  5K5G B;  1L4A C;  1VQQ A;  1KB9 D;  1G1I A;  1FC2 C;  1VQ5 W;  5GTH E;  3V6I A;  2Y9Y A;  2IZ1 A;  3CCL W;  3B71 A;  3CC4 P;  3WMM 0;  3G4S P;  1M1J B;  2QM8 A;  5KLV D;  1YJW W;  3A3Y B;  3L73 D;  1VQL P;  2V7Q J;  4YJX A;  3G71 P;  2ZJQ W;  2Q1K A;  4JYB A;  5CBO A;  1VQ8 P;  2A06 E;  2AEF A;  2WA8 A;  3LIE A;  5GAE a;  1YI2 W;  2NPS D;  1E5W A;  4PV1 D;  1H0T B;  5DJT B;  5AW8 B;  2QJK B;  3HE5 B;  1SQV G;  1T2K D;  2AEM A;  1R6O C;  1LJ2 A;  4Y28 J;  4PJ0 E;  1W2E A;  5AW3 B;  1J1E C;  2I1K A;  4IL6 X;  2FYN C;  1NTK J;  1ZN5 A;  3H1J J;  1PZQ A;  1U7J A;  1RHZ B;  3A0H E;  1LWU A;  1KYO H;  4N3Y B;  1YQ3 C;  2UWJ E;  3L72 D;  2M0B A;  5APW A;  5BVZ A;  3E7K A;  1X22 A;  1LTI C;  3Q3D A;  5APV A;  3SSU A;  1BGY J;  1EDK A;  1LWU C;  3C9I A;  3GQ0 A;  3JCU H;  1H0T A;  1KD1 X;  3HD7 A;  1PIX A;  3OAK A;  1ZRT D;  2RN0 A;  3HE5 A;  1S3J A;  1S72 P;  3TF5 A;  5AVQ B;  3BCC E;  4EIJ A;  1LTJ A;  3I55 P;  3CCR W;  1M1J C;  3EFG A;  1LTG C;  4NPE A;  1LP1 B;  4ZKU A;  2OGU A;  4JYC A;  3BVH A;  3M9B A;  2QJK C;  2KSJ A;  1MWU A;  3CX5 H;  2Z5H A;  5CJ4 A;  5DJU B;  3H1H E;  3E1R A;  1Y9B A;  4I7Z B;  5APT A;  1S2E A;  3NXS A;  3TGU J;  1SFC B;  1M90 Q;  1R8E A;  1SQV D;  3CXC V;  3KQG A;  1S9K D;  3CC2 W;  2JDI H;  3CCU P;  2HLO A;  1R6Q C;  4R4M A;  1W2B V;  1JTH B;  1KQF B;  1N7S B;  5AW7 B;  4I1L A;  4LC1 A;  3RL0 D;  1T3U A;  1NHL A;  4L73 A;  5TIS E;  1NTM K;  2BCC D;  1XTG B;  1NJI X;  4YTP C;  1GK4 A;  3ITK A;  1LP1 A;  1QL1 A;  5B5E E;  4C7N B;  2P7J A;  2AXT E;  1BGY G;  3CMA P;  2JR8 A;  4DOJ A;  1AFO A;  1HGZ A;  5AVR B;  5M1A A;  4BWN A;  4IFM A;  1VPC A;  1OZH A;  2KUB A;  3AE5 C;  3L75 E;  1M7L A;  2E5T A;  2P10 A;  3H1L E;  5AW2 B;  1SFC A;  2XND H;  3CC4 W;  2OAR A;  1JEK A;  2NPS A;  5AVY B;  3VN0 A;  1OMI A;  3GHG A;  2A45 I;  5AVX B;  1VQL W;  1N7S A;  4N78 E;  4IFF A;  2O3J A;  3G71 W;  1VQ8 W;  3M0D C;  1MWS A;  5BU5 A;  2E76 D;  4I7Z C;  1QL2 A;  2IBZ E;  4JPZ B;  1SFC C;  3TGU G;  1OWA A;  2K88 A;  1M57 D;  1SQX G;  3UIA A;  1PPJ G;  4IL6 E;  3USS A;  4W7Y A;  3A0H H;  2O01 N;  1N7S C;  3A2A A;  3HE4 B;  1NTK D;  1VDF A;  3NFQ A;  3WU2 E;  1H88 A;  2KS1 B;  1NOH A;  4ASV A;  3A0B E;  1HBW A;  4LLH A;  3H25 A;  2CPB A;  4R4L A;  3SFD C;  3AEE C;  3G6E P;  1NTM J;  3SWK A;  3FX0 A;  2BEQ D;  4KJM A;  4BRY B;  1M90 X;  2OYI B;  4WCE W;  1SS1 A;  1OVU A;  1YHQ W;  4AUW A;  3CXH I;  1PP9 G;  1BXY A;  4IOI H;  3VP8 A;  1SLQ A;  1JB0 J;  1BGY D;  1JO5 A;  2E74 B;  4PD4 I;  1DD3 A;  4CPK A;  1OW7 A;  1L0L G;  4GIF A;  3F5H A;  3L74 J;  1YTZ I;  2N9B A;  3AED C;  3KZI E;  4D6T E;  2HG5 D;  1OVV A;  1GK6 A;  1YIJ P;  2HPC A;  1S72 W;  3I55 W;  3TNU A;  3PHL A;  1P84 E;  5KAI E;  1GU5 A;  1SQP K;  2W6B A;  1PV3 A;  4Z1M H;  3O2B A;  1AVY A;  4L74 A;  2KS1 A;  4OVN F;  4H0L B;  4DZO A;  3AE2 C;  4H44 B;  5AW1 B;  2W6J H;  3CI9 A;  2WPQ A;  1VQ6 P;  3ABV C;  1IK9 A;  2M8R A;  4KHX A;  1CTF A;  3TGU D;  1CI6 B;  1FZC A;  1IO4 A;  3CCU W;  3WUV A;  3KDP B;  3P7K A;  1L0N E;  5AVZ B;  1PPJ D;  4BXL A;  1OFC X;  3FWN A;  3B5N B;  2IPP A;  2ZT9 D;  2YKO A;  2YMY A;  3FWL A;  2ZYA A;  2O01 J;  1NTM G;  5TJH A;  1VF5 D;  1BSN A;  2OTL P;  2B87 A;  2OYI C;  1OX3 A;  3RK3 E;  1KOR A;  1BCC G;  2C0W A;  4DCK A;  1LZW A;  1KQL A;  3D3I A;  3ZG5 A;  2OTJ P;  3T97 A;  3CMA W;  3TYY A;  1AV1 A;  2E74 C;  1J2J B;  1IFI A;  3EWK A;  1PP9 D;  1A02 F;  3CL3 D;  2N1T B;  1NYH A;  2FYU G;  1L0L D;  1RE3 A;  3CWB E;  5AVV B;  2KP8 A;  4XFJ A;  1GL2 B;  2LXC B;  1KYO E;  2W27 A;  1SQQ J;  3WUT A;  1VQN P;  3S9O A;  2FKW B;  3BRV B;  4TLF A;  1SQP J;  4H44 C;  1NAY A;  1VQK P;  4IL6 H;  1ZLL A;  1VL2 A;  2QIW A;  3JCU E;  1RH5 B;  3KHU A;  1NO4 A;  1MZ9 A;  1IFN A;  3L71 J;  3AE1 C;  1H8A A;  3L70 E;  3HUS A;  1EZV E;  3B5N C;  2MKV A;  1JY2 O;  2K3R A;  2KZI A;  2PAJ A;  1KB9 E;  1GD2 E;  3AE7 C;  3MD0 A;  2KOG A;  3CCV W;  4IOC W;  5CHX A;  5H2F H;  5KLV E;  3C8V A;  3MTU E;  3G3P A;  1JY2 P;  5M19 A;  4W7Z A;  1N2D C;  2KSE A;  2MJZ A;  3L73 E;  1LT1 A;  1SP4 A;  2POH A;  1GL2 A;  1NTM D;  1K73 X;  3CX5 E;  3H1I E;  3HUS C;  1JUN A;  1FDM A;  1BCC D;  1Y8A A;  3GLM A;  1IK7 A;  2D2C D;  4GOF A;  3PTZ A;  1RQV A;  2HYN A;  1JM0 A;  3H1K G;  1FOS F;  5GAG a;  1QVG O;  1KIL B;  2N1T C;  2WWW A;  1LGH B;  3L37 A;  3Q5R A;  4GKG A;  1KD1 Q;  2WVR A;  1GL2 C;  1YIJ W;  2E75 D;  1SQQ G;  4ZNC A;  1EXJ A;  1EXI A;  2ZFC A;  3L72 E;  1NAF A;  2ZJS E;  4RJT A;  1HF9 A;  1OW8 A;  4BL3 A;  4OH8 B;  1GMJ A;  1LWU B;  4W80 A;  2KXP B;  1MWT A;  3KXD A;  2KYV A;  5CMZ A;  3L71 G;  5CCH D;  1VQ6 W;  3NMD A;  3MUD A;  3RK2 D;  3O2H A;  4JQ0 D;  3BCC J;  2QA4 P;  1T8Z A;  3HRN A;  1ZRT E;  1MWR A;  1FDI A;  2IX7 C;  3CPW V;  4I6M C;  4HJG H;  1GZL A;  3VOP A;  1FZE A;  1KIL A;  2WSC J;  4QMA A;  2I1J A;  2KLV A;  2W6A A;  3K5B A;  2IYP A;  3HD7 B;  1NTZ G;  1NJI Q;  3MUD C;  3QWO C;  2OTL W;  3GW6 A;  4H13 D;  2M3E A;  3MHV A;  5APS A;  3TDK A;  1LTJ B;  3H1H J;  1BE3 G;  3RK3 B;  4EYY Q;  4DKI A;  2OTJ W;  1KIL C;  3W68 A;  1SQV E;  1N86 A;  2BCC G;  1S9K E;  3CCS P;  3H1K D;  3JSV C;  2Y0D A;  1WT6 A;  2P58 A;  3R2P A;  2R5B A;  2ZXX A;  1FS0 E;  1HJ0 A;  3PP5 A;  3Q2Y A;  2LXB A;  2B89 A;  1M1K X;  1KQS O;  1FZB A;  2PFX A;  3V5B A;  4OGQ B;  3JC2 2;  3ZG0 A;  1UII A;  3G9R A;  3VTP C;  5BU8 B;  4UB8 H;  1SQQ D;  3P8M C;  1VQN W;  1JY3 O;  2Z5I A;  2JWD A;  1J1D C;  2Q5U A;  4AQR D;  4HKZ H;  1MBV B;  2Q7C A;  4GT1 A;  1VQK W;  1JY3 P;  2WSF J;  3VP9 A;  1KB9 H;  4AYC A;  1W5C E;  3LW5 J;  3L75 J;  3H1L J;  3VYI A;  3L71 D;  2JJL A;  1D7M A;  4LGD E;  2WPR A;  4WFB W;  5KJ7 A;  1Q2N A;  1X79 B;  4JBZ A;  3HD7 C;  5AVS B;  1LTJ C;  4WFN W;  3RK3 C;  3OA7 A;  1HJB A;  1NTZ D;  3WUU A;  1NTK G;  4IFD K;  3H1J G;  1L0N K;  1HUC A;  1BE3 D;  2NPS B;  4PV1 B;  5KJ7 C;  1NH4 A;  3VMA A;  2XZR A;  3B8E B;  4UB6 E;  3GHG B;  5GTI H;  1TU3 F;  2NZ2 A;  2IFM A;  3GQ1 A;  1T3J A;  4OGQ C;  2OYO A;  1URQ D;  2L91 A;  4ZMD A;  1K8A Q;  2JO1 A;  2A45 G;  1LTB C;  2IDB A;  3II6 A;  3W7T A;  2Y0C A;  4WF9 W;  1VQO P;  5CCH A;  2P1J A;  5HL7 W;  3LID A;  4HH2 A;  5APU A;  2WSE H;  1QLE D;  3E1I A;  3Q5P A;  4D6T J;  3H1L G;  2O1J A;  5AVT B;  2CK3 H;  1S4X A;  2QA4 W;  1MUU A;  2WMM A;  3G4S W;  4KT0 J;  3CC7 P;  1WRG A;  3CCM P;  3G1B A;  3CF5 W;  2WQY C;  2ITA A;  4U7J A;  2W83 C;  1K04 A;  5KTB A;  3BRT B;  1FZA A;  1SQB K;  1EC5 A;  2IBZ G;  3N7N A;  1AQ5 A;  3OW2 O;  3OJA B;  2HPC B;  3W7U A;  2IYO A;  2WSS H;  2NPS C;  4PV1 C;  3TNU B;  1VQ4 P;  3GHG C;  4WY4 D;  1T2K C;  4C7R A;  3AE8 C;  3W7W A;  1S5L X;  1LTS C;  2H89 C;  3H1J D;  1L0N J;  4XE5 B;  2PGD A;  1MG9 A;  3VMX A;  2QJY C;  3CCS W;  3G19 A;  1SQX E;  2QE7 H;  1YQ4 C;  1PPJ E;  5KAF H;  3P32 A;  2WPV B;  2WIT A;  1JCC A;  4YPC A;  2M5A A;  2K9J B;  2IFN A;  2IBZ I;  5H2F E;  3H32 A;  1PGJ A;  3RL0 B;  1FZC B;  1KIL E;  4NPF X;  2KNC A;  4OWF A;  2KK7 A;  4BL2 A;  1FE6 A;  1LTA C;  1NU1 E;  2QVA A;  4WBA A;  1KFN A;  2KLU A;  1PP9 E;  2B87 B;  5AVU B;  1JOC A;  3V2R A;  4ZKP A;  3CWB J;  2G8Y A;  2Y0E A;  1K8A X;  3M91 A;  2AXC A;  2RKL A;  3H1L D;  4B86 A;  3T97 B;  1L0L E;  3IF4 A;  2Z4E A;  3U59 A;  2V7Q H;  4N78 D;  1Q82 Q;  1ZME C;  1EDL A;  3U1C A;  2K9J A;  1SQB J;  2LR2 A;  1VQ7 P;  2IBZ D;  1K05 A;  4UB6 H;  1K73 Q;  3W7S A;  1L4A D;  2QJP C;  2XV5 A;  4WWI A;  3CXH D;  3G3Z A;  2E76 B;  1OIP A;  1ZXG A;  4EI2 A;  3L70 J;  1URQ A;  1KC8 Q;  2BEZ F;  2FFD A;  1OW6 A;  3P8C D;  4PD4 D;  3H6P A;  2H8P D;  1USD A;  1MKM A;  4YXW H;  3L73 J;  3RL0 C;  2P67 A;  1FZC C;  3O1F B;  2HFE D;  5AW4 B;  1URQ C;  3H1I J;  1GTW A;  4WFA W;  3HUS B;  1VQO W;  3FGA D;  4M3L A;  1N7L A;  2A45 H;  1SQV K;  3GF3 A;  3L74 G;  1BCC E;  1PFI A;  1ZOY C;  3I56 P;  1NKN A;  2W90 A;  4U3F E;  3D71 A;  3L36 A;  2WSF H;  2W8Z A;  4RES B;  4MN4 C;  1ZP0 C;  3M9H A;  3L72 J;  3CC7 W;  3CCM W;  2FYU E;  4Y99 C;  1SVF A;  4UB8 E;  5JVH W;  1LNQ A;  1KV4 A;  2XU6 A;  1GU4 A;  1RE3 C;  1SQB G;  4WY4 A;  1S1C X;  2FXM A;  2OTK E;  1IFJ A;  3FXD A;  3O1F A;  2E76 C;  1RF0 A;  1VQ4 W;  1R5S A;  1RQS A;  1RE4 A;  3L70 G;  3CCJ P;  3CXH H;  1KYO I;  1N73 A;  2R44 A;  2SPZ A;  1CSB A;  1NKZ B;  4PD4 H;  4YXD C;  3AEA C;  3AEF C;  1Q82 X;  1YIT P;  3MIW A;  3R4Y A;  2KI7 B;  2B9B A;  1N8R Q;  1RF0 C;  1M1K Q;  3G6E W;  2V4H A;  1RE4 C;  2ZYG A;  3H1I G;  2ZT9 B;  1CW5 A;  4GOE A;  1IJD B;  2B88 A;  1HH0 A;  1VF5 B;  1KC8 X;  2OYH B;  2YO2 A;  1Q81 Q;  3U1A A;  1VQ9 P;  3RBZ A;  1SQV J;  3L74 D;  1AJY A;  1YJ9 P;  3M0A A;  1Q90 D;  5GTI E;  5CA3 A;  2IZ0 A;  3H1K E;  2WT7 A;  2R32 A;  1IFP A;  1KYO D;  1SQP G;  3CX5 I;  4ASW A;  5GAD a;  3EQ2 A;  3SFE C;  2QEX P;  1SQQ E;  1LT9 B;  1FDO A;  1J1D B;  4C46 A;  4RO0 A;  2H43 A;  1BDC A;  3Q1M A;  3VMZ A;  2YMK A;  1SQB D;  4XA4 A;  2ZYD A;  1FZG A;  2JWA A;  3V4W A;  3V2P A;  5GAH a;  2OYH A;  1EQ7 A;  3L70 D;  3L71 E;  2A06 G;  5B66 H;  3ZDM A;  1U57 A;  2ZT9 C;  1GW3 A;  3D70 A;  3O8Z A;  2R3S A;  1SFC D;  2FBW C;  1VF5 C;  2OYH C;  3CX5 D;  1KTM A;  3H1I D;  2HR3 A;  2M3B A;  1YBK A;  1VQP P;  1QVG V;  1NTZ E;  2GUS A;  1LT9 A;  2NRG A;  1N7S D;  3IAO A;  3AE9 C;  2Y9Z A;  1SQX K;  1QVF V;  1BE3 E;  2W9R A;  3B4S A;  4N6J A;  3KYQ A;  3CME P;  3I56 W;  2D2C B;  1RF1 A;  1N8R X;  3IR9 A;  2N9Y B;  3O6Q A;  4WVZ A;  1W2B O;  1AA0 A;  2BCC E;  5KAF E;  2YKQ A;  2GA1 A;  5APQ A;  3PLN A;  3PIP W;  1JCD A;  1LT9 C;  2E75 B;  1Q81 X;  1ZR2 A;  1SQP D;  4L76 A;  1KMI Z;  1NU1 K;  5JVG W;  1PGQ A;  3GMA A;  1NWQ A;  1IFD A;  1RF1 C;  4GOD A;  2WZ7 A;  2KB7 P;  1M1J A;  1YHQ P;  2J59 M;  4HB1 A;  1S5L H;  3BCC G;  4UY8 Z;  1MFT A;  2VRS A;  1Q7Y Q;  3CCQ P;  3J7Z Z;  1KZU B;  1L0L K;  3CCJ W;  2E5Y A;  2Q6Q A;  1DD4 A;  3RK2 B;  1FJK A;  1BDD A;  1YJN P;  1YIT W;  2O01 H;  2A06 D;  3H1H G;  4K35 A;  1H89 A;  1QEX A;  2H7H A;  1NVO A;  1IZN B;  3AE6 C;  1Q86 Q;  5CJ0 A;  1ZV8 A;  3C1L A;  3CCE P;  4H13 B;  2PP6 A;  5M1B A;  1VQ9 W;  2D2C C;  3VMY A;  3N4X A;  2QJY B;  2GUV A;  1NTK E;  1YJ9 W;  3H1J E;  1SQX J;  4K3A A;  3A5T A;  1KQS V;  2XNX A;  3Q5S A;  3ZFZ A;  1OXZ A;  1JY2 N;  2E75 C;  2C0X A;  5AW5 B;  4U67 W;  3F89 A;  2QEX W;  2E74 D;  5AW6 B;  2YIU B;  5E79 H;  1NU1 J;  3L75 G;  5DM7 W;  1BGY E;  2XDJ A;  2M5A B;  1KN7 A;  5EFW B;  1PP9 J;  1RQU A;  3H32 B;  3BCC D;  3PJS K;  2YNY A;  5GTH H;  5CCH C;  3AEC C;  3TK1 A;  1HTL C;  3RK2 C;  1BSH A;  2FYU K;  1L0L J;  3M0D A;  1DEE G;  4A7P A;  1DX7 A;  2KNC B;  4H0L D;  3DNJ A;  2C9N Y;  4H44 D;  5APX A;  3GW1 A;  1JTH A;  1HWT C;  1QX8 A;  1Q7Y X;  1JJ2 V;  1A02 J;  3EFF K;  3H1H D;  2FYZ A;  3S1K A;  3FXE A;  2J5U A;  3V4Q A;  2FY8 A;  3M06 A;  4NPD A;  1PL5 A;  4PJ0 H;  4H13 C;  2Q9I A;  1E79 H;  2QJP B;  2AEJ A;  1VQP W;  3TSI A;  1MBU C;  3TGU E;  4IO9 W;  2WTY A;  3B5N D;  4CJN A;  5KLV K;  2ZVN B;  3CXH E;  5CCG D;  5C39 A;  2I8D A;  4C7N A;  2DW3 A;  3CME W;  5KKZ B;  3P8C E;  3GG2 A;  1DH3 A;  4PD4 E;  3AE3 C;  1U7M A;  2YKP A;  3CCV P;  1Q86 X;  3MP7 B;  1PGP A;  1URQ B;  3CLQ A;  3M9Q A;  2FFD B;  2YIU C;  4EOT A;  1JMB A;  4IOA W;  1VQM P;  1NU1 G;  2C9L Y;  4D6T G;  1BCC J;  2N1T D;  1MFZ A;  3PIO W;  1ZR4 A;  4U3F J;  1GL2 D;  2L5G B;  3A7O A;  2QM7 A;  3L75 D;  3CCQ W;  2LKM A;  1YTZ T;  1RY3 A;  1HGV A;  2KIK A;  3MGN A;  1SQQ K;  2WSC H;  2FYU J;  1LTT C;  2XKM A;  4Y99 B;  3IFM A;  1YJN W;  5AVW B;  3OW2 V;  1FZF A;  1FAV A;  3HE4 A;  1KQG B;  1EDI A;  2RMZ A;  2J58 A;  4EDF A;  2ZJR W;  1DEB A;  2R3C A;  1L0N G;  5CBN A;  1JY3 N;  1P84 I;  3CD6 P;  3RBX A;  1AVO A;  4CPG A;  3O2O A;  3CCE W;  2ZXE B;  1VQ5 P;  4BRY A;  5KKZ C;  5AW0 B;  2OYI A;  3CCL P;  1CZQ A;  4WY4 B;  5KLV J;  1YJW P;  1SQX D;  5TIS H;  3SWY A;  5B66 E;  1R5L A;  5GW7 A;  2CPS A;  3RGU A;  2WA9 A;  2H88 C;  1Z56 A;  2QG4 A;  4DJG A;  1G2C B;  2YXQ B;  1FBM A;  3MZW B;  1G1J A;  2FFD C;  1YI2 P;  1N73 B;  3I5C A;  1NTM E;  5B5E H;  1NTZ K;  4O9B A;  2AXT H;  1KIL D;  1X8Y A;  1IC2 A;  4YJM A;  1T6A A;  1M56 D;  4L75 A;  1YYC A;  3CWB G;  1DIP A;  1NU1 D;  2R5D A;  4U3F G;  1JMM A;  1EDJ A;  3DLL W;  4D6T D;  1K9M Q;  1PGO A;  1KFM A;  3IN6 A;  4WB4 A;  1QGK B;  1USE A;  2ZVO B;  3LW5 H;  3HTK B;  3H1K J;  3L74 E;  2OQQ A;  2QRX A;  2JP3 A;  2O1K A;  1P84 D;  2GM4 A;  3PH0 A;  5KLI B;  1NGM B;  3QH9 A;  4JF7 A;  3W67 A;  2YO3 A;  2WPS A;  3BAT A;  5AW9 B;  1CI6 A;  1FOS E;  5APY A;  3SWF A;  2QSI A;  2HOD B;  1HVV A;  4H0L C;  3KPE A;  3B5N A;  1G2C A;  5CCG A;  2WT7 B;  1AQT A;  2BAS A;  1EZV G;  1L2P A;  1S5L E;  2WSE J;  1SQB E;  1GDT A;  1L0N D;  3W7X A;  1IFM A;  4WY4 C;  3CCR P;  1ZW0 A;  3L4F A;  2Q3E A;  5KLV G;  2JKV A;  1X0T A;  3WU2 H;  1L4A B;  3L73 G;  1WMK A;  3HD7 D;  3A0B H;  5L8R J;  3CPW O;  5CCG C;  2ZJP W;  1GW4 A;  3HTK A;  5M18 A;  1N73 C;  3D6Y A; 
#chains in the Genus database with same CATH homology
 2QJK C;  3Q5P A;  2H88 C;  4H44 B;  2WSF J;  2E76 D;  2WA8 A;  4I7Z C;  1VL2 A;  3Q5S A;  4PV1 D;  2QIW A;  2G8Y A;  2E75 C;  3LW5 J;  3D6Z A;  3O2H A;  2K9Y A;  1ZP0 C;  1Y9B A;  3ABV C;  1R6O C;  4I7Z B;  3T97 B;  3AE1 C;  1CTF A;  1ZRT E;  4KT0 J;  4RKU J;  2YIU C;  4Y28 J;  1FDI A;  2E75 B;  1R8E A;  3G1B A;  2E74 D;  1KMI Z;  2MKV A;  3SFE C;  2WQY C;  4TT3 H;  4YJM A;  3GMA A;  4U7J A;  2WSC J;  4IL6 X;  1FDO A;  3AE7 C;  1R6Q C;  1DIP A;  2FYN C;  3GF7 A;  1K04 A;  4R4M A;  3AEB C;  1ZME C;  1S1C X;  2ZT9 D;  3Q1M A;  1KQF B;  3AEG C;  2YMK A;  3C8V A;  3IN6 A;  4OGQ D;  3RL0 g;  3G3P A;  5KLI C;  2O01 J;  1RQU A;  1YQ3 C;  2OQQ A;  3H25 A;  3O1F A;  2JP3 A;  2E76 C;  1K05 A;  1VF5 D;  4R4L A;  4H13 D;  1RQS A;  3SFD C;  3AEE C;  4PV1 C;  3AEC C;  4YTP C;  3RK3 E;  1KOR A;  2QJP C;  1NGM B;  1MBX C;  1UIX A;  2BEQ D;  1LZW A;  2E76 B;  1DD4 A;  3AE8 C;  4PV1 B;  3Q3D A;  1S5L X;  2BEZ F;  3GLM A;  1IK7 A;  1OW6 A;  2D2C D;  2H89 C;  4H0L D;  3DNJ A;  4YKA A;  1RQV A;  2E74 C;  2FXP A;  1MG9 A;  4YXD C;  3AE4 C;  2QSI A;  3AEA C;  3AEF C;  2QJY C;  1JB0 J;  1U57 A;  4H44 D;  3EWK A;  1TU3 F;  3G19 A;  4H0L C;  2NZ2 A;  3R4Y A;  2E74 B;  1YQ4 C;  1DD3 A;  1KQG B;  3GW1 A;  2ZT9 C;  3GQ1 A;  4GDO A;  2WPV B;  3GQ0 A;  1OW7 A;  1MKM A;  3Q5R A;  4OGQ C;  1HJ0 A;  3Q2Y A;  1NYH A;  3AED C;  2J5U A;  3D70 A;  3AE6 C;  2WSE J;  2G3A A;  1PIX A;  2E75 D;  2FBW C;  2ZT9 B;  1VF5 C;  1PL5 A;  3O1F B;  3AE5 C;  4H13 C;  1EXJ A;  2JO1 A;  4OGQ B;  4XFJ A;  1KTM A;  1EXI A;  2P10 A;  3G9R A;  2IDB A;  3O2O A;  3FGA D;  1MBU C;  1VF5 B;  4H13 B;  1KIL E;  3S9O A;  1HF9 A;  3B71 A;  5KKZ C;  1OW8 A;  3GF3 A;  3IAO A;  5M1B A;  2D2C C;  3AE9 C;  1WMK A;  1PV3 A;  4Z1M H;  2W9R A;  3O2B A;  1OMI A;  4H44 C;  1GMJ A;  1ZOY C;  5L8R J;  1AJY A;  2WA9 A;  2V7Q J;  1MBV B;  2D2C B;  4H0L B;  4YJX A;  1Q90 D;  3AE3 C;  3AE2 C;  3D6Y A;  3O6Q A;  3D71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...