1DD3A

Crystal structure of ribosomal protein l12 from thermotoga maritima
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd3A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd3A02
1DD4A 1RQVA 1MBUC 4YJMA 1LZWA 2WA9A 1MBXC 2W9RA 3O2HA 2WA8A 4YKAA 1MBVB 1MG9A 1CTFA 3DNJA 1RQUA 4YJXA 1DD3A 3G19A 3O1FA 3GW1A 1R6OC 1RQSA 3G1BA 3O2BA 3GQ0A 3O1FB 3O2OA 3GQ1A 3G3PA 1R6QC
chains in the Genus database with same CATH superfamily
2WA9A 3D71A 1JY2O 1Y8AA 3TNUA 2QE7H 1YITW 4IL6X 2ZFCA 2V4HA 2YXRB 1VQQA 1BDCA 1J1DC 5CCGC 3EFFK 1R8EA 1NTKK 4YTPC 2YO2A 4RESB 5GAEa 2XKMA 1LT9C 3NMDA 3B8EB 4OWFA 1A02J 1M1KX 1KILD 3MIWA 1BSNA 3A0HH 4AQRD 4EDFA 3K5BA 1HTLC 3NTNA 4I7ZC 3G3ZA 4PD4D 1QVGV 4UB8H 1FZCB 1BDDA 3W67A 3A0BH 1NO4A 2NPSC 2R5BA 4U7JA 2IFMA 1CI6A 5GAGa 3JCUH 1N73B 3WUTA 1VQNW 2BCCJ 1BE3G 4W7ZA 1LTTC 4BXLA 1VQOW 1Y9BA 2Y0CA 3L72G 1PP9G 2C0XA 5H2FH 3CCRP 1L4AA 1PPJD 2WSEH 2AXCA 1XTCC 1NAYA 3SFDC 1QL2A 5KAIH 3S9OA 3CF5W 1JY2P 3L71E 4OGQB 2BEQD 2W83C 3AE8C 1JM0A 1VQ7P 1KFNA 4ZNCA 1L4AD 2WSFJ 3H1KE 4C46A 1BXYA 2W6AA 4XE5B 1SVFA 2KSJA 3WUVA 1N8RQ 1MFZA 3M0DA 1KYOE 5AVTB 2A06E 3AEDC 2JO1A 4WY4D 2KP8A 2KUBA 1EXIA 1RQVA 3IAOA 2WVRA 3VOPA 1M1JB 2JR8A 4WY4C 4H13D 2FXMA 1OXZA 1A02F 1NVOA 1LTIC 2O3JA 3H1JD 3L71G 1G1IA 2IX7C 1NU1D 3KZIE 1S4XA 3H1HG 3G9RA 1M1KQ 2YNYA 3B5NC 4AUWA 1LWUB 1YHQW 1U7MA 2ZJQW 5AW1B 3CCJW 2NPSA 2H89C 1MWTA 4W7YA 1BCCD 4O9BA 3TGUG 1NTMG 3RK3C 3L75E 1L0LD 3HD7D 3RL0C 3P8CE 1URQA 3ZG0A 1MUUA 1SQPE 1NJIX 3CD6W 1WRGA 5DJTB 1M90X 3AE4C 3L72J 3PIOW 3RK2B 2LKMA 4JF7A 3HD7C 3KXDA 3H32B 5M19A 3LIEA 3L73G 2FYNB 1RE4A 3HE4B 3TSIA 3CCSP 3GF7A 1LGHB 1AVYA 1UIXA 2OTKE 3CWBE 1J2JB 4N6JA 5KAIE 1YJNW 1PL5A 4GODA 2E5TA 1Q86X 2IDBA 1GDTA 1KB9E 4K3AA 3EWKA 1SQBJ 1FDMA 3AE6C 1EXJA 2QA4W 2ITAA 3JSVC 3MP7B 1JOCA 1KILE 1H0TB 1BGYE 1IK7A 2QJPC 1KQGB 3CCMW 1S5LE 1YIJP 1USDA 1NOHA 4TT3H 4HH2A 1SLQA 4R4LA 1JCDA 4XA4A 1NTKE 2ZYGA 1PP9E 3FWNA 1SQBE 2O1KA 3W7UA 2N1TD 2Q1KA 4EI2A 1NWQA 4MN4C 3VMXA 1DH3A 1FJKA 3O2HA 1T8ZA 4LGDE 1CI6B 3CWBJ 3CXHD 4N78D 1JY3N 1KYOH 3IFMA 3GW1A 3CCSW 2E42A 1GU5A 5GAHa 4M3LA 5JVHW 5M1AA 2P67A 5APVA 1S2EA 2R32A 2B87A 2ZT9D 4H44D 5AVYB 3L73E 3L75J 2E43A 2FYUG 3GW6A 4IO9W 1GW4A 2M5AA 3L75D 3L71D 2WPRA 4BL2A 3L73D 4RJTA 5AW8B 1RHZB 3NFQA 3DNJA 3D3IA 2P10A 1G2CA 3OW2V 1GD2E 4H0LD 1VQ6W 1NTZE 3MUDA 3L36A 1AA0A 2LXBA 1YYCA 3CCVP 1M90Q 1DIPA 2P7JA 3CXHE 4N78E 1UIIA 1NTMD 5E79H 4CPGA 1YBKA 1K8AX 1M7LA 4B86A 1VL2A 4WF9W 5AVWB 1VQ7W 4R4MA 3BRTB 3H1JJ 3HUSA 3CC4P 1NU1J 3AE3C 3H1KG 3PIPW 2RKLA 3BATA 3TNUB 1FZEA 1KD1X 3CI9A 3GHGA 3DLLW 3E7KA 2YMKA 3MHVA 5AVSB 1L0NE 2M3EA 4C7NA 3O2OA 2IYPA 2H8PD 4UB6E 5APSA 1AV1A 4RKUJ 3RK2C 1IJDB 1KYOI 1HBWA 2LR2A 3GG2A 1VF5C 4CJNA 2I1JA 1SQBK 2PGDA 2BCCG 2AXTE 3CX5I 1YQ4C 3A0HE 1NTME 1FZAA 1LTJB 3CCUW 3FGAD 2FYZA 5B5EH 2QM8A 2ZJSE 1RF1C 1M57D 1ZRTD 4DOJA 3A5TA 1Z56A 1FC2C 1SQQD 3CCQP 1T6AA 2M8RA 1VQ6P 5CCGA 3Q5PA 3V2NA 5KLVK 4QMAA 5DM7W 3E1IA 1QLED 2E74B 3LW5J 1EC5A 1NH4A 2LXCB 2IFNA 3CX5E 5M1BA 1SQBD 4L75A 3BCCD 2WSSH 3O1FA 3T97A 3G1BA 1VQKP 5K5GB 3RK3E 2H43A 1LNQA 5CBOA 1OW8A 1K73Q 1IK9A 1EDIA 2WSEJ 3G6EW 1NTKG 1N7LA 3H1JG 5E79E 1VQ8P 4A7PA 3H25A 5CJ0A 5DJUB 5AW7B 4H0LC 3OAKA 3G3PA 1ZN5A 3OA7A 1EZVI 1D7MA 1BGYG 1IFJA 2PRRA 2FYUE 3CXCV 1N7SD 2IBZE 1S5LH 1EDKA 5M18A 2YIUB 4JYBA 3H1KD 3VN0A 5GTIH 5B66H 3O2BA 1MZ9A 1NKNA 2L5GB 3WUUA 1KB9H 1MBUC 4Y99C 5C39A 3RGUA 5KKZB 4DCKA 1L0LE 3CCLP 3TDKA 1N73C 3H1IJ 1ZMEC 3H1IG 2R5DA 1L4AC 1PPJE 1VQ9P 2J59M 3W7TA 2ZJPW 3PLNA 5BVZA 3AEBC 2NRGA 3WMM0 1S72P 2A06G 2YKOA 1GW3A 1NU1E 2HFED 1S72W 5KLVD 2KS1B 4PV1B 3HE5B 1KD1Q 2OYIA 3MGNA 1MWUA 1AJYA 2NZ2A 2ZT9B 1PGJA 5AVZB 2H7HA 1SQBG 4WY4B 4NPEA 3ZDMA 2RMZA 1H0TA 1EDJA 1JCCA 3IN6A 5CJ4A 4HJGH 4YJXA 1QL1A 2NPSD 5AW3B 1FDIA 3L75G 4H0LB 1LTAC 3GF3A 2A45H 2E74C 4U3FD 2JWAA 3A0BE 1N73A 2PFXA 1YHQP 2WMMA 3B71A 3FWLA 3I55P 2QA4P 2D2CD 2A45G 1KN7A 1ZR2A 1SQXD 2OARA 1RE4C 3W7XA 2FXOA 1RY3A 4HB1A 4RO0A 5GADa 1H8AA 1QVFV 2IPPA 3HTKB 4U3FG 2UWJE 1ZR4A 4H13C 2R44A 2MKVA 1PZQA 3R2PA 2E76C 2K37A 3TK1A 1NTMK 1EZVG 1P84D 3AEGC 1VQ8W 2B88A 2QRXA 2I8DA 4IFDK 1S5LX 3CLQA 5CCGD 3FXEA 1LTGC 4YKAA 4H13B 4AYCA 1NJIQ 1PGPA 2SPZA 3B5NA 2BEZF 1PGOA 1FS0E 2E5YA 3ITKA 3M0DC 3S1KA 4IL6E 2JP3A 5B5EE 3CC2P 1K9MX 1VQPP 2AEMA 5CCHD 1J1EC 4I7ZB 2QJPB 4L74A 2CPBA 4LLHA 2PAJA 2RH0A 1ZV8A 1MG9A 1BGYD 1KB9D 1YJNP 2K9YA 1Q86Q 2K88A 2JJLA 1PFIA 4C7NB 1JY2N 1L4AB 1DEBA 3AE2C 4Z1MH 3RBZA 1KV4A 1KILA 3I5CA 4GIFA 3H1LJ 5TISE 5APWA 1JO5A 1J1DB 2W6BA 3KDPB 1VQ5P 5AW5B 1MKMA 3PRJA 2DW3A 2Q7CA 2WPQA 2Q3EA 3U1CA 1OFCX 1IFNA 5B66E 1YJWP 3P7KA 2G3AA 5AVUB 5H2FE 1BSHA 1NTMJ 1N7SA 2YXQB 2JWDA 2GUVA 5APTA 1NYHA 1YJWW 4JPZB 1NTZG 1KQSV 1KILC 1X8YA 3P8CD 1SQQK 1ZRTE 1IO4A 2QJKC 1HF9A 3KZIH 4ZKUA 3HE4A 1DD4A 3G4SW 3MTUE 4PD4H 5GTHH 1R5SA 3RK2D 2IBZD 4GOEA 1GK6A 5DM6W 1L0NG 4JBZA 1VQ4P 2V7QJ 1ZOYC 4ZKPA 1LT9A 2WSFH 4D6TG 1NU1K 1E79H 1YTZI 4OVNF 2E75B 5CBNA 3HRNA 2WITA 3D6ZA 5TISH 2KZJA 2FKWB 3VP8A 3V2QA 1LP1A 1YI2P 3H1HD 4IOIH 4U3FJ 3SWYA 2IYOA 3PJSK 1K9MQ 3CCEP 3ZG5A 3Q5RA 2N1TB 4WY4A 3O8ZA 3M9BA 2IBZI 3CCUP 3H1LG 3KYQA 1EDLA 1Q7YQ 1OVVA 4WVZA 3FX0A 2O1JA 2OTJP 3RK3B 2P1JA 3F89A 4WWIA 3GQ0A 2WTYA 2JEEA 1VQPW 3HE5A 5APUA 2FFDC 5TJHA 2BCCE 4OGQC 3ABVC 4EIJA 2POHA 3L73J 1NTZJ 1JJ2V 2ZYAA 2XU6A 2XNDH 1JTHA 1K8AQ 3C9IA 1JMBA 1FDOA 4YXDC 1L2PA 5AW2B 1YIJW 2N1TC 4BRYB 4PJ0E 3CC7P 3HD7A 2KB7P 2KNCA 3SFEC 1PP9J 4PV1D 3H6PA 1PPJG 1PP9D 2AEJA 3BASA 1IFDA 2BASA 2E75C 1VQLP 2QG4A 4BL3A 3PHLA 3N7NA 1RF1A 2D2CC 1LZWA 3H1HE 2OYHC 1HGZA 3P8MC 2KZIA 3GMAA 1QEXA 1P84H 4D6TD 2K9JA 5JVGW 3TGUD 2RN0A 1BCCG 4D6TJ 4IOCW 4D6TE 4WFAW 3QH9A 1AQTA 3AE1C 1FZFA 4GOFA 1LP1B 1KQLA 2YKPA 2E74D 2Z5IA 1BE3J 2IBZG 3I56P 3PP5A 4K35A 2QEXP 4TLFA 1CW5A 1GL2C 5HL7W 3IR9A 1Q81Q 4WBAA 2XDJA 1NTZK 5KJ7A 3EFGA 3Q2YA 3L37A 3II6A 1CSBA 2Y0DA 3VMYA 1HJ0A 2K1AA 3FXDA 1QGKB 2N1TA 3BCCG 1WMKA 3CCJP 3E1RA 2P2UA 1L0NK 5CCHC 2QJYC 2I1KA 2IZ0A 1BCCE 2W90A 1SQQE 2GA1A 4L73A 2PP6A 3KPEA 5AW0B 3V2RA 3WU2H 4I2LC 3CCEW 3L72E 2Y9ZA 1KILB 1K73X 2WA8A 2FYUD 2Q3IA 2OTLW 3V6IA 1LTBC 2Q9IA 1LT9B 2HG5D 1JY3P 2OGUA 3CXHH 1OIPA 3VP9A 3JCUE 3L74E 1R5LA 4PD4I 3U59A 3L4FA 1G1JA 1KFMA 2C0WA 1PV3A 2WQYC 2L91A 2KIKA 3L71J 1VQOP 4IFFA 5AVRB 5KAFE 4WFBW 1VQLW 2XNXA 5KLIB 1FJPA 1YJ9P 1JEKA 1NTZD 1SQVK 2WSCH 3CCLW 1Q90D 5AW4B 4KHXA 3C8VA 1U57A 1BE3D 3D70A 2KYVA 1YI2W 1LWUC 3D6YA 1T3JA 2BCCD 1VDFA 3T97B 1Q82Q 1Q2NA 3USSA 2XV5A 3N4XA 2Y0EA 3VMAA 5CCHA 3RL0B 1KC8X 2R3SA 3G4SP 1GL2B 2FY8A 3HUSC 3CCQW 1OVUA 3L70E 1FE6A 3SWKA 1M56D 3M06A 1AFOA 3TGUE 1YITP 4WB4A 3V4WA 4DJGA 1MWSA 1EQ7A 1ZXGA 1SFCD 1SS1A 1Q81X 5GW7A 3CMEP 1PIXA 2QVAA 3KQGA 2E75D 4L76A 1VQNP 1J1EB 3AEAC 2ZXEB 2B87B 4PJ0H 2A06D 2B89A 1L0LK 1MV8A 4YXWH 3CPWV 1NKZB 4YJMA 1YJ9W 1T2KD 1JUNA 1KYOD 2W27A 2YO3A 1KTMA 2K9JB 1S1CX 3CX5D 1VF5D 1CTFA 3C1LA 1MFTA 5GTIE 4PV1C 3CL3D 4OH8B 2M0BA 1OW7A 3GQ1A 3V2PA 3W68A 1SQVE 1N86A 4IL6H 2YIUC 3SSUA 3G71W 3BCCJ 2W9RA 1JB0J 3AE9C 1FAVA 5L8RJ 5KJ7D 2QM7A 1Y47A 1RQUA 3CD6P 4GKGA 4EYYQ 1SQPK 1OZHA 1OX3A 3A3YB 2JDIH 1W2BO 1VQMP 1FU1A 1NAFA 1MWRA 3GHGB 3AEFC 1H88A 2P58A 1QVFO 4KJMA 3B5NB 1SQQG 4JYCA 4Y28J 1NTKD 1DD3A 1IZNB 2QIWA 3H1JE 2HODA 1XTGB 3EQ2A 2KK7A 1X0TA 1ZW0A 5KJ7C 1ZLLA 1FOSE 4I6MC 3CC4W 1KMIZ 3CPWO 1GTWA 1M1JC 1E5WA 3WU2E 2ZT9C 2J58A 1NU1G 2ZXXA 1KB9I 2KLVA 1KORA 3CMAW 1VQ9W 1SQVG 1W2EA 1H89A 1X79B 1RE3C 2AEFA 3KHUA 1X22A 5AVQB 2O01J 4CPKA 3OJAB 3L70G 1P84E 2QEXW 1OWAA 1FBMA 3W7SA 3L72D 1KZUB 1FZCA 4C7RA 3CMAP 2C9NY 2OYOA 1SQPD 3O6QA 4GT1A 2HLOA 3BRVB 1SQQJ 1EZVD 2HR3A 5KKZC 3IF4A 1VF5B 4UB8E 1HJBA 1DEEG 5KLVJ 5AW6B 2YMYA 1YQ3C 5APQA 3Q5SA 1OVRA 2QSIA 3AE7C 1G2CB 2OYHA 3CCRW 3MUDC 5CA3A 2KS1A 3P32A 1LWUA 2R3CA 1K04A 1JMMA 1OW6A 3H1IE 3O6QB 1KQFB 2OYIC 3UIAA 1R6OC 2NPSB 1SFCB 2K3RA 1NHLA 2KOGA 2WPVB 1L0LG 3M0AA 4N3YB 3H1HJ 1ZP0C 1AQ5A 5KLIC 4I1LA 3B5ND 1VQMW 2WT7A 1W2BV 3PH0A 3RK3D 3G19A 2ZVOB 2HPCA 1HUCA 1HVVA 1GMJA 3CWBD 4JQ0D 1LTSC 3VMZA 1AVOA 1S9KD 3HUSB 1SFCA 3L70J 2IZ1A 1QX8A 3QWOC 2O01H 4H44B 5APYA 2WSCJ 1RF0C 3TGUJ 1N7SB 1SQPG 2YKQA 5AVVB 1LTJA 4LC1A 1EZVE 2KNCB 1MBXC 4NPDA 3TF5A 3VYIA 1LJ2A 1T2KC 1HGVA 2MJZA 3U1AA 2VRSA 1K05A 1VQKW 1RQSA 2Q5UA 3CWBG 2KI7B 4W80A 2J5UA 1RF1B 2QJYB 3LW5H 1SQXE 1P84I 1LTJC 1TU3F 1OMIA 2Q6QA 1URQB 3BVHA 4UY8Z 2OYHB 2C9LY 1GL2A 1L0NJ 3G71P 1VPCA 1L0ND 4U3FE 2WPSA 2ZAEB 4ASVA 2OQQA 2KXPB 5BU5A 2W8ZA 5KAFH 2M3BA 2M5AB 2HYNA 1GL2D 2AXTH 4BWNA 3L74D 3M9QA 3L74J 3AEEC 3RL0g 5GTHE 2FYNC 1CZQA 4HYTB 5CHXA 2WT7B 4U67W 3L74G 2GUSA 2H88C 1QVGO 5EFWB 1IFIA 2WWWA 3BCCE 3L35A 3RL0D 2Y9YA 3TYYA 3A7OA 1VQ4W 1S3JA 3GLMA 1JY3O 3NXSA 1JNMA 3MZWB 5AW9B 1JTHB 1SQXJ 1IFMA 2FFDA 1SQXG 2A45I 3H1LE 3V5BA 2E76D 3ZFZA 4HKZH 4Y99B 4BRYA 2KLUA 3HD7B 1SQVD 5AVXB 3CXHI 1SP4A 2V7QH 4UB6H 1BCCJ 1USEA 4NPFX 3CCMP 3S4RA 1IFPA 4EOTA 1MBVB 3CC2W 3PTZA 3CCVW 3M9HA 4ASWA 2FFDB 1RH5B 1YTZT 4KT0J 2Z4EA 2CPSA 5BU8B 1NTKJ 4PD4E 1WT6A 1URQC 3GHGC 2O01N 2N9BA 2D2CB 3AE5C 3L70D 1BGYJ 5KLVE 2XZRA 2HODB 3VTPC 4DZOA 4GDOA 3Q1MA 2FYUK 3H1ID 5KTBA 2KSEA 2OTLP 1NGMB 3I55W 1Q82X 3H32A 3I56W 1N2DC 1X9VA 3J7ZZ 1R6QC 1HWTC 3RBXA 4H44C 3W7WA 3CX5H 4YPCA 4DT0A 2Z5HA 2CK3H 3HTKA 4WCEW 1SQPJ 1KC8Q 1W5CE 2OTJW 2QJKB 3OW2O 1RE3A 5APXA 4IOAW 2WZ7A 3A2AA 1S9KE 2B9BA 1FZGA 3V4QA 3CC7W 5CMZA 3JC22 1GK4A 3O1FB 1N7SC 2FXPA 1KQSO 1SFCC 1N8RX 4DKIA 1RF0A 1IC2A 3F5HA 1GU4A 2ZVNB 1HH0A 4OGQD 1FOSF 3SWFA 1FZCC 1T3UA 3MD0A 3R4YA 2JKVA 3LIDA 1DX7A 1LT1A 3M91A 4ZMDA 2GM4A 1SQXK 1URQD 1U7JA 2G8YA 5KLVG 1FZBA 1Q7YX 1PGQA 1GZLA 3AECC 3H1KJ 2ZJRW 3B4SA 2HPCB 2W6JH 2OYIB 3H1LD 1SQVJ 1M8OB 2ZYDA 3Q3DA 2FYUJ 2N9YB 3G6EP 4XFJA 2FBWC 4WFNW 1BE3E 1L0LJ 1M1JA 4IFMA 3CMEW 2E76B 1VQ5W
chains in the Genus database with same CATH topology
1DD4A 3AEBC 3AEGC 2QSIA 2WA9A 3AE7C 3D71A 2WSFJ 1S5LX 1DIPA 3AEFC 4IL6X 3GF7A 1TU3F 3SFEC 5M1BA 1OMIA 2WA8A 4YKAA 4PV1D 1UIXA 4H13B 1K04A 1MBVB 2V7QJ 1OW6A 1ZOYC 1R8EA 1KQFB 4Y28J 1PL5A 2BEZF 1DD3A 4YTPC 3O1FA 1VL2A 2QIWA 3RL0g 2E75C 1R6OC 3G1BA 3AEDC 2IDBA 2JO1A 3O1FB 2JP3A 4R4MA 3RK3E 4PV1B 2FXPA 2WPVB 3AE3C 1EXIA 4KT0J 1RQVA 2E75B 3EWKA 2OQQA 1AJYA 2NZ2A 2D2CC 2ZT9B 3IAOA 1LZWA 3AE6C 3D6ZA 1OW8A 1ZP0C 4I7ZB 1EXJA 3GMAA 1KILE 5KLIC 1IK7A 2QJPC 1KQGB 2WSEJ 4H13D 1PIXA 1KMIZ 2E75D 3IN6A 1MG9A 4I7ZC 3AEAC 4OGQD 3Q5RA 4YJXA 2D2CB 2ZT9C 2K9YA 2YMKA 3AE1C 3H25A 3AE5C 4TT3H 3G19A 3O2OA 3AEEC 2E74D 2FYNC 1FDIA 4H0LB 4H0LC 1KORA 1PV3A 2WQYC 4R4LA 3GF3A 1GMJA 4RKUJ 2E74C 3G3PA 3R4YA 3AE2C 4GDOA 4Z1MH 4YJMA 4U7JA 3G9RA 1VF5C 2H88C 3Q1MA 2O01J 1KTMA 3O2HA 1YQ4C 3B71A 1MKMA 1S1CX 3FGAD 4H44B 1VF5D 1CTFA 2G8YA 2WSCJ 3Q2YA 3GLMA 1NGMB 2D2CD 3GW1A 2H89C 3O2BA 3AECC 3GQ0A 4PV1C 1HJ0A 1OW7A 1Q90D 2G3AA 3GQ1A 1Y9BA 1R6QC 1MBUC 4OGQC 4H44D 2ZT9D 1WMKA 3ABVC 3O6QA 3C8VA 1U57A 2YIUC 4H44C 4H13C 3D70A 1MBXC 2W9RA 1JB0J 1NYHA 3SFDC 3AE9C 2MKVA 3Q5SA 3Q5PA 1ZMEC 3Q3DA 5L8RJ 2E76D 3D6YA 3S9OA 5KKZC 1VF5B 3DNJA 2QJYC 4OGQB 3T97B 1RQUA 1ZRTE 4XFJA 3AE4C 2BEQD 1K05A 2E76C 2FBWC 2P10A 2QJKC 1HF9A 1RQSA 3AE8C 2E74B 4H0LD 1FDOA 1YQ3C 3LW5J 4YXDC 2J5UA 2E76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD4 A;  1RQV A;  1MBU C;  4YJM A;  1LZW A;  2WA9 A;  1MBX C;  2W9R A;  3O2H A;  2WA8 A;  4YKA A;  1MBV B;  1MG9 A;  1CTF A;  3DNJ A;  1RQU A;  4YJX A;  1DD3 A;  3G19 A;  3O1F A;  3GW1 A;  1R6O C;  1RQS A;  3G1B A;  3O2B A;  3GQ0 A;  3O1F B;  3O2O A;  3GQ1 A;  3G3P A;  1R6Q C; 
#chains in the Genus database with same CATH topology
 2WA9 A;  3D71 A;  1JY2 O;  1Y8A A;  3TNU A;  2QE7 H;  1YIT W;  4IL6 X;  2ZFC A;  2V4H A;  2YXR B;  1VQQ A;  1BDC A;  1J1D C;  5CCG C;  3EFF K;  1R8E A;  1NTK K;  4YTP C;  2YO2 A;  4RES B;  5GAE a;  2XKM A;  1LT9 C;  3NMD A;  3B8E B;  4OWF A;  1A02 J;  1M1K X;  1KIL D;  3MIW A;  1BSN A;  3A0H H;  4AQR D;  4EDF A;  3K5B A;  1HTL C;  3NTN A;  4I7Z C;  3G3Z A;  4PD4 D;  1QVG V;  4UB8 H;  1FZC B;  1BDD A;  3W67 A;  3A0B H;  1NO4 A;  2NPS C;  2R5B A;  4U7J A;  2IFM A;  1CI6 A;  5GAG a;  3JCU H;  1N73 B;  3WUT A;  1VQN W;  2BCC J;  1BE3 G;  4W7Z A;  1LTT C;  4BXL A;  1VQO W;  1Y9B A;  2Y0C A;  3L72 G;  1PP9 G;  2C0X A;  5H2F H;  3CCR P;  1L4A A;  1PPJ D;  2WSE H;  2AXC A;  1XTC C;  1NAY A;  3SFD C;  1QL2 A;  5KAI H;  3S9O A;  3CF5 W;  1JY2 P;  3L71 E;  4OGQ B;  2BEQ D;  2W83 C;  3AE8 C;  1JM0 A;  1VQ7 P;  1KFN A;  4ZNC A;  1L4A D;  2WSF J;  3H1K E;  4C46 A;  1BXY A;  2W6A A;  4XE5 B;  1SVF A;  2KSJ A;  3WUV A;  1N8R Q;  1MFZ A;  3M0D A;  1KYO E;  5AVT B;  2A06 E;  3AED C;  2JO1 A;  4WY4 D;  2KP8 A;  2KUB A;  1EXI A;  1RQV A;  3IAO A;  2WVR A;  3VOP A;  1M1J B;  2JR8 A;  4WY4 C;  4H13 D;  2FXM A;  1OXZ A;  1A02 F;  1NVO A;  1LTI C;  2O3J A;  3H1J D;  3L71 G;  1G1I A;  2IX7 C;  1NU1 D;  3KZI E;  1S4X A;  3H1H G;  3G9R A;  1M1K Q;  2YNY A;  3B5N C;  4AUW A;  1LWU B;  1YHQ W;  1U7M A;  2ZJQ W;  5AW1 B;  3CCJ W;  2NPS A;  2H89 C;  1MWT A;  4W7Y A;  1BCC D;  4O9B A;  3TGU G;  1NTM G;  3RK3 C;  3L75 E;  1L0L D;  3HD7 D;  3RL0 C;  3P8C E;  1URQ A;  3ZG0 A;  1MUU A;  1SQP E;  1NJI X;  3CD6 W;  1WRG A;  5DJT B;  1M90 X;  3AE4 C;  3L72 J;  3PIO W;  3RK2 B;  2LKM A;  4JF7 A;  3HD7 C;  3KXD A;  3H32 B;  5M19 A;  3LIE A;  3L73 G;  2FYN B;  1RE4 A;  3HE4 B;  3TSI A;  3CCS P;  3GF7 A;  1LGH B;  1AVY A;  1UIX A;  2OTK E;  3CWB E;  1J2J B;  4N6J A;  5KAI E;  1YJN W;  1PL5 A;  4GOD A;  2E5T A;  1Q86 X;  2IDB A;  1GDT A;  1KB9 E;  4K3A A;  3EWK A;  1SQB J;  1FDM A;  3AE6 C;  1EXJ A;  2QA4 W;  2ITA A;  3JSV C;  3MP7 B;  1JOC A;  1KIL E;  1H0T B;  1BGY E;  1IK7 A;  2QJP C;  1KQG B;  3CCM W;  1S5L E;  1YIJ P;  1USD A;  1NOH A;  4TT3 H;  4HH2 A;  1SLQ A;  4R4L A;  1JCD A;  4XA4 A;  1NTK E;  2ZYG A;  1PP9 E;  3FWN A;  1SQB E;  2O1K A;  3W7U A;  2N1T D;  2Q1K A;  4EI2 A;  1NWQ A;  4MN4 C;  3VMX A;  1DH3 A;  1FJK A;  3O2H A;  1T8Z A;  4LGD E;  1CI6 B;  3CWB J;  3CXH D;  4N78 D;  1JY3 N;  1KYO H;  3IFM A;  3GW1 A;  3CCS W;  2E42 A;  1GU5 A;  5GAH a;  4M3L A;  5JVH W;  5M1A A;  2P67 A;  5APV A;  1S2E A;  2R32 A;  2B87 A;  2ZT9 D;  4H44 D;  5AVY B;  3L73 E;  3L75 J;  2E43 A;  2FYU G;  3GW6 A;  4IO9 W;  1GW4 A;  2M5A A;  3L75 D;  3L71 D;  2WPR A;  4BL2 A;  3L73 D;  4RJT A;  5AW8 B;  1RHZ B;  3NFQ A;  3DNJ A;  3D3I A;  2P10 A;  1G2C A;  3OW2 V;  1GD2 E;  4H0L D;  1VQ6 W;  1NTZ E;  3MUD A;  3L36 A;  1AA0 A;  2LXB A;  1YYC A;  3CCV P;  1M90 Q;  1DIP A;  2P7J A;  3CXH E;  4N78 E;  1UII A;  1NTM D;  5E79 H;  4CPG A;  1YBK A;  1K8A X;  1M7L A;  4B86 A;  1VL2 A;  4WF9 W;  5AVW B;  1VQ7 W;  4R4M A;  3BRT B;  3H1J J;  3HUS A;  3CC4 P;  1NU1 J;  3AE3 C;  3H1K G;  3PIP W;  2RKL A;  3BAT A;  3TNU B;  1FZE A;  1KD1 X;  3CI9 A;  3GHG A;  3DLL W;  3E7K A;  2YMK A;  3MHV A;  5AVS B;  1L0N E;  2M3E A;  4C7N A;  3O2O A;  2IYP A;  2H8P D;  4UB6 E;  5APS A;  1AV1 A;  4RKU J;  3RK2 C;  1IJD B;  1KYO I;  1HBW A;  2LR2 A;  3GG2 A;  1VF5 C;  4CJN A;  2I1J A;  1SQB K;  2PGD A;  2BCC G;  2AXT E;  3CX5 I;  1YQ4 C;  3A0H E;  1NTM E;  1FZA A;  1LTJ B;  3CCU W;  3FGA D;  2FYZ A;  5B5E H;  2QM8 A;  2ZJS E;  1RF1 C;  1M57 D;  1ZRT D;  4DOJ A;  3A5T A;  1Z56 A;  1FC2 C;  1SQQ D;  3CCQ P;  1T6A A;  2M8R A;  1VQ6 P;  5CCG A;  3Q5P A;  3V2N A;  5KLV K;  4QMA A;  5DM7 W;  3E1I A;  1QLE D;  2E74 B;  3LW5 J;  1EC5 A;  1NH4 A;  2LXC B;  2IFN A;  3CX5 E;  5M1B A;  1SQB D;  4L75 A;  3BCC D;  2WSS H;  3O1F A;  3T97 A;  3G1B A;  1VQK P;  5K5G B;  3RK3 E;  2H43 A;  1LNQ A;  5CBO A;  1OW8 A;  1K73 Q;  1IK9 A;  1EDI A;  2WSE J;  3G6E W;  1NTK G;  1N7L A;  3H1J G;  5E79 E;  1VQ8 P;  4A7P A;  3H25 A;  5CJ0 A;  5DJU B;  5AW7 B;  4H0L C;  3OAK A;  3G3P A;  1ZN5 A;  3OA7 A;  1EZV I;  1D7M A;  1BGY G;  1IFJ A;  2PRR A;  2FYU E;  3CXC V;  1N7S D;  2IBZ E;  1S5L H;  1EDK A;  5M18 A;  2YIU B;  4JYB A;  3H1K D;  3VN0 A;  5GTI H;  5B66 H;  3O2B A;  1MZ9 A;  1NKN A;  2L5G B;  3WUU A;  1KB9 H;  1MBU C;  4Y99 C;  5C39 A;  3RGU A;  5KKZ B;  4DCK A;  1L0L E;  3CCL P;  3TDK A;  1N73 C;  3H1I J;  1ZME C;  3H1I G;  2R5D A;  1L4A C;  1PPJ E;  1VQ9 P;  2J59 M;  3W7T A;  2ZJP W;  3PLN A;  5BVZ A;  3AEB C;  2NRG A;  3WMM 0;  1S72 P;  2A06 G;  2YKO A;  1GW3 A;  1NU1 E;  2HFE D;  1S72 W;  5KLV D;  2KS1 B;  4PV1 B;  3HE5 B;  1KD1 Q;  2OYI A;  3MGN A;  1MWU A;  1AJY A;  2NZ2 A;  2ZT9 B;  1PGJ A;  5AVZ B;  2H7H A;  1SQB G;  4WY4 B;  4NPE A;  3ZDM A;  2RMZ A;  1H0T A;  1EDJ A;  1JCC A;  3IN6 A;  5CJ4 A;  4HJG H;  4YJX A;  1QL1 A;  2NPS D;  5AW3 B;  1FDI A;  3L75 G;  4H0L B;  1LTA C;  3GF3 A;  2A45 H;  2E74 C;  4U3F D;  2JWA A;  3A0B E;  1N73 A;  2PFX A;  1YHQ P;  2WMM A;  3B71 A;  3FWL A;  3I55 P;  2QA4 P;  2D2C D;  2A45 G;  1KN7 A;  1ZR2 A;  1SQX D;  2OAR A;  1RE4 C;  3W7X A;  2FXO A;  1RY3 A;  4HB1 A;  4RO0 A;  5GAD a;  1H8A A;  1QVF V;  2IPP A;  3HTK B;  4U3F G;  2UWJ E;  1ZR4 A;  4H13 C;  2R44 A;  2MKV A;  1PZQ A;  3R2P A;  2E76 C;  2K37 A;  3TK1 A;  1NTM K;  1EZV G;  1P84 D;  3AEG C;  1VQ8 W;  2B88 A;  2QRX A;  2I8D A;  4IFD K;  1S5L X;  3CLQ A;  5CCG D;  3FXE A;  1LTG C;  4YKA A;  4H13 B;  4AYC A;  1NJI Q;  1PGP A;  2SPZ A;  3B5N A;  2BEZ F;  1PGO A;  1FS0 E;  2E5Y A;  3ITK A;  3M0D C;  3S1K A;  4IL6 E;  2JP3 A;  5B5E E;  3CC2 P;  1K9M X;  1VQP P;  2AEM A;  5CCH D;  1J1E C;  4I7Z B;  2QJP B;  4L74 A;  2CPB A;  4LLH A;  2PAJ A;  2RH0 A;  1ZV8 A;  1MG9 A;  1BGY D;  1KB9 D;  1YJN P;  2K9Y A;  1Q86 Q;  2K88 A;  2JJL A;  1PFI A;  4C7N B;  1JY2 N;  1L4A B;  1DEB A;  3AE2 C;  4Z1M H;  3RBZ A;  1KV4 A;  1KIL A;  3I5C A;  4GIF A;  3H1L J;  5TIS E;  5APW A;  1JO5 A;  1J1D B;  2W6B A;  3KDP B;  1VQ5 P;  5AW5 B;  1MKM A;  3PRJ A;  2DW3 A;  2Q7C A;  2WPQ A;  2Q3E A;  3U1C A;  1OFC X;  1IFN A;  5B66 E;  1YJW P;  3P7K A;  2G3A A;  5AVU B;  5H2F E;  1BSH A;  1NTM J;  1N7S A;  2YXQ B;  2JWD A;  2GUV A;  5APT A;  1NYH A;  1YJW W;  4JPZ B;  1NTZ G;  1KQS V;  1KIL C;  1X8Y A;  3P8C D;  1SQQ K;  1ZRT E;  1IO4 A;  2QJK C;  1HF9 A;  3KZI H;  4ZKU A;  3HE4 A;  1DD4 A;  3G4S W;  3MTU E;  4PD4 H;  5GTH H;  1R5S A;  3RK2 D;  2IBZ D;  4GOE A;  1GK6 A;  5DM6 W;  1L0N G;  4JBZ A;  1VQ4 P;  2V7Q J;  1ZOY C;  4ZKP A;  1LT9 A;  2WSF H;  4D6T G;  1NU1 K;  1E79 H;  1YTZ I;  4OVN F;  2E75 B;  5CBN A;  3HRN A;  2WIT A;  3D6Z A;  5TIS H;  2KZJ A;  2FKW B;  3VP8 A;  3V2Q A;  1LP1 A;  1YI2 P;  3H1H D;  4IOI H;  4U3F J;  3SWY A;  2IYO A;  3PJS K;  1K9M Q;  3CCE P;  3ZG5 A;  3Q5R A;  2N1T B;  4WY4 A;  3O8Z A;  3M9B A;  2IBZ I;  3CCU P;  3H1L G;  3KYQ A;  1EDL A;  1Q7Y Q;  1OVV A;  4WVZ A;  3FX0 A;  2O1J A;  2OTJ P;  3RK3 B;  2P1J A;  3F89 A;  4WWI A;  3GQ0 A;  2WTY A;  2JEE A;  1VQP W;  3HE5 A;  5APU A;  2FFD C;  5TJH A;  2BCC E;  4OGQ C;  3ABV C;  4EIJ A;  2POH A;  3L73 J;  1NTZ J;  1JJ2 V;  2ZYA A;  2XU6 A;  2XND H;  1JTH A;  1K8A Q;  3C9I A;  1JMB A;  1FDO A;  4YXD C;  1L2P A;  5AW2 B;  1YIJ W;  2N1T C;  4BRY B;  4PJ0 E;  3CC7 P;  3HD7 A;  2KB7 P;  2KNC A;  3SFE C;  1PP9 J;  4PV1 D;  3H6P A;  1PPJ G;  1PP9 D;  2AEJ A;  3BAS A;  1IFD A;  2BAS A;  2E75 C;  1VQL P;  2QG4 A;  4BL3 A;  3PHL A;  3N7N A;  1RF1 A;  2D2C C;  1LZW A;  3H1H E;  2OYH C;  1HGZ A;  3P8M C;  2KZI A;  3GMA A;  1QEX A;  1P84 H;  4D6T D;  2K9J A;  5JVG W;  3TGU D;  2RN0 A;  1BCC G;  4D6T J;  4IOC W;  4D6T E;  4WFA W;  3QH9 A;  1AQT A;  3AE1 C;  1FZF A;  4GOF A;  1LP1 B;  1KQL A;  2YKP A;  2E74 D;  2Z5I A;  1BE3 J;  2IBZ G;  3I56 P;  3PP5 A;  4K35 A;  2QEX P;  4TLF A;  1CW5 A;  1GL2 C;  5HL7 W;  3IR9 A;  1Q81 Q;  4WBA A;  2XDJ A;  1NTZ K;  5KJ7 A;  3EFG A;  3Q2Y A;  3L37 A;  3II6 A;  1CSB A;  2Y0D A;  3VMY A;  1HJ0 A;  2K1A A;  3FXD A;  1QGK B;  2N1T A;  3BCC G;  1WMK A;  3CCJ P;  3E1R A;  2P2U A;  1L0N K;  5CCH C;  2QJY C;  2I1K A;  2IZ0 A;  1BCC E;  2W90 A;  1SQQ E;  2GA1 A;  4L73 A;  2PP6 A;  3KPE A;  5AW0 B;  3V2R A;  3WU2 H;  4I2L C;  3CCE W;  3L72 E;  2Y9Z A;  1KIL B;  1K73 X;  2WA8 A;  2FYU D;  2Q3I A;  2OTL W;  3V6I A;  1LTB C;  2Q9I A;  1LT9 B;  2HG5 D;  1JY3 P;  2OGU A;  3CXH H;  1OIP A;  3VP9 A;  3JCU E;  3L74 E;  1R5L A;  4PD4 I;  3U59 A;  3L4F A;  1G1J A;  1KFM A;  2C0W A;  1PV3 A;  2WQY C;  2L91 A;  2KIK A;  3L71 J;  1VQO P;  4IFF A;  5AVR B;  5KAF E;  4WFB W;  1VQL W;  2XNX A;  5KLI B;  1FJP A;  1YJ9 P;  1JEK A;  1NTZ D;  1SQV K;  2WSC H;  3CCL W;  1Q90 D;  5AW4 B;  4KHX A;  3C8V A;  1U57 A;  1BE3 D;  3D70 A;  2KYV A;  1YI2 W;  1LWU C;  3D6Y A;  1T3J A;  2BCC D;  1VDF A;  3T97 B;  1Q82 Q;  1Q2N A;  3USS A;  2XV5 A;  3N4X A;  2Y0E A;  3VMA A;  5CCH A;  3RL0 B;  1KC8 X;  2R3S A;  3G4S P;  1GL2 B;  2FY8 A;  3HUS C;  3CCQ W;  1OVU A;  3L70 E;  1FE6 A;  3SWK A;  1M56 D;  3M06 A;  1AFO A;  3TGU E;  1YIT P;  4WB4 A;  3V4W A;  4DJG A;  1MWS A;  1EQ7 A;  1ZXG A;  1SFC D;  1SS1 A;  1Q81 X;  5GW7 A;  3CME P;  1PIX A;  2QVA A;  3KQG A;  2E75 D;  4L76 A;  1VQN P;  1J1E B;  3AEA C;  2ZXE B;  2B87 B;  4PJ0 H;  2A06 D;  2B89 A;  1L0L K;  1MV8 A;  4YXW H;  3CPW V;  1NKZ B;  4YJM A;  1YJ9 W;  1T2K D;  1JUN A;  1KYO D;  2W27 A;  2YO3 A;  1KTM A;  2K9J B;  1S1C X;  3CX5 D;  1VF5 D;  1CTF A;  3C1L A;  1MFT A;  5GTI E;  4PV1 C;  3CL3 D;  4OH8 B;  2M0B A;  1OW7 A;  3GQ1 A;  3V2P A;  3W68 A;  1SQV E;  1N86 A;  4IL6 H;  2YIU C;  3SSU A;  3G71 W;  3BCC J;  2W9R A;  1JB0 J;  3AE9 C;  1FAV A;  5L8R J;  5KJ7 D;  2QM7 A;  1Y47 A;  1RQU A;  3CD6 P;  4GKG A;  4EYY Q;  1SQP K;  1OZH A;  1OX3 A;  3A3Y B;  2JDI H;  1W2B O;  1VQM P;  1FU1 A;  1NAF A;  1MWR A;  3GHG B;  3AEF C;  1H88 A;  2P58 A;  1QVF O;  4KJM A;  3B5N B;  1SQQ G;  4JYC A;  4Y28 J;  1NTK D;  1DD3 A;  1IZN B;  2QIW A;  3H1J E;  2HOD A;  1XTG B;  3EQ2 A;  2KK7 A;  1X0T A;  1ZW0 A;  5KJ7 C;  1ZLL A;  1FOS E;  4I6M C;  3CC4 W;  1KMI Z;  3CPW O;  1GTW A;  1M1J C;  1E5W A;  3WU2 E;  2ZT9 C;  2J58 A;  1NU1 G;  2ZXX A;  1KB9 I;  2KLV A;  1KOR A;  3CMA W;  1VQ9 W;  1SQV G;  1W2E A;  1H89 A;  1X79 B;  1RE3 C;  2AEF A;  3KHU A;  1X22 A;  5AVQ B;  2O01 J;  4CPK A;  3OJA B;  3L70 G;  1P84 E;  2QEX W;  1OWA A;  1FBM A;  3W7S A;  3L72 D;  1KZU B;  1FZC A;  4C7R A;  3CMA P;  2C9N Y;  2OYO A;  1SQP D;  3O6Q A;  4GT1 A;  2HLO A;  3BRV B;  1SQQ J;  1EZV D;  2HR3 A;  5KKZ C;  3IF4 A;  1VF5 B;  4UB8 E;  1HJB A;  1DEE G;  5KLV J;  5AW6 B;  2YMY A;  1YQ3 C;  5APQ A;  3Q5S A;  1OVR A;  2QSI A;  3AE7 C;  1G2C B;  2OYH A;  3CCR W;  3MUD C;  5CA3 A;  2KS1 A;  3P32 A;  1LWU A;  2R3C A;  1K04 A;  1JMM A;  1OW6 A;  3H1I E;  3O6Q B;  1KQF B;  2OYI C;  3UIA A;  1R6O C;  2NPS B;  1SFC B;  2K3R A;  1NHL A;  2KOG A;  2WPV B;  1L0L G;  3M0A A;  4N3Y B;  3H1H J;  1ZP0 C;  1AQ5 A;  5KLI C;  4I1L A;  3B5N D;  1VQM W;  2WT7 A;  1W2B V;  3PH0 A;  3RK3 D;  3G19 A;  2ZVO B;  2HPC A;  1HUC A;  1HVV A;  1GMJ A;  3CWB D;  4JQ0 D;  1LTS C;  3VMZ A;  1AVO A;  1S9K D;  3HUS B;  1SFC A;  3L70 J;  2IZ1 A;  1QX8 A;  3QWO C;  2O01 H;  4H44 B;  5APY A;  2WSC J;  1RF0 C;  3TGU J;  1N7S B;  1SQP G;  2YKQ A;  5AVV B;  1LTJ A;  4LC1 A;  1EZV E;  2KNC B;  1MBX C;  4NPD A;  3TF5 A;  3VYI A;  1LJ2 A;  1T2K C;  1HGV A;  2MJZ A;  3U1A A;  2VRS A;  1K05 A;  1VQK W;  1RQS A;  2Q5U A;  3CWB G;  2KI7 B;  4W80 A;  2J5U A;  1RF1 B;  2QJY B;  3LW5 H;  1SQX E;  1P84 I;  1LTJ C;  1TU3 F;  1OMI A;  2Q6Q A;  1URQ B;  3BVH A;  4UY8 Z;  2OYH B;  2C9L Y;  1GL2 A;  1L0N J;  3G71 P;  1VPC A;  1L0N D;  4U3F E;  2WPS A;  2ZAE B;  4ASV A;  2OQQ A;  2KXP B;  5BU5 A;  2W8Z A;  5KAF H;  2M3B A;  2M5A B;  2HYN A;  1GL2 D;  2AXT H;  4BWN A;  3L74 D;  3M9Q A;  3L74 J;  3AEE C;  3RL0 g;  5GTH E;  2FYN C;  1CZQ A;  4HYT B;  5CHX A;  2WT7 B;  4U67 W;  3L74 G;  2GUS A;  2H88 C;  1QVG O;  5EFW B;  1IFI A;  2WWW A;  3BCC E;  3L35 A;  3RL0 D;  2Y9Y A;  3TYY A;  3A7O A;  1VQ4 W;  1S3J A;  3GLM A;  1JY3 O;  3NXS A;  1JNM A;  3MZW B;  5AW9 B;  1JTH B;  1SQX J;  1IFM A;  2FFD A;  1SQX G;  2A45 I;  3H1L E;  3V5B A;  2E76 D;  3ZFZ A;  4HKZ H;  4Y99 B;  4BRY A;  2KLU A;  3HD7 B;  1SQV D;  5AVX B;  3CXH I;  1SP4 A;  2V7Q H;  4UB6 H;  1BCC J;  1USE A;  4NPF X;  3CCM P;  3S4R A;  1IFP A;  4EOT A;  1MBV B;  3CC2 W;  3PTZ A;  3CCV W;  3M9H A;  4ASW A;  2FFD B;  1RH5 B;  1YTZ T;  4KT0 J;  2Z4E A;  2CPS A;  5BU8 B;  1NTK J;  4PD4 E;  1WT6 A;  1URQ C;  3GHG C;  2O01 N;  2N9B A;  2D2C B;  3AE5 C;  3L70 D;  1BGY J;  5KLV E;  2XZR A;  2HOD B;  3VTP C;  4DZO A;  4GDO A;  3Q1M A;  2FYU K;  3H1I D;  5KTB A;  2KSE A;  2OTL P;  1NGM B;  3I55 W;  1Q82 X;  3H32 A;  3I56 W;  1N2D C;  1X9V A;  3J7Z Z;  1R6Q C;  1HWT C;  3RBX A;  4H44 C;  3W7W A;  3CX5 H;  4YPC A;  4DT0 A;  2Z5H A;  2CK3 H;  3HTK A;  4WCE W;  1SQP J;  1KC8 Q;  1W5C E;  2OTJ W;  2QJK B;  3OW2 O;  1RE3 A;  5APX A;  4IOA W;  2WZ7 A;  3A2A A;  1S9K E;  2B9B A;  1FZG A;  3V4Q A;  3CC7 W;  5CMZ A;  3JC2 2;  1GK4 A;  3O1F B;  1N7S C;  2FXP A;  1KQS O;  1SFC C;  1N8R X;  4DKI A;  1RF0 A;  1IC2 A;  3F5H A;  1GU4 A;  2ZVN B;  1HH0 A;  4OGQ D;  1FOS F;  3SWF A;  1FZC C;  1T3U A;  3MD0 A;  3R4Y A;  2JKV A;  3LID A;  1DX7 A;  1LT1 A;  3M91 A;  4ZMD A;  2GM4 A;  1SQX K;  1URQ D;  1U7J A;  2G8Y A;  5KLV G;  1FZB A;  1Q7Y X;  1PGQ A;  1GZL A;  3AEC C;  3H1K J;  2ZJR W;  3B4S A;  2HPC B;  2W6J H;  2OYI B;  3H1L D;  1SQV J;  1M8O B;  2ZYD A;  3Q3D A;  2FYU J;  2N9Y B;  3G6E P;  4XFJ A;  2FBW C;  4WFN W;  1BE3 E;  1L0L J;  1M1J A;  4IFM A;  3CME W;  2E76 B;  1VQ5 W; 
#chains in the Genus database with same CATH homology
 1DD4 A;  3AEB C;  3AEG C;  2QSI A;  2WA9 A;  3AE7 C;  3D71 A;  2WSF J;  1S5L X;  1DIP A;  3AEF C;  4IL6 X;  3GF7 A;  1TU3 F;  3SFE C;  5M1B A;  1OMI A;  2WA8 A;  4YKA A;  4PV1 D;  1UIX A;  4H13 B;  1K04 A;  1MBV B;  2V7Q J;  1OW6 A;  1ZOY C;  1R8E A;  1KQF B;  4Y28 J;  1PL5 A;  2BEZ F;  1DD3 A;  4YTP C;  3O1F A;  1VL2 A;  2QIW A;  3RL0 g;  2E75 C;  1R6O C;  3G1B A;  3AED C;  2IDB A;  2JO1 A;  3O1F B;  2JP3 A;  4R4M A;  3RK3 E;  4PV1 B;  2FXP A;  2WPV B;  3AE3 C;  1EXI A;  4KT0 J;  1RQV A;  2E75 B;  3EWK A;  2OQQ A;  1AJY A;  2NZ2 A;  2D2C C;  2ZT9 B;  3IAO A;  1LZW A;  3AE6 C;  3D6Z A;  1OW8 A;  1ZP0 C;  4I7Z B;  1EXJ A;  3GMA A;  1KIL E;  5KLI C;  1IK7 A;  2QJP C;  1KQG B;  2WSE J;  4H13 D;  1PIX A;  1KMI Z;  2E75 D;  3IN6 A;  1MG9 A;  4I7Z C;  3AEA C;  4OGQ D;  3Q5R A;  4YJX A;  2D2C B;  2ZT9 C;  2K9Y A;  2YMK A;  3AE1 C;  3H25 A;  3AE5 C;  4TT3 H;  3G19 A;  3O2O A;  3AEE C;  2E74 D;  2FYN C;  1FDI A;  4H0L B;  4H0L C;  1KOR A;  1PV3 A;  2WQY C;  4R4L A;  3GF3 A;  1GMJ A;  4RKU J;  2E74 C;  3G3P A;  3R4Y A;  3AE2 C;  4GDO A;  4Z1M H;  4YJM A;  4U7J A;  3G9R A;  1VF5 C;  2H88 C;  3Q1M A;  2O01 J;  1KTM A;  3O2H A;  1YQ4 C;  3B71 A;  1MKM A;  1S1C X;  3FGA D;  4H44 B;  1VF5 D;  1CTF A;  2G8Y A;  2WSC J;  3Q2Y A;  3GLM A;  1NGM B;  2D2C D;  3GW1 A;  2H89 C;  3O2B A;  3AEC C;  3GQ0 A;  4PV1 C;  1HJ0 A;  1OW7 A;  1Q90 D;  2G3A A;  3GQ1 A;  1Y9B A;  1R6Q C;  1MBU C;  4OGQ C;  4H44 D;  2ZT9 D;  1WMK A;  3ABV C;  3O6Q A;  3C8V A;  1U57 A;  2YIU C;  4H44 C;  4H13 C;  3D70 A;  1MBX C;  2W9R A;  1JB0 J;  1NYH A;  3SFD C;  3AE9 C;  2MKV A;  3Q5S A;  3Q5P A;  1ZME C;  3Q3D A;  5L8R J;  2E76 D;  3D6Y A;  3S9O A;  5KKZ C;  1VF5 B;  3DNJ A;  2QJY C;  4OGQ B;  3T97 B;  1RQU A;  1ZRT E;  4XFJ A;  3AE4 C;  2BEQ D;  1K05 A;  2E76 C;  2FBW C;  2P10 A;  2QJK C;  1HF9 A;  1RQS A;  3AE8 C;  2E74 B;  4H0L D;  1FDO A;  1YQ3 C;  3LW5 J;  4YXD C;  2J5U A;  2E76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...