1DD3A

Crystal structure of ribosomal protein l12 from thermotoga maritima
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKLEEAGAEVELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L7/L12
publication title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1dd3A01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1dd3A02
4YKAA 1R6QC 1MG9A 1DD4A 1MBUC 1DD3A 1CTFA 1RQUA 1R6OC 3O2OA 3GQ0A 1RQSA 3O2BA 2W9RA 3O1FA 2WA8A 2WA9A 3G3PA 3GQ1A 3O2HA 3GW1A 4YJMA 3O1FB 3G19A 3G1BA 1MBVB 4YJXA 1RQVA 1LZWA 3DNJA 1MBXC
chains in the Genus database with same CATH superfamily
1JNMA 5KLVE 3CWBE 2W6AA 1DH3A 3HTKA 3H1LD 2LXBA 5KLVK 4WF9W 1J1EC 1WMKA 4RJTA 2WA8A 1KMIZ 5GADa 1VQKP 3SSUA 4JF7A 2HPCB 2E75C 3H6PA 1YJWW 3C9IA 1SFCD 4H0LB 3L71G 2O01J 1HF9A 1KFMA 1S5LH 3H1IG 1NH4A 3AEDC 4XE5B 3H1HD 2YKQA 1PPJD 3H1LJ 1FDMA 1LZWA 3G3ZA 5AW0B 2FY8A 5M19A 3RK3C 3B5ND 3V2RA 4PD4H 1U7JA 3BCCE 4ASVA 3CMAP 1SQVD 2GA1A 2E75D 3GF3A 1RH5B 1SQQG 3U1CA 1DD4A 1FC2C 1PP9E 2QJYB 3WU2E 1VQOW 1J1DC 3G4SW 3KZIE 2Q3EA 4UB6H 3N4XA 3R4YA 3VTPC 1QEXA 4PD4D 5CCGD 3GW1A 4ASWA 3RK2D 3CCSW 5KLVG 1P84I 3PTZA 1SQVJ 2ZXEB 1K9MQ 1JJ2V 5CCHA 1HJ0A 3RK3D 3D70A 4BL3A 2IBZD 3CC4P 3Q3DA 2O1KA 3ZDMA 1OZHA 4U67W 1KZUB 1JY3O 2HYNA 1LTJC 1EDLA 3Q5RA 1LT9C 1KFNA 3SWYA 4Y99C 1Q86Q 4KHXA 3LW5H 1E79H 4D6TJ 3PJSK 3CD6P 1YQ3C 2QM8A 4N3YB 1Q81Q 1S9KE 4L75A 1M7LA 3V2QA 3O1FB 3VOPA 1QVGO 2KSEA 2N1TB 5APQA 3SFEC 3RL0C 1KYOI 3P8CD 3MP7B 1XTGB 5AVXB 1HJBA 1EQ7A 2W90A 1IFDA 3HE5B 1KB9H 2ZT9C 1M1KX 2ZJRW 2D2CB 4WY4B 3BASA 1NAYA 1LWUB 2BEQD 1EXJA 1MWSA 1PP9G 1JMBA 1EDKA 3CCVP 2OTJW 2K37A 1BE3E 3L37A 3I5CA 3WUVA 4AUWA 2OYIC 1MUUA 1SQPD 1PGPA 1LTSC 3CMEW 5CBNA 1NAFA 1FDIA 2WA9A 3H1JD 3LW5J 3PIPW 3HRNA 1MBVB 2PP6A 3EQ2A 1SQXK 4LC1A 4EDFA 3JCUH 1YI2P 1HGZA 1EXIA 2N9YB 5AVRB 3CCJW 1Q7YQ 3S1KA 1KTMA 3VP8A 5TISE 2E5YA 2NPSB 5TJHA 5DM7W 1OFCX 3FGAD 3D6ZA 1BCCJ 4GT1A 1L4AC 1VQ4W 4WB4A 3G71P 3AE6C 4GIFA 3KXDA 2B87B 1N2DC 2KZJA 4JPZB 4W7ZA 1YQ4C 4YTPC 3PH0A 2JWDA 4JQ0D 3CXHI 4UY8Z 1LTIC 1HGVA 1VQLW 4L74A 2QEXW 1MFTA 4DCKA 3O1FA 1G1IA 1FZFA 1URQC 3H1HE 4OVNF 3FXEA 3AE3C 1BDCA 3L70D 1VQ5P 1BE3G 3WMM0 2XV5A 4N78D 3TGUJ 4WY4A 1D7MA 5M18A 1JUNA 1EDJA 3ZG5A 3H1KD 5JVHW 3HE4B 2A45G 2XNDH 1SQVE 3G6EW 4AQRD 4GKGA 1JMMA 2V7QH 2ZXXA 3A0HH 1R6QC 1LT1A 1ZP0C 3N7NA 3L70J 4R4LA 2MJZA 1SQBD 3O2HA 2WT7B 1URQD 3VMYA 2K9YA 4PD4E 1OVRA 1M57D 2KS1A 1BSNA 3V5BA 1N8RQ 3I55W 2ZYDA 1NTKD 1FOSE 1RF1A 2ZVNB 2WSFH 1VQQA 2G8YA 1VF5C 3RK3E 1KILB 5KKZC 3CF5W 1M90Q 1T2KC 2IBZE 5CCHD 2E5TA 1A02F 1YHQW 1SQBJ 3CC2W 1TU3F 4NPFX 3L35A 3NTNA 1L0ND 2IZ1A 1JCCA 1VQMP 5AVSB 2YKPA 4GODA 5AW5B 5CBOA 3H1HG 1NTKJ 1LTJB 1ZN5A 2V7QJ 1IZNB 1LT9B 4IL6X 4Y99B 3CC7P 2PRRA 1NJIX 1K73X 2KNCA 1N7LA 1MBUC 5CJ0A 4R4MA 2AXTE 3P8CE 1LP1A 2K3RA 3TSIA 2Y9YA 3M0DA 1KQSO 3II6A 2FYZA 1VF5D 3C1LA 1SQVG 4GOFA 2HODB 4JBZA 3RL0B 2E74C 1N73A 1Y9BA 4RO0A 2YO3A 3O6QA 1UIXA 2WSFJ 1AV1A 2FYUD 1KD1X 1K8AX 2ZT9B 1MWTA 4PV1C 1NTZD 3UIAA 1PL5A 5JVGW 4IFFA 1EZVE 2ZVOB 3V6IA 4EIJA 5H2FH 1SQPE 2E43A 3V4WA 5AW8B 5M1AA 1KB9E 2KZIA 1H8AA 1SQPK 2Z5IA 3H1JE 4CPKA 3IN6A 2QJPC 1VQNW 3P32A 3L74D 4BRYB 2OTKE 2IBZG 1N7SA 4WVZA 4H13D 1WT6A 2FYUJ 1VQ8W 3A7OA 3KQGA 2OARA 2WPRA 2FFDC 2C0WA 2XDJA 5KAFH 1H0TB 3KHUA 3S9OA 1OVUA 2YO2A 3GHGC 1YYCA 3JCUE 2ZYGA 3RL0g 5EFWB 1YITP 1BSHA 1R8EA 3L74J 1DX7A 3CX5I 3CCMW 3AE5C 1ZR2A 4W7YA 2H8PD 2Y9ZA 1JY3P 1VQ7P 1Q82X 3KYQA 3USSA 5B5EH 1L4AB 3CCUP 1HUCA 2W9RA 1VQKW 5AW9B 3JSVC 3OW2O 4WFAW 1G1JA 1LTBC 2QJKC 3CCRP 1OW6A 1G2CB 2XU6A 1DD3A 1EZVG 1SQPG 2QVAA 1RQSA 1SQQE 3IFMA 3D71A 1FJPA 2K9JA 4LLHA 1FZCC 3H1JG 4YXWH 5GAHa 3H1KE 4UB8E 1SQQK 3D3IA 1HH0A 2E76C 1R5SA 4I7ZC 1KQSV 1FZBA 5KJ7C 3B5NC 1FZAA 1VQPP 1H89A 3CMAW 1RF0C 2ZAEB 1L0LD 1SQBE 5GTHH 2YMKA 3F89A 5GAEa 3P8MC 1NU1D 4EOTA 1ZXGA 3SWKA 1KQLA 4EI2A 2LR2A 1JO5A 3CXCV 1NTMD 1Q2NA 1NTKE 5KLIC 4EYYQ 3A0HE 4DOJA 2PGDA 1FOSF 4OGQB 5CCGC 1H0TA 2HLOA 3RK2C 2Q7CA 4K3AA 1T3UA 2E76D 4YKAA 1L0LJ 1N86A 5KJ7D 1P84H 2XZRA 4XFJA 5AVYB 3VMAA 1NU1J 1QX8A 1RQUA 5KKZB 1L0NE 1LGHB 1RE4C 3CC4W 3S4RA 1JOCA 3IF4A 3EWKA 1T3JA 1NTMJ 5KAIH 3BATA 1L0NK 1GTWA 4BXLA 2OQQA 3L70G 2P10A 3H32A 3AEAC 2JEEA 1JY2O 3B8EB 1ZV8A 3CD6W 1JB0J 1P84D 1S2EA 3RGUA 1Y8AA 1YTZI 3H1KG 3HD7A 5APTA 1GU5A 1AFOA 1M8OB 4C46A 3U59A 1YJWP 4D6TD 3AEBC 1KYOH 3OW2V 3AE8C 5C39A 1SQBG 4RKUJ 1FE6A 3ITKA 1NTZE 2E74B 2BCCD 2IPPA 3GQ1A 4L73A 5M1BA 1NTZK 2ITAA 2Y0DA 2H43A 4PV1B 1LTAC 1NTKG 3CCVW 1VQ9P 5AVZB 3MUDC 4CPGA 1KYOD 2HPCA 2M3BA 2GM4A 1QL1A 2QJPB 1N7SD 5H2FE 2BCCJ 1YI2W 1L0NG 2OYHC 2A06D 1FJKA 5BU5A 4H44B 2KI7B 4IO9W 1VPCA 4AYCA 2FFDB 3HUSC 3NMDA 3OAKA 1KV4A 3G1BA 4M3LA 1K73Q 3AEEC 1KC8X 3TK1A 3L72D 3GHGB 1GL2C 3E1IA 5CMZA 3QWOC 2CPSA 2P2UA 4ZMDA 3G71W 1USDA 5AW2B 1X22A 1M1JB 3MTUE 4IOAW 3M0AA 1DIPA 5K5GB 2FYUG 1RE3A 2Z5HA 1BCCD 1NTZG 4HH2A 2R5DA 3CXHH 3IAOA 3L72J 1H88A 1Z56A 2QJKB 4I1LA 1SFCB 3VMXA 5B5EE 1ZRTD 2H7HA 2NRGA 2I8DA 1GL2D 3J7ZZ 1OWAA 1IK7A 2IYOA 2VRSA 3I56P 1FZCB 1KORA 4IOCW 3W7TA 1W2EA 2B9BA 1ZLLA 5DM6W 3R2PA 3H1LE 3CXHD 3B71A 2HFED 3B5NB 1L0LE 2OTLW 3TGUD 2FXPA 1OXZA 2QA4P 1J1EB 3H1ID 1GDTA 2IYPA 2E75B 2Z4EA 2N1TA 2O3JA 3T97B 3OA7A 3L73D 3Q2YA 2QIWA 3DLLW 4TLFA 1Q82Q 1PPJE 5KLIB 5GTHE 3HE5A 2QM7A 3SWFA 3RK2B 1LWUA 2JO1A 5CCHC 3H1IJ 3CCJP 3PLNA 1PFIA 1S5LE 1LTGC 4L76A 3RK3B 1MKMA 4IFMA 2KYVA 1VQMW 2WQYC 3L73J 1CTFA 1SQVK 2P58A 1GD2E 4KJMA 3GQ0A 3L75D 1M1JA 1YIJP 3A0BH 1VQ4P 4LGDE 3CC7W 1KQFB 3W67A 1RHZB 5KLVD 3CWBD 4Z1MH 1QLED 3HD7D 4DKIA 2FBWC 1J1DB 1ZW0A 5KAIE 4D6TE 3CCQW 2HG5D 1PGOA 3H1LG 3PP5A 1CI6B 2QEXP 2QRXA 2FYNC 1T8ZA 1L0LG 1W2BO 3L75J 1NU1G 2JDIH 4PJ0H 3VMZA 1JCDA 2NPSA 4UB6E 2I1JA 3V2NA 1S1CX 3GLMA 5KLVJ 3GG2A 1NO4A 1NTMG 3CWBJ 1Q86X 2W8ZA 2RMZA 2G3AA 2B87A 2K1AA 1Q81X 4WFBW 1KYOE 1PPJG 3CPWO 1PGQA 3G19A 2SPZA 2JWAA 4U3FD 1CW5A 3BCCD 4H0LD 2WSSH 2AEJA 4H13C 2YKOA 2KOGA 1GK6A 3FXDA 2OYHB 2WPSA 1YJNP 1KN7A 2RH0A 1PP9D 1BGYD 2M5AB 1R6OC 3TNUB 1AQTA 3CI9A 4JYCA 1YJ9P 3G9RA 4U3FJ 1YBKA 3HE4A 1YITW 2KP8A 1VQ6P 1PV3A 1FZGA 3BCCJ 1IC2A 1EC5A 1IFMA 3A3YB 3BVHA 1YHQP 4D6TG 1R5LA 3CX5H 1VQ7W 4B86A 3TF5A 2R32A 1E5WA 2OYIB 3CCUW 1FU1A 2Q9IA 1PP9J 4K35A 1BCCE 1JY2P 3TDKA 1BGYJ 3HTKB 2WT7A 2BCCG 3C8VA 2JR8A 1OIPA 1ZRTE 2BEZF 3CCRW 3W7WA 2WMMA 1GU4A 4RESB 2WZ7A 2KK7A 1CI6A 3CX5D 2YXRB 1U7MA 1KILA 4ZNCA 2MKVA 2HR3A 5AVVB 1OMIA 4IL6H 1CSBA 1GZLA 2CPBA 4HJGH 2D2CC 4WY4C 1M56D 3CXHE 2WITA 2POHA 1PGJA 1VQPW 4QMAA 1SS1A 2A06G 3TGUE 1W2BV 5BU8B 1LTJA 4U7JA 1M1KQ 1LT9A 2QSIA 1NWQA 2LKMA 2PAJA 3KDPB 2OYOA 4C7RA 5B66H 4I2LC 1W5CE 3H25A 4OWFA 3L72G 3PHLA 1NGMB 3L70E 2N1TD 1SQXD 3O2OA 3CPWV 1SVFA 2O01N 2J59M 1URQB 2HODA 2RKLA 4N78E 1HWTC 3AE2C 3CLQA 3CCEP 3G3PA 1RF1C 2D2CD 4WY4D 1IFPA 2KSJA 4DZOA 5DJUB 3TNUA 1GK4A 3AEGC 1IFJA 1BCCG 1DEBA 1X79B 2A45I 5APUA 1NKZB 5AW7B 4HB1A 5CA3A 2ZJSE 3L75E 1S72P 2R3SA 4MN4C 1SQXJ 1JM0A 1EDIA 3CCMP 1X8YA 5AW4B 2OYIA 1MWRA 2FXMA 2Q1KA 2ZFCA 2KIKA 2K88A 4BRYA 1SQBK 3M9HA 1N8RX 1AQ5A 1S4XA 3ABVC 1HBWA 1IFNA 1AA0A 1M90X 1NTKK 3M0DC 3TGUG 4BWNA 3A0BE 3A5TA 1VF5B 4OH8B 1N73C 3MIWA 2FYNB 2AXCA 5APXA 1ZOYC 2NPSD 1JY3N 2J58A 2YNYA 2C9LY 1LJ2A 3CL3D 3L73G 3DNJA 3CCLP 1VQ9W 1L4AA 1PIXA 3GF7A 4CJNA 3VYIA 4U3FE 1LTTC 1OW7A 4PJ0E 5KTBA 5AVQB 1NKNA 2W6BA 3E7KA 3RBXA 2WPQA 5AVUB 1N7SC 3H1HJ 1RQVA 2ZJPW 1G2CA 3AECC 2XKMA 3M9BA 3NXSA 2FXOA 3AE1C 2AEMA 3V4QA 1MG9A 2LXCB 4H13B 5GTIH 3MD0A 1NYHA 1URQA 3L75G 1BGYE 1U57A 2KXPB 2FYUE 3W7XA 3P7KA 2WTYA 1KILC 3CWBG 2FYUK 2IX7C 1FDOA 1DEEG 1USEA 1OX3A 1LNQA 4GOEA 1NHLA 2IFMA 4PD4I 4N6JA 2M3EA 1QVFO 1MV8A 2C0XA 3L74E 1OVVA 1J2JB 2AXTH 3W7SA 2IBZI 2JJLA 3M06A 1S3JA 2BASA 1FAVA 2W6JH 2B88A 3OJAB 2P1JA 3PRJA 1VQOP 1X9VA 4IFDK 3G4SP 2KB7P 3CX5E 1X0TA 2Q3IA 1JTHB 4DJGA 4DT0A 1KILD 3M9QA 3CCSP 4ZKPA 1NJIQ 5GW7A 3W7UA 4U3FG 4WBAA 3BCCG 3I56W 4KT0J 2C9NY 5KAFE 3AE4C 4C7NB 1VDFA 5AW1B 3O8ZA 2KUBA 1BXYA 2DW3A 3GMAA 1SLQA 1KD1Q 4IL6E 1K8AQ 1BGYG 2QA4W 5AVTB 1MZ9A 1EZVD 2M8RA 1HVVA 2KLUA 1SQXE 3D6YA 1KB9D 5APWA 4BL2A 1SP4A 1GW3A 1EZVI 1VQ5W 2Q6QA 1K04A 3RL0D 2ZYAA 1KB9I 2KS1B 2L5GB 5B66E 3L74G 3Q1MA 3MZWB 2WPVB 1RF1B 2ZT9D 4W80A 1SQPJ 1VL2A 2E76B 4I7ZB 2QG4A 3QH9A 3L71D 4WCEW 3H1JJ 1NU1E 2NZ2A 3W68A 2OTJP 1L0LK 3U1AA 1YIJW 4Y28J 1NTME 1NU1K 2H89C 3B4SA 3CMEP 2KLVA 3FWLA 1NTMK 1QVFV 3HD7C 3FX0A 1UIIA 3VP9A 5E79H 2RN0A 4UB8H 1JTHA 2KNCB 3K5BA 2FFDA 3L71J 1LP1B 4A7PA 1IO4A 5HL7W 2JKVA 2YIUC 4WWIA 3GHGA 2M0BA 1N73B 5CJ4A 3AE7C 2W83C 3O6QB 2L91A 1SQQD 1RY3A 1FZEA 1SQXG 3MGNA 4I6MC 3F5HA 4C7NA 1QVGV 2IFNA 2WSCH 1L4AD 1T6AA 1P84E 1ZR4A 4TT3H 3NFQA 2OTLP 2XNXA 4JYBA 3E1RA 4O9BA 2Y0CA 1K9MX 4H0LC 2P7JA 5APSA 1VQLP 1SFCA 1FBMA 2UWJE 1SQQJ 1N7SB 5L8RJ 2Y0EA 4OGQC 1YJNW 3H1KJ 1Q90D 2R44A 1L2PA 2BCCE 1NOHA 2W27A 2CK3H 4WFNW 1FZCA 1YJ9W 1VQ6W 3L36A 1IFIA 5KJ7A 2AEFA 3B5NA 5GTIE 2OGUA 3WU2H 4IOIH 3AEFC 1GW4A 3KZIH 3G6EP 1MBXC 4HYTB 1MFZA 1RF0A 2WSCJ 2O1JA 3WUTA 2WSEH 2A06E 2GUSA 2QJYC 2YXQB 3T97A 3Q5SA 1RE3C 2WVRA 3L4FA 5BVZA 2R5BA 4OGQD 1BDDA 2N9BA 2J5UA 1KILE 1IK9A 1JEKA 1NVOA 3I55P 5CCGA 3CCQP 3VN0A 1QL2A 1HTLC 3L72E 3HUSB 3O2BA 1L0NJ 3IR9A 1T2KD 1AVOA 2E42A 4YJMA 3KPEA 4HKZH 2K9JB 4YJXA 1MWUA 3CC2P 3EFGA 1RE4A 3M91A 2B89A 1GL2B 4YXDC 3Q5PA 3LIDA 5GAGa 4XA4A 1AVYA 2GUVA 1IJDB 1K05A 3ZFZA 2R3CA 2IDBA 2WSEJ 1ZMEC 1Q7YX 2N1TC 3SFDC 1S9KD 5AVWB 3RBZA 4H44C 1A02J 1NTZJ 1AJYA 5APVA 3GW6A 3CCEW 1KQGB 3A2AA 1PZQA 2E74D 2V4HA 1LWUC 5AW6B 1GMJA 1QGKB 1WRGA 3L71E 4PV1D 2WWWA 1S5LX 1S72W 2A45H 3H1IE 2PFXA 3BRTB 3MUDA 3WUUA 2JP3A 2IZ0A 3ZG0A 3MHVA 1KC8Q 1M1JC 4NPEA 4ZKUA 1CZQA 1BE3D 2ZJQW 3H32B 3TYYA 3L73E 1FS0E 3PIOW 1VQNP 2YMYA 1OW8A 2FKWB 3JC22 2O01H 2Q5UA 4NPDA 4H44D 5TISH 2OYHA 3LIEA 1VQ8P 3HD7B 5APYA 2H88C 1SFCC 3V2PA 3BRVB 1YTZT 2M5AA 5CHXA 1XTCC 3HUSA 2QE7H 4YPCA 1BE3J 2NPSC 3EFFK 5E79E 3AE9C 5AW3B 2YIUB 1GL2A 3FWNA 2P67A 1JY2N 3CCLW 5DJTB 2I1KA 1Y47A 4GDOA
chains in the Genus database with same CATH topology
1ZMEC 1OW6A 1R6QC 2NZ2A 1VF5B 1ZP0C 2ZT9B 1HJ0A 1DD3A 4PV1C 4H0LD 1JB0J 1EXIA 3SFDC 1PL5A 4R4LA 4U7JA 3D70A 1RQSA 4H13C 2QSIA 4Y28J 1ZOYC 2JO1A 4H44C 3Q3DA 2H89C 1AJYA 1WMKA 2WA8A 1KMIZ 3D71A 1KQGB 3O2HA 2E75C 2E74D 2K9YA 3AEFC 3DNJA 3Q5RA 2E76C 4I7ZC 3H25A 1MBXC 4H0LB 1KTMA 1MKMA 3IN6A 1DIPA 1GMJA 2O01J 2WSCJ 2QJPC 3AEBC 1NGMB 1PIXA 1HF9A 3GF7A 2WQYC 1CTFA 1R6OC 4PV1D 3O2OA 3GQ0A 3AE8C 1YQ3C 2G8YA 3AEDC 3FGAD 1VF5C 4KT0J 3IAOA 1OW7A 1S5LX 3G9RA 4H13D 3AE4C 4RKUJ 3RK3E 2E74B 2QJYC 3D6ZA 5KKZC 3AE2C 3Q5SA 1PV3A 3AE6C 3G3PA 2YMKA 3GQ1A 3O1FB 2JP3A 1KQFB 2D2CD 5M1BA 1RQVA 1LZWA 2YIUC 4Z1MH 4OGQD 1TU3F 3GMAA 3AECC 1YQ4C 3SFEC 3AE7C 4PV1B 2J5UA 1KILE 4YTPC 3AE1C 2FBWC 3AEGC 1MG9A 4H13B 3S9OA 1NYHA 1IK7A 1OW8A 1U57A 5KLIC 3O2BA 2ZT9C 1KORA 2D2CB 3D6YA 3O1FA 2V7QJ 3RL0g 2FYNC 4OGQB 4H44D 1R8EA 2BEQD 3B71A 4IL6X 2H88C 4YJMA 3C8VA 4TT3H 1EXJA 3AE5C 4YJXA 2E75D 3AE3C 3GF3A 1FDOA 1ZRTE 2BEZF 2FXPA 2E76D 4YKAA 1K04A 4YXDC 4XFJA 1S1CX 3Q5PA 3GLMA 1DD4A 1MBUC 4R4MA 1RQUA 4H0LC 2MKVA 3ABVC 4H44B 3Q1MA 2WPVB 2G3AA 2W9RA 1VF5D 2ZT9D 3AE9C 3EWKA 3R4YA 1OMIA 2E75B 5L8RJ 1FDIA 2WA9A 1K05A 1VL2A 2E76B 4I7ZB 2D2CC 2E74C 3T97B 3GW1A 3LW5J 4OGQC 1Y9BA 2QJKC 2OQQA 1MBVB 3G1BA 3G19A 2P10A 1Q90D 3O6QA 3Q2YA 1UIXA 2QIWA 2IDBA 2WSFJ 3AEEC 3AEAC 4GDOA 2WSEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKA A;  1R6Q C;  1MG9 A;  1DD4 A;  1MBU C;  1DD3 A;  1CTF A;  1RQU A;  1R6O C;  3O2O A;  3GQ0 A;  1RQS A;  3O2B A;  2W9R A;  3O1F A;  2WA8 A;  2WA9 A;  3G3P A;  3GQ1 A;  3O2H A;  3GW1 A;  4YJM A;  3O1F B;  3G19 A;  3G1B A;  1MBV B;  4YJX A;  1RQV A;  1LZW A;  3DNJ A;  1MBX C; 
#chains in the Genus database with same CATH topology
 1JNM A;  5KLV E;  3CWB E;  2W6A A;  1DH3 A;  3HTK A;  3H1L D;  2LXB A;  5KLV K;  4WF9 W;  1J1E C;  1WMK A;  4RJT A;  2WA8 A;  1KMI Z;  5GAD a;  1VQK P;  3SSU A;  4JF7 A;  2HPC B;  2E75 C;  3H6P A;  1YJW W;  3C9I A;  1SFC D;  4H0L B;  3L71 G;  2O01 J;  1HF9 A;  1KFM A;  1S5L H;  3H1I G;  1NH4 A;  3AED C;  4XE5 B;  3H1H D;  2YKQ A;  1PPJ D;  3H1L J;  1FDM A;  1LZW A;  3G3Z A;  5AW0 B;  2FY8 A;  5M19 A;  3RK3 C;  3B5N D;  3V2R A;  4PD4 H;  1U7J A;  3BCC E;  4ASV A;  3CMA P;  1SQV D;  2GA1 A;  2E75 D;  3GF3 A;  1RH5 B;  1SQQ G;  3U1C A;  1DD4 A;  1FC2 C;  1PP9 E;  2QJY B;  3WU2 E;  1VQO W;  1J1D C;  3G4S W;  3KZI E;  2Q3E A;  4UB6 H;  3N4X A;  3R4Y A;  3VTP C;  1QEX A;  4PD4 D;  5CCG D;  3GW1 A;  4ASW A;  3RK2 D;  3CCS W;  5KLV G;  1P84 I;  3PTZ A;  1SQV J;  2ZXE B;  1K9M Q;  1JJ2 V;  5CCH A;  1HJ0 A;  3RK3 D;  3D70 A;  4BL3 A;  2IBZ D;  3CC4 P;  3Q3D A;  2O1K A;  3ZDM A;  1OZH A;  4U67 W;  1KZU B;  1JY3 O;  2HYN A;  1LTJ C;  1EDL A;  3Q5R A;  1LT9 C;  1KFN A;  3SWY A;  4Y99 C;  1Q86 Q;  4KHX A;  3LW5 H;  1E79 H;  4D6T J;  3PJS K;  3CD6 P;  1YQ3 C;  2QM8 A;  4N3Y B;  1Q81 Q;  1S9K E;  4L75 A;  1M7L A;  3V2Q A;  3O1F B;  3VOP A;  1QVG O;  2KSE A;  2N1T B;  5APQ A;  3SFE C;  3RL0 C;  1KYO I;  3P8C D;  3MP7 B;  1XTG B;  5AVX B;  1HJB A;  1EQ7 A;  2W90 A;  1IFD A;  3HE5 B;  1KB9 H;  2ZT9 C;  1M1K X;  2ZJR W;  2D2C B;  4WY4 B;  3BAS A;  1NAY A;  1LWU B;  2BEQ D;  1EXJ A;  1MWS A;  1PP9 G;  1JMB A;  1EDK A;  3CCV P;  2OTJ W;  2K37 A;  1BE3 E;  3L37 A;  3I5C A;  3WUV A;  4AUW A;  2OYI C;  1MUU A;  1SQP D;  1PGP A;  1LTS C;  3CME W;  5CBN A;  1NAF A;  1FDI A;  2WA9 A;  3H1J D;  3LW5 J;  3PIP W;  3HRN A;  1MBV B;  2PP6 A;  3EQ2 A;  1SQX K;  4LC1 A;  4EDF A;  3JCU H;  1YI2 P;  1HGZ A;  1EXI A;  2N9Y B;  5AVR B;  3CCJ W;  1Q7Y Q;  3S1K A;  1KTM A;  3VP8 A;  5TIS E;  2E5Y A;  2NPS B;  5TJH A;  5DM7 W;  1OFC X;  3FGA D;  3D6Z A;  1BCC J;  4GT1 A;  1L4A C;  1VQ4 W;  4WB4 A;  3G71 P;  3AE6 C;  4GIF A;  3KXD A;  2B87 B;  1N2D C;  2KZJ A;  4JPZ B;  4W7Z A;  1YQ4 C;  4YTP C;  3PH0 A;  2JWD A;  4JQ0 D;  3CXH I;  4UY8 Z;  1LTI C;  1HGV A;  1VQL W;  4L74 A;  2QEX W;  1MFT A;  4DCK A;  3O1F A;  1G1I A;  1FZF A;  1URQ C;  3H1H E;  4OVN F;  3FXE A;  3AE3 C;  1BDC A;  3L70 D;  1VQ5 P;  1BE3 G;  3WMM 0;  2XV5 A;  4N78 D;  3TGU J;  4WY4 A;  1D7M A;  5M18 A;  1JUN A;  1EDJ A;  3ZG5 A;  3H1K D;  5JVH W;  3HE4 B;  2A45 G;  2XND H;  1SQV E;  3G6E W;  4AQR D;  4GKG A;  1JMM A;  2V7Q H;  2ZXX A;  3A0H H;  1R6Q C;  1LT1 A;  1ZP0 C;  3N7N A;  3L70 J;  4R4L A;  2MJZ A;  1SQB D;  3O2H A;  2WT7 B;  1URQ D;  3VMY A;  2K9Y A;  4PD4 E;  1OVR A;  1M57 D;  2KS1 A;  1BSN A;  3V5B A;  1N8R Q;  3I55 W;  2ZYD A;  1NTK D;  1FOS E;  1RF1 A;  2ZVN B;  2WSF H;  1VQQ A;  2G8Y A;  1VF5 C;  3RK3 E;  1KIL B;  5KKZ C;  3CF5 W;  1M90 Q;  1T2K C;  2IBZ E;  5CCH D;  2E5T A;  1A02 F;  1YHQ W;  1SQB J;  3CC2 W;  1TU3 F;  4NPF X;  3L35 A;  3NTN A;  1L0N D;  2IZ1 A;  1JCC A;  1VQM P;  5AVS B;  2YKP A;  4GOD A;  5AW5 B;  5CBO A;  3H1H G;  1NTK J;  1LTJ B;  1ZN5 A;  2V7Q J;  1IZN B;  1LT9 B;  4IL6 X;  4Y99 B;  3CC7 P;  2PRR A;  1NJI X;  1K73 X;  2KNC A;  1N7L A;  1MBU C;  5CJ0 A;  4R4M A;  2AXT E;  3P8C E;  1LP1 A;  2K3R A;  3TSI A;  2Y9Y A;  3M0D A;  1KQS O;  3II6 A;  2FYZ A;  1VF5 D;  3C1L A;  1SQV G;  4GOF A;  2HOD B;  4JBZ A;  3RL0 B;  2E74 C;  1N73 A;  1Y9B A;  4RO0 A;  2YO3 A;  3O6Q A;  1UIX A;  2WSF J;  1AV1 A;  2FYU D;  1KD1 X;  1K8A X;  2ZT9 B;  1MWT A;  4PV1 C;  1NTZ D;  3UIA A;  1PL5 A;  5JVG W;  4IFF A;  1EZV E;  2ZVO B;  3V6I A;  4EIJ A;  5H2F H;  1SQP E;  2E43 A;  3V4W A;  5AW8 B;  5M1A A;  1KB9 E;  2KZI A;  1H8A A;  1SQP K;  2Z5I A;  3H1J E;  4CPK A;  3IN6 A;  2QJP C;  1VQN W;  3P32 A;  3L74 D;  4BRY B;  2OTK E;  2IBZ G;  1N7S A;  4WVZ A;  4H13 D;  1WT6 A;  2FYU J;  1VQ8 W;  3A7O A;  3KQG A;  2OAR A;  2WPR A;  2FFD C;  2C0W A;  2XDJ A;  5KAF H;  1H0T B;  3KHU A;  3S9O A;  1OVU A;  2YO2 A;  3GHG C;  1YYC A;  3JCU E;  2ZYG A;  3RL0 g;  5EFW B;  1YIT P;  1BSH A;  1R8E A;  3L74 J;  1DX7 A;  3CX5 I;  3CCM W;  3AE5 C;  1ZR2 A;  4W7Y A;  2H8P D;  2Y9Z A;  1JY3 P;  1VQ7 P;  1Q82 X;  3KYQ A;  3USS A;  5B5E H;  1L4A B;  3CCU P;  1HUC A;  2W9R A;  1VQK W;  5AW9 B;  3JSV C;  3OW2 O;  4WFA W;  1G1J A;  1LTB C;  2QJK C;  3CCR P;  1OW6 A;  1G2C B;  2XU6 A;  1DD3 A;  1EZV G;  1SQP G;  2QVA A;  1RQS A;  1SQQ E;  3IFM A;  3D71 A;  1FJP A;  2K9J A;  4LLH A;  1FZC C;  3H1J G;  4YXW H;  5GAH a;  3H1K E;  4UB8 E;  1SQQ K;  3D3I A;  1HH0 A;  2E76 C;  1R5S A;  4I7Z C;  1KQS V;  1FZB A;  5KJ7 C;  3B5N C;  1FZA A;  1VQP P;  1H89 A;  3CMA W;  1RF0 C;  2ZAE B;  1L0L D;  1SQB E;  5GTH H;  2YMK A;  3F89 A;  5GAE a;  3P8M C;  1NU1 D;  4EOT A;  1ZXG A;  3SWK A;  1KQL A;  4EI2 A;  2LR2 A;  1JO5 A;  3CXC V;  1NTM D;  1Q2N A;  1NTK E;  5KLI C;  4EYY Q;  3A0H E;  4DOJ A;  2PGD A;  1FOS F;  4OGQ B;  5CCG C;  1H0T A;  2HLO A;  3RK2 C;  2Q7C A;  4K3A A;  1T3U A;  2E76 D;  4YKA A;  1L0L J;  1N86 A;  5KJ7 D;  1P84 H;  2XZR A;  4XFJ A;  5AVY B;  3VMA A;  1NU1 J;  1QX8 A;  1RQU A;  5KKZ B;  1L0N E;  1LGH B;  1RE4 C;  3CC4 W;  3S4R A;  1JOC A;  3IF4 A;  3EWK A;  1T3J A;  1NTM J;  5KAI H;  3BAT A;  1L0N K;  1GTW A;  4BXL A;  2OQQ A;  3L70 G;  2P10 A;  3H32 A;  3AEA C;  2JEE A;  1JY2 O;  3B8E B;  1ZV8 A;  3CD6 W;  1JB0 J;  1P84 D;  1S2E A;  3RGU A;  1Y8A A;  1YTZ I;  3H1K G;  3HD7 A;  5APT A;  1GU5 A;  1AFO A;  1M8O B;  4C46 A;  3U59 A;  1YJW P;  4D6T D;  3AEB C;  1KYO H;  3OW2 V;  3AE8 C;  5C39 A;  1SQB G;  4RKU J;  1FE6 A;  3ITK A;  1NTZ E;  2E74 B;  2BCC D;  2IPP A;  3GQ1 A;  4L73 A;  5M1B A;  1NTZ K;  2ITA A;  2Y0D A;  2H43 A;  4PV1 B;  1LTA C;  1NTK G;  3CCV W;  1VQ9 P;  5AVZ B;  3MUD C;  4CPG A;  1KYO D;  2HPC A;  2M3B A;  2GM4 A;  1QL1 A;  2QJP B;  1N7S D;  5H2F E;  2BCC J;  1YI2 W;  1L0N G;  2OYH C;  2A06 D;  1FJK A;  5BU5 A;  4H44 B;  2KI7 B;  4IO9 W;  1VPC A;  4AYC A;  2FFD B;  3HUS C;  3NMD A;  3OAK A;  1KV4 A;  3G1B A;  4M3L A;  1K73 Q;  3AEE C;  1KC8 X;  3TK1 A;  3L72 D;  3GHG B;  1GL2 C;  3E1I A;  5CMZ A;  3QWO C;  2CPS A;  2P2U A;  4ZMD A;  3G71 W;  1USD A;  5AW2 B;  1X22 A;  1M1J B;  3MTU E;  4IOA W;  3M0A A;  1DIP A;  5K5G B;  2FYU G;  1RE3 A;  2Z5H A;  1BCC D;  1NTZ G;  4HH2 A;  2R5D A;  3CXH H;  3IAO A;  3L72 J;  1H88 A;  1Z56 A;  2QJK B;  4I1L A;  1SFC B;  3VMX A;  5B5E E;  1ZRT D;  2H7H A;  2NRG A;  2I8D A;  1GL2 D;  3J7Z Z;  1OWA A;  1IK7 A;  2IYO A;  2VRS A;  3I56 P;  1FZC B;  1KOR A;  4IOC W;  3W7T A;  1W2E A;  2B9B A;  1ZLL A;  5DM6 W;  3R2P A;  3H1L E;  3CXH D;  3B71 A;  2HFE D;  3B5N B;  1L0L E;  2OTL W;  3TGU D;  2FXP A;  1OXZ A;  2QA4 P;  1J1E B;  3H1I D;  1GDT A;  2IYP A;  2E75 B;  2Z4E A;  2N1T A;  2O3J A;  3T97 B;  3OA7 A;  3L73 D;  3Q2Y A;  2QIW A;  3DLL W;  4TLF A;  1Q82 Q;  1PPJ E;  5KLI B;  5GTH E;  3HE5 A;  2QM7 A;  3SWF A;  3RK2 B;  1LWU A;  2JO1 A;  5CCH C;  3H1I J;  3CCJ P;  3PLN A;  1PFI A;  1S5L E;  1LTG C;  4L76 A;  3RK3 B;  1MKM A;  4IFM A;  2KYV A;  1VQM W;  2WQY C;  3L73 J;  1CTF A;  1SQV K;  2P58 A;  1GD2 E;  4KJM A;  3GQ0 A;  3L75 D;  1M1J A;  1YIJ P;  3A0B H;  1VQ4 P;  4LGD E;  3CC7 W;  1KQF B;  3W67 A;  1RHZ B;  5KLV D;  3CWB D;  4Z1M H;  1QLE D;  3HD7 D;  4DKI A;  2FBW C;  1J1D B;  1ZW0 A;  5KAI E;  4D6T E;  3CCQ W;  2HG5 D;  1PGO A;  3H1L G;  3PP5 A;  1CI6 B;  2QEX P;  2QRX A;  2FYN C;  1T8Z A;  1L0L G;  1W2B O;  3L75 J;  1NU1 G;  2JDI H;  4PJ0 H;  3VMZ A;  1JCD A;  2NPS A;  4UB6 E;  2I1J A;  3V2N A;  1S1C X;  3GLM A;  5KLV J;  3GG2 A;  1NO4 A;  1NTM G;  3CWB J;  1Q86 X;  2W8Z A;  2RMZ A;  2G3A A;  2B87 A;  2K1A A;  1Q81 X;  4WFB W;  1KYO E;  1PPJ G;  3CPW O;  1PGQ A;  3G19 A;  2SPZ A;  2JWA A;  4U3F D;  1CW5 A;  3BCC D;  4H0L D;  2WSS H;  2AEJ A;  4H13 C;  2YKO A;  2KOG A;  1GK6 A;  3FXD A;  2OYH B;  2WPS A;  1YJN P;  1KN7 A;  2RH0 A;  1PP9 D;  1BGY D;  2M5A B;  1R6O C;  3TNU B;  1AQT A;  3CI9 A;  4JYC A;  1YJ9 P;  3G9R A;  4U3F J;  1YBK A;  3HE4 A;  1YIT W;  2KP8 A;  1VQ6 P;  1PV3 A;  1FZG A;  3BCC J;  1IC2 A;  1EC5 A;  1IFM A;  3A3Y B;  3BVH A;  1YHQ P;  4D6T G;  1R5L A;  3CX5 H;  1VQ7 W;  4B86 A;  3TF5 A;  2R32 A;  1E5W A;  2OYI B;  3CCU W;  1FU1 A;  2Q9I A;  1PP9 J;  4K35 A;  1BCC E;  1JY2 P;  3TDK A;  1BGY J;  3HTK B;  2WT7 A;  2BCC G;  3C8V A;  2JR8 A;  1OIP A;  1ZRT E;  2BEZ F;  3CCR W;  3W7W A;  2WMM A;  1GU4 A;  4RES B;  2WZ7 A;  2KK7 A;  1CI6 A;  3CX5 D;  2YXR B;  1U7M A;  1KIL A;  4ZNC A;  2MKV A;  2HR3 A;  5AVV B;  1OMI A;  4IL6 H;  1CSB A;  1GZL A;  2CPB A;  4HJG H;  2D2C C;  4WY4 C;  1M56 D;  3CXH E;  2WIT A;  2POH A;  1PGJ A;  1VQP W;  4QMA A;  1SS1 A;  2A06 G;  3TGU E;  1W2B V;  5BU8 B;  1LTJ A;  4U7J A;  1M1K Q;  1LT9 A;  2QSI A;  1NWQ A;  2LKM A;  2PAJ A;  3KDP B;  2OYO A;  4C7R A;  5B66 H;  4I2L C;  1W5C E;  3H25 A;  4OWF A;  3L72 G;  3PHL A;  1NGM B;  3L70 E;  2N1T D;  1SQX D;  3O2O A;  3CPW V;  1SVF A;  2O01 N;  2J59 M;  1URQ B;  2HOD A;  2RKL A;  4N78 E;  1HWT C;  3AE2 C;  3CLQ A;  3CCE P;  3G3P A;  1RF1 C;  2D2C D;  4WY4 D;  1IFP A;  2KSJ A;  4DZO A;  5DJU B;  3TNU A;  1GK4 A;  3AEG C;  1IFJ A;  1BCC G;  1DEB A;  1X79 B;  2A45 I;  5APU A;  1NKZ B;  5AW7 B;  4HB1 A;  5CA3 A;  2ZJS E;  3L75 E;  1S72 P;  2R3S A;  4MN4 C;  1SQX J;  1JM0 A;  1EDI A;  3CCM P;  1X8Y A;  5AW4 B;  2OYI A;  1MWR A;  2FXM A;  2Q1K A;  2ZFC A;  2KIK A;  2K88 A;  4BRY A;  1SQB K;  3M9H A;  1N8R X;  1AQ5 A;  1S4X A;  3ABV C;  1HBW A;  1IFN A;  1AA0 A;  1M90 X;  1NTK K;  3M0D C;  3TGU G;  4BWN A;  3A0B E;  3A5T A;  1VF5 B;  4OH8 B;  1N73 C;  3MIW A;  2FYN B;  2AXC A;  5APX A;  1ZOY C;  2NPS D;  1JY3 N;  2J58 A;  2YNY A;  2C9L Y;  1LJ2 A;  3CL3 D;  3L73 G;  3DNJ A;  3CCL P;  1VQ9 W;  1L4A A;  1PIX A;  3GF7 A;  4CJN A;  3VYI A;  4U3F E;  1LTT C;  1OW7 A;  4PJ0 E;  5KTB A;  5AVQ B;  1NKN A;  2W6B A;  3E7K A;  3RBX A;  2WPQ A;  5AVU B;  1N7S C;  3H1H J;  1RQV A;  2ZJP W;  1G2C A;  3AEC C;  2XKM A;  3M9B A;  3NXS A;  2FXO A;  3AE1 C;  2AEM A;  3V4Q A;  1MG9 A;  2LXC B;  4H13 B;  5GTI H;  3MD0 A;  1NYH A;  1URQ A;  3L75 G;  1BGY E;  1U57 A;  2KXP B;  2FYU E;  3W7X A;  3P7K A;  2WTY A;  1KIL C;  3CWB G;  2FYU K;  2IX7 C;  1FDO A;  1DEE G;  1USE A;  1OX3 A;  1LNQ A;  4GOE A;  1NHL A;  2IFM A;  4PD4 I;  4N6J A;  2M3E A;  1QVF O;  1MV8 A;  2C0X A;  3L74 E;  1OVV A;  1J2J B;  2AXT H;  3W7S A;  2IBZ I;  2JJL A;  3M06 A;  1S3J A;  2BAS A;  1FAV A;  2W6J H;  2B88 A;  3OJA B;  2P1J A;  3PRJ A;  1VQO P;  1X9V A;  4IFD K;  3G4S P;  2KB7 P;  3CX5 E;  1X0T A;  2Q3I A;  1JTH B;  4DJG A;  4DT0 A;  1KIL D;  3M9Q A;  3CCS P;  4ZKP A;  1NJI Q;  5GW7 A;  3W7U A;  4U3F G;  4WBA A;  3BCC G;  3I56 W;  4KT0 J;  2C9N Y;  5KAF E;  3AE4 C;  4C7N B;  1VDF A;  5AW1 B;  3O8Z A;  2KUB A;  1BXY A;  2DW3 A;  3GMA A;  1SLQ A;  1KD1 Q;  4IL6 E;  1K8A Q;  1BGY G;  2QA4 W;  5AVT B;  1MZ9 A;  1EZV D;  2M8R A;  1HVV A;  2KLU A;  1SQX E;  3D6Y A;  1KB9 D;  5APW A;  4BL2 A;  1SP4 A;  1GW3 A;  1EZV I;  1VQ5 W;  2Q6Q A;  1K04 A;  3RL0 D;  2ZYA A;  1KB9 I;  2KS1 B;  2L5G B;  5B66 E;  3L74 G;  3Q1M A;  3MZW B;  2WPV B;  1RF1 B;  2ZT9 D;  4W80 A;  1SQP J;  1VL2 A;  2E76 B;  4I7Z B;  2QG4 A;  3QH9 A;  3L71 D;  4WCE W;  3H1J J;  1NU1 E;  2NZ2 A;  3W68 A;  2OTJ P;  1L0L K;  3U1A A;  1YIJ W;  4Y28 J;  1NTM E;  1NU1 K;  2H89 C;  3B4S A;  3CME P;  2KLV A;  3FWL A;  1NTM K;  1QVF V;  3HD7 C;  3FX0 A;  1UII A;  3VP9 A;  5E79 H;  2RN0 A;  4UB8 H;  1JTH A;  2KNC B;  3K5B A;  2FFD A;  3L71 J;  1LP1 B;  4A7P A;  1IO4 A;  5HL7 W;  2JKV A;  2YIU C;  4WWI A;  3GHG A;  2M0B A;  1N73 B;  5CJ4 A;  3AE7 C;  2W83 C;  3O6Q B;  2L91 A;  1SQQ D;  1RY3 A;  1FZE A;  1SQX G;  3MGN A;  4I6M C;  3F5H A;  4C7N A;  1QVG V;  2IFN A;  2WSC H;  1L4A D;  1T6A A;  1P84 E;  1ZR4 A;  4TT3 H;  3NFQ A;  2OTL P;  2XNX A;  4JYB A;  3E1R A;  4O9B A;  2Y0C A;  1K9M X;  4H0L C;  2P7J A;  5APS A;  1VQL P;  1SFC A;  1FBM A;  2UWJ E;  1SQQ J;  1N7S B;  5L8R J;  2Y0E A;  4OGQ C;  1YJN W;  3H1K J;  1Q90 D;  2R44 A;  1L2P A;  2BCC E;  1NOH A;  2W27 A;  2CK3 H;  4WFN W;  1FZC A;  1YJ9 W;  1VQ6 W;  3L36 A;  1IFI A;  5KJ7 A;  2AEF A;  3B5N A;  5GTI E;  2OGU A;  3WU2 H;  4IOI H;  3AEF C;  1GW4 A;  3KZI H;  3G6E P;  1MBX C;  4HYT B;  1MFZ A;  1RF0 A;  2WSC J;  2O1J A;  3WUT A;  2WSE H;  2A06 E;  2GUS A;  2QJY C;  2YXQ B;  3T97 A;  3Q5S A;  1RE3 C;  2WVR A;  3L4F A;  5BVZ A;  2R5B A;  4OGQ D;  1BDD A;  2N9B A;  2J5U A;  1KIL E;  1IK9 A;  1JEK A;  1NVO A;  3I55 P;  5CCG A;  3CCQ P;  3VN0 A;  1QL2 A;  1HTL C;  3L72 E;  3HUS B;  3O2B A;  1L0N J;  3IR9 A;  1T2K D;  1AVO A;  2E42 A;  4YJM A;  3KPE A;  4HKZ H;  2K9J B;  4YJX A;  1MWU A;  3CC2 P;  3EFG A;  1RE4 A;  3M91 A;  2B89 A;  1GL2 B;  4YXD C;  3Q5P A;  3LID A;  5GAG a;  4XA4 A;  1AVY A;  2GUV A;  1IJD B;  1K05 A;  3ZFZ A;  2R3C A;  2IDB A;  2WSE J;  1ZME C;  1Q7Y X;  2N1T C;  3SFD C;  1S9K D;  5AVW B;  3RBZ A;  4H44 C;  1A02 J;  1NTZ J;  1AJY A;  5APV A;  3GW6 A;  3CCE W;  1KQG B;  3A2A A;  1PZQ A;  2E74 D;  2V4H A;  1LWU C;  5AW6 B;  1GMJ A;  1QGK B;  1WRG A;  3L71 E;  4PV1 D;  2WWW A;  1S5L X;  1S72 W;  2A45 H;  3H1I E;  2PFX A;  3BRT B;  3MUD A;  3WUU A;  2JP3 A;  2IZ0 A;  3ZG0 A;  3MHV A;  1KC8 Q;  1M1J C;  4NPE A;  4ZKU A;  1CZQ A;  1BE3 D;  2ZJQ W;  3H32 B;  3TYY A;  3L73 E;  1FS0 E;  3PIO W;  1VQN P;  2YMY A;  1OW8 A;  2FKW B;  3JC2 2;  2O01 H;  2Q5U A;  4NPD A;  4H44 D;  5TIS H;  2OYH A;  3LIE A;  1VQ8 P;  3HD7 B;  5APY A;  2H88 C;  1SFC C;  3V2P A;  3BRV B;  1YTZ T;  2M5A A;  5CHX A;  1XTC C;  3HUS A;  2QE7 H;  4YPC A;  1BE3 J;  2NPS C;  3EFF K;  5E79 E;  3AE9 C;  5AW3 B;  2YIU B;  1GL2 A;  3FWN A;  2P67 A;  1JY2 N;  3CCL W;  5DJT B;  2I1K A;  1Y47 A;  4GDO A; 
#chains in the Genus database with same CATH homology
 1ZME C;  1OW6 A;  1R6Q C;  2NZ2 A;  1VF5 B;  1ZP0 C;  2ZT9 B;  1HJ0 A;  1DD3 A;  4PV1 C;  4H0L D;  1JB0 J;  1EXI A;  3SFD C;  1PL5 A;  4R4L A;  4U7J A;  3D70 A;  1RQS A;  4H13 C;  2QSI A;  4Y28 J;  1ZOY C;  2JO1 A;  4H44 C;  3Q3D A;  2H89 C;  1AJY A;  1WMK A;  2WA8 A;  1KMI Z;  3D71 A;  1KQG B;  3O2H A;  2E75 C;  2E74 D;  2K9Y A;  3AEF C;  3DNJ A;  3Q5R A;  2E76 C;  4I7Z C;  3H25 A;  1MBX C;  4H0L B;  1KTM A;  1MKM A;  3IN6 A;  1DIP A;  1GMJ A;  2O01 J;  2WSC J;  2QJP C;  3AEB C;  1NGM B;  1PIX A;  1HF9 A;  3GF7 A;  2WQY C;  1CTF A;  1R6O C;  4PV1 D;  3O2O A;  3GQ0 A;  3AE8 C;  1YQ3 C;  2G8Y A;  3AED C;  3FGA D;  1VF5 C;  4KT0 J;  3IAO A;  1OW7 A;  1S5L X;  3G9R A;  4H13 D;  3AE4 C;  4RKU J;  3RK3 E;  2E74 B;  2QJY C;  3D6Z A;  5KKZ C;  3AE2 C;  3Q5S A;  1PV3 A;  3AE6 C;  3G3P A;  2YMK A;  3GQ1 A;  3O1F B;  2JP3 A;  1KQF B;  2D2C D;  5M1B A;  1RQV A;  1LZW A;  2YIU C;  4Z1M H;  4OGQ D;  1TU3 F;  3GMA A;  3AEC C;  1YQ4 C;  3SFE C;  3AE7 C;  4PV1 B;  2J5U A;  1KIL E;  4YTP C;  3AE1 C;  2FBW C;  3AEG C;  1MG9 A;  4H13 B;  3S9O A;  1NYH A;  1IK7 A;  1OW8 A;  1U57 A;  5KLI C;  3O2B A;  2ZT9 C;  1KOR A;  2D2C B;  3D6Y A;  3O1F A;  2V7Q J;  3RL0 g;  2FYN C;  4OGQ B;  4H44 D;  1R8E A;  2BEQ D;  3B71 A;  4IL6 X;  2H88 C;  4YJM A;  3C8V A;  4TT3 H;  1EXJ A;  3AE5 C;  4YJX A;  2E75 D;  3AE3 C;  3GF3 A;  1FDO A;  1ZRT E;  2BEZ F;  2FXP A;  2E76 D;  4YKA A;  1K04 A;  4YXD C;  4XFJ A;  1S1C X;  3Q5P A;  3GLM A;  1DD4 A;  1MBU C;  4R4M A;  1RQU A;  4H0L C;  2MKV A;  3ABV C;  4H44 B;  3Q1M A;  2WPV B;  2G3A A;  2W9R A;  1VF5 D;  2ZT9 D;  3AE9 C;  3EWK A;  3R4Y A;  1OMI A;  2E75 B;  5L8R J;  1FDI A;  2WA9 A;  1K05 A;  1VL2 A;  2E76 B;  4I7Z B;  2D2C C;  2E74 C;  3T97 B;  3GW1 A;  3LW5 J;  4OGQ C;  1Y9B A;  2QJK C;  2OQQ A;  1MBV B;  3G1B A;  3G19 A;  2P10 A;  1Q90 D;  3O6Q A;  3Q2Y A;  1UIX A;  2QIW A;  2IDB A;  2WSF J;  3AEE C;  3AEA C;  4GDO A;  2WSE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...