1RQVA

Spatial model of l7 dimer from e.coli with one hinge region in helical state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 50S ribosomal protein L7/L12
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rqvA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rqvA02
3GQ0A 2WA8A 3O2HA 3GQ1A 1R6OC 1DD3A 3DNJA 1R6QC 3G19A 3O1FB 3G1BA 4YJMA 1CTFA 1MBXC 1RQUA 1RQVA 4YJXA 3O2OA 1RQSA 2WA9A 1MBVB 3O2BA 1DD4A 4YKAA 2W9RA 1MBUC 3G3PA 1MG9A 3GW1A 1LZWA 3O1FA
chains in the Genus database with same CATH superfamily
2KZIA 3GMAA 1FDOA 1NTMG 2YKOA 3M0DA 4Y28J 3B5ND 1QEXA 4OGQB 5AVVB 2WTYA 1S2EA 2ZT9B 3L35A 5AW8B 1W2BO 3NMDA 3A0HH 4IFMA 3A2AA 4WWIA 1VQQA 2HYNA 4JYCA 1JNMA 4ASWA 5GTIH 1SQXG 1KQSO 2C9LY 3U1CA 1VQNP 3FX0A 2W27A 1FZCA 4PJ0H 3MUDA 2LXCB 4IOCW 3VMZA 3M0DC 1YJWW 5BU8B 3CD6P 3I55P 2KK7A 3NTNA 3O2BA 2PAJA 1Q7YX 2JR8A 1JY2P 2B89A 2K1AA 2XDJA 1SQPD 1HWTC 2IBZI 5M18A 1LTGC 1IFJA 1CSBA 3O6QB 3M9HA 1L4AB 2FYUD 1N7SC 3AEEC 2E76C 3Q5PA 2WSFH 2ZFCA 1Q86Q 3A0BE 1K73Q 1LWUA 5KLIB 1KMIZ 3I55W 3RK3E 3D70A 1L4AC 3AE9C 2QEXW 1G1JA 3AEBC 5KAIE 1SQVJ 5DM6W 2C0WA 1VQ9P 3CCMW 1VF5D 1LJ2A 1PGOA 3MHVA 1FZBA 1YHQW 2O1KA 3L71D 3BCCE 2E42A 3H1IG 3OW2O 3B5NA 1EQ7A 2OYHA 2LR2A 2WPSA 1SFCB 3GLMA 5TISE 4ZKUA 1NKZB 3GHGB 3LW5H 1G2CB 3JCUE 3CPWV 1NU1G 1R6OC 2A45G 5E79E 1PP9E 1KQFB 2NPSD 3L73J 3B5NB 2A45H 3M0AA 3A5TA 5B5EE 2W90A 3V2RA 1X22A 1MFZA 2QJPB 2QJKC 3GHGA 3K5BA 1GK6A 1KQGB 2J58A 1N8RX 3OJAB 2SPZA 3D6ZA 2Q1KA 2NRGA 2P1JA 5KLVG 2GUVA 1DX7A 3GW6A 3VMAA 2H8PD 5GTIE 4WY4C 4KJMA 3D6YA 3CLQA 2WSCH 3H25A 1NJIX 3H1IJ 3L36A 1VQ7P 3G6EW 1T2KD 4GODA 4XA4A 3V6IA 4PV1C 3H1KD 1LT9A 3H1HG 5CCHA 3CC7W 3VYIA 2A06D 2MKVA 2Z4EA 3KDPB 4EDFA 2Q3IA 2KSEA 1ZRTD 2G8YA 4DJGA 1D7MA 2RKLA 5CA3A 2AEMA 1QX8A 5KAFE 4NPEA 1NTKG 3I56W 4HH2A 4UB6H 3TNUA 5GAHa 2V7QJ 5AW6B 2K9YA 3SWKA 5AVSB 1T6AA 4DZOA 2M3BA 5CJ4A 4I6MC 1KILD 4L74A 2O01H 3FWLA 2E74B 1NVOA 1YJNW 4BRYA 4UB8E 2JEEA 2Z5HA 1SQBJ 2YXQB 1ZR4A 4W80A 2FYUJ 4TT3H 1VQMW 1NTKE 4EYYQ 3F89A 1Q7YQ 3TSIA 1L0NK 3J7ZZ 2ZXEB 2KYVA 4L73A 1GK4A 1ZOYC 4OGQD 1G1IA 2WSFJ 3CC2W 3Q1MA 2YO2A 2Y9ZA 4JQ0D 1HBWA 1FZEA 1Q81X 1VQ7W 2G3AA 3CCUW 3IR9A 2FYUE 2QG4A 3PHLA 1OVUA 3CXHI 4B86A 1URQC 3HUSB 1JTHB 3AE4C 2N1TD 1FC2C 4OGQC 1YITW 2HR3A 1GMJA 2GM4A 3DNJA 2OTJP 1KFMA 1LTJB 1VL2A 2FXMA 1JY3O 3BASA 3S9OA 4LLHA 1SQQD 2E76D 3MP7B 1VQKW 1EZVE 1FOSF 2BEZF 3QH9A 3CMEP 3MD0A 5CCGD 5JVHW 3CWBG 1RF0A 4M3LA 3B8EB 1NU1J 3L74G 2BCCD 1K9MX 4U7JA 1LTSC 3W7TA 1NTZJ 3H1HD 3PRJA 1JY2N 3CCJP 1KILA 4KHXA 4ZNCA 2FFDB 1IC2A 1JY3P 1CW5A 1USEA 1Y8AA 2P67A 2WQYC 1KQLA 3CMEW 1QVGV 1YHQP 3JC22 3HD7A 1HF9A 3H1IE 1L0LD 1JCDA 2KIKA 5AVXB 2W9RA 1E5WA 1N73C 1AQTA 4CPKA 3O6QA 1J1EB 3FWNA 3CMAW 2YXRB 2FYZA 1KB9E 5L8RJ 1RF1C 2FYNC 3IAOA 1FZFA 1MUUA 1SQVD 2JWDA 4N78E 3V5BA 4YXDC 2HFED 1OVRA 4LC1A 3W7UA 3CCEP 1N86A 1Q82Q 1AVYA 5AVUB 2XV5A 5AW0B 1LZWA 2M3EA 2OYOA 1N7SB 3N4XA 3W68A 1KTMA 2E75C 2PP6A 2YIUC 5CCHD 1N73A 1X0TA 1NTMK 1G2CA 3BATA 2KI7B 1HJBA 1OW6A 2NZ2A 3Q3DA 2Q7CA 2Q9IA 1YJNP 5CMZA 3SFDC 1J2JB 4QMAA 2FKWB 5GTHH 5KKZB 2WA9A 2WSEJ 4O9BA 3I56P 1JUNA 4HB1A 2HG5D 1N2DC 3L72J 1EZVI 3E1IA 1Q82X 1H88A 1X79B 4H44D 3A0HE 2Y0DA 5APQA 4YPCA 3B4SA 2GA1A 2XNXA 5KKZC 3ZG5A 1EDIA 1SQQG 4EOTA 1T2KC 2QSIA 1FU1A 3V2QA 1KYOE 3WU2H 1KFNA 1GDTA 2N1TB 1OFCX 1JTHA 5KTBA 4D6TG 1MFTA 2R3CA 2ZXXA 1CI6B 1WMKA 3VP9A 4U3FJ 1VQ4P 1M90Q 1GL2B 1U7MA 3G6EP 3VN0A 1A02F 3VOPA 2N1TC 1SQVG 1BCCJ 1URQD 3W7WA 1L2PA 4I2LC 4WBAA 1S4XA 1RHZB 2QJPC 1DH3A 1SFCD 2CPSA 1OMIA 2QA4W 2OQQA 1VQ6P 5H2FE 2WPRA 1RE3A 3M91A 3P7KA 3H1HJ 2E5YA 1LTTC 3AEAC 3GQ0A 4Y99B 2R32A 2B88A 4HYTB 3GQ1A 4U67W 1JMMA 1SQBE 3HRNA 5KLVE 4H0LD 1HH0A 4N3YB 1IFNA 1WRGA 1KILE 3LW5J 1HGVA 1P84E 1OVVA 3BCCJ 2W6AA 3HUSA 1M1KQ 3ABVC 3GF7A 5GADa 3W7XA 1NTZG 1LTIC 4XFJA 1VQOW 2PGDA 3CCQW 1SQPG 1PL5A 3H1ID 4JPZB 1K04A 3FXDA 1BCCG 1KILC 1R5LA 2OYIB 3CCSW 2QJKB 1PV3A 1Q86X 1OXZA 2KS1A 3V4WA 2D2CB 3GW1A 1LT1A 4PD4E 4UB6E 1M1JC 4XE5B 2BCCE 2J5UA 1N7LA 4BL2A 2QM8A 1PP9G 2A06E 2E74C 1BE3D 3KPEA 3GG2A 4PJ0E 2E74D 2L91A 4IL6X 3H6PA 1M56D 2FFDA 5APTA 3QWOC 2RN0A 3L74E 1S9KE 3AE8C 3CCEW 3E1RA 3KZIH 1LT9C 1HUCA 1H8AA 3CC4W 1LT9B 2Z5IA 3BCCG 3I5CA 1T8ZA 3CWBE 2BEQD 3D3IA 3L73G 5DJUB 1NGMB 2WZ7A 2XKMA 2IFNA 5KJ7D 5APXA 3WU2E 3GF3A 1FAVA 3H1KG 1FE6A 3L71J 1KV4A 2WMMA 4YJMA 2H88C 4UY8Z 3RBZA 3LIDA 2K3RA 3ZG0A 1NTMJ 1JY3N 2M8RA 3AEGC 2ZJRW 4H0LC 1MZ9A 2IX7C 3SWFA 3C9IA 3WMM0 4TLFA 1R6QC 5AW2B 2IDBA 1VQLW 2FBWC 2IPPA 5KLVD 1S72W 4UB8H 5H2FH 1KC8Q 3R4YA 1M1JA 4DOJA 4N78D 3TGUD 2B87A 2WPQA 1L4AD 3L75E 3MIWA 3HD7B 1OX3A 1QLED 3M06A 3CCVW 3JSVC 3E7KA 1OZHA 4YJXA 5KAFH 2GUSA 4HJGH 3HD7D 3CXHE 4YXWH 3B5NC 1J1DC 1MWTA 3CCUP 3P8CE 1BGYE 3P8CD 1FZCC 2FYUK 1LTAC 4IFFA 3CX5D 3RL0D 5JVGW 3S4RA 4RJTA 3L70E 1BCCE 2H7HA 1RH5B 3EQ2A 4BRYB 1NU1E 1GTWA 1SQPE 3TYYA 1OW7A 1S3JA 3H32A 4LGDE 3L75D 5EFWB 4ZKPA 3CCLW 2R5BA 1EXIA 1SQXJ 3H1KE 1N7SD 3KQGA 3CCSP 1GU5A 3R2PA 2KOGA 1Z56A 3HE5B 2N1TA 3CCQP 1KC8X 1W5CE 2QRXA 1VQ5P 1GU4A 5APUA 1JY2O 1IFMA 4MN4C 2DW3A 3U1AA 2L5GB 1U7JA 3O2OA 3A7OA 2FYUG 3L72E 2R44A 2I1JA 1NKNA 1QL2A 1UIXA 1ZW0A 2I1KA 1SFCC 3ZFZA 2RMZA 5AVQB 1Q81Q 1M8OB 1QVFO 3V2NA 1ZP0C 1VQ5W 3OAKA 4IOAW 4R4LA 3N7NA 1GZLA 1VQ6W 4H13B 3O1FA 2QA4P 1NHLA 1L0NJ 1SQBK 2ITAA 2N9BA 1R5SA 1S9KD 4Y99C 3L74D 1LTJA 1VQ8W 1PGPA 3RGUA 2ZT9D 2KP8A 1PP9J 2AXCA 3EFFK 3H1JG 4U3FD 2CK3H 2YO3A 3CXHD 1RF1A 1VQ8P 1SQQE 1U57A 2HLOA 3PH0A 1UIIA 1Q90D 2KXPB 4IO9W 2IZ1A 3CC7P 4WFAW 3L71E 4PD4D 2OARA 3AE7C 1YI2P 2PRRA 3VP8A 4WY4B 5AVYB 3L74J 4HKZH 1AV1A 1FDIA 1L4AA 1Y9BA 1K73X 2LKMA 2MJZA 2WWWA 5HL7W 2HODB 5B66E 4GIFA 1AQ5A 2E75B 1BSHA 1L0LE 2Y0EA 1N73B 1XTGB 3RK2C 4JF7A 3L75G 2R5DA 3H1HE 1S1CX 1J1EC 1PFIA 1MV8A 1FBMA 5CCGC 1JM0A 2ZYDA 1LNQA 1P84I 1L0LG 2E75D 5CBNA 3BRVB 3AE1C 2B87B 3BRTB 3VTPC 1YQ4C 5M19A 2WPVB 1VQLP 3V2PA 4KT0J 2Q3EA 1WT6A 4L75A 3RK2B 1VQ9W 1AJYA 5AVTB 1IFDA 4GKGA 3H1JJ 5GW7A 1Q2NA 1PIXA 3VMXA 1IFIA 5AW9B 3FGAD 3CCRW 2WVRA 3G4SW 2XNDH 1ZR2A 1H89A 3AE3C 1QL1A 1KQSV 2OGUA 1OIPA 4BWNA 1YIJP 1GW4A 1MBXC 3PIPW 3O8ZA 1EXJA 1MBVB 1MBUC 1IO4A 1EDJA 1VPCA 3G3ZA 3SFEC 1X9VA 2FFDC 1DEBA 2JDIH 1DEEG 4H13D 2QEXP 5KJ7A 1NTKJ 3T97B 1QGKB 1IFPA 3C8VA 2ZVOB 2A06G 1ZXGA 1YJWP 2OYIC 2IYPA 1NJIQ 3RBXA 2FYNB 4GOFA 3L37A 2K9JA 1MG9A 1USDA 1VQNW 1Y47A 1PPJE 1VDFA 4C7NA 3TGUJ 2BASA 2WSSH 1NTZD 2FXPA 5BU5A 1S5LE 1BDDA 1IZNB 1LP1B 4I1LA 2OYHC 1M1KX 1HTLC 2FY8A 4GT1A 4C7RA 1EC5A 1DD4A 3L70J 4I7ZC 3ITKA 3AEFC 1VQOP 3CD6W 3RL0g 1TU3F 2Y0CA 2W8ZA 3PJSK 3L73D 3HUSC 2WT7A 4PV1B 3FXEA 1M1JB 3O1FB 3H32B 2KUBA 1PGJA 1AVOA 4R4MA 1K8AX 3SSUA 3UIAA 3II6A 3LIEA 1R8EA 5AW5B 4OH8B 2I8DA 4PD4H 2ZJPW 4EIJA 2AXTE 1PP9D 4H44C 2WITA 1RE3C 2OTJW 3BVHA 3WUUA 5CCHC 1L0LJ 3M9QA 2IZ0A 1JCCA 3CPWO 1K05A 1BGYG 2E5TA 4AQRD 3TGUG 4WCEW 2WA8A 4D6TE 1H0TA 3PIOW 1YIJW 3H1JD 3CWBD 4RO0A 2AEFA 1FZCB 1MWRA 3G4SP 2O01N 4IFDK 3G71P 2XU6A 2IBZD 4WFBW 2ZYAA 3M9BA 2E76B 3HE4A 1SQVK 3VMYA 2Q5UA 1OW8A 3GHGC 3CC2P 2KNCA 1SQQJ 2YKPA 2J59M 1BE3G 1NTZK 1K9MQ 3L4FA 2ZAEB 5CBOA 1KILB 2ZJQW 3KHUA 3HTKB 1RQSA 1VQMP 2NPSA 5BVZA 3HE5A 5GAEa 1RY3A 3EFGA 5KAIH 3Q2YA 2M0BA 2AEJA 1X8YA 1MWSA 4CJNA 1KD1X 1ZMEC 5KLVJ 4RESB 1EZVD 1BGYJ 1OWAA 4WY4A 1YTZT 2RH0A 2JWAA 2N9YB 2HPCA 4H0LB 4AYCA 1FOSE 1L0ND 2W83C 3U59A 3L73E 3PP5A 2QVAA 2O1JA 2XZRA 2D2CC 1IK7A 2IYOA 1BSNA 1NWQA 3RK3C 1JB0J 2OYHB 3MZWB 5AW1B 3L70D 2JO1A 3TK1A 2CPBA 5K5GB 1KB9H 1YI2W 1BE3J 4U3FE 1FJPA 2C9NY 1EDKA 3C1LA 1FZAA 3MGNA 2WSCJ 1FS0E 3L71G 3A0BH 1GL2C 5APSA 1M57D 1RE4A 4BXLA 1KB9I 4WB4A 1KYOH 1IJDB 2POHA 3TDKA 5AVRB 3JCUH 3RK3D 1HGZA 5E79H 1VQPW 3RK3B 2D2CD 1PZQA 3ZDMA 5C39A 1JJ2V 1NTME 2O01J 2FXOA 5TISH 2JP3A 1A02J 1VF5B 3Q5RA 3RL0B 3S1KA 3AECC 2VRSA 1SQQK 1L0NG 4C7NB 2KLVA 4WFNW 1GL2D 3V4QA 3TNUB 2NPSC 2K88A 2O3JA 4JBZA 4BL3A 4IL6E 5B5EH 1XTCC 1DIPA 3B71A 1KB9D 1SFCA 3SWYA 3W67A 3HD7C 1NAYA 1ZN5A 1L0NE 2B9BA 1LWUC 2QJYC 3T97A 4ZMDA 3CCJW 3IFMA 1N7SA 3P32A 2M5AB 3G1BA 4NPDA 1YYCA 1L0LK 1NU1D 2E43A 1RF0C 3G3PA 2OTLW 3CCLP 1MKMA 1URQB 1S72P 4A7PA 1M7LA 4U3FG 2PFXA 3H1LJ 5DM7W 5M1BA 3EWKA 1LTBC 3CX5I 1VQKP 1SQBG 3L72D 3MUDC 3WUVA 1T3UA 1H0TB 3KYQA 4YTPC 3CMAP 1PPJG 2A45I 4D6TD 3IN6A 4AUWA 5GTHE 4OWFA 1URQA 3Q5SA 2QM7A 4ASVA 3DLLW 1QVGO 3NFQA 1W2BV 1NOHA 4GDOA 4WF9W 3USSA 1SQVE 4IL6H 2YMKA 2V7QH 3KXDA 2OTLP 5M1AA 5APYA 3PTZA 4W7ZA 3CCRP 1BCCD 3CC4P 1DD3A 1SVFA 1KZUB 2R3SA 1HVVA 2K9JB 3CCVP 4D6TJ 3CX5E 5B66H 1NTMD 1GL2A 1J1DB 3H1KJ 1N8RQ 3CF5W 1T3JA 2QE7H 1P84H 1LP1A 4K35A 2OYIA 2YMYA 5TJHA 3PLNA 3P8MC 1SS1A 3RK2D 1ZRTE 4PV1D 1NU1K 1NH4A 1RF1B 1IK9A 3H1LG 2UWJE 1NTKD 3BCCD 4DCKA 4WVZA 4N6JA 1YITP 2KNCB 1NAFA 2V4HA 4GOEA 2IBZE 3TGUE 5KLVK 5AW7B 4IOIH 1RQVA 4YKAA 3AE5C 4NPFX 1KYOI 1FDMA 1YJ9P 2YNYA 1VQPP 2JJLA 1S5LH 1SLQA 3OW2V 4OVNF 1VF5C 3RL0C 3G19A 1GW3A 2W6BA 1YBKA 2P7JA 3OA7A 1SQPJ 2P58A 2KSJA 1KYOD 2KZJA 2HPCB 2KS1B 3L75J 1SQXE 3MTUE 1SQXD 2WSEH 3NXSA 5CHXA 1LWUB 2QJYB 3CL3D 4H13C 1RQUA 5CCGA 3WUTA 2BCCG 2JKVA 1NO4A 2C0XA 1JEKA 2ZJSE 1BGYD 4H44B 1JOCA 1FZGA 3AEDC 1QVFV 3HTKA 1ZV8A 1S5LX 3H1JE 2QIWA 4PD4I 4CPGA 2Q6QA 4W7YA 1AA0A 4RKUJ 1YQ3C 4C46A 1EDLA 1NTKK 1NTZE 2HODA 2M5AA 4L76A 1PGQA 3KZIE 3TF5A 3CI9A 3CWBJ 5AVWB 1PPJD 1NYHA 1SP4A 2YKQA 4I7ZB 1FJKA 3CX5H 5CJ0A 3IF4A 2KB7P 2WT7B 3H1LD 1K8AQ 1CZQA 5APWA 2W6JH 1GD2E 4EI2A 3G9RA 3W7SA 5AW3B 4K3AA 4DT0A 1KD1Q 3O2HA 2AXTH 3CXCV 5AVZB 5AW4B 2OTKE 2P2UA 1E79H 1W2EA 3G71W 5DJTB 1JMBA 5KLIC 2BCCJ 1YTZI 2IFMA 1ZLLA 1RE4C 2ZYGA 3AE2C 5APVA 1P84D 1BDCA 1EZVG 1CI6A 1JO5A 2K37A 3L72G 3CCMP 1SQBD 1SQPK 3D71A 1VQ4W 4WY4D 1SQXK 2LXBA 1KN7A 2Y9YA 2IBZG 1BXYA 1LGHB 3A3YB 5GAGa 2ZVNB 4DKIA 3AE6C 1KORA 1MWUA 3L70G 2H89C 2KLUA 1HJ0A 2H43A 2P10A 3HE4B 5KJ7C 1AFOA 1M90X 1CTFA 3F5HA 1YJ9W 4JYBA 1BE3E 3H1LE 4Z1MH 3CXHH 2YIUB 1LTJC 2ZT9C 2NPSB
chains in the Genus database with same CATH topology
4XFJA 2WA8A 1VF5D 3T97B 2G3AA 3GMAA 1FDOA 1NYHA 3EWKA 5M1BA 3C8VA 4I7ZB 1R6QC 2WSCJ 1PL5A 4H44D 4Y28J 2IDBA 2FBWC 1K04A 2MKVA 4OGQB 1RQVA 2E75B 2ZT9B 5L8RJ 3O2OA 1PV3A 5KKZC 3AE4C 2FYNC 3R4YA 4YKAA 3AE5C 4YTPC 2G8YA 3IAOA 2D2CB 3GLMA 1MG9A 2QSIA 3G9RA 4OGQC 3GW1A 2E76B 1S1CX 2D2CD 2O01J 1OW8A 3O2HA 1UIXA 4YXDC 1GMJA 2J5UA 3IN6A 1R6OC 2E75D 2JP3A 3DNJA 3Q5SA 3AE1C 2FXPA 1VF5B 1VF5C 1WMKA 1KQFB 3Q5RA 3G19A 1VL2A 3AECC 5KLIC 2E74C 1YQ4C 2V7QJ 3S9OA 2K9YA 2WPVB 4YJXA 1RQSA 2E76D 1ZP0C 4KT0J 3AE2C 4GDOA 3O2BA 1DD4A 2E74D 4I7ZC 4R4LA 3AEFC 2BEZF 4H13B 4IL6X 1LZWA 3O1FA 3RL0g 2YMKA 1TU3F 2E74B 1AJYA 3D71A 3Q2YA 2QJPC 3AE8C 1KTMA 2E75C 2YIUC 2QJKC 1DD3A 4PV1B 1DIPA 3B71A 1ZMEC 2ZT9D 4H13C 1KQGB 3O1FB 1PIXA 1RQUA 3AEEC 1OMIA 2E76C 3Q5PA 2OQQA 3D6ZA 4R4MA 4U7JA 2BEQD 1R8EA 1OW6A 2NZ2A 4TT3H 3FGAD 3Q3DA 4H0LB 1NGMB 3AE6C 2QJYC 1KORA 1U57A 4H44C 3AEAC 4H44B 3GQ0A 1Q90D 2WQYC 2H89C 1HJ0A 2P10A 3D6YA 3GF3A 3GQ1A 3AEDC 1ZOYC 1OW7A 3SFDC 4OGQD 3AE3C 3H25A 4H0LD 1HF9A 1KMIZ 1S5LX 2WSFJ 3Q1MA 3AE7C 1KILE 2D2CC 1IK7A 3RK3E 3D70A 3G1BA 1CTFA 3LW5J 2H88C 2QIWA 1MBXC 4YJMA 1ZRTE 4PV1D 1K05A 3AE9C 1EXIA 1JB0J 2WA9A 1EXJA 1MBVB 2WSEJ 3ABVC 3AEBC 2W9RA 3GF7A 1MBUC 1FDIA 4Z1MH 3G3PA 4PV1C 3AEGC 4RKUJ 3SFEC 1Y9BA 1YQ3C 2JO1A 4H0LC 2ZT9C 4H13D 3O6QA 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ0 A;  2WA8 A;  3O2H A;  3GQ1 A;  1R6O C;  1DD3 A;  3DNJ A;  1R6Q C;  3G19 A;  3O1F B;  3G1B A;  4YJM A;  1CTF A;  1MBX C;  1RQU A;  1RQV A;  4YJX A;  3O2O A;  1RQS A;  2WA9 A;  1MBV B;  3O2B A;  1DD4 A;  4YKA A;  2W9R A;  1MBU C;  3G3P A;  1MG9 A;  3GW1 A;  1LZW A;  3O1F A; 
#chains in the Genus database with same CATH topology
 2KZI A;  3GMA A;  1FDO A;  1NTM G;  2YKO A;  3M0D A;  4Y28 J;  3B5N D;  1QEX A;  4OGQ B;  5AVV B;  2WTY A;  1S2E A;  2ZT9 B;  3L35 A;  5AW8 B;  1W2B O;  3NMD A;  3A0H H;  4IFM A;  3A2A A;  4WWI A;  1VQQ A;  2HYN A;  4JYC A;  1JNM A;  4ASW A;  5GTI H;  1SQX G;  1KQS O;  2C9L Y;  3U1C A;  1VQN P;  3FX0 A;  2W27 A;  1FZC A;  4PJ0 H;  3MUD A;  2LXC B;  4IOC W;  3VMZ A;  3M0D C;  1YJW W;  5BU8 B;  3CD6 P;  3I55 P;  2KK7 A;  3NTN A;  3O2B A;  2PAJ A;  1Q7Y X;  2JR8 A;  1JY2 P;  2B89 A;  2K1A A;  2XDJ A;  1SQP D;  1HWT C;  2IBZ I;  5M18 A;  1LTG C;  1IFJ A;  1CSB A;  3O6Q B;  3M9H A;  1L4A B;  2FYU D;  1N7S C;  3AEE C;  2E76 C;  3Q5P A;  2WSF H;  2ZFC A;  1Q86 Q;  3A0B E;  1K73 Q;  1LWU A;  5KLI B;  1KMI Z;  3I55 W;  3RK3 E;  3D70 A;  1L4A C;  3AE9 C;  2QEX W;  1G1J A;  3AEB C;  5KAI E;  1SQV J;  5DM6 W;  2C0W A;  1VQ9 P;  3CCM W;  1VF5 D;  1LJ2 A;  1PGO A;  3MHV A;  1FZB A;  1YHQ W;  2O1K A;  3L71 D;  3BCC E;  2E42 A;  3H1I G;  3OW2 O;  3B5N A;  1EQ7 A;  2OYH A;  2LR2 A;  2WPS A;  1SFC B;  3GLM A;  5TIS E;  4ZKU A;  1NKZ B;  3GHG B;  3LW5 H;  1G2C B;  3JCU E;  3CPW V;  1NU1 G;  1R6O C;  2A45 G;  5E79 E;  1PP9 E;  1KQF B;  2NPS D;  3L73 J;  3B5N B;  2A45 H;  3M0A A;  3A5T A;  5B5E E;  2W90 A;  3V2R A;  1X22 A;  1MFZ A;  2QJP B;  2QJK C;  3GHG A;  3K5B A;  1GK6 A;  1KQG B;  2J58 A;  1N8R X;  3OJA B;  2SPZ A;  3D6Z A;  2Q1K A;  2NRG A;  2P1J A;  5KLV G;  2GUV A;  1DX7 A;  3GW6 A;  3VMA A;  2H8P D;  5GTI E;  4WY4 C;  4KJM A;  3D6Y A;  3CLQ A;  2WSC H;  3H25 A;  1NJI X;  3H1I J;  3L36 A;  1VQ7 P;  3G6E W;  1T2K D;  4GOD A;  4XA4 A;  3V6I A;  4PV1 C;  3H1K D;  1LT9 A;  3H1H G;  5CCH A;  3CC7 W;  3VYI A;  2A06 D;  2MKV A;  2Z4E A;  3KDP B;  4EDF A;  2Q3I A;  2KSE A;  1ZRT D;  2G8Y A;  4DJG A;  1D7M A;  2RKL A;  5CA3 A;  2AEM A;  1QX8 A;  5KAF E;  4NPE A;  1NTK G;  3I56 W;  4HH2 A;  4UB6 H;  3TNU A;  5GAH a;  2V7Q J;  5AW6 B;  2K9Y A;  3SWK A;  5AVS B;  1T6A A;  4DZO A;  2M3B A;  5CJ4 A;  4I6M C;  1KIL D;  4L74 A;  2O01 H;  3FWL A;  2E74 B;  1NVO A;  1YJN W;  4BRY A;  4UB8 E;  2JEE A;  2Z5H A;  1SQB J;  2YXQ B;  1ZR4 A;  4W80 A;  2FYU J;  4TT3 H;  1VQM W;  1NTK E;  4EYY Q;  3F89 A;  1Q7Y Q;  3TSI A;  1L0N K;  3J7Z Z;  2ZXE B;  2KYV A;  4L73 A;  1GK4 A;  1ZOY C;  4OGQ D;  1G1I A;  2WSF J;  3CC2 W;  3Q1M A;  2YO2 A;  2Y9Z A;  4JQ0 D;  1HBW A;  1FZE A;  1Q81 X;  1VQ7 W;  2G3A A;  3CCU W;  3IR9 A;  2FYU E;  2QG4 A;  3PHL A;  1OVU A;  3CXH I;  4B86 A;  1URQ C;  3HUS B;  1JTH B;  3AE4 C;  2N1T D;  1FC2 C;  4OGQ C;  1YIT W;  2HR3 A;  1GMJ A;  2GM4 A;  3DNJ A;  2OTJ P;  1KFM A;  1LTJ B;  1VL2 A;  2FXM A;  1JY3 O;  3BAS A;  3S9O A;  4LLH A;  1SQQ D;  2E76 D;  3MP7 B;  1VQK W;  1EZV E;  1FOS F;  2BEZ F;  3QH9 A;  3CME P;  3MD0 A;  5CCG D;  5JVH W;  3CWB G;  1RF0 A;  4M3L A;  3B8E B;  1NU1 J;  3L74 G;  2BCC D;  1K9M X;  4U7J A;  1LTS C;  3W7T A;  1NTZ J;  3H1H D;  3PRJ A;  1JY2 N;  3CCJ P;  1KIL A;  4KHX A;  4ZNC A;  2FFD B;  1IC2 A;  1JY3 P;  1CW5 A;  1USE A;  1Y8A A;  2P67 A;  2WQY C;  1KQL A;  3CME W;  1QVG V;  1YHQ P;  3JC2 2;  3HD7 A;  1HF9 A;  3H1I E;  1L0L D;  1JCD A;  2KIK A;  5AVX B;  2W9R A;  1E5W A;  1N73 C;  1AQT A;  4CPK A;  3O6Q A;  1J1E B;  3FWN A;  3CMA W;  2YXR B;  2FYZ A;  1KB9 E;  5L8R J;  1RF1 C;  2FYN C;  3IAO A;  1FZF A;  1MUU A;  1SQV D;  2JWD A;  4N78 E;  3V5B A;  4YXD C;  2HFE D;  1OVR A;  4LC1 A;  3W7U A;  3CCE P;  1N86 A;  1Q82 Q;  1AVY A;  5AVU B;  2XV5 A;  5AW0 B;  1LZW A;  2M3E A;  2OYO A;  1N7S B;  3N4X A;  3W68 A;  1KTM A;  2E75 C;  2PP6 A;  2YIU C;  5CCH D;  1N73 A;  1X0T A;  1NTM K;  1G2C A;  3BAT A;  2KI7 B;  1HJB A;  1OW6 A;  2NZ2 A;  3Q3D A;  2Q7C A;  2Q9I A;  1YJN P;  5CMZ A;  3SFD C;  1J2J B;  4QMA A;  2FKW B;  5GTH H;  5KKZ B;  2WA9 A;  2WSE J;  4O9B A;  3I56 P;  1JUN A;  4HB1 A;  2HG5 D;  1N2D C;  3L72 J;  1EZV I;  3E1I A;  1Q82 X;  1H88 A;  1X79 B;  4H44 D;  3A0H E;  2Y0D A;  5APQ A;  4YPC A;  3B4S A;  2GA1 A;  2XNX A;  5KKZ C;  3ZG5 A;  1EDI A;  1SQQ G;  4EOT A;  1T2K C;  2QSI A;  1FU1 A;  3V2Q A;  1KYO E;  3WU2 H;  1KFN A;  1GDT A;  2N1T B;  1OFC X;  1JTH A;  5KTB A;  4D6T G;  1MFT A;  2R3C A;  2ZXX A;  1CI6 B;  1WMK A;  3VP9 A;  4U3F J;  1VQ4 P;  1M90 Q;  1GL2 B;  1U7M A;  3G6E P;  3VN0 A;  1A02 F;  3VOP A;  2N1T C;  1SQV G;  1BCC J;  1URQ D;  3W7W A;  1L2P A;  4I2L C;  4WBA A;  1S4X A;  1RHZ B;  2QJP C;  1DH3 A;  1SFC D;  2CPS A;  1OMI A;  2QA4 W;  2OQQ A;  1VQ6 P;  5H2F E;  2WPR A;  1RE3 A;  3M91 A;  3P7K A;  3H1H J;  2E5Y A;  1LTT C;  3AEA C;  3GQ0 A;  4Y99 B;  2R32 A;  2B88 A;  4HYT B;  3GQ1 A;  4U67 W;  1JMM A;  1SQB E;  3HRN A;  5KLV E;  4H0L D;  1HH0 A;  4N3Y B;  1IFN A;  1WRG A;  1KIL E;  3LW5 J;  1HGV A;  1P84 E;  1OVV A;  3BCC J;  2W6A A;  3HUS A;  1M1K Q;  3ABV C;  3GF7 A;  5GAD a;  3W7X A;  1NTZ G;  1LTI C;  4XFJ A;  1VQO W;  2PGD A;  3CCQ W;  1SQP G;  1PL5 A;  3H1I D;  4JPZ B;  1K04 A;  3FXD A;  1BCC G;  1KIL C;  1R5L A;  2OYI B;  3CCS W;  2QJK B;  1PV3 A;  1Q86 X;  1OXZ A;  2KS1 A;  3V4W A;  2D2C B;  3GW1 A;  1LT1 A;  4PD4 E;  4UB6 E;  1M1J C;  4XE5 B;  2BCC E;  2J5U A;  1N7L A;  4BL2 A;  2QM8 A;  1PP9 G;  2A06 E;  2E74 C;  1BE3 D;  3KPE A;  3GG2 A;  4PJ0 E;  2E74 D;  2L91 A;  4IL6 X;  3H6P A;  1M56 D;  2FFD A;  5APT A;  3QWO C;  2RN0 A;  3L74 E;  1S9K E;  3AE8 C;  3CCE W;  3E1R A;  3KZI H;  1LT9 C;  1HUC A;  1H8A A;  3CC4 W;  1LT9 B;  2Z5I A;  3BCC G;  3I5C A;  1T8Z A;  3CWB E;  2BEQ D;  3D3I A;  3L73 G;  5DJU B;  1NGM B;  2WZ7 A;  2XKM A;  2IFN A;  5KJ7 D;  5APX A;  3WU2 E;  3GF3 A;  1FAV A;  3H1K G;  1FE6 A;  3L71 J;  1KV4 A;  2WMM A;  4YJM A;  2H88 C;  4UY8 Z;  3RBZ A;  3LID A;  2K3R A;  3ZG0 A;  1NTM J;  1JY3 N;  2M8R A;  3AEG C;  2ZJR W;  4H0L C;  1MZ9 A;  2IX7 C;  3SWF A;  3C9I A;  3WMM 0;  4TLF A;  1R6Q C;  5AW2 B;  2IDB A;  1VQL W;  2FBW C;  2IPP A;  5KLV D;  1S72 W;  4UB8 H;  5H2F H;  1KC8 Q;  3R4Y A;  1M1J A;  4DOJ A;  4N78 D;  3TGU D;  2B87 A;  2WPQ A;  1L4A D;  3L75 E;  3MIW A;  3HD7 B;  1OX3 A;  1QLE D;  3M06 A;  3CCV W;  3JSV C;  3E7K A;  1OZH A;  4YJX A;  5KAF H;  2GUS A;  4HJG H;  3HD7 D;  3CXH E;  4YXW H;  3B5N C;  1J1D C;  1MWT A;  3CCU P;  3P8C E;  1BGY E;  3P8C D;  1FZC C;  2FYU K;  1LTA C;  4IFF A;  3CX5 D;  3RL0 D;  5JVG W;  3S4R A;  4RJT A;  3L70 E;  1BCC E;  2H7H A;  1RH5 B;  3EQ2 A;  4BRY B;  1NU1 E;  1GTW A;  1SQP E;  3TYY A;  1OW7 A;  1S3J A;  3H32 A;  4LGD E;  3L75 D;  5EFW B;  4ZKP A;  3CCL W;  2R5B A;  1EXI A;  1SQX J;  3H1K E;  1N7S D;  3KQG A;  3CCS P;  1GU5 A;  3R2P A;  2KOG A;  1Z56 A;  3HE5 B;  2N1T A;  3CCQ P;  1KC8 X;  1W5C E;  2QRX A;  1VQ5 P;  1GU4 A;  5APU A;  1JY2 O;  1IFM A;  4MN4 C;  2DW3 A;  3U1A A;  2L5G B;  1U7J A;  3O2O A;  3A7O A;  2FYU G;  3L72 E;  2R44 A;  2I1J A;  1NKN A;  1QL2 A;  1UIX A;  1ZW0 A;  2I1K A;  1SFC C;  3ZFZ A;  2RMZ A;  5AVQ B;  1Q81 Q;  1M8O B;  1QVF O;  3V2N A;  1ZP0 C;  1VQ5 W;  3OAK A;  4IOA W;  4R4L A;  3N7N A;  1GZL A;  1VQ6 W;  4H13 B;  3O1F A;  2QA4 P;  1NHL A;  1L0N J;  1SQB K;  2ITA A;  2N9B A;  1R5S A;  1S9K D;  4Y99 C;  3L74 D;  1LTJ A;  1VQ8 W;  1PGP A;  3RGU A;  2ZT9 D;  2KP8 A;  1PP9 J;  2AXC A;  3EFF K;  3H1J G;  4U3F D;  2CK3 H;  2YO3 A;  3CXH D;  1RF1 A;  1VQ8 P;  1SQQ E;  1U57 A;  2HLO A;  3PH0 A;  1UII A;  1Q90 D;  2KXP B;  4IO9 W;  2IZ1 A;  3CC7 P;  4WFA W;  3L71 E;  4PD4 D;  2OAR A;  3AE7 C;  1YI2 P;  2PRR A;  3VP8 A;  4WY4 B;  5AVY B;  3L74 J;  4HKZ H;  1AV1 A;  1FDI A;  1L4A A;  1Y9B A;  1K73 X;  2LKM A;  2MJZ A;  2WWW A;  5HL7 W;  2HOD B;  5B66 E;  4GIF A;  1AQ5 A;  2E75 B;  1BSH A;  1L0L E;  2Y0E A;  1N73 B;  1XTG B;  3RK2 C;  4JF7 A;  3L75 G;  2R5D A;  3H1H E;  1S1C X;  1J1E C;  1PFI A;  1MV8 A;  1FBM A;  5CCG C;  1JM0 A;  2ZYD A;  1LNQ A;  1P84 I;  1L0L G;  2E75 D;  5CBN A;  3BRV B;  3AE1 C;  2B87 B;  3BRT B;  3VTP C;  1YQ4 C;  5M19 A;  2WPV B;  1VQL P;  3V2P A;  4KT0 J;  2Q3E A;  1WT6 A;  4L75 A;  3RK2 B;  1VQ9 W;  1AJY A;  5AVT B;  1IFD A;  4GKG A;  3H1J J;  5GW7 A;  1Q2N A;  1PIX A;  3VMX A;  1IFI A;  5AW9 B;  3FGA D;  3CCR W;  2WVR A;  3G4S W;  2XND H;  1ZR2 A;  1H89 A;  3AE3 C;  1QL1 A;  1KQS V;  2OGU A;  1OIP A;  4BWN A;  1YIJ P;  1GW4 A;  1MBX C;  3PIP W;  3O8Z A;  1EXJ A;  1MBV B;  1MBU C;  1IO4 A;  1EDJ A;  1VPC A;  3G3Z A;  3SFE C;  1X9V A;  2FFD C;  1DEB A;  2JDI H;  1DEE G;  4H13 D;  2QEX P;  5KJ7 A;  1NTK J;  3T97 B;  1QGK B;  1IFP A;  3C8V A;  2ZVO B;  2A06 G;  1ZXG A;  1YJW P;  2OYI C;  2IYP A;  1NJI Q;  3RBX A;  2FYN B;  4GOF A;  3L37 A;  2K9J A;  1MG9 A;  1USD A;  1VQN W;  1Y47 A;  1PPJ E;  1VDF A;  4C7N A;  3TGU J;  2BAS A;  2WSS H;  1NTZ D;  2FXP A;  5BU5 A;  1S5L E;  1BDD A;  1IZN B;  1LP1 B;  4I1L A;  2OYH C;  1M1K X;  1HTL C;  2FY8 A;  4GT1 A;  4C7R A;  1EC5 A;  1DD4 A;  3L70 J;  4I7Z C;  3ITK A;  3AEF C;  1VQO P;  3CD6 W;  3RL0 g;  1TU3 F;  2Y0C A;  2W8Z A;  3PJS K;  3L73 D;  3HUS C;  2WT7 A;  4PV1 B;  3FXE A;  1M1J B;  3O1F B;  3H32 B;  2KUB A;  1PGJ A;  1AVO A;  4R4M A;  1K8A X;  3SSU A;  3UIA A;  3II6 A;  3LIE A;  1R8E A;  5AW5 B;  4OH8 B;  2I8D A;  4PD4 H;  2ZJP W;  4EIJ A;  2AXT E;  1PP9 D;  4H44 C;  2WIT A;  1RE3 C;  2OTJ W;  3BVH A;  3WUU A;  5CCH C;  1L0L J;  3M9Q A;  2IZ0 A;  1JCC A;  3CPW O;  1K05 A;  1BGY G;  2E5T A;  4AQR D;  3TGU G;  4WCE W;  2WA8 A;  4D6T E;  1H0T A;  3PIO W;  1YIJ W;  3H1J D;  3CWB D;  4RO0 A;  2AEF A;  1FZC B;  1MWR A;  3G4S P;  2O01 N;  4IFD K;  3G71 P;  2XU6 A;  2IBZ D;  4WFB W;  2ZYA A;  3M9B A;  2E76 B;  3HE4 A;  1SQV K;  3VMY A;  2Q5U A;  1OW8 A;  3GHG C;  3CC2 P;  2KNC A;  1SQQ J;  2YKP A;  2J59 M;  1BE3 G;  1NTZ K;  1K9M Q;  3L4F A;  2ZAE B;  5CBO A;  1KIL B;  2ZJQ W;  3KHU A;  3HTK B;  1RQS A;  1VQM P;  2NPS A;  5BVZ A;  3HE5 A;  5GAE a;  1RY3 A;  3EFG A;  5KAI H;  3Q2Y A;  2M0B A;  2AEJ A;  1X8Y A;  1MWS A;  4CJN A;  1KD1 X;  1ZME C;  5KLV J;  4RES B;  1EZV D;  1BGY J;  1OWA A;  4WY4 A;  1YTZ T;  2RH0 A;  2JWA A;  2N9Y B;  2HPC A;  4H0L B;  4AYC A;  1FOS E;  1L0N D;  2W83 C;  3U59 A;  3L73 E;  3PP5 A;  2QVA A;  2O1J A;  2XZR A;  2D2C C;  1IK7 A;  2IYO A;  1BSN A;  1NWQ A;  3RK3 C;  1JB0 J;  2OYH B;  3MZW B;  5AW1 B;  3L70 D;  2JO1 A;  3TK1 A;  2CPB A;  5K5G B;  1KB9 H;  1YI2 W;  1BE3 J;  4U3F E;  1FJP A;  2C9N Y;  1EDK A;  3C1L A;  1FZA A;  3MGN A;  2WSC J;  1FS0 E;  3L71 G;  3A0B H;  1GL2 C;  5APS A;  1M57 D;  1RE4 A;  4BXL A;  1KB9 I;  4WB4 A;  1KYO H;  1IJD B;  2POH A;  3TDK A;  5AVR B;  3JCU H;  3RK3 D;  1HGZ A;  5E79 H;  1VQP W;  3RK3 B;  2D2C D;  1PZQ A;  3ZDM A;  5C39 A;  1JJ2 V;  1NTM E;  2O01 J;  2FXO A;  5TIS H;  2JP3 A;  1A02 J;  1VF5 B;  3Q5R A;  3RL0 B;  3S1K A;  3AEC C;  2VRS A;  1SQQ K;  1L0N G;  4C7N B;  2KLV A;  4WFN W;  1GL2 D;  3V4Q A;  3TNU B;  2NPS C;  2K88 A;  2O3J A;  4JBZ A;  4BL3 A;  4IL6 E;  5B5E H;  1XTC C;  1DIP A;  3B71 A;  1KB9 D;  1SFC A;  3SWY A;  3W67 A;  3HD7 C;  1NAY A;  1ZN5 A;  1L0N E;  2B9B A;  1LWU C;  2QJY C;  3T97 A;  4ZMD A;  3CCJ W;  3IFM A;  1N7S A;  3P32 A;  2M5A B;  3G1B A;  4NPD A;  1YYC A;  1L0L K;  1NU1 D;  2E43 A;  1RF0 C;  3G3P A;  2OTL W;  3CCL P;  1MKM A;  1URQ B;  1S72 P;  4A7P A;  1M7L A;  4U3F G;  2PFX A;  3H1L J;  5DM7 W;  5M1B A;  3EWK A;  1LTB C;  3CX5 I;  1VQK P;  1SQB G;  3L72 D;  3MUD C;  3WUV A;  1T3U A;  1H0T B;  3KYQ A;  4YTP C;  3CMA P;  1PPJ G;  2A45 I;  4D6T D;  3IN6 A;  4AUW A;  5GTH E;  4OWF A;  1URQ A;  3Q5S A;  2QM7 A;  4ASV A;  3DLL W;  1QVG O;  3NFQ A;  1W2B V;  1NOH A;  4GDO A;  4WF9 W;  3USS A;  1SQV E;  4IL6 H;  2YMK A;  2V7Q H;  3KXD A;  2OTL P;  5M1A A;  5APY A;  3PTZ A;  4W7Z A;  3CCR P;  1BCC D;  3CC4 P;  1DD3 A;  1SVF A;  1KZU B;  2R3S A;  1HVV A;  2K9J B;  3CCV P;  4D6T J;  3CX5 E;  5B66 H;  1NTM D;  1GL2 A;  1J1D B;  3H1K J;  1N8R Q;  3CF5 W;  1T3J A;  2QE7 H;  1P84 H;  1LP1 A;  4K35 A;  2OYI A;  2YMY A;  5TJH A;  3PLN A;  3P8M C;  1SS1 A;  3RK2 D;  1ZRT E;  4PV1 D;  1NU1 K;  1NH4 A;  1RF1 B;  1IK9 A;  3H1L G;  2UWJ E;  1NTK D;  3BCC D;  4DCK A;  4WVZ A;  4N6J A;  1YIT P;  2KNC B;  1NAF A;  2V4H A;  4GOE A;  2IBZ E;  3TGU E;  5KLV K;  5AW7 B;  4IOI H;  1RQV A;  4YKA A;  3AE5 C;  4NPF X;  1KYO I;  1FDM A;  1YJ9 P;  2YNY A;  1VQP P;  2JJL A;  1S5L H;  1SLQ A;  3OW2 V;  4OVN F;  1VF5 C;  3RL0 C;  3G19 A;  1GW3 A;  2W6B A;  1YBK A;  2P7J A;  3OA7 A;  1SQP J;  2P58 A;  2KSJ A;  1KYO D;  2KZJ A;  2HPC B;  2KS1 B;  3L75 J;  1SQX E;  3MTU E;  1SQX D;  2WSE H;  3NXS A;  5CHX A;  1LWU B;  2QJY B;  3CL3 D;  4H13 C;  1RQU A;  5CCG A;  3WUT A;  2BCC G;  2JKV A;  1NO4 A;  2C0X A;  1JEK A;  2ZJS E;  1BGY D;  4H44 B;  1JOC A;  1FZG A;  3AED C;  1QVF V;  3HTK A;  1ZV8 A;  1S5L X;  3H1J E;  2QIW A;  4PD4 I;  4CPG A;  2Q6Q A;  4W7Y A;  1AA0 A;  4RKU J;  1YQ3 C;  4C46 A;  1EDL A;  1NTK K;  1NTZ E;  2HOD A;  2M5A A;  4L76 A;  1PGQ A;  3KZI E;  3TF5 A;  3CI9 A;  3CWB J;  5AVW B;  1PPJ D;  1NYH A;  1SP4 A;  2YKQ A;  4I7Z B;  1FJK A;  3CX5 H;  5CJ0 A;  3IF4 A;  2KB7 P;  2WT7 B;  3H1L D;  1K8A Q;  1CZQ A;  5APW A;  2W6J H;  1GD2 E;  4EI2 A;  3G9R A;  3W7S A;  5AW3 B;  4K3A A;  4DT0 A;  1KD1 Q;  3O2H A;  2AXT H;  3CXC V;  5AVZ B;  5AW4 B;  2OTK E;  2P2U A;  1E79 H;  1W2E A;  3G71 W;  5DJT B;  1JMB A;  5KLI C;  2BCC J;  1YTZ I;  2IFM A;  1ZLL A;  1RE4 C;  2ZYG A;  3AE2 C;  5APV A;  1P84 D;  1BDC A;  1EZV G;  1CI6 A;  1JO5 A;  2K37 A;  3L72 G;  3CCM P;  1SQB D;  1SQP K;  3D71 A;  1VQ4 W;  4WY4 D;  1SQX K;  2LXB A;  1KN7 A;  2Y9Y A;  2IBZ G;  1BXY A;  1LGH B;  3A3Y B;  5GAG a;  2ZVN B;  4DKI A;  3AE6 C;  1KOR A;  1MWU A;  3L70 G;  2H89 C;  2KLU A;  1HJ0 A;  2H43 A;  2P10 A;  3HE4 B;  5KJ7 C;  1AFO A;  1M90 X;  1CTF A;  3F5H A;  1YJ9 W;  4JYB A;  1BE3 E;  3H1L E;  4Z1M H;  3CXH H;  2YIU B;  1LTJ C;  2ZT9 C;  2NPS B; 
#chains in the Genus database with same CATH homology
 4XFJ A;  2WA8 A;  1VF5 D;  3T97 B;  2G3A A;  3GMA A;  1FDO A;  1NYH A;  3EWK A;  5M1B A;  3C8V A;  4I7Z B;  1R6Q C;  2WSC J;  1PL5 A;  4H44 D;  4Y28 J;  2IDB A;  2FBW C;  1K04 A;  2MKV A;  4OGQ B;  1RQV A;  2E75 B;  2ZT9 B;  5L8R J;  3O2O A;  1PV3 A;  5KKZ C;  3AE4 C;  2FYN C;  3R4Y A;  4YKA A;  3AE5 C;  4YTP C;  2G8Y A;  3IAO A;  2D2C B;  3GLM A;  1MG9 A;  2QSI A;  3G9R A;  4OGQ C;  3GW1 A;  2E76 B;  1S1C X;  2D2C D;  2O01 J;  1OW8 A;  3O2H A;  1UIX A;  4YXD C;  1GMJ A;  2J5U A;  3IN6 A;  1R6O C;  2E75 D;  2JP3 A;  3DNJ A;  3Q5S A;  3AE1 C;  2FXP A;  1VF5 B;  1VF5 C;  1WMK A;  1KQF B;  3Q5R A;  3G19 A;  1VL2 A;  3AEC C;  5KLI C;  2E74 C;  1YQ4 C;  2V7Q J;  3S9O A;  2K9Y A;  2WPV B;  4YJX A;  1RQS A;  2E76 D;  1ZP0 C;  4KT0 J;  3AE2 C;  4GDO A;  3O2B A;  1DD4 A;  2E74 D;  4I7Z C;  4R4L A;  3AEF C;  2BEZ F;  4H13 B;  4IL6 X;  1LZW A;  3O1F A;  3RL0 g;  2YMK A;  1TU3 F;  2E74 B;  1AJY A;  3D71 A;  3Q2Y A;  2QJP C;  3AE8 C;  1KTM A;  2E75 C;  2YIU C;  2QJK C;  1DD3 A;  4PV1 B;  1DIP A;  3B71 A;  1ZME C;  2ZT9 D;  4H13 C;  1KQG B;  3O1F B;  1PIX A;  1RQU A;  3AEE C;  1OMI A;  2E76 C;  3Q5P A;  2OQQ A;  3D6Z A;  4R4M A;  4U7J A;  2BEQ D;  1R8E A;  1OW6 A;  2NZ2 A;  4TT3 H;  3FGA D;  3Q3D A;  4H0L B;  1NGM B;  3AE6 C;  2QJY C;  1KOR A;  1U57 A;  4H44 C;  3AEA C;  4H44 B;  3GQ0 A;  1Q90 D;  2WQY C;  2H89 C;  1HJ0 A;  2P10 A;  3D6Y A;  3GF3 A;  3GQ1 A;  3AED C;  1ZOY C;  1OW7 A;  3SFD C;  4OGQ D;  3AE3 C;  3H25 A;  4H0L D;  1HF9 A;  1KMI Z;  1S5L X;  2WSF J;  3Q1M A;  3AE7 C;  1KIL E;  2D2C C;  1IK7 A;  3RK3 E;  3D70 A;  3G1B A;  1CTF A;  3LW5 J;  2H88 C;  2QIW A;  1MBX C;  4YJM A;  1ZRT E;  4PV1 D;  1K05 A;  3AE9 C;  1EXI A;  1JB0 J;  2WA9 A;  1EXJ A;  1MBV B;  2WSE J;  3ABV C;  3AEB C;  2W9R A;  3GF7 A;  1MBU C;  1FDI A;  4Z1M H;  3G3P A;  4PV1 C;  3AEG C;  4RKU J;  3SFE C;  1Y9B A;  1YQ3 C;  2JO1 A;  4H0L C;  2ZT9 C;  4H13 D;  3O6Q A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...