1RQVA

Spatial model of l7 dimer from e.coli with one hinge region in helical state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
b'SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7/L12
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rqvA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rqvA02
3DNJA 1MBXC 1MBUC 1R6QC 3O1FB 3GQ0A 4YKAA 3O2HA 1DD4A 3G19A 1MBVB 2W9RA 1CTFA 3O1FA 4YJMA 3GW1A 1DD3A 3G3PA 1R6OC 1RQVA 1MG9A 2WA8A 3G1BA 1LZWA 3GQ1A 3O2BA 1RQSA 3O2OA 4YJXA 1RQUA 2WA9A
chains in the Genus database with same CATH superfamily
1T8ZA 3JCUE 3RBXA 2J58A 3O1FB 1MZ9A 1KORA 4UB6H 4JF7A 3G3PA 5AVVB 4IL6H 5APVA 3L71D 3W7SA 1WT6A 2OYIB 1S9KE 1YJNW 1SQVK 3AE7C 2WITA 3ABVC 1J1DB 1NU1K 1DD4A 3CD6W 1SQPD 3U1CA 1DIPA 1FOSE 4IOCW 2IBZE 1LWUB 3EWKA 1Q7YQ 1HVVA 5H2FE 3V5BA 2JP3A 3PRJA 2XNDH 1Q82Q 1N73B 2OTKE 2HODB 1K04A 1VQ9W 1SFCC 1Z56A 1VF5B 1EZVG 3G1BA 5TJHA 2HG5D 1M7LA 1K9MQ 3U59A 4R4MA 3NTNA 2E5YA 3O2BA 3CC2W 5AVWB 1BCCG 3IN6A 3CXCV 1NAFA 4CPGA 4C7NB 2KNCA 3Q5RA 3HTKB 1QGKB 5GAGa 4CPKA 5CCHA 1K8AQ 3Q3DA 2K1AA 3L75G 1NTMG 3MUDC 2M5AA 3B71A 1VQLP 3JSVC 5K5GB 3CCSP 1KMIZ 2IYPA 4AQRD 1VQNP 2MKVA 2KYVA 2FXPA 2NPSC 1JUNA 3I56W 1KYOD 3V4QA 2FY8A 1JEKA 1LTJA 2E43A 1RH5B 4ASWA 2P10A 3SWKA 5APXA 4W7YA 3W7UA 3Q5SA 3TK1A 2N1TB 1LTAC 3VOPA 4A7PA 1LTIC 3L74G 1AV1A 2N9BA 1L0NJ 1NTKD 1VQPP 2AXTH 2WPVB 2P67A 1S72W 4WY4B 3EQ2A 3UIAA 3O8ZA 1YITW 2FKWB 2KLVA 3KZIE 2WSEJ 1MBXC 4HYTB 2QVAA 3L36A 1MKMA 4PJ0H 3L73G 1KTMA 1RE4C 3HE4A 3H32B 4QMAA 3SSUA 1VQ4W 3RK3C 2YO2A 3P8CD 1KB9I 4NPFX 2OYHB 1Q86Q 1FZBA 3H1KD 3CL3D 1PV3A 4ASVA 2QA4W 1HUCA 2ZFCA 1Q81Q 2V7QH 4BL3A 3WUVA 3N4XA 4GOEA 1VQOW 1SP4A 4H13B 1BGYJ 1ZMEC 4U3FE 3O1FA 4HJGH 2YO3A 1D7MA 4RO0A 4HB1A 3WU2H 2QSIA 3GLMA 3NFQA 1CI6A 3D6YA 1AQ5A 2GUVA 3TGUE 3U1AA 3RK2D 3AE5C 1HBWA 3CWBJ 2QEXW 5CJ0A 3W7WA 1EDLA 4YJMA 3L70G 1BE3G 3H1HJ 3HE5B 1JY3P 2A06E 2Z4EA 2H88C 4BWNA 3GW6A 2WPSA 3FWLA 1EZVD 1LWUA 1AVOA 1S2EA 3CXHI 1NTZJ 3M06A 3O2HA 3SFDC 3CCUP 2HODA 3C8VA 5APQA 5BU5A 2NZ2A 1S4XA 2HYNA 4EYYQ 3RL0C 5CCHC 1SQPK 2DW3A 2IDBA 2QG4A 1SFCB 5M1BA 2YKOA 3L75D 3VMAA 2JKVA 4DOJA 1NTMD 3BCCD 2C0WA 3A0HE 2W9RA 1KD1Q 4K35A 4PV1C 5AW3B 3HTKA 1K73Q 1KILE 1LTJC 1HF9A 1OW7A 1ZRTE 4XA4A 1LP1A 2ZAEB 4H0LC 5JVGW 1USEA 1LTGC 4PD4H 1JMBA 1HGVA 2OYOA 1AVYA 2HR3A 1VQMW 1YIJP 2IBZG 1JTHA 3RBZA 1K8AX 2R3SA 2PRRA 4OGQD 2BCCJ 3V2QA 1SS1A 1FOSF 3CC7W 2NPSB 1YJWP 2Q1KA 1SQQE 3CCVP 1HJ0A 1SQXD 4BXLA 2XKMA 3CX5E 4PD4E 1JCDA 1QX8A 1HGZA 1QL2A 1JCCA 2IFNA 5TISE 2VRSA 3OA7A 3V4WA 5E79H 4I2LC 3H1LJ 3L73D 1L0LJ 3CMEW 4WVZA 2OTLW 1T2KD 1KFNA 2ZJSE 3SWYA 2ZJPW 2B87B 4JBZA 1VL2A 5AW8B 2KUBA 5AW9B 2KSJA 2OTJP 1NTKK 3AEFC 4RKUJ 1GW3A 2OYHA 2L5GB 1KQFB 1VPCA 3L71J 3RK3B 3AEEC 3B8EB 1VQ8P 3G71P 1J1DC 1Q86X 2ZYDA 1E79H 2Q3IA 3TDKA 1PP9D 5KAIH 1FZAA 1VQ6P 4LLHA 1OW8A 1FZFA 1SQPJ 4LGDE 3L70D 1BE3D 2W6JH 5GTHH 1ZN5A 1LWUC 4D6TE 2SPZA 4K3AA 5BVZA 4HH2A 1SQBE 4U67W 4H44D 3CWBD 3HE5A 5CBNA 3CPWO 1KYOI 2FFDA 2ZXXA 1KQGB 2P7JA 1K05A 1YHQW 4EIJA 2Y9ZA 2Y9YA 3VMZA 1M8OB 1YJ9W 2V7QJ 3RGUA 1QEXA 2FYNC 1S9KD 3GHGA 3FXDA 3PLNA 2D2CD 2KNCB 2YNYA 3CC4P 3ZDMA 4EDFA 3CMAW 3RL0B 3TGUG 3A3YB 2E74D 3AEGC 1VQKP 2ZJQW 2J5UA 4I7ZC 3T97A 2QE7H 4JYCA 1MWTA 4PV1B 1KD1X 2A06G 2K3RA 3H6PA 4U7JA 1LTJB 3S1KA 4H0LB 3AEBC 1URQD 1EDKA 1T3JA 1NTKJ 3CCEW 3KXDA 3BRVB 1N2DC 3RK3E 5KLIC 3G19A 1S5LH 3HRNA 3VMXA 2R44A 4N78D 4IFDK 5KTBA 2KSEA 1SQVE 3KQGA 1YJNP 1CW5A 2M3BA 1NU1E 3W7TA 1ZP0C 5AW1B 1JO5A 3CD6P 2YIUC 3H1KJ 5KJ7D 4UY8Z 1U7MA 1IK9A 2A45G 2P1JA 1SQXK 2HFED 4GOFA 1EZVI 4TT3H 1FE6A 2N9YB 1BGYE 1RY3A 3F89A 1VQ9P 1P84E 3CPWV 1RE4A 4GIFA 3H1JD 1OMIA 2BASA 1SQQG 1L0NK 3W68A 2LXCB 4TLFA 1G2CA 3CC2P 1CI6B 1J1EC 2WA8A 5H2FH 1FS0E 3EFFK 1KQLA 1MUUA 2KIKA 2FFDC 3H1HE 3CI9A 3AE9C 4KT0J 2H43A 2B88A 2FYUD 1N86A 1GZLA 5CMZA 4UB8H 3RK2C 2RH0A 1BCCJ 1QVFO 1S5LX 3I56P 3AE3C 4DZOA 3GHGC 3LW5H 5AVZB 3VTPC 3G9RA 1YBKA 1VQ5W 5APWA 2ZYAA 3L75J 5AW5B 3L37A 4UB8E 1NTMJ 3BCCJ 3GF7A 1IFMA 1VDFA 1UIXA 4L75A 2KXPB 2KS1B 2I8DA 3M91A 1S72P 3V2NA 2K9JA 3R4YA 1GL2D 1YITP 2UWJE 3P8MC 2FYNB 4IO9W 3W67A 2BEQD 2A06D 1LP1B 1M1KX 4D6TG 1TU3F 1SQBG 4Z1MH 2BCCE 1JTHB 4IL6X 1VQ4P 1AFOA 1Q90D 1MWSA 1NTZK 3CCJW 4I7ZB 1J2JB 5AW6B 1SQXJ 2JJLA 1N7SD 2E76D 2QA4P 3KZIH 3WUTA 4GDOA 1EDJA 1OW6A 4OGQC 2XU6A 2KI7B 1VQOP 2Z5HA 3L73J 3OAKA 2BEZF 1N8RQ 1NHLA 3H1LE 2O1JA 4C7RA 4WFAW 1PPJE 5APYA 1GDTA 2QRXA 4AYCA 1JOCA 1KILD 3TF5A 1ZRTD 3GQ1A 1URQA 5KLIB 1OFCX 4Y99C 2QJKC 2QEXP 1MBUC 2YXQB 3A5TA 1NAYA 3AEDC 4GODA 5KLVD 1VQ7W 4OWFA 4JPZB 2OARA 5GW7A 2RMZA 1T2KC 2XDJA 3Q1MA 1SQQD 2IPPA 2V4HA 4PD4D 3W7XA 2YIUB 3EFGA 1QVFV 2W90A 1PP9J 1XTGB 1FZGA 1YI2W 3L70J 1AJYA 1KV4A 1BE3J 5AW7B 1SQPE 2IZ0A 1KN7A 3DLLW 4WF9W 3IAOA 1L0LK 2W8ZA 3FX0A 3I55W 3D70A 1NJIX 2R3CA 1SQVG 1GK6A 1GTWA 1NU1G 3L4FA 1J1EB 4HKZH 1HH0A 3H1IE 3Q2YA 5DJUB 2FFDB 4YJXA 1VQMP 3B5ND 2WT7B 5KKZC 3A0HH 3D6ZA 3RK2B 1BCCD 1BGYG 2WVRA 1CSBA 3MD0A 3CC7P 2RKLA 1LTSC 5AVRB 3GHGB 2W6BA 3PP5A 3WUUA 1SFCD 2WA9A 2FYUK 2A45H 1OIPA 1UIIA 1A02J 3KPEA 2KS1A 1KYOE 1CTFA 1SQBD 3CCMW 2WSCH 3CMEP 3T97B 3H1HG 5CHXA 1N7LA 4M3LA 1JY2N 3AE8C 2OTLP 1DX7A 3CX5H 3K5BA 5BU8B 3ZFZA 2E75D 2E74C 1OZHA 1BDDA 1YQ3C 3AEAC 4IFMA 5TISH 2J59M 1NTKE 2WPRA 1GL2A 2NPSD 3L74D 2O01H 1T3UA 2K88A 3L72E 1URQC 2W83C 1FZEA 3A0BE 2O3JA 3IR9A 1OXZA 1DEEG 4DCKA 3PIOW 4OGQB 1FDOA 3KDPB 1N8RX 1SVFA 2YKPA 5CJ4A 2G3AA 3H1KE 1RF1C 3CLQA 1FZCC 5AW0B 1QLED 1GK4A 1YYCA 3ZG0A 1GD2E 3V2PA 2Q9IA 2BCCG 4Y99B 2QJKB 2XV5A 4JQ0D 3H1JJ 5APTA 2KOGA 1YHQP 2KZJA 1IFPA 1LGHB 2G8YA 3M9HA 5CCGD 2OGUA 3N7NA 1YJ9P 5GAHa 5M19A 4ZNCA 1G2CB 1SQVD 2R5DA 3CCRW 2ITAA 1M57D 1NU1D 3H1LG 1LT9A 1PPJG 5B5EE 5KLVK 2FYUJ 1KC8Q 3Q5PA 1NYHA 1QVGO 4BL2A 1KQSO 3CMAP 5AW2B 2JWAA 3A7OA 1JY2O 1ZXGA 3OW2O 2QJPC 1IC2A 1W5CE 4CJNA 1RQSA 5AVXB 1H8AA 1P84D 3HD7D 1IK7A 2K9YA 2JEEA 2WT7A 1NTME 3BCCE 3CCQW 1Y8AA 4L73A 4GT1A 3CCEP 1CZQA 5EFWB 1BSNA 1MFTA 1FU1A 5KKZB 1PL5A 1W2BO 4U3FG 4WCEW 1SQPG 1EQ7A 1M1KQ 1S3JA 2K9JB 1NH4A 3AECC 1ZW0A 5CCHD 3B5NA 1JJ2V 1G1IA 1U7JA 5GADa 2IBZD 4WWIA 1GL2C 3O2OA 3A2AA 4PV1D 3KYQA 3H1IG 4L74A 1SQXE 2Y0CA 2M0BA 3TNUA 2WSEH 2KK7A 3C1LA 2ZXEB 1L2PA 2JO1A 4PD4I 2E74B 1WMKA 1NTMK 1EXIA 3PH0A 4NPDA 1L0NE 1FDMA 1FC2C 4WFBW 2E76C 1G1JA 3CCLW 4WBAA 2O1KA 3GW1A 3CF5W 3G4SW 2IX7C 3PIPW 1EXJA 1URQB 5B66E 5KLVJ 1GU4A 2WPQA 2H7HA 1KILC 1P84H 2QJYC 2ZT9D 1QVGV 2IFMA 1SQQJ 1M1JA 3I5CA 1L4AD 1USDA 3LIDA 3RL0g 3SFEC 4DT0A 1ZR4A 2M3EA 1OVVA 1RF1B 1FZCB 1PP9E 1R5LA 3OW2V 3VYIA 1NTKG 1LT9C 3E1IA 1KB9H 3HUSA 2C9NY 2LXBA 1VQ5P 2M8RA 5CBOA 3AE6C 3VN0A 1NO4A 2O01J 3M0AA 1NJIQ 3L72G 3IFMA 3FXEA 3PJSK 1AQTA 1OX3A 3CWBE 4BRYA 1W2BV 5AVTB 1NGMB 1KB9E 3MGNA 5CCGA 1KFMA 2O01N 4AUWA 4KHXA 3H1KG 1JNMA 1NKZB 2HPCA 1RQVA 1KC8X 5AVYB 1NTZE 3CCJP 2AEJA 1X22A 1ZOYC 3G3ZA 4KJMA 2JWDA 2QJPB 2YMKA 4U3FD 1VF5D 3CXHH 2P2UA 3JC22 3B5NC 4UB6E 4D6TJ 2YMYA 2I1KA 1LTBC 4IL6E 4EOTA 1XTCC 1BDCA 1SQBJ 3TGUD 1JY3N 3G6EW 2LR2A 1ZLLA 3HD7A 3H1ID 4RJTA 1R6OC 2W27A 3CXHE 2CPSA 4Y28J 4I6MC 2XZRA 3S9OA 2GUSA 1MV8A 3M9QA 3D71A 3AE1C 1VQ7P 3L74J 2B9BA 1R8EA 4C46A 4O9BA 3FWNA 4YPCA 5M18A 3B4SA 1GL2B 2ZVOB 2PAJA 4DJGA 2WZ7A 2E75C 3R2PA 4N78E 4JYBA 3D3IA 1YQ4C 2MJZA 3BCCG 2WSFH 4IFFA 2N1TD 1FJKA 1JMMA 1YI2P 4ZKPA 3O6QA 3E7KA 2E5TA 1H0TA 3V6IA 4WY4D 1EC5A 4GKGA 1JM0A 1X8YA 1L0LE 2CK3H 1RF0C 2XNXA 3I55P 1M1JC 1X9VA 1NKNA 1OVRA 1N7SB 5APUA 3VP9A 2E76B 4N6JA 5M1AA 2R32A 4WB4A 3QWOC 1M90X 4YTPC 3M0DA 5APSA 3HUSC 3ZG5A 3H1JE 1MBVB 3II6A 4W7ZA 1IFDA 4EI2A 1SQXG 1DH3A 2Q7CA 1EDIA 1KILB 2IYOA 1P84I 2QJYB 3L72D 3FGAD 4IOIH 4XFJA 1RF1A 1FZCA 3L71E 1SQVJ 3CX5D 2E42A 2K37A 1NU1J 5HL7W 3VP8A 4H13D 1R6QC 1VQLW 2R5BA 2CPBA 3CCSW 1VQNW 1L0NG 3MZWB 5CCGC 2FYUE 2AXTE 1LT9B 1JY3O 1NWQA 1L4AA 5KJ7A 1HJBA 4YXDC 4YXWH 1FJPA 3QH9A 1NVOA 3S4RA 3CCMP 1MWRA 1SLQA 4PJ0E 2IBZI 3PTZA 3ITKA 4W80A 2QM7A 1X0TA 1VQPW 3DNJA 3BRTB 2OYIA 3AE4C 2JDIH 1ZR2A 2Q6QA 1PP9G 3TYYA 1BXYA 1KYOH 1LJ2A 2YXRB 1Y9BA 3M9BA 1W2EA 4H44C 1T6AA 4B86A 4ZMDA 3HD7C 1YTZI 5KAFH 1R5SA 3WU2E 2NRGA 1MFZA 2FXOA 2QM8A 4D6TD 3B5NB 2Q3EA 3CWBG 1N73A 2KP8A 1PGQA 3J7ZZ 3P7KA 1Q7YX 2D2CC 2Z5IA 1KZUB 2LKMA 5KAFE 1Q82X 3A0BH 3KHUA 1PZQA 2AXCA 4I1LA 3TNUB 1QL1A 4MN4C 4C7NA 2P58A 1NTZG 4RESB 1K9MX 2ZJRW 3MP7B 4N3YB 3LW5J 2WQYC 1S1CX 3L35A 1RQUA 2WSSH 3USSA 2Y0EA 3VMYA 1ZV8A 3MHVA 1Q2NA 1JB0J 2OQQA 2E75B 2AEMA 3CCRP 3M0DC 1LTTC 2B89A 5KLVE 3MTUE 5CA3A 1GU5A 4R4LA 3CCUW 1OWAA 1A02F 1PGJA 5AVQB 3SWFA 4OH8B 2ZVNB 3P8CE 1N7SA 1FBMA 1IJDB 2WMMA 1M1JB 2N1TA 5AVUB 1MWUA 1IFNA 2Q5UA 1E5WA 4WFNW 4WY4A 5B5EH 2ZT9C 1MG9A 1KILA 1L0ND 1L4AC 3HUSB 5KJ7C 2FBWC 2PGDA 3MIWA 3CCQP 3RK3D 2WSFJ 3IF4A 3TSIA 1PFIA 3GQ0A 3LIEA 5AW4B 1DD3A 1IO4A 1YIJW 3H32A 5E79E 1Y47A 1BSHA 2PP6A 4BRYB 1L0LG 2WTYA 1EZVE 2OYIC 1YJWW 3CCVW 3WMM0 1SQQK 1RHZB 2HPCB 1BCCE 1GMJA 2RN0A 1H88A 1RE3A 1Q81X 2GA1A 3OJAB 1VQQA 4LC1A 4U3FJ 2QIWA 3H1JG 1BGYD 4NPEA 1YTZT 5DM6W 4XE5B 3V2RA 1GW4A 1M56D 3L75E 3L71G 3TGUJ 5DM7W 2FYZA 2L91A 2YKQA 1N73C 1IFIA 3BATA 1PGOA 1LZWA 5KAIE 3BVHA 1VF5C 1WRGA 3H1IJ 3CCLP 2FYUG 4H44B 2OTJW 1KB9D 3H1HD 5GTHE 3HD7B 3RL0D 3G4SP 1FDIA 2C9LY 1JY2P 3F5HA 1VQ8W 2A45I 2H8PD 3G71W 3AE2C 1NTZD 3L74E 4OVNF 1VQ6W 5C39A 3E1RA 1H89A 5GAEa 1SFCA 2D2CB 4H0LD 3NXSA 3NMDA 1DEBA 5B66H 2KLUA 2WWWA 2M5AB 3CX5I 3L73E 2JR8A 2FXMA 2IZ1A 4ZKUA 3O6QB 1SQBK 3GG2A 5GTIH 2POHA 1H0TB 1N7SC 1IFJA 3BASA 1K73X 1M90Q 2N1TC 3CXHD 3MUDA 2AEFA 1LT1A 4WY4C 1NOHA 2NPSA 2BCCD 5L8RJ 3PHLA 1HWTC 4DKIA 2WSCJ 3L72J 3P32A 5GTIE 1RF0A 3GMAA 1KQSV 1HTLC 2KZIA 3CC4W 5JVHW 5AVSB 3GF3A 1U57A 1AA0A 1PIXA 1IZNB 3JCUH 1LNQA 2H89C 1VQKW 2ZYGA 3L70E 5DJTB 4IOAW 1BE3E 2OYHC 3H1LD 2Y0DA 3HE4B 1PPJD 2C0XA 2KB7P 4L76A 4YKAA 1L0LD 1PGPA 2ZT9B 3H25A 2I1JA 1X79B 2B87A 2PFXA 1L4AB 1S5LE 2W6AA 4H13C 3C9IA 3G6EP 1RE3C 1FAVA 2HLOA 1OVUA 2GM4A 5KLVG
chains in the Genus database with same CATH topology
1NYHA 2FBWC 1HJ0A 1KMIZ 4YTPC 1KQGB 2E75D 2E74C 2MKVA 1K05A 1YQ3C 2E76C 1ZOYC 2FXPA 3AE5C 3AEAC 3O1FB 2WSFJ 2D2CB 4H0LD 3GQ0A 3R4YA 2YMKA 1KORA 2YIUC 1VF5D 1MBVB 1AJYA 4YJMA 3GW1A 1DD3A 3G3PA 2BEQD 2P10A 2V7QJ 2D2CC 2QJPC 1EXJA 2FYNC 1TU3F 4TT3H 3FGAD 3IAOA 2H88C 4XFJA 1RQSA 3D70A 3Q5SA 2D2CD 3AE7C 2QJYC 3ABVC 4Z1MH 1IK7A 2ZT9D 4IL6X 2K9YA 4H13D 1R6QC 1Q90D 1OMIA 1DD4A 3O2HA 3SFDC 1VL2A 4I7ZB 3RL0g 2WPVB 3SFEC 3C8VA 1GMJA 1R6OC 2E74D 3Q2YA 3AEGC 3LW5J 4OGQB 2E76D 2NZ2A 1FDOA 1DIPA 2J5UA 4Y28J 2WA8A 2WQYC 4I7ZC 1PL5A 4GDOA 1S1CX 2QIWA 2WSEJ 4YXDC 4RKUJ 3AEFC 3EWKA 4YJXA 1RQUA 1OW6A 3S9OA 4OGQC 2G3AA 1MBXC 2IDBA 3B71A 5L8RJ 5M1BA 5KKZC 3D71A 3AE1C 2WSCJ 1KQFB 4PV1B 2BEZF 1JB0J 2JP3A 2OQQA 1MKMA 3AECC 3AE6C 1R8EA 1KTMA 2E75B 3D6ZA 2O01J 4U7JA 1K04A 3AEEC 3AE9C 4KT0J 2W9RA 3GMAA 4H0LB 4PV1C 1VF5B 3AEBC 2E75C 3GF3A 4R4LA 1KILE 1U57A 1HF9A 1OW7A 1OW8A 1YQ4C 3G1BA 1ZRTE 1LZWA 1PIXA 4H0LC 3GQ1A 1VF5C 4R4MA 3O2OA 3O2BA 2H89C 2WA9A 4PV1D 1S5LX 1PV3A 3DNJA 2G8YA 2QJKC 3IN6A 3AE3C 1MBUC 4H44B 3AE4C 3O6QA 3AEDC 1NGMB 3RK3E 5KLIC 3G9RA 4YKAA 2ZT9B 1Y9BA 3H25A 4H44C 4H13B 3Q5RA 1ZMEC 3G19A 1CTFA 1FDIA 3O1FA 4OGQD 2JO1A 1RQVA 3Q3DA 3T97B 2ZT9C 1MG9A 2QSIA 3GLMA 4H13C 2E74B 1WMKA 3GF7A 3Q1MA 3AE2C 4H44D 2E76B 3AE8C 1EXIA 3D6YA 3Q5PA 1UIXA 1ZP0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DNJ A;  1MBX C;  1MBU C;  1R6Q C;  3O1F B;  3GQ0 A;  4YKA A;  3O2H A;  1DD4 A;  3G19 A;  1MBV B;  2W9R A;  1CTF A;  3O1F A;  4YJM A;  3GW1 A;  1DD3 A;  3G3P A;  1R6O C;  1RQV A;  1MG9 A;  2WA8 A;  3G1B A;  1LZW A;  3GQ1 A;  3O2B A;  1RQS A;  3O2O A;  4YJX A;  1RQU A;  2WA9 A; 
#chains in the Genus database with same CATH topology
 1T8Z A;  3JCU E;  3RBX A;  2J58 A;  3O1F B;  1MZ9 A;  1KOR A;  4UB6 H;  4JF7 A;  3G3P A;  5AVV B;  4IL6 H;  5APV A;  3L71 D;  3W7S A;  1WT6 A;  2OYI B;  1S9K E;  1YJN W;  1SQV K;  3AE7 C;  2WIT A;  3ABV C;  1J1D B;  1NU1 K;  1DD4 A;  3CD6 W;  1SQP D;  3U1C A;  1DIP A;  1FOS E;  4IOC W;  2IBZ E;  1LWU B;  3EWK A;  1Q7Y Q;  1HVV A;  5H2F E;  3V5B A;  2JP3 A;  3PRJ A;  2XND H;  1Q82 Q;  1N73 B;  2OTK E;  2HOD B;  1K04 A;  1VQ9 W;  1SFC C;  1Z56 A;  1VF5 B;  1EZV G;  3G1B A;  5TJH A;  2HG5 D;  1M7L A;  1K9M Q;  3U59 A;  4R4M A;  3NTN A;  2E5Y A;  3O2B A;  3CC2 W;  5AVW B;  1BCC G;  3IN6 A;  3CXC V;  1NAF A;  4CPG A;  4C7N B;  2KNC A;  3Q5R A;  3HTK B;  1QGK B;  5GAG a;  4CPK A;  5CCH A;  1K8A Q;  3Q3D A;  2K1A A;  3L75 G;  1NTM G;  3MUD C;  2M5A A;  3B71 A;  1VQL P;  3JSV C;  5K5G B;  3CCS P;  1KMI Z;  2IYP A;  4AQR D;  1VQN P;  2MKV A;  2KYV A;  2FXP A;  2NPS C;  1JUN A;  3I56 W;  1KYO D;  3V4Q A;  2FY8 A;  1JEK A;  1LTJ A;  2E43 A;  1RH5 B;  4ASW A;  2P10 A;  3SWK A;  5APX A;  4W7Y A;  3W7U A;  3Q5S A;  3TK1 A;  2N1T B;  1LTA C;  3VOP A;  4A7P A;  1LTI C;  3L74 G;  1AV1 A;  2N9B A;  1L0N J;  1NTK D;  1VQP P;  2AXT H;  2WPV B;  2P67 A;  1S72 W;  4WY4 B;  3EQ2 A;  3UIA A;  3O8Z A;  1YIT W;  2FKW B;  2KLV A;  3KZI E;  2WSE J;  1MBX C;  4HYT B;  2QVA A;  3L36 A;  1MKM A;  4PJ0 H;  3L73 G;  1KTM A;  1RE4 C;  3HE4 A;  3H32 B;  4QMA A;  3SSU A;  1VQ4 W;  3RK3 C;  2YO2 A;  3P8C D;  1KB9 I;  4NPF X;  2OYH B;  1Q86 Q;  1FZB A;  3H1K D;  3CL3 D;  1PV3 A;  4ASV A;  2QA4 W;  1HUC A;  2ZFC A;  1Q81 Q;  2V7Q H;  4BL3 A;  3WUV A;  3N4X A;  4GOE A;  1VQO W;  1SP4 A;  4H13 B;  1BGY J;  1ZME C;  4U3F E;  3O1F A;  4HJG H;  2YO3 A;  1D7M A;  4RO0 A;  4HB1 A;  3WU2 H;  2QSI A;  3GLM A;  3NFQ A;  1CI6 A;  3D6Y A;  1AQ5 A;  2GUV A;  3TGU E;  3U1A A;  3RK2 D;  3AE5 C;  1HBW A;  3CWB J;  2QEX W;  5CJ0 A;  3W7W A;  1EDL A;  4YJM A;  3L70 G;  1BE3 G;  3H1H J;  3HE5 B;  1JY3 P;  2A06 E;  2Z4E A;  2H88 C;  4BWN A;  3GW6 A;  2WPS A;  3FWL A;  1EZV D;  1LWU A;  1AVO A;  1S2E A;  3CXH I;  1NTZ J;  3M06 A;  3O2H A;  3SFD C;  3CCU P;  2HOD A;  3C8V A;  5APQ A;  5BU5 A;  2NZ2 A;  1S4X A;  2HYN A;  4EYY Q;  3RL0 C;  5CCH C;  1SQP K;  2DW3 A;  2IDB A;  2QG4 A;  1SFC B;  5M1B A;  2YKO A;  3L75 D;  3VMA A;  2JKV A;  4DOJ A;  1NTM D;  3BCC D;  2C0W A;  3A0H E;  2W9R A;  1KD1 Q;  4K35 A;  4PV1 C;  5AW3 B;  3HTK A;  1K73 Q;  1KIL E;  1LTJ C;  1HF9 A;  1OW7 A;  1ZRT E;  4XA4 A;  1LP1 A;  2ZAE B;  4H0L C;  5JVG W;  1USE A;  1LTG C;  4PD4 H;  1JMB A;  1HGV A;  2OYO A;  1AVY A;  2HR3 A;  1VQM W;  1YIJ P;  2IBZ G;  1JTH A;  3RBZ A;  1K8A X;  2R3S A;  2PRR A;  4OGQ D;  2BCC J;  3V2Q A;  1SS1 A;  1FOS F;  3CC7 W;  2NPS B;  1YJW P;  2Q1K A;  1SQQ E;  3CCV P;  1HJ0 A;  1SQX D;  4BXL A;  2XKM A;  3CX5 E;  4PD4 E;  1JCD A;  1QX8 A;  1HGZ A;  1QL2 A;  1JCC A;  2IFN A;  5TIS E;  2VRS A;  3OA7 A;  3V4W A;  5E79 H;  4I2L C;  3H1L J;  3L73 D;  1L0L J;  3CME W;  4WVZ A;  2OTL W;  1T2K D;  1KFN A;  2ZJS E;  3SWY A;  2ZJP W;  2B87 B;  4JBZ A;  1VL2 A;  5AW8 B;  2KUB A;  5AW9 B;  2KSJ A;  2OTJ P;  1NTK K;  3AEF C;  4RKU J;  1GW3 A;  2OYH A;  2L5G B;  1KQF B;  1VPC A;  3L71 J;  3RK3 B;  3AEE C;  3B8E B;  1VQ8 P;  3G71 P;  1J1D C;  1Q86 X;  2ZYD A;  1E79 H;  2Q3I A;  3TDK A;  1PP9 D;  5KAI H;  1FZA A;  1VQ6 P;  4LLH A;  1OW8 A;  1FZF A;  1SQP J;  4LGD E;  3L70 D;  1BE3 D;  2W6J H;  5GTH H;  1ZN5 A;  1LWU C;  4D6T E;  2SPZ A;  4K3A A;  5BVZ A;  4HH2 A;  1SQB E;  4U67 W;  4H44 D;  3CWB D;  3HE5 A;  5CBN A;  3CPW O;  1KYO I;  2FFD A;  2ZXX A;  1KQG B;  2P7J A;  1K05 A;  1YHQ W;  4EIJ A;  2Y9Z A;  2Y9Y A;  3VMZ A;  1M8O B;  1YJ9 W;  2V7Q J;  3RGU A;  1QEX A;  2FYN C;  1S9K D;  3GHG A;  3FXD A;  3PLN A;  2D2C D;  2KNC B;  2YNY A;  3CC4 P;  3ZDM A;  4EDF A;  3CMA W;  3RL0 B;  3TGU G;  3A3Y B;  2E74 D;  3AEG C;  1VQK P;  2ZJQ W;  2J5U A;  4I7Z C;  3T97 A;  2QE7 H;  4JYC A;  1MWT A;  4PV1 B;  1KD1 X;  2A06 G;  2K3R A;  3H6P A;  4U7J A;  1LTJ B;  3S1K A;  4H0L B;  3AEB C;  1URQ D;  1EDK A;  1T3J A;  1NTK J;  3CCE W;  3KXD A;  3BRV B;  1N2D C;  3RK3 E;  5KLI C;  3G19 A;  1S5L H;  3HRN A;  3VMX A;  2R44 A;  4N78 D;  4IFD K;  5KTB A;  2KSE A;  1SQV E;  3KQG A;  1YJN P;  1CW5 A;  2M3B A;  1NU1 E;  3W7T A;  1ZP0 C;  5AW1 B;  1JO5 A;  3CD6 P;  2YIU C;  3H1K J;  5KJ7 D;  4UY8 Z;  1U7M A;  1IK9 A;  2A45 G;  2P1J A;  1SQX K;  2HFE D;  4GOF A;  1EZV I;  4TT3 H;  1FE6 A;  2N9Y B;  1BGY E;  1RY3 A;  3F89 A;  1VQ9 P;  1P84 E;  3CPW V;  1RE4 A;  4GIF A;  3H1J D;  1OMI A;  2BAS A;  1SQQ G;  1L0N K;  3W68 A;  2LXC B;  4TLF A;  1G2C A;  3CC2 P;  1CI6 B;  1J1E C;  2WA8 A;  5H2F H;  1FS0 E;  3EFF K;  1KQL A;  1MUU A;  2KIK A;  2FFD C;  3H1H E;  3CI9 A;  3AE9 C;  4KT0 J;  2H43 A;  2B88 A;  2FYU D;  1N86 A;  1GZL A;  5CMZ A;  4UB8 H;  3RK2 C;  2RH0 A;  1BCC J;  1QVF O;  1S5L X;  3I56 P;  3AE3 C;  4DZO A;  3GHG C;  3LW5 H;  5AVZ B;  3VTP C;  3G9R A;  1YBK A;  1VQ5 W;  5APW A;  2ZYA A;  3L75 J;  5AW5 B;  3L37 A;  4UB8 E;  1NTM J;  3BCC J;  3GF7 A;  1IFM A;  1VDF A;  1UIX A;  4L75 A;  2KXP B;  2KS1 B;  2I8D A;  3M91 A;  1S72 P;  3V2N A;  2K9J A;  3R4Y A;  1GL2 D;  1YIT P;  2UWJ E;  3P8M C;  2FYN B;  4IO9 W;  3W67 A;  2BEQ D;  2A06 D;  1LP1 B;  1M1K X;  4D6T G;  1TU3 F;  1SQB G;  4Z1M H;  2BCC E;  1JTH B;  4IL6 X;  1VQ4 P;  1AFO A;  1Q90 D;  1MWS A;  1NTZ K;  3CCJ W;  4I7Z B;  1J2J B;  5AW6 B;  1SQX J;  2JJL A;  1N7S D;  2E76 D;  2QA4 P;  3KZI H;  3WUT A;  4GDO A;  1EDJ A;  1OW6 A;  4OGQ C;  2XU6 A;  2KI7 B;  1VQO P;  2Z5H A;  3L73 J;  3OAK A;  2BEZ F;  1N8R Q;  1NHL A;  3H1L E;  2O1J A;  4C7R A;  4WFA W;  1PPJ E;  5APY A;  1GDT A;  2QRX A;  4AYC A;  1JOC A;  1KIL D;  3TF5 A;  1ZRT D;  3GQ1 A;  1URQ A;  5KLI B;  1OFC X;  4Y99 C;  2QJK C;  2QEX P;  1MBU C;  2YXQ B;  3A5T A;  1NAY A;  3AED C;  4GOD A;  5KLV D;  1VQ7 W;  4OWF A;  4JPZ B;  2OAR A;  5GW7 A;  2RMZ A;  1T2K C;  2XDJ A;  3Q1M A;  1SQQ D;  2IPP A;  2V4H A;  4PD4 D;  3W7X A;  2YIU B;  3EFG A;  1QVF V;  2W90 A;  1PP9 J;  1XTG B;  1FZG A;  1YI2 W;  3L70 J;  1AJY A;  1KV4 A;  1BE3 J;  5AW7 B;  1SQP E;  2IZ0 A;  1KN7 A;  3DLL W;  4WF9 W;  3IAO A;  1L0L K;  2W8Z A;  3FX0 A;  3I55 W;  3D70 A;  1NJI X;  2R3C A;  1SQV G;  1GK6 A;  1GTW A;  1NU1 G;  3L4F A;  1J1E B;  4HKZ H;  1HH0 A;  3H1I E;  3Q2Y A;  5DJU B;  2FFD B;  4YJX A;  1VQM P;  3B5N D;  2WT7 B;  5KKZ C;  3A0H H;  3D6Z A;  3RK2 B;  1BCC D;  1BGY G;  2WVR A;  1CSB A;  3MD0 A;  3CC7 P;  2RKL A;  1LTS C;  5AVR B;  3GHG B;  2W6B A;  3PP5 A;  3WUU A;  1SFC D;  2WA9 A;  2FYU K;  2A45 H;  1OIP A;  1UII A;  1A02 J;  3KPE A;  2KS1 A;  1KYO E;  1CTF A;  1SQB D;  3CCM W;  2WSC H;  3CME P;  3T97 B;  3H1H G;  5CHX A;  1N7L A;  4M3L A;  1JY2 N;  3AE8 C;  2OTL P;  1DX7 A;  3CX5 H;  3K5B A;  5BU8 B;  3ZFZ A;  2E75 D;  2E74 C;  1OZH A;  1BDD A;  1YQ3 C;  3AEA C;  4IFM A;  5TIS H;  2J59 M;  1NTK E;  2WPR A;  1GL2 A;  2NPS D;  3L74 D;  2O01 H;  1T3U A;  2K88 A;  3L72 E;  1URQ C;  2W83 C;  1FZE A;  3A0B E;  2O3J A;  3IR9 A;  1OXZ A;  1DEE G;  4DCK A;  3PIO W;  4OGQ B;  1FDO A;  3KDP B;  1N8R X;  1SVF A;  2YKP A;  5CJ4 A;  2G3A A;  3H1K E;  1RF1 C;  3CLQ A;  1FZC C;  5AW0 B;  1QLE D;  1GK4 A;  1YYC A;  3ZG0 A;  1GD2 E;  3V2P A;  2Q9I A;  2BCC G;  4Y99 B;  2QJK B;  2XV5 A;  4JQ0 D;  3H1J J;  5APT A;  2KOG A;  1YHQ P;  2KZJ A;  1IFP A;  1LGH B;  2G8Y A;  3M9H A;  5CCG D;  2OGU A;  3N7N A;  1YJ9 P;  5GAH a;  5M19 A;  4ZNC A;  1G2C B;  1SQV D;  2R5D A;  3CCR W;  2ITA A;  1M57 D;  1NU1 D;  3H1L G;  1LT9 A;  1PPJ G;  5B5E E;  5KLV K;  2FYU J;  1KC8 Q;  3Q5P A;  1NYH A;  1QVG O;  4BL2 A;  1KQS O;  3CMA P;  5AW2 B;  2JWA A;  3A7O A;  1JY2 O;  1ZXG A;  3OW2 O;  2QJP C;  1IC2 A;  1W5C E;  4CJN A;  1RQS A;  5AVX B;  1H8A A;  1P84 D;  3HD7 D;  1IK7 A;  2K9Y A;  2JEE A;  2WT7 A;  1NTM E;  3BCC E;  3CCQ W;  1Y8A A;  4L73 A;  4GT1 A;  3CCE P;  1CZQ A;  5EFW B;  1BSN A;  1MFT A;  1FU1 A;  5KKZ B;  1PL5 A;  1W2B O;  4U3F G;  4WCE W;  1SQP G;  1EQ7 A;  1M1K Q;  1S3J A;  2K9J B;  1NH4 A;  3AEC C;  1ZW0 A;  5CCH D;  3B5N A;  1JJ2 V;  1G1I A;  1U7J A;  5GAD a;  2IBZ D;  4WWI A;  1GL2 C;  3O2O A;  3A2A A;  4PV1 D;  3KYQ A;  3H1I G;  4L74 A;  1SQX E;  2Y0C A;  2M0B A;  3TNU A;  2WSE H;  2KK7 A;  3C1L A;  2ZXE B;  1L2P A;  2JO1 A;  4PD4 I;  2E74 B;  1WMK A;  1NTM K;  1EXI A;  3PH0 A;  4NPD A;  1L0N E;  1FDM A;  1FC2 C;  4WFB W;  2E76 C;  1G1J A;  3CCL W;  4WBA A;  2O1K A;  3GW1 A;  3CF5 W;  3G4S W;  2IX7 C;  3PIP W;  1EXJ A;  1URQ B;  5B66 E;  5KLV J;  1GU4 A;  2WPQ A;  2H7H A;  1KIL C;  1P84 H;  2QJY C;  2ZT9 D;  1QVG V;  2IFM A;  1SQQ J;  1M1J A;  3I5C A;  1L4A D;  1USD A;  3LID A;  3RL0 g;  3SFE C;  4DT0 A;  1ZR4 A;  2M3E A;  1OVV A;  1RF1 B;  1FZC B;  1PP9 E;  1R5L A;  3OW2 V;  3VYI A;  1NTK G;  1LT9 C;  3E1I A;  1KB9 H;  3HUS A;  2C9N Y;  2LXB A;  1VQ5 P;  2M8R A;  5CBO A;  3AE6 C;  3VN0 A;  1NO4 A;  2O01 J;  3M0A A;  1NJI Q;  3L72 G;  3IFM A;  3FXE A;  3PJS K;  1AQT A;  1OX3 A;  3CWB E;  4BRY A;  1W2B V;  5AVT B;  1NGM B;  1KB9 E;  3MGN A;  5CCG A;  1KFM A;  2O01 N;  4AUW A;  4KHX A;  3H1K G;  1JNM A;  1NKZ B;  2HPC A;  1RQV A;  1KC8 X;  5AVY B;  1NTZ E;  3CCJ P;  2AEJ A;  1X22 A;  1ZOY C;  3G3Z A;  4KJM A;  2JWD A;  2QJP B;  2YMK A;  4U3F D;  1VF5 D;  3CXH H;  2P2U A;  3JC2 2;  3B5N C;  4UB6 E;  4D6T J;  2YMY A;  2I1K A;  1LTB C;  4IL6 E;  4EOT A;  1XTC C;  1BDC A;  1SQB J;  3TGU D;  1JY3 N;  3G6E W;  2LR2 A;  1ZLL A;  3HD7 A;  3H1I D;  4RJT A;  1R6O C;  2W27 A;  3CXH E;  2CPS A;  4Y28 J;  4I6M C;  2XZR A;  3S9O A;  2GUS A;  1MV8 A;  3M9Q A;  3D71 A;  3AE1 C;  1VQ7 P;  3L74 J;  2B9B A;  1R8E A;  4C46 A;  4O9B A;  3FWN A;  4YPC A;  5M18 A;  3B4S A;  1GL2 B;  2ZVO B;  2PAJ A;  4DJG A;  2WZ7 A;  2E75 C;  3R2P A;  4N78 E;  4JYB A;  3D3I A;  1YQ4 C;  2MJZ A;  3BCC G;  2WSF H;  4IFF A;  2N1T D;  1FJK A;  1JMM A;  1YI2 P;  4ZKP A;  3O6Q A;  3E7K A;  2E5T A;  1H0T A;  3V6I A;  4WY4 D;  1EC5 A;  4GKG A;  1JM0 A;  1X8Y A;  1L0L E;  2CK3 H;  1RF0 C;  2XNX A;  3I55 P;  1M1J C;  1X9V A;  1NKN A;  1OVR A;  1N7S B;  5APU A;  3VP9 A;  2E76 B;  4N6J A;  5M1A A;  2R32 A;  4WB4 A;  3QWO C;  1M90 X;  4YTP C;  3M0D A;  5APS A;  3HUS C;  3ZG5 A;  3H1J E;  1MBV B;  3II6 A;  4W7Z A;  1IFD A;  4EI2 A;  1SQX G;  1DH3 A;  2Q7C A;  1EDI A;  1KIL B;  2IYO A;  1P84 I;  2QJY B;  3L72 D;  3FGA D;  4IOI H;  4XFJ A;  1RF1 A;  1FZC A;  3L71 E;  1SQV J;  3CX5 D;  2E42 A;  2K37 A;  1NU1 J;  5HL7 W;  3VP8 A;  4H13 D;  1R6Q C;  1VQL W;  2R5B A;  2CPB A;  3CCS W;  1VQN W;  1L0N G;  3MZW B;  5CCG C;  2FYU E;  2AXT E;  1LT9 B;  1JY3 O;  1NWQ A;  1L4A A;  5KJ7 A;  1HJB A;  4YXD C;  4YXW H;  1FJP A;  3QH9 A;  1NVO A;  3S4R A;  3CCM P;  1MWR A;  1SLQ A;  4PJ0 E;  2IBZ I;  3PTZ A;  3ITK A;  4W80 A;  2QM7 A;  1X0T A;  1VQP W;  3DNJ A;  3BRT B;  2OYI A;  3AE4 C;  2JDI H;  1ZR2 A;  2Q6Q A;  1PP9 G;  3TYY A;  1BXY A;  1KYO H;  1LJ2 A;  2YXR B;  1Y9B A;  3M9B A;  1W2E A;  4H44 C;  1T6A A;  4B86 A;  4ZMD A;  3HD7 C;  1YTZ I;  5KAF H;  1R5S A;  3WU2 E;  2NRG A;  1MFZ A;  2FXO A;  2QM8 A;  4D6T D;  3B5N B;  2Q3E A;  3CWB G;  1N73 A;  2KP8 A;  1PGQ A;  3J7Z Z;  3P7K A;  1Q7Y X;  2D2C C;  2Z5I A;  1KZU B;  2LKM A;  5KAF E;  1Q82 X;  3A0B H;  3KHU A;  1PZQ A;  2AXC A;  4I1L A;  3TNU B;  1QL1 A;  4MN4 C;  4C7N A;  2P58 A;  1NTZ G;  4RES B;  1K9M X;  2ZJR W;  3MP7 B;  4N3Y B;  3LW5 J;  2WQY C;  1S1C X;  3L35 A;  1RQU A;  2WSS H;  3USS A;  2Y0E A;  3VMY A;  1ZV8 A;  3MHV A;  1Q2N A;  1JB0 J;  2OQQ A;  2E75 B;  2AEM A;  3CCR P;  3M0D C;  1LTT C;  2B89 A;  5KLV E;  3MTU E;  5CA3 A;  1GU5 A;  4R4L A;  3CCU W;  1OWA A;  1A02 F;  1PGJ A;  5AVQ B;  3SWF A;  4OH8 B;  2ZVN B;  3P8C E;  1N7S A;  1FBM A;  1IJD B;  2WMM A;  1M1J B;  2N1T A;  5AVU B;  1MWU A;  1IFN A;  2Q5U A;  1E5W A;  4WFN W;  4WY4 A;  5B5E H;  2ZT9 C;  1MG9 A;  1KIL A;  1L0N D;  1L4A C;  3HUS B;  5KJ7 C;  2FBW C;  2PGD A;  3MIW A;  3CCQ P;  3RK3 D;  2WSF J;  3IF4 A;  3TSI A;  1PFI A;  3GQ0 A;  3LIE A;  5AW4 B;  1DD3 A;  1IO4 A;  1YIJ W;  3H32 A;  5E79 E;  1Y47 A;  1BSH A;  2PP6 A;  4BRY B;  1L0L G;  2WTY A;  1EZV E;  2OYI C;  1YJW W;  3CCV W;  3WMM 0;  1SQQ K;  1RHZ B;  2HPC B;  1BCC E;  1GMJ A;  2RN0 A;  1H88 A;  1RE3 A;  1Q81 X;  2GA1 A;  3OJA B;  1VQQ A;  4LC1 A;  4U3F J;  2QIW A;  3H1J G;  1BGY D;  4NPE A;  1YTZ T;  5DM6 W;  4XE5 B;  3V2R A;  1GW4 A;  1M56 D;  3L75 E;  3L71 G;  3TGU J;  5DM7 W;  2FYZ A;  2L91 A;  2YKQ A;  1N73 C;  1IFI A;  3BAT A;  1PGO A;  1LZW A;  5KAI E;  3BVH A;  1VF5 C;  1WRG A;  3H1I J;  3CCL P;  2FYU G;  4H44 B;  2OTJ W;  1KB9 D;  3H1H D;  5GTH E;  3HD7 B;  3RL0 D;  3G4S P;  1FDI A;  2C9L Y;  1JY2 P;  3F5H A;  1VQ8 W;  2A45 I;  2H8P D;  3G71 W;  3AE2 C;  1NTZ D;  3L74 E;  4OVN F;  1VQ6 W;  5C39 A;  3E1R A;  1H89 A;  5GAE a;  1SFC A;  2D2C B;  4H0L D;  3NXS A;  3NMD A;  1DEB A;  5B66 H;  2KLU A;  2WWW A;  2M5A B;  3CX5 I;  3L73 E;  2JR8 A;  2FXM A;  2IZ1 A;  4ZKU A;  3O6Q B;  1SQB K;  3GG2 A;  5GTI H;  2POH A;  1H0T B;  1N7S C;  1IFJ A;  3BAS A;  1K73 X;  1M90 Q;  2N1T C;  3CXH D;  3MUD A;  2AEF A;  1LT1 A;  4WY4 C;  1NOH A;  2NPS A;  2BCC D;  5L8R J;  3PHL A;  1HWT C;  4DKI A;  2WSC J;  3L72 J;  3P32 A;  5GTI E;  1RF0 A;  3GMA A;  1KQS V;  1HTL C;  2KZI A;  3CC4 W;  5JVH W;  5AVS B;  3GF3 A;  1U57 A;  1AA0 A;  1PIX A;  1IZN B;  3JCU H;  1LNQ A;  2H89 C;  1VQK W;  2ZYG A;  3L70 E;  5DJT B;  4IOA W;  1BE3 E;  2OYH C;  3H1L D;  2Y0D A;  3HE4 B;  1PPJ D;  2C0X A;  2KB7 P;  4L76 A;  4YKA A;  1L0L D;  1PGP A;  2ZT9 B;  3H25 A;  2I1J A;  1X79 B;  2B87 A;  2PFX A;  1L4A B;  1S5L E;  2W6A A;  4H13 C;  3C9I A;  3G6E P;  1RE3 C;  1FAV A;  2HLO A;  1OVU A;  2GM4 A;  5KLV G; 
#chains in the Genus database with same CATH homology
 1NYH A;  2FBW C;  1HJ0 A;  1KMI Z;  4YTP C;  1KQG B;  2E75 D;  2E74 C;  2MKV A;  1K05 A;  1YQ3 C;  2E76 C;  1ZOY C;  2FXP A;  3AE5 C;  3AEA C;  3O1F B;  2WSF J;  2D2C B;  4H0L D;  3GQ0 A;  3R4Y A;  2YMK A;  1KOR A;  2YIU C;  1VF5 D;  1MBV B;  1AJY A;  4YJM A;  3GW1 A;  1DD3 A;  3G3P A;  2BEQ D;  2P10 A;  2V7Q J;  2D2C C;  2QJP C;  1EXJ A;  2FYN C;  1TU3 F;  4TT3 H;  3FGA D;  3IAO A;  2H88 C;  4XFJ A;  1RQS A;  3D70 A;  3Q5S A;  2D2C D;  3AE7 C;  2QJY C;  3ABV C;  4Z1M H;  1IK7 A;  2ZT9 D;  4IL6 X;  2K9Y A;  4H13 D;  1R6Q C;  1Q90 D;  1OMI A;  1DD4 A;  3O2H A;  3SFD C;  1VL2 A;  4I7Z B;  3RL0 g;  2WPV B;  3SFE C;  3C8V A;  1GMJ A;  1R6O C;  2E74 D;  3Q2Y A;  3AEG C;  3LW5 J;  4OGQ B;  2E76 D;  2NZ2 A;  1FDO A;  1DIP A;  2J5U A;  4Y28 J;  2WA8 A;  2WQY C;  4I7Z C;  1PL5 A;  4GDO A;  1S1C X;  2QIW A;  2WSE J;  4YXD C;  4RKU J;  3AEF C;  3EWK A;  4YJX A;  1RQU A;  1OW6 A;  3S9O A;  4OGQ C;  2G3A A;  1MBX C;  2IDB A;  3B71 A;  5L8R J;  5M1B A;  5KKZ C;  3D71 A;  3AE1 C;  2WSC J;  1KQF B;  4PV1 B;  2BEZ F;  1JB0 J;  2JP3 A;  2OQQ A;  1MKM A;  3AEC C;  3AE6 C;  1R8E A;  1KTM A;  2E75 B;  3D6Z A;  2O01 J;  4U7J A;  1K04 A;  3AEE C;  3AE9 C;  4KT0 J;  2W9R A;  3GMA A;  4H0L B;  4PV1 C;  1VF5 B;  3AEB C;  2E75 C;  3GF3 A;  4R4L A;  1KIL E;  1U57 A;  1HF9 A;  1OW7 A;  1OW8 A;  1YQ4 C;  3G1B A;  1ZRT E;  1LZW A;  1PIX A;  4H0L C;  3GQ1 A;  1VF5 C;  4R4M A;  3O2O A;  3O2B A;  2H89 C;  2WA9 A;  4PV1 D;  1S5L X;  1PV3 A;  3DNJ A;  2G8Y A;  2QJK C;  3IN6 A;  3AE3 C;  1MBU C;  4H44 B;  3AE4 C;  3O6Q A;  3AED C;  1NGM B;  3RK3 E;  5KLI C;  3G9R A;  4YKA A;  2ZT9 B;  1Y9B A;  3H25 A;  4H44 C;  4H13 B;  3Q5R A;  1ZME C;  3G19 A;  1CTF A;  1FDI A;  3O1F A;  4OGQ D;  2JO1 A;  1RQV A;  3Q3D A;  3T97 B;  2ZT9 C;  1MG9 A;  2QSI A;  3GLM A;  4H13 C;  2E74 B;  1WMK A;  3GF7 A;  3Q1M A;  3AE2 C;  4H44 D;  2E76 B;  3AE8 C;  1EXI A;  3D6Y A;  3Q5P A;  1UIX A;  1ZP0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...