1RQVA

Spatial model of l7 dimer from e.coli with one hinge region in helical state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome
pubmed doi rcsb
molecule keywords 50S ribosomal protein L7/L12
molecule tags Ribosome
source organism Escherichia coli
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rqvA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rqvA02
1CTFA 1RQUA 1R6QC 2WA9A 3GQ1A 1RQSA 1MG9A 3GW1A 1LZWA 3G1BA 4YJXA 1MBXC 3O1FA 3DNJA 3GQ0A 2WA8A 3G3PA 1R6OC 3O1FB 1MBUC 4YKAA 3O2HA 1RQVA 4YJMA 3O2OA 2W9RA 1DD3A 1DD4A 1MBVB 3G19A 3O2BA
chains in the Genus database with same CATH superfamily
4UY8Z 2JEEA 1GZLA 3CX5I 5KTBA 1LT9C 2JJLA 2JKVA 1GK4A 1W5CE 3L71G 1S4XA 5AW7B 3P8CE 1N7SC 1VQ8W 4NPDA 5APVA 1N8RQ 2C0WA 4O9BA 1PPJG 1OIPA 2LR2A 3CCLW 3T97A 3JCUH 1L0LJ 1KILE 1L0LE 1FDOA 2MJZA 5KAFE 1HGVA 1PGJA 1PIXA 3CWBD 3G3ZA 1T3JA 1L0NJ 1EXJA 1P84D 1VF5B 1PZQA 1Q82Q 4WFNW 2FYUD 1S1CX 2KS1A 2KXPB 4UB6H 1S5LH 2IYPA 3L75D 1LP1A 3T97B 1JY2P 2KB7P 4LLHA 4I6MC 1K04A 2E42A 4DJGA 1NU1D 3CXHH 1SQQE 1RY3A 5M19A 4GOFA 4W7YA 1NTKJ 2B88A 1UIXA 3Q5RA 1FJPA 1X0TA 2YKQA 4ASWA 4RESB 1KILC 1R8EA 5GTIH 1W2BV 1JY3N 2B89A 1EQ7A 3O1FA 1KQLA 1VQ8P 1LP1B 5GAEa 1MFTA 2KOGA 3OJAB 4EYYQ 2RN0A 3D71A 3TYYA 4WB4A 3R4YA 3FXDA 1SQPD 4PV1C 1YIJW 5APUA 1BGYD 3HE4A 1JCCA 4YTPC 3I56W 2BCCD 2LKMA 1SFCC 1FJKA 1PGPA 5AW5B 5TISE 2V7QJ 3V6IA 3O1FB 3GLMA 3RK2B 1CZQA 1NKZB 3E7KA 4C46A 2WPVB 1FBMA 1LT9A 1SQBE 2JWDA 5APQA 2KP8A 3HE4B 5JVGW 2LXBA 2YKPA 1M90X 2C9NY 1N7SA 5AW9B 1BXYA 3H1LD 1ZRTD 3G4SW 2OTLW 1LT9B 2M0BA 1M8OB 2POHA 1L0LG 1MUUA 1PFIA 3A0HE 1YIJP 4EOTA 1MV8A 1L0NG 3WUUA 1N7SB 3I56P 3CX5E 3JC22 5B5EH 4BXLA 2RH0A 3N7NA 5B66H 1JY2O 3L73J 1KZUB 5JVHW 1RE3A 4JYBA 3BCCE 3H32A 1QLED 1VQNW 4L74A 1OXZA 1KB9E 2W90A 2E76C 4IFMA 4YXDC 1PP9E 2WSSH 2K3RA 3ZG0A 2E43A 1NTKG 1D7MA 5KLIC 1KILA 5CHXA 1VDFA 1L0LK 2HYNA 1TU3F 3G4SP 2OTLP 1DIPA 3H32B 2H88C 1RF0C 1L0NK 3PRJA 4H44D 5AVYB 3AE8C 2AEJA 1KYOI 1NTZJ 2N1TD 2W6AA 1SFCA 2HG5D 2H8PD 3D6ZA 5BU8B 1KILB 3H1KJ 1WMKA 5KLVE 4LGDE 3FWNA 4L73A 1MWTA 1KQGB 1LTBC 4RO0A 2KK7A 5AW4B 2J5UA 2IDBA 2WWWA 4PV1B 2D2CC 3H1HE 1SQBG 1M90Q 1DX7A 1NTKK 1KQSO 3SSUA 2IPPA 1VQNP 3M91A 3NMDA 5DJUB 1R6QC 1SFCB 1NGMB 1JOCA 1YTZI 4Y99B 2XU6A 1YQ4C 2ITAA 3FXEA 4XFJA 1LNQA 3ZFZA 4ZNCA 3CWBJ 2YKOA 1NTME 3I55P 1LTJC 4RKUJ 3A7OA 4DT0A 4WFBW 3GW6A 1ZMEC 1A02J 5CCHD 4IL6H 3O6QA 2FYUJ 3I5CA 2FYUE 2OYHC 1AQTA 3H1IE 4AYCA 3L75E 2IFMA 2ZYAA 1MZ9A 1JY2N 1SQBK 1VQ5P 2QJPC 1NU1J 2QJKC 4RJTA 1NU1E 3L73G 2V4HA 1NVOA 1ZOYC 2K9YA 1S9KE 3O6QB 1G1IA 1PP9G 1AVOA 2IZ0A 2P2UA 2QM8A 2E74D 4HH2A 4NPEA 2FYZA 1SQPJ 1SQVD 1RF1C 4B86A 1BGYJ 2YMYA 1RF0A 2Q3EA 1NAYA 1SP4A 2E76B 3BATA 5KKZC 2BCCJ 2BCCE 2ZJPW 3TGUE 4YJMA 5APTA 2P67A 1PV3A 3HD7D 5KLIB 1NTZG 3A5TA 1JTHA 3M0DC 1PGQA 1YI2W 2O3JA 4WVZA 4PJ0E 2SPZA 2QE7H 2FKWB 1CW5A 1EZVI 4JF7A 1LGHB 3H1LJ 2CPBA 1T6AA 1JTHB 1ZV8A 1MKMA 5AW6B 1KTMA 2NPSC 2WSEH 1URQC 4IFDK 5AVSB 1KYOE 3GHGC 1LTJA 4W80A 2D2CB 2M5AA 2IFNA 2Z4EA 3CWBG 1EC5A 1U7JA 3V2PA 1ZW0A 1NTZK 2PFXA 1S2EA 3KZIH 2Y9ZA 5KLVK 1MWRA 3M9QA 2OYHA 2FYUG 2MKVA 1EDKA 3CD6W 3PTZA 1R6OC 3L75G 1SLQA 1RHZB 1GU4A 5CJ4A 3L71E 1LTJB 2M5AB 1K73Q 1NU1G 2A45H 1YI2P 2YO3A 3RL0C 3HTKB 1OX3A 1PPJE 3L72D 2OYHB 1N8RX 5KAFH 2K1AA 2ZT9C 2QJPB 3MUDA 1NTMK 3HRNA 2WMMA 1DD4A 2QJKB 1RF1A 2HLOA 1ZR4A 1SQPG 1BGYG 4M3LA 2FYUK 1BCCD 1Q82X 2N9YB 1W2EA 5GTHE 4EI2A 2BCCG 1FOSE 2ZYGA 3P7KA 1T3UA 2IYOA 2AEFA 2E5TA 3M0DA 2XKMA 1Q7YQ 1NU1K 1GL2C 1RF1B 2WA9A 3CD6P 5KKZB 5BVZA 4OGQD 3SWKA 1OW7A 1HH0A 3B5ND 2ZVOB 1L4AC 3D6YA 2R44A 1KC8X 3H1LG 3L37A 3CXHD 3G9RA 3OA7A 1NWQA 4DKIA 2J59M 5TISH 3W7SA 1KQSV 1HJBA 1KFMA 3AE1C 1JEKA 1G2CA 2WSFJ 3H1KD 5E79E 2KNCB 2Y0DA 2Q1KA 4OH8B 4PD4I 2NPSB 1BE3D 1QX8A 1URQB 2XZRA 1OMIA 4BWNA 1IC2A 3GHGB 1ZXGA 4N3YB 1EZVE 4LC1A 2IBZI 2AXTE 3RBXA 5AVVB 1KB9I 4WBAA 2AEMA 1G2CB 4HYTB 2FFDC 5GAHa 4UB8H 1SQVJ 3B8EB 3SWFA 1Y9BA 1SQVE 1FOSF 3A0HH 1LTSC 5KAIE 1L0NE 3CX5H 3GF3A 3RL0B 1RQUA 4U3FD 1GU5A 3Q5SA 5M1AA 4H0LC 2JO1A 5APSA 1VPCA 2ZXXA 3RK3E 3CC2W 2ZYDA 3VP8A 2ZT9B 3MP7B 3KPEA 4IOCW 1NJIX 4R4MA 2H89C 2QEXW 4GIFA 2W9RA 2ZFCA 3TDKA 1NTKE 1HTLC 2WPSA 5CJ0A 3VMYA 3VP9A 2WSCH 1MFZA 3RBZA 3HUSC 5GADa 4N78D 1KC8Q 1X9VA 1S5LX 1FE6A 1YJ9W 2M8RA 2KLVA 2QA4W 4I7ZC 3CCLP 1AV1A 1NH4A 2C0XA 1GL2B 4H13B 2I8DA 1H0TA 3PH0A 3RK3C 3CPWV 1NO4A 3R2PA 5AVXB 1T8ZA 1P84I 2CPSA 1L4AB 3IF4A 2KUBA 3CC2P 4EDFA 1LT1A 1KMIZ 5AW8B 3Q5PA 1H0TB 3CL3D 3G1BA 1EDJA 1U7MA 2QEXP 5CA3A 1EZVG 5HL7W 3VN0A 3Q2YA 2JDIH 3L72J 4JQ0D 3K5BA 5KJ7D 2WPQA 3GMAA 1EDIA 3CCEW 3RL0g 1M1JC 1M56D 4W7ZA 4U7JA 5GW7A 3Q1MA 2JR8A 3DLLW 1SQVG 1IK7A 1NHLA 1VF5D 1VQ4W 1FZBA 1MBUC 1BCCJ 1BCCE 1OVVA 4BRYB 3O8ZA 4PD4E 2AXCA 2K88A 1Q90D 2FFDB 2H7HA 5DM7W 2L91A 5AVWB 3L70D 3L73E 1NJIQ 1VQ7W 2IBZE 2B87A 3MD0A 3W68A 5AW3B 1RE4C 1KQFB 3IAOA 2YNYA 3F89A 3WU2E 2YIUC 1RQVA 5AVRB 4D6TD 3IN6A 4Y28J 5M1BA 1YHQW 1M1KX 4ZMDA 1T2KC 1Q2NA 4NPFX 1CTFA 1N86A 3ABVC 4H0LB 3HUSA 5AW1B 3MHVA 4JPZB 3SFDC 3VTPC 1KD1Q 1SQVK 3DNJA 3A0BE 3CCJW 3CCEP 2B87B 3WUTA 2O01H 1UIIA 4H13D 5AVTB 1IFJA 3BVHA 1GD2E 3Q3DA 2G3AA 1NTZE 2KYVA 1VQ4P 1JUNA 4QMAA 3H1KE 3OAKA 3HUSB 2PAJA 2W6BA 1QL1A 3RK2D 4R4LA 1BE3J 4GODA 4I7ZB 4WY4C 1JMBA 1ZLLA 4PJ0H 1VQ7P 3AEAC 3H1JD 1GW3A 4KT0J 2RKLA 2ZJQW 3D3IA 3RK3B 1MG9A 3AEFC 1KORA 3A3YB 5CCGC 4A7PA 1YHQP 2YXRB 1SVFA 3L72G 1N2DC 1QEXA 1KN7A 1KYOH 3LW5H 3CWBE 2B9BA 2E75C 4MN4C 2W6JH 1VQMW 3CCMW 1P84E 1H88A 1HUCA 1YITW 1BSHA 1CSBA 1LTGC 1N7SD 4U3FJ 4U3FE 2Q5UA 1J2JB 2WITA 2A06D 3KQGA 1BCCG 5DJTB 3BASA 2QJYC 3M06A 1ZR2A 1FZEA 2FXPA 1M1JB 3BRVB 1MWSA 4HKZH 2IBZG 1RE4A 1GMJA 1K73X 3VMAA 1M1KQ 4BL3A 2XV5A 4IL6X 4AUWA 5B66E 1SQXD 1DD3A 1IK9A 3O2BA 3L35A 1AQ5A 4XE5B 1FDMA 1L2PA 2XDJA 2H43A 1SQPE 3P8CD 1BGYE 2OTKE 3M9BA 5EFWB 2YIUB 5GTHH 4K3AA 1VQMP 1H8AA 2Q3IA 4I2LC 3CCMP 1KILD 1K8AQ 1OFCX 2OYOA 1LTIC 3H1KG 1EXIA 3PP5A 1RQSA 1Q7YX 3P8MC 4PV1D 4WY4A 4WWIA 1BE3G 3KXDA 3CPWO 2P58A 1KV4A 4WF9W 1ZP0C 1SFCD 3M0AA 5CCGA 2YO2A 3G71W 2IX7C 3H1LE 1ZRTE 2OYIC 1SQQD 4DCKA 1A02F 3CMAW 4WY4B 3OW2O 1LJ2A 2W83C 2Q9IA 3HTKA 5E79H 3PJSK 4ZKPA 4YJXA 2GUSA 4U3FG 3AEGC 1CI6A 3KYQA 3L70J 2Y9YA 1KFNA 3CLQA 2E75B 1YJNW 3FWLA 2AXTH 2P10A 1IJDB 4D6TJ 1FAVA 4D6TE 1K9MX 2O1KA 1QVFO 1VQQA 4YXWH 2OTJW 3PHLA 4DZOA 1CI6B 3G71P 2QJYB 3FGAD 1LWUC 3QH9A 4IOAW 3S4RA 3TNUA 5KAIH 5K5GB 3CMAP 2XNDH 2E76D 2ZJRW 3NFQA 4C7NA 4L76A 4I1LA 1VQ6W 5BU5A 2Z5HA 2YXQB 4XA4A 3MGNA 2Y0CA 3CF5W 3W7XA 2J58A 4YPCA 3TNUB 2DW3A 5L8RJ 3H1JJ 5H2FE 3CX5D 1SS1A 1YJNP 4N6JA 4C7NB 3CCUW 1JNMA 2KNCA 3BCCD 2OYIA 3NXSA 4ZKUA 2OTJP 2NPSA 4H44C 4KJMA 1SQPK 1URQA 1PP9D 2IZ1A 2D2CD 2N1TC 3GHGA 2ZVNB 3PLNA 1R5SA 1FZFA 2V7QH 1LTAC 1DH3A 2JWAA 2C9LY 1G1JA 4AQRD 1N7LA 2WSEJ 2OYIB 1VQ6P 2BASA 2OARA 4TT3H 1IFMA 3EQ2A 1QVGO 3L70G 2VRSA 4YKAA 2I1JA 1K9MQ 5KLVD 3MZWB 1S72W 2L5GB 4HB1A 3VYIA 4D6TG 5GAGa 1SQXJ 3CCUP 2K37A 1SQXE 3H1HD 4DOJA 1HVVA 4C7RA 1LWUA 3SWYA 1YBKA 3GG2A 2FY8A 5AVZB 5CCHC 3CXHI 3EFGA 3CCVW 2PP6A 3WMM0 4PD4H 1X79B 1PL5A 1K05A 1YYCA 1NTMD 2PRRA 1LWUB 1KB9H 2WTYA 3WU2H 1GL2A 3AE4C 3CMEW 2Q6QA 3H1ID 1NYHA 2WZ7A 1BSNA 3H1JG 2E74C 5APYA 3S1KA 1U57A 1RE3C 3ITKA 1S72P 3V5BA 1GW4A 1L4AA 1SQQJ 4CPGA 3A0BH 1S9KD 1KD1X 1WT6A 3II6A 1HJ0A 4HJGH 2N1TA 2R3SA 3HD7C 1J1DC 2LXCB 2KS1B 3L74D 2ZAEB 2WPRA 3CXCV 1DEEG 3CCVP 3PIPW 2BEQD 1AA0A 1IO4A 2K9JA 2A06G 3AE2C 2NPSD 1IFNA 1URQD 1VQLW 4H44B 1Q81Q 3U59A 3TGUD 2N1TB 2NRGA 4Y99C 3OW2V 1AVYA 1Q86X 4BRYA 3CMEP 2UWJE 3L72E 1SQBJ 3B71A 2K9JB 2CK3H 2FFDA 2FXOA 1FS0E 4K35A 1SQXG 3WUVA 3IR9A 2M3EA 1YJ9P 2QA4P 2GA1A 1P84H 3V2RA 5CCHA 3GQ0A 1EDLA 3HE5A 2A45G 3O2HA 3RL0D 1FDIA 3G19A 3JCUE 4UB8E 3L4FA 1USDA 1KYOD 1QVFV 1VQOW 2ZT9D 2G8YA 5AW2B 4TLFA 1VQLP 1NKNA 1ZN5A 3HE5B 1GK6A 3V2QA 3AE5C 3W7WA 1N73C 1R5LA 2Z5IA 4U67W 1VQPW 1DEBA 4UB6E 1S5LE 1USEA 2XNXA 1SQXK 2YMKA 3PIOW 3BCCJ 3AE9C 4GT1A 1YJWW 3L71D 3CCRW 1FZCC 2P1JA 2FYNC 3CXHE 3MIWA 1PP9J 1SQQG 1GL2D 3G6EW 3H25A 1PPJD 2WSCJ 3HD7A 2FXMA 1X22A 5GTIE 3L36A 2E74B 3I55W 3LIDA 2KIKA 1L4AD 4CJNA 1K8AX 2KLUA 4L75A 2QSIA 2HR3A 1JO5A 1BE3E 3CC4W 2WT7A 1S3JA 1YQ3C 2NZ2A 4IOIH 4OGQC 1VQOP 3M9HA 3CCQW 1Q86Q 5KLVJ 3HD7B 1J1DB 3GQ1A 4JYCA 2R5BA 3B5NC 1VQ5W 3UIAA 2HFED 1RH5B 5APWA 3C1LA 3KHUA 3CI9A 1SQQK 2QVAA 1VQPP 1PGOA 2R5DA 4IO9W 5C39A 3SFEC 3H1HJ 2O1JA 2N9BA 4BL2A 3TF5A 1YJWP 1M1JA 1NOHA 2WT7B 1FU1A 1GDTA 3CCRP 3CCJP 3A2AA 1QVGV 3G6EP 2WVRA 1AJYA 1Y8AA 1FZAA 1QL2A 1NTMJ 3FX0A 1MWUA 2HODA 1HBWA 2OGUA 3W67A 1VQKW 3H6PA 3CC7W 3E1IA 1NAFA 3NTNA 3CC4P 1X8YA 1IZNB 3H1IJ 2KZJA 4EIJA 3G3PA 3L75J 1N73A 5B5EE 3CCQP 4Z1MH 4H0LD 4N78E 3AE6C 2HODB 3BRTB 1EZVD 1FZCA 3BCCG 4GKGA 3IFMA 3VMXA 3L74J 3L74E 1HWTC 1N73B 3TSIA 3C9IA 1L0LD 1H89A 1YITP 3MUDC 3RGUA 1BDCA 5AW0B 2O01J 1FZCB 3AE3C 2FYNB 1L0ND 3VMZA 5H2FH 1W2BO 3TGUJ 1QGKB 1XTGB 3B4SA 3AEBC 1VQKP 3CC7P 4GOEA 1MBVB 3RK3D 5AVUB 3B5NA 3V4WA 5KLVG 1JB0J 4IFFA 1J1EC 3LIEA 5CBOA 1E79H 2BEZF 3E1RA 4WFAW 1NTKD 3H1HG 5CBNA 3TK1A 3ZG5A 3J7ZZ 4OGQB 1OWAA 2KI7B 4JBZA 1JY3P 3U1CA 3B5NB 5DM6W 2A45I 1FC2C 2WSFH 5AVQB 2GUVA 1MBXC 3CCSW 3AEDC 2PGDA 1VQ9W 2QIWA 3LW5J 1OW6A 3L70E 3JSVC 1IFDA 1NTMG 1HF9A 3GF7A 3W7UA 1XTCC 3N4XA 3C8VA 4IL6E 1M57D 5TJHA 1Z56A 2O01N 5KJ7C 3MTUE 2RMZA 3H1IG 3P32A 3U1AA 1SQBD 3L71J 4ASVA 4OWFA 1IFIA 5APXA 3EFFK 4GDOA 1VF5C 4KHXA 2QM7A 1LZWA 2Y0EA 2E5YA 3V4QA 2WQYC 1LTTC 1T2KD 2W8ZA 3L74G 1JM0A 3AECC 2W27A 1GTWA 2I1KA 5CMZA 2R32A 3CCSP 3D70A 5M18A 1VQ9P 3GW1A 2P7JA 1YTZT 3H1JE 3KDPB 4PD4D 1OVUA 3QWOC 3TGUG 1E5WA 3VOPA 1JMMA 1VL2A 1OW8A 4CPKA 3L73D 2IBZD 3USSA 4OVNF 4H13C 3ZDMA 1HGZA 1Y47A 1KB9D 2ZJSE 2Q7CA 4WY4D 2FBWC 1IFPA 2WA8A 1WRGA 1BDDA 1JY3O 3RK2C 3O2OA 3AE7C 2HPCA 5CCGD 1FZGA 2A06E 2JP3A 1OZHA 1J1EB 1OVRA 1JJ2V 2OQQA 2QRXA 3EWKA 3W7TA 2GM4A 4WCEW 3V2NA 2KZIA 1AFOA 3AEEC 3S9OA 2KSJA 2ZXEB 2M3BA 2E75D 1NTZD 1Q81X 1JCDA 3KZIE 2R3CA 3F5HA 2QG4A 2KSEA 1M7LA 5KJ7A 2HPCB
chains in the Genus database with same CATH topology
4YTPC 2QJKC 3GQ1A 1PL5A 1ZOYC 1ZRTE 2K9YA 5L8RJ 1LZWA 3G9RA 2MKVA 2O01J 1K05A 3AE3C 1TU3F 2V7QJ 2WQYC 1DIPA 3GQ0A 2H88C 1KQFB 3IAOA 1R6OC 3O1FB 1S5LX 3GLMA 3O2HA 3AEBC 3AECC 3SFEC 2YIUC 4H44D 1RQVA 4I7ZC 3AE8C 3IN6A 2QJYC 4Y28J 5M1BA 2WPVB 3AE1C 1MBVB 1FDIA 2WSFJ 2E74D 3G19A 2FXPA 4H13B 3AE4C 1CTFA 3D70A 1JB0J 3D6ZA 1NYHA 4H44C 3ABVC 4H0LB 1WMKA 3GW1A 1GMJA 1KILE 2ZT9D 3SFDC 1AJYA 2E74C 1FDOA 4YJXA 2D2CD 1OMIA 1KQGB 3AEGC 1U57A 1PIXA 2E76B 2G8YA 3DNJA 2BEZF 5KKZC 2J5UA 4H13D 1VL2A 2IDBA 4IL6X 1OW8A 2ZT9C 4PV1B 4YJMA 4OGQB 1EXJA 1VF5B 2D2CC 1PV3A 2E75B 3AE5C 1DD3A 1DD4A 3Q3DA 2G3AA 3O2BA 4H13C 2P10A 1R6QC 2WSEJ 1KMIZ 1HJ0A 1NGMB 1S1CX 2YMKA 3Q5PA 3AE9C 3G1BA 4TT3H 3T97B 1MBXC 3AEDC 2FBWC 2FYNC 1YQ4C 2QIWA 4R4LA 1Y9BA 1K04A 2WA8A 3G3PA 3LW5J 3Q2YA 4XFJA 1OW6A 2BEQD 4YKAA 4I7ZB 3H25A 3AE2C 3FGAD 4Z1MH 3AE7C 1HF9A 3O2OA 3GF7A 4H0LD 3GMAA 4RKUJ 3AE6C 2WSCJ 1UIXA 3AEAC 3GF3A 2JP3A 4KT0J 3Q5RA 1RQUA 4H44B 3RL0g 3C8VA 2OQQA 2WA9A 2E76D 4U7JA 1EXIA 3Q1MA 1RQSA 2E74B 3EWKA 1MG9A 3Q5SA 3AEFC 1KORA 4H0LC 1MKMA 1ZMEC 2JO1A 1R8EA 1KTMA 3O6QA 3RK3E 3AEEC 4PV1D 3O1FA 4OGQD 1IK7A 3S9OA 1VF5D 2E75D 2E76C 2ZT9B 1OW7A 1MBUC 2QSIA 4YXDC 2D2CB 3D71A 4R4MA 2H89C 1ZP0C 3R4YA 1YQ3C 3D6YA 2NZ2A 4PV1C 3B71A 2W9RA 2QJPC 4OGQC 4GDOA 1VF5C 2E75C 5KLIC 1Q90D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTF A;  1RQU A;  1R6Q C;  2WA9 A;  3GQ1 A;  1RQS A;  1MG9 A;  3GW1 A;  1LZW A;  3G1B A;  4YJX A;  1MBX C;  3O1F A;  3DNJ A;  3GQ0 A;  2WA8 A;  3G3P A;  1R6O C;  3O1F B;  1MBU C;  4YKA A;  3O2H A;  1RQV A;  4YJM A;  3O2O A;  2W9R A;  1DD3 A;  1DD4 A;  1MBV B;  3G19 A;  3O2B A; 
#chains in the Genus database with same CATH topology
 4UY8 Z;  2JEE A;  1GZL A;  3CX5 I;  5KTB A;  1LT9 C;  2JJL A;  2JKV A;  1GK4 A;  1W5C E;  3L71 G;  1S4X A;  5AW7 B;  3P8C E;  1N7S C;  1VQ8 W;  4NPD A;  5APV A;  1N8R Q;  2C0W A;  4O9B A;  1PPJ G;  1OIP A;  2LR2 A;  3CCL W;  3T97 A;  3JCU H;  1L0L J;  1KIL E;  1L0L E;  1FDO A;  2MJZ A;  5KAF E;  1HGV A;  1PGJ A;  1PIX A;  3CWB D;  3G3Z A;  1T3J A;  1L0N J;  1EXJ A;  1P84 D;  1VF5 B;  1PZQ A;  1Q82 Q;  4WFN W;  2FYU D;  1S1C X;  2KS1 A;  2KXP B;  4UB6 H;  1S5L H;  2IYP A;  3L75 D;  1LP1 A;  3T97 B;  1JY2 P;  2KB7 P;  4LLH A;  4I6M C;  1K04 A;  2E42 A;  4DJG A;  1NU1 D;  3CXH H;  1SQQ E;  1RY3 A;  5M19 A;  4GOF A;  4W7Y A;  1NTK J;  2B88 A;  1UIX A;  3Q5R A;  1FJP A;  1X0T A;  2YKQ A;  4ASW A;  4RES B;  1KIL C;  1R8E A;  5GTI H;  1W2B V;  1JY3 N;  2B89 A;  1EQ7 A;  3O1F A;  1KQL A;  1VQ8 P;  1LP1 B;  5GAE a;  1MFT A;  2KOG A;  3OJA B;  4EYY Q;  2RN0 A;  3D71 A;  3TYY A;  4WB4 A;  3R4Y A;  3FXD A;  1SQP D;  4PV1 C;  1YIJ W;  5APU A;  1BGY D;  3HE4 A;  1JCC A;  4YTP C;  3I56 W;  2BCC D;  2LKM A;  1SFC C;  1FJK A;  1PGP A;  5AW5 B;  5TIS E;  2V7Q J;  3V6I A;  3O1F B;  3GLM A;  3RK2 B;  1CZQ A;  1NKZ B;  3E7K A;  4C46 A;  2WPV B;  1FBM A;  1LT9 A;  1SQB E;  2JWD A;  5APQ A;  2KP8 A;  3HE4 B;  5JVG W;  2LXB A;  2YKP A;  1M90 X;  2C9N Y;  1N7S A;  5AW9 B;  1BXY A;  3H1L D;  1ZRT D;  3G4S W;  2OTL W;  1LT9 B;  2M0B A;  1M8O B;  2POH A;  1L0L G;  1MUU A;  1PFI A;  3A0H E;  1YIJ P;  4EOT A;  1MV8 A;  1L0N G;  3WUU A;  1N7S B;  3I56 P;  3CX5 E;  3JC2 2;  5B5E H;  4BXL A;  2RH0 A;  3N7N A;  5B66 H;  1JY2 O;  3L73 J;  1KZU B;  5JVH W;  1RE3 A;  4JYB A;  3BCC E;  3H32 A;  1QLE D;  1VQN W;  4L74 A;  1OXZ A;  1KB9 E;  2W90 A;  2E76 C;  4IFM A;  4YXD C;  1PP9 E;  2WSS H;  2K3R A;  3ZG0 A;  2E43 A;  1NTK G;  1D7M A;  5KLI C;  1KIL A;  5CHX A;  1VDF A;  1L0L K;  2HYN A;  1TU3 F;  3G4S P;  2OTL P;  1DIP A;  3H32 B;  2H88 C;  1RF0 C;  1L0N K;  3PRJ A;  4H44 D;  5AVY B;  3AE8 C;  2AEJ A;  1KYO I;  1NTZ J;  2N1T D;  2W6A A;  1SFC A;  2HG5 D;  2H8P D;  3D6Z A;  5BU8 B;  1KIL B;  3H1K J;  1WMK A;  5KLV E;  4LGD E;  3FWN A;  4L73 A;  1MWT A;  1KQG B;  1LTB C;  4RO0 A;  2KK7 A;  5AW4 B;  2J5U A;  2IDB A;  2WWW A;  4PV1 B;  2D2C C;  3H1H E;  1SQB G;  1M90 Q;  1DX7 A;  1NTK K;  1KQS O;  3SSU A;  2IPP A;  1VQN P;  3M91 A;  3NMD A;  5DJU B;  1R6Q C;  1SFC B;  1NGM B;  1JOC A;  1YTZ I;  4Y99 B;  2XU6 A;  1YQ4 C;  2ITA A;  3FXE A;  4XFJ A;  1LNQ A;  3ZFZ A;  4ZNC A;  3CWB J;  2YKO A;  1NTM E;  3I55 P;  1LTJ C;  4RKU J;  3A7O A;  4DT0 A;  4WFB W;  3GW6 A;  1ZME C;  1A02 J;  5CCH D;  4IL6 H;  3O6Q A;  2FYU J;  3I5C A;  2FYU E;  2OYH C;  1AQT A;  3H1I E;  4AYC A;  3L75 E;  2IFM A;  2ZYA A;  1MZ9 A;  1JY2 N;  1SQB K;  1VQ5 P;  2QJP C;  1NU1 J;  2QJK C;  4RJT A;  1NU1 E;  3L73 G;  2V4H A;  1NVO A;  1ZOY C;  2K9Y A;  1S9K E;  3O6Q B;  1G1I A;  1PP9 G;  1AVO A;  2IZ0 A;  2P2U A;  2QM8 A;  2E74 D;  4HH2 A;  4NPE A;  2FYZ A;  1SQP J;  1SQV D;  1RF1 C;  4B86 A;  1BGY J;  2YMY A;  1RF0 A;  2Q3E A;  1NAY A;  1SP4 A;  2E76 B;  3BAT A;  5KKZ C;  2BCC J;  2BCC E;  2ZJP W;  3TGU E;  4YJM A;  5APT A;  2P67 A;  1PV3 A;  3HD7 D;  5KLI B;  1NTZ G;  3A5T A;  1JTH A;  3M0D C;  1PGQ A;  1YI2 W;  2O3J A;  4WVZ A;  4PJ0 E;  2SPZ A;  2QE7 H;  2FKW B;  1CW5 A;  1EZV I;  4JF7 A;  1LGH B;  3H1L J;  2CPB A;  1T6A A;  1JTH B;  1ZV8 A;  1MKM A;  5AW6 B;  1KTM A;  2NPS C;  2WSE H;  1URQ C;  4IFD K;  5AVS B;  1KYO E;  3GHG C;  1LTJ A;  4W80 A;  2D2C B;  2M5A A;  2IFN A;  2Z4E A;  3CWB G;  1EC5 A;  1U7J A;  3V2P A;  1ZW0 A;  1NTZ K;  2PFX A;  1S2E A;  3KZI H;  2Y9Z A;  5KLV K;  1MWR A;  3M9Q A;  2OYH A;  2FYU G;  2MKV A;  1EDK A;  3CD6 W;  3PTZ A;  1R6O C;  3L75 G;  1SLQ A;  1RHZ B;  1GU4 A;  5CJ4 A;  3L71 E;  1LTJ B;  2M5A B;  1K73 Q;  1NU1 G;  2A45 H;  1YI2 P;  2YO3 A;  3RL0 C;  3HTK B;  1OX3 A;  1PPJ E;  3L72 D;  2OYH B;  1N8R X;  5KAF H;  2K1A A;  2ZT9 C;  2QJP B;  3MUD A;  1NTM K;  3HRN A;  2WMM A;  1DD4 A;  2QJK B;  1RF1 A;  2HLO A;  1ZR4 A;  1SQP G;  1BGY G;  4M3L A;  2FYU K;  1BCC D;  1Q82 X;  2N9Y B;  1W2E A;  5GTH E;  4EI2 A;  2BCC G;  1FOS E;  2ZYG A;  3P7K A;  1T3U A;  2IYO A;  2AEF A;  2E5T A;  3M0D A;  2XKM A;  1Q7Y Q;  1NU1 K;  1GL2 C;  1RF1 B;  2WA9 A;  3CD6 P;  5KKZ B;  5BVZ A;  4OGQ D;  3SWK A;  1OW7 A;  1HH0 A;  3B5N D;  2ZVO B;  1L4A C;  3D6Y A;  2R44 A;  1KC8 X;  3H1L G;  3L37 A;  3CXH D;  3G9R A;  3OA7 A;  1NWQ A;  4DKI A;  2J59 M;  5TIS H;  3W7S A;  1KQS V;  1HJB A;  1KFM A;  3AE1 C;  1JEK A;  1G2C A;  2WSF J;  3H1K D;  5E79 E;  2KNC B;  2Y0D A;  2Q1K A;  4OH8 B;  4PD4 I;  2NPS B;  1BE3 D;  1QX8 A;  1URQ B;  2XZR A;  1OMI A;  4BWN A;  1IC2 A;  3GHG B;  1ZXG A;  4N3Y B;  1EZV E;  4LC1 A;  2IBZ I;  2AXT E;  3RBX A;  5AVV B;  1KB9 I;  4WBA A;  2AEM A;  1G2C B;  4HYT B;  2FFD C;  5GAH a;  4UB8 H;  1SQV J;  3B8E B;  3SWF A;  1Y9B A;  1SQV E;  1FOS F;  3A0H H;  1LTS C;  5KAI E;  1L0N E;  3CX5 H;  3GF3 A;  3RL0 B;  1RQU A;  4U3F D;  1GU5 A;  3Q5S A;  5M1A A;  4H0L C;  2JO1 A;  5APS A;  1VPC A;  2ZXX A;  3RK3 E;  3CC2 W;  2ZYD A;  3VP8 A;  2ZT9 B;  3MP7 B;  3KPE A;  4IOC W;  1NJI X;  4R4M A;  2H89 C;  2QEX W;  4GIF A;  2W9R A;  2ZFC A;  3TDK A;  1NTK E;  1HTL C;  2WPS A;  5CJ0 A;  3VMY A;  3VP9 A;  2WSC H;  1MFZ A;  3RBZ A;  3HUS C;  5GAD a;  4N78 D;  1KC8 Q;  1X9V A;  1S5L X;  1FE6 A;  1YJ9 W;  2M8R A;  2KLV A;  2QA4 W;  4I7Z C;  3CCL P;  1AV1 A;  1NH4 A;  2C0X A;  1GL2 B;  4H13 B;  2I8D A;  1H0T A;  3PH0 A;  3RK3 C;  3CPW V;  1NO4 A;  3R2P A;  5AVX B;  1T8Z A;  1P84 I;  2CPS A;  1L4A B;  3IF4 A;  2KUB A;  3CC2 P;  4EDF A;  1LT1 A;  1KMI Z;  5AW8 B;  3Q5P A;  1H0T B;  3CL3 D;  3G1B A;  1EDJ A;  1U7M A;  2QEX P;  5CA3 A;  1EZV G;  5HL7 W;  3VN0 A;  3Q2Y A;  2JDI H;  3L72 J;  4JQ0 D;  3K5B A;  5KJ7 D;  2WPQ A;  3GMA A;  1EDI A;  3CCE W;  3RL0 g;  1M1J C;  1M56 D;  4W7Z A;  4U7J A;  5GW7 A;  3Q1M A;  2JR8 A;  3DLL W;  1SQV G;  1IK7 A;  1NHL A;  1VF5 D;  1VQ4 W;  1FZB A;  1MBU C;  1BCC J;  1BCC E;  1OVV A;  4BRY B;  3O8Z A;  4PD4 E;  2AXC A;  2K88 A;  1Q90 D;  2FFD B;  2H7H A;  5DM7 W;  2L91 A;  5AVW B;  3L70 D;  3L73 E;  1NJI Q;  1VQ7 W;  2IBZ E;  2B87 A;  3MD0 A;  3W68 A;  5AW3 B;  1RE4 C;  1KQF B;  3IAO A;  2YNY A;  3F89 A;  3WU2 E;  2YIU C;  1RQV A;  5AVR B;  4D6T D;  3IN6 A;  4Y28 J;  5M1B A;  1YHQ W;  1M1K X;  4ZMD A;  1T2K C;  1Q2N A;  4NPF X;  1CTF A;  1N86 A;  3ABV C;  4H0L B;  3HUS A;  5AW1 B;  3MHV A;  4JPZ B;  3SFD C;  3VTP C;  1KD1 Q;  1SQV K;  3DNJ A;  3A0B E;  3CCJ W;  3CCE P;  2B87 B;  3WUT A;  2O01 H;  1UII A;  4H13 D;  5AVT B;  1IFJ A;  3BVH A;  1GD2 E;  3Q3D A;  2G3A A;  1NTZ E;  2KYV A;  1VQ4 P;  1JUN A;  4QMA A;  3H1K E;  3OAK A;  3HUS B;  2PAJ A;  2W6B A;  1QL1 A;  3RK2 D;  4R4L A;  1BE3 J;  4GOD A;  4I7Z B;  4WY4 C;  1JMB A;  1ZLL A;  4PJ0 H;  1VQ7 P;  3AEA C;  3H1J D;  1GW3 A;  4KT0 J;  2RKL A;  2ZJQ W;  3D3I A;  3RK3 B;  1MG9 A;  3AEF C;  1KOR A;  3A3Y B;  5CCG C;  4A7P A;  1YHQ P;  2YXR B;  1SVF A;  3L72 G;  1N2D C;  1QEX A;  1KN7 A;  1KYO H;  3LW5 H;  3CWB E;  2B9B A;  2E75 C;  4MN4 C;  2W6J H;  1VQM W;  3CCM W;  1P84 E;  1H88 A;  1HUC A;  1YIT W;  1BSH A;  1CSB A;  1LTG C;  1N7S D;  4U3F J;  4U3F E;  2Q5U A;  1J2J B;  2WIT A;  2A06 D;  3KQG A;  1BCC G;  5DJT B;  3BAS A;  2QJY C;  3M06 A;  1ZR2 A;  1FZE A;  2FXP A;  1M1J B;  3BRV B;  1MWS A;  4HKZ H;  2IBZ G;  1RE4 A;  1GMJ A;  1K73 X;  3VMA A;  1M1K Q;  4BL3 A;  2XV5 A;  4IL6 X;  4AUW A;  5B66 E;  1SQX D;  1DD3 A;  1IK9 A;  3O2B A;  3L35 A;  1AQ5 A;  4XE5 B;  1FDM A;  1L2P A;  2XDJ A;  2H43 A;  1SQP E;  3P8C D;  1BGY E;  2OTK E;  3M9B A;  5EFW B;  2YIU B;  5GTH H;  4K3A A;  1VQM P;  1H8A A;  2Q3I A;  4I2L C;  3CCM P;  1KIL D;  1K8A Q;  1OFC X;  2OYO A;  1LTI C;  3H1K G;  1EXI A;  3PP5 A;  1RQS A;  1Q7Y X;  3P8M C;  4PV1 D;  4WY4 A;  4WWI A;  1BE3 G;  3KXD A;  3CPW O;  2P58 A;  1KV4 A;  4WF9 W;  1ZP0 C;  1SFC D;  3M0A A;  5CCG A;  2YO2 A;  3G71 W;  2IX7 C;  3H1L E;  1ZRT E;  2OYI C;  1SQQ D;  4DCK A;  1A02 F;  3CMA W;  4WY4 B;  3OW2 O;  1LJ2 A;  2W83 C;  2Q9I A;  3HTK A;  5E79 H;  3PJS K;  4ZKP A;  4YJX A;  2GUS A;  4U3F G;  3AEG C;  1CI6 A;  3KYQ A;  3L70 J;  2Y9Y A;  1KFN A;  3CLQ A;  2E75 B;  1YJN W;  3FWL A;  2AXT H;  2P10 A;  1IJD B;  4D6T J;  1FAV A;  4D6T E;  1K9M X;  2O1K A;  1QVF O;  1VQQ A;  4YXW H;  2OTJ W;  3PHL A;  4DZO A;  1CI6 B;  3G71 P;  2QJY B;  3FGA D;  1LWU C;  3QH9 A;  4IOA W;  3S4R A;  3TNU A;  5KAI H;  5K5G B;  3CMA P;  2XND H;  2E76 D;  2ZJR W;  3NFQ A;  4C7N A;  4L76 A;  4I1L A;  1VQ6 W;  5BU5 A;  2Z5H A;  2YXQ B;  4XA4 A;  3MGN A;  2Y0C A;  3CF5 W;  3W7X A;  2J58 A;  4YPC A;  3TNU B;  2DW3 A;  5L8R J;  3H1J J;  5H2F E;  3CX5 D;  1SS1 A;  1YJN P;  4N6J A;  4C7N B;  3CCU W;  1JNM A;  2KNC A;  3BCC D;  2OYI A;  3NXS A;  4ZKU A;  2OTJ P;  2NPS A;  4H44 C;  4KJM A;  1SQP K;  1URQ A;  1PP9 D;  2IZ1 A;  2D2C D;  2N1T C;  3GHG A;  2ZVN B;  3PLN A;  1R5S A;  1FZF A;  2V7Q H;  1LTA C;  1DH3 A;  2JWA A;  2C9L Y;  1G1J A;  4AQR D;  1N7L A;  2WSE J;  2OYI B;  1VQ6 P;  2BAS A;  2OAR A;  4TT3 H;  1IFM A;  3EQ2 A;  1QVG O;  3L70 G;  2VRS A;  4YKA A;  2I1J A;  1K9M Q;  5KLV D;  3MZW B;  1S72 W;  2L5G B;  4HB1 A;  3VYI A;  4D6T G;  5GAG a;  1SQX J;  3CCU P;  2K37 A;  1SQX E;  3H1H D;  4DOJ A;  1HVV A;  4C7R A;  1LWU A;  3SWY A;  1YBK A;  3GG2 A;  2FY8 A;  5AVZ B;  5CCH C;  3CXH I;  3EFG A;  3CCV W;  2PP6 A;  3WMM 0;  4PD4 H;  1X79 B;  1PL5 A;  1K05 A;  1YYC A;  1NTM D;  2PRR A;  1LWU B;  1KB9 H;  2WTY A;  3WU2 H;  1GL2 A;  3AE4 C;  3CME W;  2Q6Q A;  3H1I D;  1NYH A;  2WZ7 A;  1BSN A;  3H1J G;  2E74 C;  5APY A;  3S1K A;  1U57 A;  1RE3 C;  3ITK A;  1S72 P;  3V5B A;  1GW4 A;  1L4A A;  1SQQ J;  4CPG A;  3A0B H;  1S9K D;  1KD1 X;  1WT6 A;  3II6 A;  1HJ0 A;  4HJG H;  2N1T A;  2R3S A;  3HD7 C;  1J1D C;  2LXC B;  2KS1 B;  3L74 D;  2ZAE B;  2WPR A;  3CXC V;  1DEE G;  3CCV P;  3PIP W;  2BEQ D;  1AA0 A;  1IO4 A;  2K9J A;  2A06 G;  3AE2 C;  2NPS D;  1IFN A;  1URQ D;  1VQL W;  4H44 B;  1Q81 Q;  3U59 A;  3TGU D;  2N1T B;  2NRG A;  4Y99 C;  3OW2 V;  1AVY A;  1Q86 X;  4BRY A;  3CME P;  2UWJ E;  3L72 E;  1SQB J;  3B71 A;  2K9J B;  2CK3 H;  2FFD A;  2FXO A;  1FS0 E;  4K35 A;  1SQX G;  3WUV A;  3IR9 A;  2M3E A;  1YJ9 P;  2QA4 P;  2GA1 A;  1P84 H;  3V2R A;  5CCH A;  3GQ0 A;  1EDL A;  3HE5 A;  2A45 G;  3O2H A;  3RL0 D;  1FDI A;  3G19 A;  3JCU E;  4UB8 E;  3L4F A;  1USD A;  1KYO D;  1QVF V;  1VQO W;  2ZT9 D;  2G8Y A;  5AW2 B;  4TLF A;  1VQL P;  1NKN A;  1ZN5 A;  3HE5 B;  1GK6 A;  3V2Q A;  3AE5 C;  3W7W A;  1N73 C;  1R5L A;  2Z5I A;  4U67 W;  1VQP W;  1DEB A;  4UB6 E;  1S5L E;  1USE A;  2XNX A;  1SQX K;  2YMK A;  3PIO W;  3BCC J;  3AE9 C;  4GT1 A;  1YJW W;  3L71 D;  3CCR W;  1FZC C;  2P1J A;  2FYN C;  3CXH E;  3MIW A;  1PP9 J;  1SQQ G;  1GL2 D;  3G6E W;  3H25 A;  1PPJ D;  2WSC J;  3HD7 A;  2FXM A;  1X22 A;  5GTI E;  3L36 A;  2E74 B;  3I55 W;  3LID A;  2KIK A;  1L4A D;  4CJN A;  1K8A X;  2KLU A;  4L75 A;  2QSI A;  2HR3 A;  1JO5 A;  1BE3 E;  3CC4 W;  2WT7 A;  1S3J A;  1YQ3 C;  2NZ2 A;  4IOI H;  4OGQ C;  1VQO P;  3M9H A;  3CCQ W;  1Q86 Q;  5KLV J;  3HD7 B;  1J1D B;  3GQ1 A;  4JYC A;  2R5B A;  3B5N C;  1VQ5 W;  3UIA A;  2HFE D;  1RH5 B;  5APW A;  3C1L A;  3KHU A;  3CI9 A;  1SQQ K;  2QVA A;  1VQP P;  1PGO A;  2R5D A;  4IO9 W;  5C39 A;  3SFE C;  3H1H J;  2O1J A;  2N9B A;  4BL2 A;  3TF5 A;  1YJW P;  1M1J A;  1NOH A;  2WT7 B;  1FU1 A;  1GDT A;  3CCR P;  3CCJ P;  3A2A A;  1QVG V;  3G6E P;  2WVR A;  1AJY A;  1Y8A A;  1FZA A;  1QL2 A;  1NTM J;  3FX0 A;  1MWU A;  2HOD A;  1HBW A;  2OGU A;  3W67 A;  1VQK W;  3H6P A;  3CC7 W;  3E1I A;  1NAF A;  3NTN A;  3CC4 P;  1X8Y A;  1IZN B;  3H1I J;  2KZJ A;  4EIJ A;  3G3P A;  3L75 J;  1N73 A;  5B5E E;  3CCQ P;  4Z1M H;  4H0L D;  4N78 E;  3AE6 C;  2HOD B;  3BRT B;  1EZV D;  1FZC A;  3BCC G;  4GKG A;  3IFM A;  3VMX A;  3L74 J;  3L74 E;  1HWT C;  1N73 B;  3TSI A;  3C9I A;  1L0L D;  1H89 A;  1YIT P;  3MUD C;  3RGU A;  1BDC A;  5AW0 B;  2O01 J;  1FZC B;  3AE3 C;  2FYN B;  1L0N D;  3VMZ A;  5H2F H;  1W2B O;  3TGU J;  1QGK B;  1XTG B;  3B4S A;  3AEB C;  1VQK P;  3CC7 P;  4GOE A;  1MBV B;  3RK3 D;  5AVU B;  3B5N A;  3V4W A;  5KLV G;  1JB0 J;  4IFF A;  1J1E C;  3LIE A;  5CBO A;  1E79 H;  2BEZ F;  3E1R A;  4WFA W;  1NTK D;  3H1H G;  5CBN A;  3TK1 A;  3ZG5 A;  3J7Z Z;  4OGQ B;  1OWA A;  2KI7 B;  4JBZ A;  1JY3 P;  3U1C A;  3B5N B;  5DM6 W;  2A45 I;  1FC2 C;  2WSF H;  5AVQ B;  2GUV A;  1MBX C;  3CCS W;  3AED C;  2PGD A;  1VQ9 W;  2QIW A;  3LW5 J;  1OW6 A;  3L70 E;  3JSV C;  1IFD A;  1NTM G;  1HF9 A;  3GF7 A;  3W7U A;  1XTC C;  3N4X A;  3C8V A;  4IL6 E;  1M57 D;  5TJH A;  1Z56 A;  2O01 N;  5KJ7 C;  3MTU E;  2RMZ A;  3H1I G;  3P32 A;  3U1A A;  1SQB D;  3L71 J;  4ASV A;  4OWF A;  1IFI A;  5APX A;  3EFF K;  4GDO A;  1VF5 C;  4KHX A;  2QM7 A;  1LZW A;  2Y0E A;  2E5Y A;  3V4Q A;  2WQY C;  1LTT C;  1T2K D;  2W8Z A;  3L74 G;  1JM0 A;  3AEC C;  2W27 A;  1GTW A;  2I1K A;  5CMZ A;  2R32 A;  3CCS P;  3D70 A;  5M18 A;  1VQ9 P;  3GW1 A;  2P7J A;  1YTZ T;  3H1J E;  3KDP B;  4PD4 D;  1OVU A;  3QWO C;  3TGU G;  1E5W A;  3VOP A;  1JMM A;  1VL2 A;  1OW8 A;  4CPK A;  3L73 D;  2IBZ D;  3USS A;  4OVN F;  4H13 C;  3ZDM A;  1HGZ A;  1Y47 A;  1KB9 D;  2ZJS E;  2Q7C A;  4WY4 D;  2FBW C;  1IFP A;  2WA8 A;  1WRG A;  1BDD A;  1JY3 O;  3RK2 C;  3O2O A;  3AE7 C;  2HPC A;  5CCG D;  1FZG A;  2A06 E;  2JP3 A;  1OZH A;  1J1E B;  1OVR A;  1JJ2 V;  2OQQ A;  2QRX A;  3EWK A;  3W7T A;  2GM4 A;  4WCE W;  3V2N A;  2KZI A;  1AFO A;  3AEE C;  3S9O A;  2KSJ A;  2ZXE B;  2M3B A;  2E75 D;  1NTZ D;  1Q81 X;  1JCD A;  3KZI E;  2R3C A;  3F5H A;  2QG4 A;  2KSE A;  1M7L A;  5KJ7 A;  2HPC B; 
#chains in the Genus database with same CATH homology
 4YTP C;  2QJK C;  3GQ1 A;  1PL5 A;  1ZOY C;  1ZRT E;  2K9Y A;  5L8R J;  1LZW A;  3G9R A;  2MKV A;  2O01 J;  1K05 A;  3AE3 C;  1TU3 F;  2V7Q J;  2WQY C;  1DIP A;  3GQ0 A;  2H88 C;  1KQF B;  3IAO A;  1R6O C;  3O1F B;  1S5L X;  3GLM A;  3O2H A;  3AEB C;  3AEC C;  3SFE C;  2YIU C;  4H44 D;  1RQV A;  4I7Z C;  3AE8 C;  3IN6 A;  2QJY C;  4Y28 J;  5M1B A;  2WPV B;  3AE1 C;  1MBV B;  1FDI A;  2WSF J;  2E74 D;  3G19 A;  2FXP A;  4H13 B;  3AE4 C;  1CTF A;  3D70 A;  1JB0 J;  3D6Z A;  1NYH A;  4H44 C;  3ABV C;  4H0L B;  1WMK A;  3GW1 A;  1GMJ A;  1KIL E;  2ZT9 D;  3SFD C;  1AJY A;  2E74 C;  1FDO A;  4YJX A;  2D2C D;  1OMI A;  1KQG B;  3AEG C;  1U57 A;  1PIX A;  2E76 B;  2G8Y A;  3DNJ A;  2BEZ F;  5KKZ C;  2J5U A;  4H13 D;  1VL2 A;  2IDB A;  4IL6 X;  1OW8 A;  2ZT9 C;  4PV1 B;  4YJM A;  4OGQ B;  1EXJ A;  1VF5 B;  2D2C C;  1PV3 A;  2E75 B;  3AE5 C;  1DD3 A;  1DD4 A;  3Q3D A;  2G3A A;  3O2B A;  4H13 C;  2P10 A;  1R6Q C;  2WSE J;  1KMI Z;  1HJ0 A;  1NGM B;  1S1C X;  2YMK A;  3Q5P A;  3AE9 C;  3G1B A;  4TT3 H;  3T97 B;  1MBX C;  3AED C;  2FBW C;  2FYN C;  1YQ4 C;  2QIW A;  4R4L A;  1Y9B A;  1K04 A;  2WA8 A;  3G3P A;  3LW5 J;  3Q2Y A;  4XFJ A;  1OW6 A;  2BEQ D;  4YKA A;  4I7Z B;  3H25 A;  3AE2 C;  3FGA D;  4Z1M H;  3AE7 C;  1HF9 A;  3O2O A;  3GF7 A;  4H0L D;  3GMA A;  4RKU J;  3AE6 C;  2WSC J;  1UIX A;  3AEA C;  3GF3 A;  2JP3 A;  4KT0 J;  3Q5R A;  1RQU A;  4H44 B;  3RL0 g;  3C8V A;  2OQQ A;  2WA9 A;  2E76 D;  4U7J A;  1EXI A;  3Q1M A;  1RQS A;  2E74 B;  3EWK A;  1MG9 A;  3Q5S A;  3AEF C;  1KOR A;  4H0L C;  1MKM A;  1ZME C;  2JO1 A;  1R8E A;  1KTM A;  3O6Q A;  3RK3 E;  3AEE C;  4PV1 D;  3O1F A;  4OGQ D;  1IK7 A;  3S9O A;  1VF5 D;  2E75 D;  2E76 C;  2ZT9 B;  1OW7 A;  1MBU C;  2QSI A;  4YXD C;  2D2C B;  3D71 A;  4R4M A;  2H89 C;  1ZP0 C;  3R4Y A;  1YQ3 C;  3D6Y A;  2NZ2 A;  4PV1 C;  3B71 A;  2W9R A;  2QJP C;  4OGQ C;  4GDO A;  1VF5 C;  2E75 C;  5KLI C;  1Q90 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...