1RQVA

Spatial model of l7 dimer from e.coli with one hinge region in helical state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7/L12
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rqvA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rqvA02
4YKAA 2WA8A 3O2BA 1DD4A 3G1BA 3DNJA 1DD3A 3GW1A 1MBVB 3GQ1A 4YJXA 4YJMA 1RQVA 3G19A 1LZWA 1CTFA 3O1FB 1MG9A 2W9RA 1RQSA 3GQ0A 3G3PA 3O2OA 3O2HA 1R6QC 3O1FA 1MBXC 2WA9A 1R6OC 1MBUC 1RQUA
chains in the Genus database with same CATH superfamily
3TYYA 2OYOA 2Y9YA 3HE5B 2XKMA 4WY4D 1HUCA 1KQSV 1RY3A 1T2KC 1KYOD 1N2DC 3H1KD 5E79H 2FYUD 4Y28J 3MUDA 1PFIA 4DZOA 1IK7A 3BRTB 2KZIA 2QM7A 5CCHC 4IFFA 4NPEA 2Y9ZA 3CCSP 3B5NA 1KV4A 2KK7A 2FKWB 1L0NJ 3G4SP 1Q90D 3M0DA 5AW1B 1M1JB 4U3FD 4XFJA 2A45G 2Z5IA 2OYHA 1VQMW 3ITKA 4U67W 3LW5H 2YKPA 1S3JA 3HUSB 5TISH 1GMJA 4PD4I 3OA7A 2AXTE 4IOIH 1SQVD 4PD4D 4W7YA 4RESB 1VF5B 1URQC 3GQ1A 2BASA 1SFCB 3E1IA 1XTGB 5APQA 1VQ9W 2E5YA 1SQQD 3CD6W 2OARA 2NPSD 2AXTH 1AFOA 3T97A 4PV1C 2JDIH 3IFMA 1N7SD 1MUUA 3FWLA 3HTKB 3M0AA 1Q7YX 1T6AA 2RMZA 5AW7B 1YTZI 1H88A 2LXBA 3IR9A 5AVVB 1VQKP 1KILC 1L0ND 3CPWO 1IJDB 1NYHA 4K3AA 2DW3A 1SQPE 3CCUW 4KT0J 1AQTA 5KLIB 3H1HE 3RK3E 1X22A 5KJ7D 2A45H 2P67A 2W6JH 2R32A 5AVQB 1LTTC 3NTNA 3CC2P 1YI2P 3C1LA 3FGAD 4ZKPA 4AUWA 3LW5J 2ZT9C 3OJAB 1Q81X 3KHUA 3UIAA 2OTJP 4IOAW 2C9NY 4YXWH 2GUVA 2ZJRW 1NHLA 2J59M 1ZR4A 3W7UA 1LTSC 5CMZA 2Q5UA 1JJ2V 3GW1A 2WTYA 3CX5H 1Y47A 3CC7P 4C7NB 1LT9A 1NJIX 1IC2A 1S9KE 1A02J 1JY2P 4ZMDA 2YIUC 1URQA 5AVUB 2OQQA 1LGHB 1L4AD 3O2HA 3BCCG 3ZDMA 2FXPA 1VQ4P 3U1AA 1GK6A 3CXHE 3MZWB 1Q7YQ 2RH0A 3Q3DA 4H44D 5AVWB 4BL2A 5APUA 2FFDC 2E75B 5DM6W 2WT7B 1KILA 1S72W 2M3EA 2QE7H 1RQVA 3KDPB 1UIIA 5KLVG 1T8ZA 3ABVC 2XNXA 3RK2B 1HJ0A 2IBZE 1VQLW 1CI6B 1R6QC 1IZNB 2YO2A 1H0TB 2ITAA 2M5AA 1Q81Q 1ZMEC 2YO3A 3BCCE 1K05A 3A0BE 1VQQA 1E5WA 1CSBA 2JO1A 3G6EW 3FXDA 1RE4C 1OW7A 1U7MA 1VQMP 1JY2N 4O9BA 3JC22 3RL0g 3PTZA 2XV5A 1QEXA 1OVUA 3GLMA 2KNCA 2H7HA 1BXYA 2E5TA 2IZ0A 3PIOW 3L75E 1SQPD 1NJIQ 1VQ9P 3H1HD 3RK3D 1RQSA 2A06G 1YIJW 3CD6P 1FZCC 5AVRB 4ZKUA 1K73X 4YTPC 2AEJA 4EI2A 1Q82X 1P84I 2Q7CA 3H1JG 3MD0A 4YJXA 1OVRA 2IYPA 3LIEA 1G2CA 1USEA 2ZYGA 3GW6A 2WSCH 3VTPC 5CBNA 4ZNCA 2NZ2A 3P8CE 2ZJQW 1N73C 2K9YA 5EFWB 1NTMG 5GAGa 3L71E 3H1IE 2JWAA 3RBXA 3R2PA 3O1FB 4H13B 3CCUP 4WY4B 2NRGA 5APTA 1MKMA 3RGUA 2R5BA 1S9KD 2A06E 2J58A 2E76D 4BL3A 1RF0C 1QVFO 1GL2C 1LTJC 2N9YB 1A02F 1YQ3C 1ZLLA 2Q3EA 3BCCJ 4BRYB 2BEZF 3H32A 4IL6E 3AE9C 4AYCA 1N86A 2HYNA 3CXHI 4JYCA 4N3YB 5M18A 5GAHa 1LTJB 2V7QH 2Y0EA 1CZQA 1QLED 3OW2O 3CXHD 1R5LA 4U3FE 3O8ZA 3Q5RA 1KQFB 2HPCB 3L35A 2E74D 1PGOA 2E42A 3G3PA 1YBKA 5M1BA 2ZYAA 4N78E 1EXJA 1LWUB 1SQVE 2CK3H 1VQKW 2N1TA 1FJKA 2WSCJ 5KLVJ 1OX3A 2NPSB 1JMMA 4NPDA 4IOCW 4L75A 1ZXGA 2Z5HA 3V6IA 2E75D 3H6PA 2WPRA 2IBZI 1RE3C 1S5LE 1N7SB 2AXCA 5APWA 1K73Q 2YXQB 1Q82Q 1FZCA 4GDOA 3NMDA 1JM0A 4OGQD 2B87B 1FZGA 5GTIE 2ZAEB 1JUNA 4KJMA 5DJTB 1NAYA 1QX8A 5KJ7C 2I1KA 3B4SA 4EYYQ 3HD7C 3BCCD 3VP8A 3W7TA 1HJBA 3GHGB 2GA1A 5B5EE 5HL7W 5KAIE 2WA9A 4I7ZC 5CJ4A 1N73A 3Q1MA 3Q5PA 1VPCA 1LTBC 1S72P 2GUSA 5B66E 1X9VA 4UB6E 5BU5A 2QVAA 3L75D 2QSIA 2V7QJ 3I55W 3PIPW 1VQLP 3NXSA 1LNQA 2PRRA 4UY8Z 3VMYA 2KXPB 3H1JJ 1MV8A 1JTHA 2AEFA 4JYBA 4UB6H 3G6EP 2ZVOB 1BDCA 4YPCA 2QJKC 4A7PA 1NTMJ 5CCGD 3WU2E 3P8CD 2H43A 1IFDA 4DOJA 2JR8A 1EDIA 2LKMA 3L74G 2B89A 3L71D 1VQ8W 5APXA 4XA4A 1L2PA 3H1ID 2QJKB 1EZVE 1MWSA 2ZFCA 1NO4A 1J1DB 2FY8A 5E79E 5AVSB 3MTUE 1RF1C 1W2BV 2WPVB 1L4AB 4H44C 5APSA 1IK9A 4H13D 1KYOI 2A06D 2HODA 2O1JA 3E1RA 1AQ5A 2H88C 1J2JB 1W2BO 1M1JC 1RE3A 2CPBA 1RF1B 4WF9W 1AV1A 3H1JD 1M8OB 3HUSC 1PV3A 4H44B 5TISE 3EQ2A 2D2CB 1KQSO 5H2FH 3RBZA 3ZG0A 1VF5C 2L5GB 4CPKA 1SFCC 1OWAA 2JP3A 1N8RQ 2E43A 2QIWA 3P8MC 3A2AA 3N4XA 1DIPA 2FYZA 1SQBG 4N78D 1SP4A 2KIKA 4CPGA 3Q2YA 1JO5A 2QJPC 4KHXA 1MWUA 3SWFA 3P32A 1R8EA 3W7SA 1JOCA 5CJ0A 1KMIZ 5BU8B 2W6BA 3AEDC 4AQRD 5K5GB 3D6ZA 2YNYA 3U1CA 2I1JA 3G3ZA 2POHA 3RK3C 2FBWC 4BXLA 2QJPB 3V2PA 1WT6A 3H1LG 2IPPA 1LTAC 5KLIC 3R4YA 1MZ9A 1YJWW 2OGUA 1BGYG 1IFNA 3RK3B 1AJYA 1M1KX 3IF4A 3MIWA 2ZJPW 2R44A 1MWTA 4LGDE 1CTFA 1FZFA 4RKUJ 4JBZA 3I5CA 3PRJA 2XDJA 4GKGA 4WFBW 1MBUC 1MFTA 1FAVA 5KLVK 3AE4C 2Z4EA 4IL6X 2OTLW 3B5ND 3S1KA 3CX5E 3CWBG 3PP5A 3KQGA 3GF3A 2E76C 1SVFA 2P58A 3L74J 3TSIA 1VDFA 3HUSA 2M3BA 2JJLA 5CCHA 1ZRTE 2MKVA 4OVNF 5GAEa 1KILE 5GTHE 1EZVI 2KUBA 1IFPA 2E76B 2UWJE 1EZVD 1SFCA 3I55P 1USDA 1G1JA 4M3LA 1VQ6W 1GK4A 1S5LX 3MP7B 1FE6A 3L37A 5GTHH 3V2NA 1W5CE 3CCMW 3K5BA 2YKOA 4ASVA 1W2EA 2WSEH 3CL3D 5KAFH 2KNCB 3GMAA 3HTKA 5TJHA 2E75C 2HFED 4HJGH 3II6A 2E74B 3CC4W 4C7RA 2R3CA 1PPJG 1VQ8P 3W67A 1U7JA 1YYCA 1BE3G 2O01N 4D6TG 4DCKA 1NTMK 1SQBJ 2D2CD 3M9HA 3RK2C 1U57A 4WBAA 1EDJA 3M9BA 2IFMA 1G2CB 3QWOC 2C0XA 4OGQB 2KLUA 1LJ2A 1JMBA 4BWNA 2K37A 1UIXA 3BRVB 1OIPA 3CCJP 2LXCB 2H89C 2QJYB 1ZW0A 2KOGA 1EXIA 1M57D 2BCCG 5M1AA 2PAJA 1YITW 4XE5B 3WUVA 3H1LJ 5CHXA 3TF5A 4HYTB 2RKLA 1SS1A 3O6QB 2XU6A 1TU3F 2ZJSE 1BGYJ 3S4RA 1X0TA 2A45I 1NTZG 1BE3E 3AEGC 4WCEW 4D6TE 4EIJA 4C7NA 2WSEJ 4EOTA 3SFEC 1ZV8A 3TK1A 2LR2A 5CCGC 1M90X 2IX7C 1Q86X 5AW0B 3VN0A 3CCLW 2KS1B 4TT3H 1URQD 2K9JA 2KZJA 4GOEA 1MWRA 5KLVE 3HE4B 3L4FA 4W80A 3CWBJ 2WZ7A 3CX5I 3M91A 4PV1D 3AE1C 1JY3N 5BVZA 3CX5D 4H13C 2N1TB 4WY4C 4OWFA 1VQNW 2RN0A 4HB1A 3AEEC 3MGNA 1YJWP 2FYUG 4WB4A 1ZRTD 1KB9H 1PGJA 1KILD 1NGMB 3S9OA 1LTIC 2FFDA 1JB0J 1CI6A 5APVA 1HGZA 3TNUA 1H8AA 1WRGA 2KLVA 4Y99C 2JEEA 5AW4B 5L8RJ 4L74A 4I6MC 3B8EB 3TGUJ 2OTLP 1NTKK 2ZT9D 2Q9IA 1PGPA 2KI7B 3AE8C 3H1JE 2PP6A 3CMAP 1JNMA 2KSEA 1MFZA 3CCRW 1EDKA 4HH2A 1NU1K 4Y99B 1LWUC 1FOSE 1BE3J 4D6TJ 2P1JA 1GU5A 2Y0DA 1YQ4C 1K9MX 2NPSC 1NTME 1IFJA 2FYNB 5JVGW 1GD2E 1RE4A 1JEKA 3V2QA 4YXDC 2YMKA 1N7SC 1YHQP 1VQ6P 1M90Q 5AW5B 4WVZA 3L36A 3CCMP 4EDFA 4LC1A 3WUUA 2M8RA 3M06A 3GHGC 2BCCJ 2K1AA 2L91A 2OYIC 1L0LJ 3A0HE 1RH5B 1SQXK 3CC4P 5AW8B 3D6YA 3G1BA 1PGQA 1FZEA 1BSNA 1FDMA 4YJMA 2IFNA 1J1EB 2O1KA 1QVGV 3P7KA 3MUDC 1NTZJ 2ZXXA 1LP1A 3CLQA 2OYIB 1JY3O 1VQ5W 1OZHA 4I2LC 2O01H 4PD4H 4WY4A 3A0HH 3B5NC 1BE3D 1S4XA 4D6TD 2QA4W 4U7JA 4I1LA 1FJPA 2Y0CA 5CBOA 3M0DC 3KXDA 4RJTA 2IZ1A 3WUTA 1JCDA 3AEFC 1IO4A 3NFQA 2WQYC 3RL0B 3N7NA 3FWNA 1SQBK 1QGKB 3CCVW 4WFNW 3B5NB 4BRYA 1FC2C 1NTKG 1YJ9W 1QL1A 1M56D 5KLVD 1VQPW 3PJSK 1YITP 3V4QA 1NAFA 2OYHB 2HR3A 1NU1G 1RF0A 4PJ0E 1GL2A 1LTJA 1N7LA 1FU1A 1X79B 3JCUH 1SLQA 3V5BA 2QM8A 3VMZA 2FYUJ 2HPCA 1J1DC 3CXCV 2PFXA 4R4MA 4Z1MH 4WFAW 2KYVA 3Q5SA 2FXMA 1K9MQ 2GM4A 1L4AC 3IN6A 1LWUA 4PJ0H 3C8VA 2N1TD 5AW2B 1K8AX 3CCLP 3T97B 3KZIH 1NH4A 4W7ZA 3PLNA 3WMM0 2WVRA 3I56W 2B87A 3PHLA 3VMXA 1NTKE 2O01J 2Q1KA 3EFFK 2D2CC 5AVTB 5H2FE 2JKVA 1SQXG 3USSA 1AVYA 3CCJW 2C0WA 5AW9B 1KTMA 1NU1E 3BVHA 1SQQJ 1VQNP 1NWQA 3W7WA 3V4WA 4DJGA 1R5SA 4H0LD 5KJ7A 4UB8H 1H89A 3HD7A 3W68A 1KQGB 3SWKA 2XZRA 3L74E 1NTMD 5GW7A 2BEQD 4ASWA 1K04A 1NKNA 1CW5A 1HGVA 1T3UA 4C46A 3PH0A 2Q6QA 4WWIA 1FDOA 5JVHW 1LT9C 1GL2D 2QEXW 1SQXE 1BSHA 3CCRP 3SFDC 1SQPG 3H1HG 2KSJA 1FS0E 1S1CX 2K88A 1LT9B 2B88A 2H8PD 2SPZA 3CCQW 3GQ0A 2WPSA 1DX7A 5M19A 3IAOA 1BDDA 1RQUA 3D71A 2W27A 1VQ7W 1PP9G 1URQB 1DD4A 3KYQA 5GADa 1L4AA 5KKZC 1PIXA 1K8AQ 3CPWV 1SQBE 2ZYDA 3HE5A 2YMYA 1MG9A 2P2UA 2FXOA 1NTKJ 3BATA 3AE5C 4PV1B 3ZFZA 3MHVA 1FBMA 1RF1A 5KTBA 3L73G 1NU1J 4QMAA 5KKZB 4HKZH 3H25A 2N9BA 3RL0D 1KFNA 3L72G 2ZXEB 3HD7D 1M1JA 1NOHA 3CI9A 3CMAW 1L0LK 3SWYA 1KILB 1VQ5P 3H1LE 2YKQA 2JWDA 1FOSF 3AE2C 2Q3IA 2QA4P 1P84E 1MBVB 1BGYE 1PP9E 1KD1X 4N6JA 4R4LA 3JSVC 3CCEW 1NTZK 4JPZB 2IYOA 3FXEA 2M5AB 1NKZB 3CCVP 1HWTC 4DKIA 5KAFE 1DEEG 1DEBA 2ZT9B 3AE6C 5CA3A 1YJ9P 1YHQW 1P84H 3DLLW 1VQPP 2WWWA 1SQXJ 2E74C 1NTKD 3L73E 3KPEA 2C9LY 3EWKA 4TLFA 3TGUG 1NU1D 3L72E 3CWBE 3O2BA 2YXRB 3A5TA 3GG2A 1VQOW 2P10A 3L70G 2IBZG 1FZAA 1Y9BA 2K9JB 4OGQC 3VYIA 3L74D 2FYUK 2QJYC 1M1KQ 4GT1A 1JY3P 4JF7A 2YIUB 3I56P 1IFIA 2R5DA 3FX0A 1EC5A 1DD3A 3G9RA 3BASA 3AE3C 3D3IA 2HG5D 3VMAA 3D70A 2XNDH 1SQPJ 1T2KD 1GU4A 3H1HJ 1R6OC 1SQXD 3L75G 1YJNW 3CXHH 3CF5W 2KB7P 1L0LG 3TGUE 3G71W 1SQVK 4GIFA 5CCHD 1NVOA 1BCCG 2FFDB 1AVOA 1M7LA 3L70E 1PPJE 1PP9J 1HF9A 1SQQK 1VF5D 3TNUB 4DT0A 1GZLA 2WA8A 1SFCD 2QRXA 1PL5A 1KD1Q 1KORA 3B71A 1SQBD 3CMEW 3H32B 1EDLA 5AVYB 2W9RA 1Y8AA 3O2OA 3L71G 3L73J 2QEXP 2I8DA 3AEAC 3H1IG 2N1TC 3A0BH 1L0NK 1FZBA 5DJUB 3L72J 1EQ7A 2BCCE 1IFMA 3G19A 1KB9E 1L0LE 3LIDA 1GTWA 3CCQP 5C39A 1BCCE 4CJNA 2W83C 1DH3A 3H1KG 3H1LD 1VQ7P 1RHZB 2WT7A 1D7MA 1ZP0C 1NTZE 1P84D 4L73A 1LTGC 1BGYD 1PP9D 1FZCB 2G3AA 1HBWA 5AW3B 4H0LC 2M0BA 5AVXB 5DM7W 3CCSW 1KFMA 2AEMA 3AE7C 4U3FG 1GW4A 1H0TA 3W7XA 2KP8A 2P7JA 3G4SW 1LP1B 1JCCA 1QL2A 1QVFV 1XTCC 3L73D 2G8YA 4H0LB 1SQVG 1N73B 1HVVA 2HLOA 2O3JA 2FYNC 1KN7A 3O6QA 4YKAA 3L70J 3L72D 1T3JA 3CWBD 1FDIA 2B9BA 1SQQG 3VP9A 1OVVA 1KYOE 3H1KE 2FYUE 3OW2V 4JQ0D 3CCEP 3AEBC 2MJZA 1GDTA 1ZOYC 1OMIA 2KS1A 1JTHB 2PGDA 3HRNA 1KC8X 3GF7A 2J5UA 1GL2B 1KYOH 1HH0A 3HE4A 3SSUA 1Q86Q 2WITA 2ZVNB 5CCGA 3F5HA 1E79H 1L0NG 1OW8A 2R3SA 2WSSH 4IL6H 1J1EC 3L75J 4GODA 3ZG5A 1Q2NA 4B86A 2IDBA 1JY2O 3A3YB 4PD4E 1X8YA 4MN4C 1BCCJ 1VQOP 3C9IA 3TGUD 4IFDK 4OH8B 2W8ZA 1SQQE 3L70D 2W6AA 2IBZD 3O1FA 3RL0C 1PPJD 3CC2W 2VRSA 2WSFH 1YI2W 2HODB 1ZR2A 2WPQA 1OFCX 1GW3A 2OTJW 2W90A 3RK2D 1QVGO 3J7ZZ 1YTZT 1S5LH 1LZWA 3L71J 2OYHC 3U59A 3QH9A 3H1IJ 1PZQA 3JCUE 1AA0A 1WMKA 5GTIH 1N8RX 1L0NE 3AECC 1OXZA 1ZN5A 3HD7B 1YJNP 1EZVG 5APYA 3G71P 3DNJA 3OAKA 2V4HA 1KB9I 5B5EH 2BCCD 3CC7W 5KAIH 1KB9D 1L0LD 4I7ZB 3H1KJ 3A7OA 1SQPK 4LLHA 1OW6A 4NPFX 3E7KA 2QG4A 4L76A 3EFGA 3VOPA 1BCCD 3KZIE 4GOFA 1LT1A 5B66H 5AVZB 1NTZD 2OTKE 2WMMA 1KQLA 1G1IA 2NPSA 1HTLC 3M9QA 3CMEP 1KZUB 5AW6B 1Z56A 4K35A 4U3FJ 1KC8Q 1MBXC 2CPSA 3F89A 1VQ4W 1N7SA 2K3RA 4IO9W 4RO0A 1SQVJ 1S2EA 2WSFJ 4IFMA 4UB8E 3WU2H 3GHGA 3TDKA 3V2RA 1YIJP 2OYIA 1VL2A
chains in the Genus database with same CATH topology
3AEDC 1EXJA 1K04A 2FXPA 3AE7C 2WSEJ 3AE2C 4YTPC 3D6ZA 3SFEC 1S5LX 2WSCJ 2FBWC 1MBVB 4YJXA 1NYHA 1YQ4C 2E75D 1LZWA 1FDOA 4R4LA 4KT0J 4H0LB 2G8YA 4H44D 3Q3DA 3RK3E 4TT3H 4Y28J 2FYNC 5KLIC 3GMAA 2E75B 2NZ2A 1HF9A 3O6QA 1WMKA 1IK7A 3R4YA 4YXDC 1VF5D 2YMKA 4GDOA 2K9YA 3SFDC 2WPVB 4OGQD 2ZT9B 3AE6C 3AECC 2E75C 4R4MA 4Z1MH 2WA8A 4YKAA 3Q5SA 1PL5A 3FGAD 2E74B 4H44C 1AJYA 3LW5J 2ZT9C 1FDIA 4H13D 3IN6A 3DNJA 2E74C 1Q90D 1RQVA 1KORA 3C8VA 4PV1D 1S1CX 3B71A 3AE1C 1CTFA 4XFJA 3O1FB 4H13B 2H88C 3ABVC 4RKUJ 3AEBC 4I7ZB 1HJ0A 2W9RA 3GQ0A 1ZOYC 3T97B 4H13C 3O2OA 1MKMA 3EWKA 1OW6A 2D2CD 3IAOA 1R6QC 1OMIA 2WA9A 4I7ZC 1GMJA 3AEEC 1PV3A 3AEAC 1RQUA 1MBUC 4H44B 3Q1MA 1ZMEC 3D71A 3Q5PA 3O2BA 1U57A 3GF7A 2J5UA 1DD4A 2D2CB 1K05A 2E76D 2P10A 3D6YA 3G1BA 3AE4C 1VF5B 2O01J 5KKZC 3GW1A 1PIXA 2D2CC 4OGQB 3GQ1A 4IL6X 4YJMA 2JO1A 1Y9BA 1NGMB 3G19A 1VF5C 1YQ3C 4OGQC 1UIXA 1OW8A 3S9OA 1MG9A 2QSIA 1OW7A 2JP3A 2H89C 2V7QJ 3GF3A 1KTMA 2E76C 2QIWA 3AE5C 2BEZF 4PV1B 1EXIA 2IDBA 1MBXC 3RL0g 2QJYC 3AE9C 3GLMA 1DIPA 1JB0J 4PV1C 1ZRTE 4U7JA 4H0LD 2MKVA 3H25A 1ZP0C 1DD3A 1KILE 2YIUC 3G9RA 3Q2YA 5L8RJ 1KQGB 2WSFJ 2OQQA 3AE3C 3Q5RA 2QJPC 3AEFC 1KQFB 2ZT9D 2E76B 2G3AA 2QJKC 2WQYC 2E74D 4H0LC 1TU3F 3AE8C 1R8EA 1RQSA 3G3PA 5M1BA 3O2HA 3D70A 2BEQD 3O1FA 1KMIZ 1R6OC 3AEGC 1VL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKA A;  2WA8 A;  3O2B A;  1DD4 A;  3G1B A;  3DNJ A;  1DD3 A;  3GW1 A;  1MBV B;  3GQ1 A;  4YJX A;  4YJM A;  1RQV A;  3G19 A;  1LZW A;  1CTF A;  3O1F B;  1MG9 A;  2W9R A;  1RQS A;  3GQ0 A;  3G3P A;  3O2O A;  3O2H A;  1R6Q C;  3O1F A;  1MBX C;  2WA9 A;  1R6O C;  1MBU C;  1RQU A; 
#chains in the Genus database with same CATH topology
 3TYY A;  2OYO A;  2Y9Y A;  3HE5 B;  2XKM A;  4WY4 D;  1HUC A;  1KQS V;  1RY3 A;  1T2K C;  1KYO D;  1N2D C;  3H1K D;  5E79 H;  2FYU D;  4Y28 J;  3MUD A;  1PFI A;  4DZO A;  1IK7 A;  3BRT B;  2KZI A;  2QM7 A;  5CCH C;  4IFF A;  4NPE A;  2Y9Z A;  3CCS P;  3B5N A;  1KV4 A;  2KK7 A;  2FKW B;  1L0N J;  3G4S P;  1Q90 D;  3M0D A;  5AW1 B;  1M1J B;  4U3F D;  4XFJ A;  2A45 G;  2Z5I A;  2OYH A;  1VQM W;  3ITK A;  4U67 W;  3LW5 H;  2YKP A;  1S3J A;  3HUS B;  5TIS H;  1GMJ A;  4PD4 I;  3OA7 A;  2AXT E;  4IOI H;  1SQV D;  4PD4 D;  4W7Y A;  4RES B;  1VF5 B;  1URQ C;  3GQ1 A;  2BAS A;  1SFC B;  3E1I A;  1XTG B;  5APQ A;  1VQ9 W;  2E5Y A;  1SQQ D;  3CD6 W;  2OAR A;  2NPS D;  2AXT H;  1AFO A;  3T97 A;  4PV1 C;  2JDI H;  3IFM A;  1N7S D;  1MUU A;  3FWL A;  3HTK B;  3M0A A;  1Q7Y X;  1T6A A;  2RMZ A;  5AW7 B;  1YTZ I;  1H88 A;  2LXB A;  3IR9 A;  5AVV B;  1VQK P;  1KIL C;  1L0N D;  3CPW O;  1IJD B;  1NYH A;  4K3A A;  2DW3 A;  1SQP E;  3CCU W;  4KT0 J;  1AQT A;  5KLI B;  3H1H E;  3RK3 E;  1X22 A;  5KJ7 D;  2A45 H;  2P67 A;  2W6J H;  2R32 A;  5AVQ B;  1LTT C;  3NTN A;  3CC2 P;  1YI2 P;  3C1L A;  3FGA D;  4ZKP A;  4AUW A;  3LW5 J;  2ZT9 C;  3OJA B;  1Q81 X;  3KHU A;  3UIA A;  2OTJ P;  4IOA W;  2C9N Y;  4YXW H;  2GUV A;  2ZJR W;  1NHL A;  2J59 M;  1ZR4 A;  3W7U A;  1LTS C;  5CMZ A;  2Q5U A;  1JJ2 V;  3GW1 A;  2WTY A;  3CX5 H;  1Y47 A;  3CC7 P;  4C7N B;  1LT9 A;  1NJI X;  1IC2 A;  1S9K E;  1A02 J;  1JY2 P;  4ZMD A;  2YIU C;  1URQ A;  5AVU B;  2OQQ A;  1LGH B;  1L4A D;  3O2H A;  3BCC G;  3ZDM A;  2FXP A;  1VQ4 P;  3U1A A;  1GK6 A;  3CXH E;  3MZW B;  1Q7Y Q;  2RH0 A;  3Q3D A;  4H44 D;  5AVW B;  4BL2 A;  5APU A;  2FFD C;  2E75 B;  5DM6 W;  2WT7 B;  1KIL A;  1S72 W;  2M3E A;  2QE7 H;  1RQV A;  3KDP B;  1UII A;  5KLV G;  1T8Z A;  3ABV C;  2XNX A;  3RK2 B;  1HJ0 A;  2IBZ E;  1VQL W;  1CI6 B;  1R6Q C;  1IZN B;  2YO2 A;  1H0T B;  2ITA A;  2M5A A;  1Q81 Q;  1ZME C;  2YO3 A;  3BCC E;  1K05 A;  3A0B E;  1VQQ A;  1E5W A;  1CSB A;  2JO1 A;  3G6E W;  3FXD A;  1RE4 C;  1OW7 A;  1U7M A;  1VQM P;  1JY2 N;  4O9B A;  3JC2 2;  3RL0 g;  3PTZ A;  2XV5 A;  1QEX A;  1OVU A;  3GLM A;  2KNC A;  2H7H A;  1BXY A;  2E5T A;  2IZ0 A;  3PIO W;  3L75 E;  1SQP D;  1NJI Q;  1VQ9 P;  3H1H D;  3RK3 D;  1RQS A;  2A06 G;  1YIJ W;  3CD6 P;  1FZC C;  5AVR B;  4ZKU A;  1K73 X;  4YTP C;  2AEJ A;  4EI2 A;  1Q82 X;  1P84 I;  2Q7C A;  3H1J G;  3MD0 A;  4YJX A;  1OVR A;  2IYP A;  3LIE A;  1G2C A;  1USE A;  2ZYG A;  3GW6 A;  2WSC H;  3VTP C;  5CBN A;  4ZNC A;  2NZ2 A;  3P8C E;  2ZJQ W;  1N73 C;  2K9Y A;  5EFW B;  1NTM G;  5GAG a;  3L71 E;  3H1I E;  2JWA A;  3RBX A;  3R2P A;  3O1F B;  4H13 B;  3CCU P;  4WY4 B;  2NRG A;  5APT A;  1MKM A;  3RGU A;  2R5B A;  1S9K D;  2A06 E;  2J58 A;  2E76 D;  4BL3 A;  1RF0 C;  1QVF O;  1GL2 C;  1LTJ C;  2N9Y B;  1A02 F;  1YQ3 C;  1ZLL A;  2Q3E A;  3BCC J;  4BRY B;  2BEZ F;  3H32 A;  4IL6 E;  3AE9 C;  4AYC A;  1N86 A;  2HYN A;  3CXH I;  4JYC A;  4N3Y B;  5M18 A;  5GAH a;  1LTJ B;  2V7Q H;  2Y0E A;  1CZQ A;  1QLE D;  3OW2 O;  3CXH D;  1R5L A;  4U3F E;  3O8Z A;  3Q5R A;  1KQF B;  2HPC B;  3L35 A;  2E74 D;  1PGO A;  2E42 A;  3G3P A;  1YBK A;  5M1B A;  2ZYA A;  4N78 E;  1EXJ A;  1LWU B;  1SQV E;  2CK3 H;  1VQK W;  2N1T A;  1FJK A;  2WSC J;  5KLV J;  1OX3 A;  2NPS B;  1JMM A;  4NPD A;  4IOC W;  4L75 A;  1ZXG A;  2Z5H A;  3V6I A;  2E75 D;  3H6P A;  2WPR A;  2IBZ I;  1RE3 C;  1S5L E;  1N7S B;  2AXC A;  5APW A;  1K73 Q;  2YXQ B;  1Q82 Q;  1FZC A;  4GDO A;  3NMD A;  1JM0 A;  4OGQ D;  2B87 B;  1FZG A;  5GTI E;  2ZAE B;  1JUN A;  4KJM A;  5DJT B;  1NAY A;  1QX8 A;  5KJ7 C;  2I1K A;  3B4S A;  4EYY Q;  3HD7 C;  3BCC D;  3VP8 A;  3W7T A;  1HJB A;  3GHG B;  2GA1 A;  5B5E E;  5HL7 W;  5KAI E;  2WA9 A;  4I7Z C;  5CJ4 A;  1N73 A;  3Q1M A;  3Q5P A;  1VPC A;  1LTB C;  1S72 P;  2GUS A;  5B66 E;  1X9V A;  4UB6 E;  5BU5 A;  2QVA A;  3L75 D;  2QSI A;  2V7Q J;  3I55 W;  3PIP W;  1VQL P;  3NXS A;  1LNQ A;  2PRR A;  4UY8 Z;  3VMY A;  2KXP B;  3H1J J;  1MV8 A;  1JTH A;  2AEF A;  4JYB A;  4UB6 H;  3G6E P;  2ZVO B;  1BDC A;  4YPC A;  2QJK C;  4A7P A;  1NTM J;  5CCG D;  3WU2 E;  3P8C D;  2H43 A;  1IFD A;  4DOJ A;  2JR8 A;  1EDI A;  2LKM A;  3L74 G;  2B89 A;  3L71 D;  1VQ8 W;  5APX A;  4XA4 A;  1L2P A;  3H1I D;  2QJK B;  1EZV E;  1MWS A;  2ZFC A;  1NO4 A;  1J1D B;  2FY8 A;  5E79 E;  5AVS B;  3MTU E;  1RF1 C;  1W2B V;  2WPV B;  1L4A B;  4H44 C;  5APS A;  1IK9 A;  4H13 D;  1KYO I;  2A06 D;  2HOD A;  2O1J A;  3E1R A;  1AQ5 A;  2H88 C;  1J2J B;  1W2B O;  1M1J C;  1RE3 A;  2CPB A;  1RF1 B;  4WF9 W;  1AV1 A;  3H1J D;  1M8O B;  3HUS C;  1PV3 A;  4H44 B;  5TIS E;  3EQ2 A;  2D2C B;  1KQS O;  5H2F H;  3RBZ A;  3ZG0 A;  1VF5 C;  2L5G B;  4CPK A;  1SFC C;  1OWA A;  2JP3 A;  1N8R Q;  2E43 A;  2QIW A;  3P8M C;  3A2A A;  3N4X A;  1DIP A;  2FYZ A;  1SQB G;  4N78 D;  1SP4 A;  2KIK A;  4CPG A;  3Q2Y A;  1JO5 A;  2QJP C;  4KHX A;  1MWU A;  3SWF A;  3P32 A;  1R8E A;  3W7S A;  1JOC A;  5CJ0 A;  1KMI Z;  5BU8 B;  2W6B A;  3AED C;  4AQR D;  5K5G B;  3D6Z A;  2YNY A;  3U1C A;  2I1J A;  3G3Z A;  2POH A;  3RK3 C;  2FBW C;  4BXL A;  2QJP B;  3V2P A;  1WT6 A;  3H1L G;  2IPP A;  1LTA C;  5KLI C;  3R4Y A;  1MZ9 A;  1YJW W;  2OGU A;  1BGY G;  1IFN A;  3RK3 B;  1AJY A;  1M1K X;  3IF4 A;  3MIW A;  2ZJP W;  2R44 A;  1MWT A;  4LGD E;  1CTF A;  1FZF A;  4RKU J;  4JBZ A;  3I5C A;  3PRJ A;  2XDJ A;  4GKG A;  4WFB W;  1MBU C;  1MFT A;  1FAV A;  5KLV K;  3AE4 C;  2Z4E A;  4IL6 X;  2OTL W;  3B5N D;  3S1K A;  3CX5 E;  3CWB G;  3PP5 A;  3KQG A;  3GF3 A;  2E76 C;  1SVF A;  2P58 A;  3L74 J;  3TSI A;  1VDF A;  3HUS A;  2M3B A;  2JJL A;  5CCH A;  1ZRT E;  2MKV A;  4OVN F;  5GAE a;  1KIL E;  5GTH E;  1EZV I;  2KUB A;  1IFP A;  2E76 B;  2UWJ E;  1EZV D;  1SFC A;  3I55 P;  1USD A;  1G1J A;  4M3L A;  1VQ6 W;  1GK4 A;  1S5L X;  3MP7 B;  1FE6 A;  3L37 A;  5GTH H;  3V2N A;  1W5C E;  3CCM W;  3K5B A;  2YKO A;  4ASV A;  1W2E A;  2WSE H;  3CL3 D;  5KAF H;  2KNC B;  3GMA A;  3HTK A;  5TJH A;  2E75 C;  2HFE D;  4HJG H;  3II6 A;  2E74 B;  3CC4 W;  4C7R A;  2R3C A;  1PPJ G;  1VQ8 P;  3W67 A;  1U7J A;  1YYC A;  1BE3 G;  2O01 N;  4D6T G;  4DCK A;  1NTM K;  1SQB J;  2D2C D;  3M9H A;  3RK2 C;  1U57 A;  4WBA A;  1EDJ A;  3M9B A;  2IFM A;  1G2C B;  3QWO C;  2C0X A;  4OGQ B;  2KLU A;  1LJ2 A;  1JMB A;  4BWN A;  2K37 A;  1UIX A;  3BRV B;  1OIP A;  3CCJ P;  2LXC B;  2H89 C;  2QJY B;  1ZW0 A;  2KOG A;  1EXI A;  1M57 D;  2BCC G;  5M1A A;  2PAJ A;  1YIT W;  4XE5 B;  3WUV A;  3H1L J;  5CHX A;  3TF5 A;  4HYT B;  2RKL A;  1SS1 A;  3O6Q B;  2XU6 A;  1TU3 F;  2ZJS E;  1BGY J;  3S4R A;  1X0T A;  2A45 I;  1NTZ G;  1BE3 E;  3AEG C;  4WCE W;  4D6T E;  4EIJ A;  4C7N A;  2WSE J;  4EOT A;  3SFE C;  1ZV8 A;  3TK1 A;  2LR2 A;  5CCG C;  1M90 X;  2IX7 C;  1Q86 X;  5AW0 B;  3VN0 A;  3CCL W;  2KS1 B;  4TT3 H;  1URQ D;  2K9J A;  2KZJ A;  4GOE A;  1MWR A;  5KLV E;  3HE4 B;  3L4F A;  4W80 A;  3CWB J;  2WZ7 A;  3CX5 I;  3M91 A;  4PV1 D;  3AE1 C;  1JY3 N;  5BVZ A;  3CX5 D;  4H13 C;  2N1T B;  4WY4 C;  4OWF A;  1VQN W;  2RN0 A;  4HB1 A;  3AEE C;  3MGN A;  1YJW P;  2FYU G;  4WB4 A;  1ZRT D;  1KB9 H;  1PGJ A;  1KIL D;  1NGM B;  3S9O A;  1LTI C;  2FFD A;  1JB0 J;  1CI6 A;  5APV A;  1HGZ A;  3TNU A;  1H8A A;  1WRG A;  2KLV A;  4Y99 C;  2JEE A;  5AW4 B;  5L8R J;  4L74 A;  4I6M C;  3B8E B;  3TGU J;  2OTL P;  1NTK K;  2ZT9 D;  2Q9I A;  1PGP A;  2KI7 B;  3AE8 C;  3H1J E;  2PP6 A;  3CMA P;  1JNM A;  2KSE A;  1MFZ A;  3CCR W;  1EDK A;  4HH2 A;  1NU1 K;  4Y99 B;  1LWU C;  1FOS E;  1BE3 J;  4D6T J;  2P1J A;  1GU5 A;  2Y0D A;  1YQ4 C;  1K9M X;  2NPS C;  1NTM E;  1IFJ A;  2FYN B;  5JVG W;  1GD2 E;  1RE4 A;  1JEK A;  3V2Q A;  4YXD C;  2YMK A;  1N7S C;  1YHQ P;  1VQ6 P;  1M90 Q;  5AW5 B;  4WVZ A;  3L36 A;  3CCM P;  4EDF A;  4LC1 A;  3WUU A;  2M8R A;  3M06 A;  3GHG C;  2BCC J;  2K1A A;  2L91 A;  2OYI C;  1L0L J;  3A0H E;  1RH5 B;  1SQX K;  3CC4 P;  5AW8 B;  3D6Y A;  3G1B A;  1PGQ A;  1FZE A;  1BSN A;  1FDM A;  4YJM A;  2IFN A;  1J1E B;  2O1K A;  1QVG V;  3P7K A;  3MUD C;  1NTZ J;  2ZXX A;  1LP1 A;  3CLQ A;  2OYI B;  1JY3 O;  1VQ5 W;  1OZH A;  4I2L C;  2O01 H;  4PD4 H;  4WY4 A;  3A0H H;  3B5N C;  1BE3 D;  1S4X A;  4D6T D;  2QA4 W;  4U7J A;  4I1L A;  1FJP A;  2Y0C A;  5CBO A;  3M0D C;  3KXD A;  4RJT A;  2IZ1 A;  3WUT A;  1JCD A;  3AEF C;  1IO4 A;  3NFQ A;  2WQY C;  3RL0 B;  3N7N A;  3FWN A;  1SQB K;  1QGK B;  3CCV W;  4WFN W;  3B5N B;  4BRY A;  1FC2 C;  1NTK G;  1YJ9 W;  1QL1 A;  1M56 D;  5KLV D;  1VQP W;  3PJS K;  1YIT P;  3V4Q A;  1NAF A;  2OYH B;  2HR3 A;  1NU1 G;  1RF0 A;  4PJ0 E;  1GL2 A;  1LTJ A;  1N7L A;  1FU1 A;  1X79 B;  3JCU H;  1SLQ A;  3V5B A;  2QM8 A;  3VMZ A;  2FYU J;  2HPC A;  1J1D C;  3CXC V;  2PFX A;  4R4M A;  4Z1M H;  4WFA W;  2KYV A;  3Q5S A;  2FXM A;  1K9M Q;  2GM4 A;  1L4A C;  3IN6 A;  1LWU A;  4PJ0 H;  3C8V A;  2N1T D;  5AW2 B;  1K8A X;  3CCL P;  3T97 B;  3KZI H;  1NH4 A;  4W7Z A;  3PLN A;  3WMM 0;  2WVR A;  3I56 W;  2B87 A;  3PHL A;  3VMX A;  1NTK E;  2O01 J;  2Q1K A;  3EFF K;  2D2C C;  5AVT B;  5H2F E;  2JKV A;  1SQX G;  3USS A;  1AVY A;  3CCJ W;  2C0W A;  5AW9 B;  1KTM A;  1NU1 E;  3BVH A;  1SQQ J;  1VQN P;  1NWQ A;  3W7W A;  3V4W A;  4DJG A;  1R5S A;  4H0L D;  5KJ7 A;  4UB8 H;  1H89 A;  3HD7 A;  3W68 A;  1KQG B;  3SWK A;  2XZR A;  3L74 E;  1NTM D;  5GW7 A;  2BEQ D;  4ASW A;  1K04 A;  1NKN A;  1CW5 A;  1HGV A;  1T3U A;  4C46 A;  3PH0 A;  2Q6Q A;  4WWI A;  1FDO A;  5JVH W;  1LT9 C;  1GL2 D;  2QEX W;  1SQX E;  1BSH A;  3CCR P;  3SFD C;  1SQP G;  3H1H G;  2KSJ A;  1FS0 E;  1S1C X;  2K88 A;  1LT9 B;  2B88 A;  2H8P D;  2SPZ A;  3CCQ W;  3GQ0 A;  2WPS A;  1DX7 A;  5M19 A;  3IAO A;  1BDD A;  1RQU A;  3D71 A;  2W27 A;  1VQ7 W;  1PP9 G;  1URQ B;  1DD4 A;  3KYQ A;  5GAD a;  1L4A A;  5KKZ C;  1PIX A;  1K8A Q;  3CPW V;  1SQB E;  2ZYD A;  3HE5 A;  2YMY A;  1MG9 A;  2P2U A;  2FXO A;  1NTK J;  3BAT A;  3AE5 C;  4PV1 B;  3ZFZ A;  3MHV A;  1FBM A;  1RF1 A;  5KTB A;  3L73 G;  1NU1 J;  4QMA A;  5KKZ B;  4HKZ H;  3H25 A;  2N9B A;  3RL0 D;  1KFN A;  3L72 G;  2ZXE B;  3HD7 D;  1M1J A;  1NOH A;  3CI9 A;  3CMA W;  1L0L K;  3SWY A;  1KIL B;  1VQ5 P;  3H1L E;  2YKQ A;  2JWD A;  1FOS F;  3AE2 C;  2Q3I A;  2QA4 P;  1P84 E;  1MBV B;  1BGY E;  1PP9 E;  1KD1 X;  4N6J A;  4R4L A;  3JSV C;  3CCE W;  1NTZ K;  4JPZ B;  2IYO A;  3FXE A;  2M5A B;  1NKZ B;  3CCV P;  1HWT C;  4DKI A;  5KAF E;  1DEE G;  1DEB A;  2ZT9 B;  3AE6 C;  5CA3 A;  1YJ9 P;  1YHQ W;  1P84 H;  3DLL W;  1VQP P;  2WWW A;  1SQX J;  2E74 C;  1NTK D;  3L73 E;  3KPE A;  2C9L Y;  3EWK A;  4TLF A;  3TGU G;  1NU1 D;  3L72 E;  3CWB E;  3O2B A;  2YXR B;  3A5T A;  3GG2 A;  1VQO W;  2P10 A;  3L70 G;  2IBZ G;  1FZA A;  1Y9B A;  2K9J B;  4OGQ C;  3VYI A;  3L74 D;  2FYU K;  2QJY C;  1M1K Q;  4GT1 A;  1JY3 P;  4JF7 A;  2YIU B;  3I56 P;  1IFI A;  2R5D A;  3FX0 A;  1EC5 A;  1DD3 A;  3G9R A;  3BAS A;  3AE3 C;  3D3I A;  2HG5 D;  3VMA A;  3D70 A;  2XND H;  1SQP J;  1T2K D;  1GU4 A;  3H1H J;  1R6O C;  1SQX D;  3L75 G;  1YJN W;  3CXH H;  3CF5 W;  2KB7 P;  1L0L G;  3TGU E;  3G71 W;  1SQV K;  4GIF A;  5CCH D;  1NVO A;  1BCC G;  2FFD B;  1AVO A;  1M7L A;  3L70 E;  1PPJ E;  1PP9 J;  1HF9 A;  1SQQ K;  1VF5 D;  3TNU B;  4DT0 A;  1GZL A;  2WA8 A;  1SFC D;  2QRX A;  1PL5 A;  1KD1 Q;  1KOR A;  3B71 A;  1SQB D;  3CME W;  3H32 B;  1EDL A;  5AVY B;  2W9R A;  1Y8A A;  3O2O A;  3L71 G;  3L73 J;  2QEX P;  2I8D A;  3AEA C;  3H1I G;  2N1T C;  3A0B H;  1L0N K;  1FZB A;  5DJU B;  3L72 J;  1EQ7 A;  2BCC E;  1IFM A;  3G19 A;  1KB9 E;  1L0L E;  3LID A;  1GTW A;  3CCQ P;  5C39 A;  1BCC E;  4CJN A;  2W83 C;  1DH3 A;  3H1K G;  3H1L D;  1VQ7 P;  1RHZ B;  2WT7 A;  1D7M A;  1ZP0 C;  1NTZ E;  1P84 D;  4L73 A;  1LTG C;  1BGY D;  1PP9 D;  1FZC B;  2G3A A;  1HBW A;  5AW3 B;  4H0L C;  2M0B A;  5AVX B;  5DM7 W;  3CCS W;  1KFM A;  2AEM A;  3AE7 C;  4U3F G;  1GW4 A;  1H0T A;  3W7X A;  2KP8 A;  2P7J A;  3G4S W;  1LP1 B;  1JCC A;  1QL2 A;  1QVF V;  1XTC C;  3L73 D;  2G8Y A;  4H0L B;  1SQV G;  1N73 B;  1HVV A;  2HLO A;  2O3J A;  2FYN C;  1KN7 A;  3O6Q A;  4YKA A;  3L70 J;  3L72 D;  1T3J A;  3CWB D;  1FDI A;  2B9B A;  1SQQ G;  3VP9 A;  1OVV A;  1KYO E;  3H1K E;  2FYU E;  3OW2 V;  4JQ0 D;  3CCE P;  3AEB C;  2MJZ A;  1GDT A;  1ZOY C;  1OMI A;  2KS1 A;  1JTH B;  2PGD A;  3HRN A;  1KC8 X;  3GF7 A;  2J5U A;  1GL2 B;  1KYO H;  1HH0 A;  3HE4 A;  3SSU A;  1Q86 Q;  2WIT A;  2ZVN B;  5CCG A;  3F5H A;  1E79 H;  1L0N G;  1OW8 A;  2R3S A;  2WSS H;  4IL6 H;  1J1E C;  3L75 J;  4GOD A;  3ZG5 A;  1Q2N A;  4B86 A;  2IDB A;  1JY2 O;  3A3Y B;  4PD4 E;  1X8Y A;  4MN4 C;  1BCC J;  1VQO P;  3C9I A;  3TGU D;  4IFD K;  4OH8 B;  2W8Z A;  1SQQ E;  3L70 D;  2W6A A;  2IBZ D;  3O1F A;  3RL0 C;  1PPJ D;  3CC2 W;  2VRS A;  2WSF H;  1YI2 W;  2HOD B;  1ZR2 A;  2WPQ A;  1OFC X;  1GW3 A;  2OTJ W;  2W90 A;  3RK2 D;  1QVG O;  3J7Z Z;  1YTZ T;  1S5L H;  1LZW A;  3L71 J;  2OYH C;  3U59 A;  3QH9 A;  3H1I J;  1PZQ A;  3JCU E;  1AA0 A;  1WMK A;  5GTI H;  1N8R X;  1L0N E;  3AEC C;  1OXZ A;  1ZN5 A;  3HD7 B;  1YJN P;  1EZV G;  5APY A;  3G71 P;  3DNJ A;  3OAK A;  2V4H A;  1KB9 I;  5B5E H;  2BCC D;  3CC7 W;  5KAI H;  1KB9 D;  1L0L D;  4I7Z B;  3H1K J;  3A7O A;  1SQP K;  4LLH A;  1OW6 A;  4NPF X;  3E7K A;  2QG4 A;  4L76 A;  3EFG A;  3VOP A;  1BCC D;  3KZI E;  4GOF A;  1LT1 A;  5B66 H;  5AVZ B;  1NTZ D;  2OTK E;  2WMM A;  1KQL A;  1G1I A;  2NPS A;  1HTL C;  3M9Q A;  3CME P;  1KZU B;  5AW6 B;  1Z56 A;  4K35 A;  4U3F J;  1KC8 Q;  1MBX C;  2CPS A;  3F89 A;  1VQ4 W;  1N7S A;  2K3R A;  4IO9 W;  4RO0 A;  1SQV J;  1S2E A;  2WSF J;  4IFM A;  4UB8 E;  3WU2 H;  3GHG A;  3TDK A;  3V2R A;  1YIJ P;  2OYI A;  1VL2 A; 
#chains in the Genus database with same CATH homology
 3AED C;  1EXJ A;  1K04 A;  2FXP A;  3AE7 C;  2WSE J;  3AE2 C;  4YTP C;  3D6Z A;  3SFE C;  1S5L X;  2WSC J;  2FBW C;  1MBV B;  4YJX A;  1NYH A;  1YQ4 C;  2E75 D;  1LZW A;  1FDO A;  4R4L A;  4KT0 J;  4H0L B;  2G8Y A;  4H44 D;  3Q3D A;  3RK3 E;  4TT3 H;  4Y28 J;  2FYN C;  5KLI C;  3GMA A;  2E75 B;  2NZ2 A;  1HF9 A;  3O6Q A;  1WMK A;  1IK7 A;  3R4Y A;  4YXD C;  1VF5 D;  2YMK A;  4GDO A;  2K9Y A;  3SFD C;  2WPV B;  4OGQ D;  2ZT9 B;  3AE6 C;  3AEC C;  2E75 C;  4R4M A;  4Z1M H;  2WA8 A;  4YKA A;  3Q5S A;  1PL5 A;  3FGA D;  2E74 B;  4H44 C;  1AJY A;  3LW5 J;  2ZT9 C;  1FDI A;  4H13 D;  3IN6 A;  3DNJ A;  2E74 C;  1Q90 D;  1RQV A;  1KOR A;  3C8V A;  4PV1 D;  1S1C X;  3B71 A;  3AE1 C;  1CTF A;  4XFJ A;  3O1F B;  4H13 B;  2H88 C;  3ABV C;  4RKU J;  3AEB C;  4I7Z B;  1HJ0 A;  2W9R A;  3GQ0 A;  1ZOY C;  3T97 B;  4H13 C;  3O2O A;  1MKM A;  3EWK A;  1OW6 A;  2D2C D;  3IAO A;  1R6Q C;  1OMI A;  2WA9 A;  4I7Z C;  1GMJ A;  3AEE C;  1PV3 A;  3AEA C;  1RQU A;  1MBU C;  4H44 B;  3Q1M A;  1ZME C;  3D71 A;  3Q5P A;  3O2B A;  1U57 A;  3GF7 A;  2J5U A;  1DD4 A;  2D2C B;  1K05 A;  2E76 D;  2P10 A;  3D6Y A;  3G1B A;  3AE4 C;  1VF5 B;  2O01 J;  5KKZ C;  3GW1 A;  1PIX A;  2D2C C;  4OGQ B;  3GQ1 A;  4IL6 X;  4YJM A;  2JO1 A;  1Y9B A;  1NGM B;  3G19 A;  1VF5 C;  1YQ3 C;  4OGQ C;  1UIX A;  1OW8 A;  3S9O A;  1MG9 A;  2QSI A;  1OW7 A;  2JP3 A;  2H89 C;  2V7Q J;  3GF3 A;  1KTM A;  2E76 C;  2QIW A;  3AE5 C;  2BEZ F;  4PV1 B;  1EXI A;  2IDB A;  1MBX C;  3RL0 g;  2QJY C;  3AE9 C;  3GLM A;  1DIP A;  1JB0 J;  4PV1 C;  1ZRT E;  4U7J A;  4H0L D;  2MKV A;  3H25 A;  1ZP0 C;  1DD3 A;  1KIL E;  2YIU C;  3G9R A;  3Q2Y A;  5L8R J;  1KQG B;  2WSF J;  2OQQ A;  3AE3 C;  3Q5R A;  2QJP C;  3AEF C;  1KQF B;  2ZT9 D;  2E76 B;  2G3A A;  2QJK C;  2WQY C;  2E74 D;  4H0L C;  1TU3 F;  3AE8 C;  1R8E A;  1RQS A;  3G3P A;  5M1B A;  3O2H A;  3D70 A;  2BEQ D;  3O1F A;  1KMI Z;  1R6O C;  3AEG C;  1VL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...