1RQUA

Nmr structure of l7 dimer from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 50S ribosomal protein L7/L12
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rquA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rquA02
3O1FA 2W9RA 1RQUA 3DNJA 1MBVB 1DD4A 1RQVA 1MBXC 1R6QC 3G3PA 4YJXA 1MG9A 3GW1A 1MBUC 2WA9A 4YKAA 4YJMA 1CTFA 3O2HA 3O2BA 2WA8A 3GQ1A 3GQ0A 3O1FB 1RQSA 3G19A 3O2OA 1R6OC 3G1BA 1LZWA 1DD3A
chains in the Genus database with same CATH superfamily
2H8PD 3CXHI 1RF1C 2HPCA 3G3ZA 1BE3E 3AE8C 4K35A 1LTBC 5CJ0A 3CWBD 2JWAA 2IX7C 1L0LJ 3CPWV 2RMZA 1ZR2A 1JCDA 3B5NA 1RF1A 2WSCH 3BCCJ 5KLVG 3G4SW 1VQMP 3SWYA 3O1FB 3H1LG 5APWA 4H0LD 1P84D 3TNUB 3F5HA 3TGUG 4PV1D 2B87A 4MN4C 1YI2W 1GMJA 1L0NJ 3PTZA 2QJPC 4EOTA 4UB8E 3CCUP 3H1IE 2ZXXA 1EZVG 2H7HA 5L8RJ 3VOPA 4PD4D 4W7ZA 3V2PA 4EIJA 1SQQG 2WSFH 2Q5UA 2QSIA 4OVNF 4PJ0H 1HBWA 1N7SA 1IFNA 2WMMA 5AVZB 3GQ1A 1ZR4A 1VQPP 4BL3A 1IFJA 3HUSB 3RK3B 1ZV8A 2ZVOB 1MFTA 4OGQD 1URQB 4I1LA 1M90Q 2FYUG 1P84H 1GL2C 4JPZB 1LTTC 1PPJG 5KJ7A 1QLED 4WF9W 1LTJA 4WCEW 2KB7P 1SQBJ 2ZJPW 5B5EE 4N6JA 3CCUW 4WY4B 2Y9ZA 3CCQP 2QEXW 5CCGC 1KZUB 2QM8A 1X22A 2E43A 1VQPW 1G2CA 1HJ0A 3AEEC 3A5TA 1VL2A 2M3EA 1SFCD 3N4XA 2P67A 1VQ7P 1SQQE 3W7SA 2O01J 3L35A 1P84E 1SLQA 2PP6A 3L74J 1YHQW 1GL2A 3CXHE 3OW2V 2QJKB 1Q82X 1NH4A 2E75D 1K73Q 4QMAA 1L4AA 1MWRA 3L75D 1LTJC 4L76A 1MWUA 1VDFA 2E5TA 1VF5B 3H1LD 1U7MA 3IAOA 3V2RA 1PV3A 1SQPJ 3PIOW 3V4QA 3M0DC 2E74D 3AE9C 1E79H 5KLVE 1QVGO 4CJNA 2IDBA 2ZAEB 2R5BA 4Y28J 1QEXA 1IJDB 1MUUA 3AE5C 5CCGD 4JF7A 4CPKA 4WY4D 3AE4C 3M9HA 4GT1A 1FU1A 5E79H 5B66H 2HFED 1NTMJ 1OVRA 5DM6W 3GMAA 1BE3J 5APXA 3NMDA 5CBNA 1GW4A 1HF9A 3W7TA 4HYTB 5KAIE 1EXIA 4JBZA 3HD7C 1HGZA 4A7PA 1EDIA 5KAFE 2BCCG 3T97A 3MD0A 2QE7H 2YMKA 3RGUA 2Q3EA 1KQFB 3L73J 2IBZD 1BSHA 5AW4B 2WZ7A 3ZFZA 2WT7B 2N9BA 4AUWA 3PJSK 1GTWA 1YJ9W 1YIJP 1YBKA 3VMXA 1NTZG 1VQ5W 3B8EB 2L91A 3LIDA 5DM7W 3HE4A 1BGYE 2POHA 2Q1KA 2Y0EA 3V5BA 2E75C 1SQXE 3L75J 4DOJA 3CX5D 1Q7YX 3Q5RA 3TGUE 1FOSE 1IC2A 1N86A 2XZRA 3H1LE 3BATA 1D7MA 1UIXA 1M1KX 1PPJE 2HYNA 1NHLA 5B5EH 1L0ND 4R4LA 1QX8A 2FXPA 5DJUB 3CC7W 4XE5B 2Q6QA 1FAVA 1KB9E 1SQPE 3CMAP 1JM0A 3WU2H 2FYUK 2YXQB 2OYHB 3CCQW 2JEEA 5AW6B 2WPVB 3L4FA 1K05A 1OZHA 1K8AQ 2Z5IA 3TNUA 2FXMA 5AVWB 2E74B 3II6A 1ZXGA 1S72P 3CCJW 4ASWA 1SQBK 1PGJA 3HRNA 3AEBC 1NU1E 3H1KJ 3ZG5A 1J1EC 2N1TD 2WWWA 1OFCX 2IBZE 4XFJA 3CD6P 3V2QA 3FXEA 1YJWP 2I1KA 1IFIA 4U3FG 2XU6A 5AW1B 3L74E 1SQVK 2A06E 1Q81Q 1H0TA 1HUCA 1RQUA 3MUDA 1JY3O 1AVOA 4IFMA 1LP1B 1SQXD 3L74G 2WPRA 1YQ3C 5KLVK 5GAHa 3HE4B 1PL5A 2HLOA 1VQOP 1RY3A 4GKGA 1QL2A 1R6QC 1KILE 3W7UA 1VQQA 1VQ8W 3KYQA 1ZP0C 1N7SB 1EDKA 4O9BA 4IOAW 4DZOA 1JOCA 1NO4A 3L73E 3I55W 3L71D 1Z56A 3IN6A 3H25A 2V7QH 4I6MC 3VP8A 5KKZB 1OVUA 1H0TB 1VQKP 3G6EW 4YXDC 4ZKPA 2KNCB 3QWOC 1CTFA 3CCRP 4BXLA 4DKIA 1URQD 3CCVW 1L0LK 1NAFA 3R4YA 2A45H 4IL6X 2IPPA 1M57D 2A45G 2QEXP 5M19A 1WT6A 2V4HA 1XTGB 1S9KD 1A02J 3D70A 3MGNA 2AXCA 3GQ0A 3HUSC 4YXWH 1OW6A 2B89A 1DEEG 3CX5I 2AEFA 5B66E 1KQLA 2W90A 3JC22 4OWFA 2O1KA 3VYIA 2OTKE 1QL1A 3B5ND 2WA9A 2VRSA 4YJMA 1YITW 2KNCA 4OGQB 2M0BA 2FBWC 3I55P 1S2EA 2YIUC 3BCCG 1BSNA 1S5LE 2W9RA 1T2KD 2O01H 4C7RA 3A0HH 5APSA 2E75B 2Y9YA 3TF5A 1SFCA 5KLVD 1PZQA 2MKVA 5BU8B 5KKZC 1VQNP 1QVFV 4Y99B 1FZCC 1J2JB 3O2BA 2R3CA 2M8RA 3I56P 3Q2YA 4AQRD 3HE5B 3L72J 1OX3A 1JY3N 3FWLA 3OA7A 1NU1J 2HODB 3H1KE 2Q9IA 1T8ZA 1KYOI 4WBAA 3AEFC 1GDTA 2WTYA 2D2CB 3CLQA 1SQVE 3OAKA 5M18A 3W67A 1JUNA 1LT9A 1MBVB 1WMKA 2QA4P 3RK2B 3CCEW 1G1JA 5GTIH 2YNYA 2QM7A 1N7LA 1USEA 1YYCA 3E1IA 1M7LA 3BASA 1NWQA 1S9KE 4IOIH 5E79E 1LTSC 1VQ9P 1N7SC 2ZT9D 3BCCE 2I1JA 2K88A 1MBUC 2AEMA 1NOHA 5KLVJ 5KJ7D 3J7ZZ 3HD7B 3H32B 5CCHC 1FZGA 2YIUB 4W7YA 1AJYA 3CXHD 1NTMD 1LWUA 3G19A 3CC2W 1DD3A 4DJGA 4U3FJ 1LT9C 1NTKG 5BU5A 2JP3A 1L0NE 1L4AC 1MWTA 2B87B 3M9BA 1FOSF 1P84I 3NXSA 1PP9G 3L73D 1BDDA 1CZQA 3L71E 3BVHA 4BRYA 3O6QA 1VQ6W 1VQ8P 4WY4C 3HE5A 5AVVB 3SWFA 1K73X 1Q90D 4KHXA 3CWBJ 2K9YA 3CMAW 2OARA 1JB0J 1KQGB 2E74C 2ZT9C 3KDPB 1FDIA 1VQNW 1GK6A 1G1IA 2O1JA 2H89C 5AVUB 3CCEP 1NTKK 2QIWA 3EFFK 3ABVC 1ZMEC 3L70G 2M3BA 4KT0J 1GU5A 1K8AX 2DW3A 1LTAC 1BCCJ 1HGVA 3V6IA 1OIPA 3RK3E 5DJTB 1Y9BA 1YITP 2M5AA 1NAYA 2KSEA 1IK7A 3S9OA 5CMZA 3LW5J 1VPCA 5GTHE 1NU1K 3CX5E 1NTME 1VQOW 3I56W 1LJ2A 2AEJA 4KJMA 1ZW0A 1JEKA 2V7QJ 1NTKJ 1SQVG 1KQSV 2OTLW 3D71A 2Y0DA 1N73A 1H88A 2OYIA 4YPCA 4LGDE 3C8VA 1JY2P 1SQBG 1LZWA 3AEDC 3G71P 1FZCB 2QRXA 1L4AB 1J1DB 2R5DA 1J1EB 1SQBD 2E42A 5CBOA 1DEBA 1GD2E 1HH0A 2ITAA 2XNDH 1NTZJ 2GUSA 5GTIE 3L72D 1IO4A 1RHZB 3FWNA 1JTHB 1ZLLA 1VQ5P 2OGUA 3L74D 3HTKA 1YJNW 2AXTE 2ZVNB 1SQQD 3D6YA 4ZNCA 1M8OB 2WT7A 1KD1X 2FXOA 2CK3H 3L71J 2YXRB 4ZKUA 2ZJQW 4ZMDA 4U3FD 1PGQA 1QVFO 1KV4A 1ZRTD 3JCUH 1URQA 3H1ID 1Y8AA 3C1LA 1SQXG 3MTUE 2HR3A 1S1CX 1U57A 1N8RX 1KMIZ 1FZCA 1FZFA 5AW0B 2KLVA 3IF4A 4H44D 2N1TB 3TGUD 3CD6W 3E1RA 1AQ5A 1UIIA 4H0LC 1USDA 2IBZI 1MWSA 3A0HE 1K04A 3M06A 4I7ZB 2Q3IA 2PGDA 1FDOA 4IFFA 3AECC 1NU1G 1QVGV 1JY2O 3V2NA 3L70J 1HWTC 2JKVA 2BEZF 2IYOA 2K9JA 2W6AA 1U7JA 1VF5D 2W8ZA 1SQXK 1R8EA 4H13B 3GW1A 4L75A 1K9MQ 1KN7A 2O3JA 1LTGC 3M91A 1GL2D 1CI6B 2ZXEB 4HB1A 3ZDMA 1KB9H 3MHVA 4H44B 2KZIA 1SQPG 5AVQB 4RKUJ 3G6EP 3H1JD 3MUDC 1LTIC 3WUUA 1Q81X 4WVZA 3A7OA 3H1JE 3IR9A 1FJKA 3RL0g 1OW7A 4RESB 1S72W 1SQQJ 4PJ0E 3TK1A 3B4SA 2HODA 2FY8A 1OVVA 1RQSA 2IFNA 4NPFX 5AW8B 5CCHD 4Z1MH 3AEAC 1NTZD 3B5NC 4I7ZC 3S1KA 3FGAD 3M9QA 3CC4P 1KYOH 3L37A 2IBZG 2NPSA 1SP4A 1BGYG 2ZYAA 3B71A 3O6QB 1KD1Q 2KP8A 2K3RA 1PFIA 3G1BA 1OXZA 3L75E 2QJKC 2LKMA 3MP7B 1VQLP 3EQ2A 1QGKB 3RK3C 2P7JA 1JNMA 4N78E 2JO1A 3D3IA 2WVRA 4HKZH 4BRYB 4I2LC 3H1JJ 1GK4A 3LIEA 2FKWB 1RE3C 3WMM0 1LNQA 3AE6C 3CF5W 5AVTB 1IZNB 2ZT9B 3CCSW 2FFDA 4WB4A 4IFDK 4D6TE 4R4MA 3EWKA 3H1HE 2J58A 3NFQA 1SQQK 2M5AB 3H1HJ 2XV5A 1LT1A 1JY2N 3CCVP 2FFDC 3CPWO 2YKPA 3O1FA 2WSSH 5M1AA 2RKLA 1FJPA 1Q86X 2QJYB 1SQVJ 2L5GB 4RO0A 3L75G 1AFOA 2PAJA 3H1LJ 3RK2D 3PIPW 1VQ7W 1HVVA 3G71W 2R44A 4JQ0D 1OMIA 1SQXJ 3A3YB 2ZYGA 3QH9A 1KILD 3HTKB 3JSVC 2W6BA 2WITA 3O8ZA 1NYHA 3KQGA 2OYHC 2MJZA 1VQ6P 2GM4A 3H1HG 1GZLA 3PP5A 4UY8Z 3Q1MA 3CCSP 1SQPK 2P1JA 3L36A 2ZJSE 3H1JG 4Y99C 1YHQP 1SQPD 1W2BO 3CX5H 5CCHA 2WSFJ 2E76C 4YTPC 1AQTA 4U67W 2WSCJ 1YQ4C 3I5CA 4H44C 2KXPB 1DIPA 1BXYA 1RE3A 3PH0A 3U1AA 3H1IJ 3D6ZA 1SQVD 2E76B 1KILC 4D6TD 1EZVD 2IZ1A 1JCCA 1KFNA 5AVXB 3HD7A 2OYIB 2FFDB 1EZVE 5APTA 5KLIB 1KORA 3WUVA 5AW3B 2J59M 2W83C 5CCGA 5EFWB 1DD4A 1KILA 3RK2C 1ZRTE 3P8MC 1ZOYC 2OYHA 3H1IG 1KYOD 1AV1A 1YI2P 1LT9B 4WFAW 2K9JB 2IZ0A 2HG5D 1PIXA 1N73B 2JDIH 3G4SP 3W7WA 4IL6E 1GL2B 1M56D 1MG9A 3H1KG 4WWIA 2FYUE 3O2HA 3NTNA 1JMMA 2FYZA 1LGHB 3CWBG 2KUBA 1FZBA 1KB9D 3TYYA 2OYIC 2Y0CA 1PP9D 1L0LD 1L2PA 2J5UA 1VQLW 3VMZA 1N2DC 3EFGA 5K5GB 2W6JH 1NTMK 1LTJB 2OTLP 3CCLP 2GUVA 2NRGA 3RL0C 1MZ9A 1M1JA 5GAEa 1EXJA 4C7NA 3WUTA 2XNXA 4PD4I 4EDFA 2KLUA 3L72E 2C9NY 4C46A 3CI9A 5HL7W 2D2CD 3KZIE 5AW7B 1FS0E 2P58A 1FE6A 4BL2A 4TLFA 1NKZB 1K9MX 2A06D 1BCCD 3W7XA 1PGPA 3C9IA 5C39A 2G3AA 4UB6E 5APUA 5GTHH 1A02F 2K37A 2A45I 4D6TJ 5GADa 1R5SA 2C9LY 2G8YA 1KTMA 4U3FE 4H13D 2I8DA 3AE7C 1WRGA 2UWJE 2O01N 4EI2A 2NPSD 1YJNP 1RF0C 1Q2NA 3CXCV 1T3UA 3CC4W 4LLHA 1GW3A 1YIJW 3A2AA 2OTJW 4GOEA 3SFEC 3L70E 3KXDA 2GA1A 1FBMA 1NVOA 1R5LA 2KZJA 3Q3DA 1VQMW 1EDLA 4HJGH 1RE4C 2K1AA 1L0LE 1XTCC 5JVGW 3S4RA 2HPCB 1PGOA 4B86A 1S3JA 4XA4A 1EZVI 2NPSB 3ZG0A 2N1TA 3R2PA 5AW9B 2R3SA 5H2FH 1BGYJ 2JR8A 2KI7B 2NPSC 2PFXA 1MV8A 3CWBE 1VQ4W 5GW7A 3K5BA 1BE3D 2WPQA 1LP1A 5KAIH 2B9BA 3USSA 4N3YB 2WSEH 2KK7A 3A0BH 3AE2C 3GG2A 3GF7A 5CJ4A 4UB8H 2QVAA 2WPSA 2LR2A 1W2EA 4PD4H 1X79B 1FDMA 1MBXC 4YJXA 3RK3D 3OJAB 1NTZE 3U1CA 1NTMG 5TISH 1Q7YQ 5KTBA 1N7SD 3AE3C 3AEGC 3WU2E 2AXTH 2WSEJ 3L72G 1M1KQ 3CCMW 1EQ7A 2FYNB 3KZIH 1IFPA 3P8CD 1URQC 5TJHA 1BCCG 3F89A 1KB9I 5H2FE 3P32A 2PRRA 1Q86Q 3TSIA 3MZWB 4U7JA 4L73A 2BCCE 2FYUD 2E76D 4K3AA 2OQQA 3PRJA 1LWUB 1M90X 1W5CE 5CHXA 3H6PA 5AVSB 1EC5A 2H88C 3L71G 3FX0A 2LXCB 1PP9E 3SSUA 1ZN5A 3TDKA 1AA0A 1T6AA 3VTPC 3IFMA 2Z4EA 2P2UA 5JVHW 1AVYA 1NTZK 2ZFCA 3GF3A 3Q5PA 1L4AD 1G2CB 4TT3H 2QJYC 1NU1D 2JJLA 5AW5B 2W27A 3CL3D 5APVA 3M0AA 4IOCW 1M1JB 3O2OA 5AW2B 4GOFA 4WY4A 2C0XA 2KS1A 3BCCD 4AYCA 2KYVA 1HJBA 1RE4A 2QG4A 3Q5SA 3E7KA 3T97B 3TGUJ 1IFMA 1X8YA 1IFDA 1JTHA 3PLNA 1KYOE 2OYOA 4PV1C 4UB6H 4PD4E 2CPBA 3CCRW 2Q7CA 4H13C 3CMEW 3GHGB 4JYCA 4ASVA 1JY3P 2B88A 1VQKW 4D6TG 3CCJP 1MFZA 1OW8A 1FZEA 5APQA 2BASA 3PHLA 2N9YB 1L0NK 2BCCJ 1E5WA 3CCMP 1CSBA 2KSJA 4L74A 3RL0D 1GU4A 1DH3A 2XDJA 2SPZA 3GHGC 2RH0A 3ITKA 1KILB 1DX7A 1JMBA 1L0NG 1NTKE 2D2CC 3GLMA 2ZJRW 1YJ9P 1OWAA 1CI6A 1NTKD 4OGQC 3SFDC 4GODA 4NPEA 4M3LA 3U59A 1Q82Q 3B5NB 1YTZI 2YKOA 3H1HD 3DLLW 1BCCE 2Z5HA 1FZAA 2WA8A 4OH8B 1X0TA 1LWUC 3M0DA 1KQSO 1YJWW 4JYBA 3AE1C 4HH2A 3GHGA 3KPEA 4H0LB 2QA4W 4C7NB 1Y47A 1NJIX 1HTLC 3CCLW 2R32A 1S5LX 3BRVB 2XKMA 1JJ2V 5GAGa 2QJPB 3VMYA 2KS1B 4YKAA 3L70D 1T3JA 1VQ9W 1VQ4P 2CPSA 2IFMA 1S5LH 1SVFA 3HUSA 4GDOA 1BE3G 3VP9A 1M1JC 1R6OC 2YMYA 3SWKA 3G9RA 3JCUE 2H43A 3BRTB 3CXHH 3VMAA 2C0WA 1VF5C 2LXBA 2ZYDA 1SFCB 4RJTA 1H8AA 3W68A 2YKQA 1N73C 5TISE 5APYA 4PV1B 3N7NA 1NKNA 2YO2A 1H89A 1PP9J 3RL0B 2NZ2A 1RH5B 1IK9A 1S4XA 4LC1A 3UIAA 1RQVA 3L73G 2IYPA 1N8RQ 1SFCC 4GIFA 3P7KA 3LW5H 4BWNA 3A0BE 4NPDA 1J1DC 3RBXA 3H32A 1YTZT 3HD7D 3CC2P 1X9VA 3GW6A 3OW2O 2P10A 5KLIC 1KC8X 1SS1A 4IL6H 5M1BA 4IO9W 3FXDA 3VN0A 1NGMB 1KC8Q 1TU3F 2A06G 1T2KC 1BGYD 1RF1B 2N1TC 3MIWA 2KOGA 1FC2C 1BDCA 3KHUA 3P8CE 5AVYB 4WFNW 3DNJA 3CMEP 1W2BV 3G3PA 1KFMA 1PPJD 2KIKA 5KAFH 1CW5A 1JO5A 5BVZA 1NJIQ 4EYYQ 4W80A 3V4WA 4DT0A 1L0LG 2E5YA 2YO3A 2WQYC 2BCCD 2BEQD 4N78D 2OTJP 2FYUJ 4WFBW 5KJ7C 5CA3A 2JWDA 4DCKA 1RF0A 3RBZA 2FYNC 2RN0A 1SQBE 5AVRB 1EDJA 1MKMA 3H1KD 3CC7P 4CPGA
chains in the Genus database with same CATH topology
3GF3A 1FDIA 3Q5PA 2NZ2A 4RKUJ 3AE8C 1MBVB 3AEBC 1WMKA 3D6ZA 4TT3H 2H89C 1RQVA 2QIWA 4R4MA 2E76B 2QJYC 3EWKA 4XFJA 2YMKA 2D2CD 3RL0g 1KQFB 1OW7A 3ABVC 1ZMEC 1KORA 3AE2C 3D70A 3GF7A 2WA8A 1HJ0A 3AEEC 2P10A 4KT0J 3GQ0A 1RQSA 3O1FB 3O2OA 1OW6A 1VL2A 5KLIC 3D6YA 1DIPA 4H0LD 3O1FA 4Z1MH 3AEAC 5M1BA 3RK3E 2O01J 4PV1D 3AE1C 1Y9BA 1RQUA 2G3AA 2ZT9D 4I7ZC 1DD4A 1NGMB 1GMJA 1MBXC 4YJXA 3Q5SA 1TU3F 2QJPC 1ZRTE 3FGAD 1IK7A 3T97B 1MBUC 2WA9A 3S9OA 1ZOYC 3LW5J 4YJMA 2E75C 4H0LB 2G8YA 1KTMA 3AE3C 4H13D 4OGQB 3AEGC 3AE7C 1YQ3C 3SFDC 2E75D 3B71A 2WSEJ 5L8RJ 1AJYA 4PV1C 1PIXA 3Q5RA 2V7QJ 1S1CX 3G19A 2FBWC 1U57A 1PL5A 1OMIA 3G1BA 1KMIZ 1DD3A 4H44D 2YIUC 3D71A 2QJKC 2W9RA 1UIXA 3DNJA 1VF5B 4H0LC 1R6QC 2E75B 4H13C 3G3PA 1KILE 1NYHA 3IAOA 1S5LX 1MG9A 2JP3A 1PV3A 2QSIA 4YKAA 2MKVA 5KKZC 3C8VA 1ZP0C 1K04A 2E74D 4I7ZB 4R4LA 3AE9C 3O2HA 4U7JA 3O2BA 2FXPA 3SFEC 1FDOA 3Q1MA 2IDBA 2E76D 3AECC 1OW8A 3Q3DA 3GQ1A 4GDOA 2OQQA 3Q2YA 2WQYC 3IN6A 3H25A 1R6OC 2BEZF 1LZWA 2JO1A 2BEQD 3AEDC 4Y28J 3G9RA 3AE5C 1VF5D 3AE4C 3O6QA 1R8EA 4H13B 2H88C 4OGQD 3GW1A 2WPVB 1VF5C 4YXDC 2WSFJ 1K05A 2E76C 2J5UA 4YTPC 1CTFA 3GMAA 2FYNC 2WSCJ 1Q90D 1YQ4C 3AE6C 2K9YA 1HF9A 4PV1B 4H44C 3R4YA 1MKMA 2D2CC 1JB0J 3GLMA 3AEFC 1KQGB 2E74C 2E74B 2ZT9C 2ZT9B 4IL6X 1EXJA 1EXIA 2D2CB 4H44B 4OGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1F A;  2W9R A;  1RQU A;  3DNJ A;  1MBV B;  1DD4 A;  1RQV A;  1MBX C;  1R6Q C;  3G3P A;  4YJX A;  1MG9 A;  3GW1 A;  1MBU C;  2WA9 A;  4YKA A;  4YJM A;  1CTF A;  3O2H A;  3O2B A;  2WA8 A;  3GQ1 A;  3GQ0 A;  3O1F B;  1RQS A;  3G19 A;  3O2O A;  1R6O C;  3G1B A;  1LZW A;  1DD3 A; 
#chains in the Genus database with same CATH topology
 2H8P D;  3CXH I;  1RF1 C;  2HPC A;  3G3Z A;  1BE3 E;  3AE8 C;  4K35 A;  1LTB C;  5CJ0 A;  3CWB D;  2JWA A;  2IX7 C;  1L0L J;  3CPW V;  2RMZ A;  1ZR2 A;  1JCD A;  3B5N A;  1RF1 A;  2WSC H;  3BCC J;  5KLV G;  3G4S W;  1VQM P;  3SWY A;  3O1F B;  3H1L G;  5APW A;  4H0L D;  1P84 D;  3TNU B;  3F5H A;  3TGU G;  4PV1 D;  2B87 A;  4MN4 C;  1YI2 W;  1GMJ A;  1L0N J;  3PTZ A;  2QJP C;  4EOT A;  4UB8 E;  3CCU P;  3H1I E;  2ZXX A;  1EZV G;  2H7H A;  5L8R J;  3VOP A;  4PD4 D;  4W7Z A;  3V2P A;  4EIJ A;  1SQQ G;  2WSF H;  2Q5U A;  2QSI A;  4OVN F;  4PJ0 H;  1HBW A;  1N7S A;  1IFN A;  2WMM A;  5AVZ B;  3GQ1 A;  1ZR4 A;  1VQP P;  4BL3 A;  1IFJ A;  3HUS B;  3RK3 B;  1ZV8 A;  2ZVO B;  1MFT A;  4OGQ D;  1URQ B;  4I1L A;  1M90 Q;  2FYU G;  1P84 H;  1GL2 C;  4JPZ B;  1LTT C;  1PPJ G;  5KJ7 A;  1QLE D;  4WF9 W;  1LTJ A;  4WCE W;  2KB7 P;  1SQB J;  2ZJP W;  5B5E E;  4N6J A;  3CCU W;  4WY4 B;  2Y9Z A;  3CCQ P;  2QEX W;  5CCG C;  1KZU B;  2QM8 A;  1X22 A;  2E43 A;  1VQP W;  1G2C A;  1HJ0 A;  3AEE C;  3A5T A;  1VL2 A;  2M3E A;  1SFC D;  3N4X A;  2P67 A;  1VQ7 P;  1SQQ E;  3W7S A;  2O01 J;  3L35 A;  1P84 E;  1SLQ A;  2PP6 A;  3L74 J;  1YHQ W;  1GL2 A;  3CXH E;  3OW2 V;  2QJK B;  1Q82 X;  1NH4 A;  2E75 D;  1K73 Q;  4QMA A;  1L4A A;  1MWR A;  3L75 D;  1LTJ C;  4L76 A;  1MWU A;  1VDF A;  2E5T A;  1VF5 B;  3H1L D;  1U7M A;  3IAO A;  3V2R A;  1PV3 A;  1SQP J;  3PIO W;  3V4Q A;  3M0D C;  2E74 D;  3AE9 C;  1E79 H;  5KLV E;  1QVG O;  4CJN A;  2IDB A;  2ZAE B;  2R5B A;  4Y28 J;  1QEX A;  1IJD B;  1MUU A;  3AE5 C;  5CCG D;  4JF7 A;  4CPK A;  4WY4 D;  3AE4 C;  3M9H A;  4GT1 A;  1FU1 A;  5E79 H;  5B66 H;  2HFE D;  1NTM J;  1OVR A;  5DM6 W;  3GMA A;  1BE3 J;  5APX A;  3NMD A;  5CBN A;  1GW4 A;  1HF9 A;  3W7T A;  4HYT B;  5KAI E;  1EXI A;  4JBZ A;  3HD7 C;  1HGZ A;  4A7P A;  1EDI A;  5KAF E;  2BCC G;  3T97 A;  3MD0 A;  2QE7 H;  2YMK A;  3RGU A;  2Q3E A;  1KQF B;  3L73 J;  2IBZ D;  1BSH A;  5AW4 B;  2WZ7 A;  3ZFZ A;  2WT7 B;  2N9B A;  4AUW A;  3PJS K;  1GTW A;  1YJ9 W;  1YIJ P;  1YBK A;  3VMX A;  1NTZ G;  1VQ5 W;  3B8E B;  2L91 A;  3LID A;  5DM7 W;  3HE4 A;  1BGY E;  2POH A;  2Q1K A;  2Y0E A;  3V5B A;  2E75 C;  1SQX E;  3L75 J;  4DOJ A;  3CX5 D;  1Q7Y X;  3Q5R A;  3TGU E;  1FOS E;  1IC2 A;  1N86 A;  2XZR A;  3H1L E;  3BAT A;  1D7M A;  1UIX A;  1M1K X;  1PPJ E;  2HYN A;  1NHL A;  5B5E H;  1L0N D;  4R4L A;  1QX8 A;  2FXP A;  5DJU B;  3CC7 W;  4XE5 B;  2Q6Q A;  1FAV A;  1KB9 E;  1SQP E;  3CMA P;  1JM0 A;  3WU2 H;  2FYU K;  2YXQ B;  2OYH B;  3CCQ W;  2JEE A;  5AW6 B;  2WPV B;  3L4F A;  1K05 A;  1OZH A;  1K8A Q;  2Z5I A;  3TNU A;  2FXM A;  5AVW B;  2E74 B;  3II6 A;  1ZXG A;  1S72 P;  3CCJ W;  4ASW A;  1SQB K;  1PGJ A;  3HRN A;  3AEB C;  1NU1 E;  3H1K J;  3ZG5 A;  1J1E C;  2N1T D;  2WWW A;  1OFC X;  2IBZ E;  4XFJ A;  3CD6 P;  3V2Q A;  3FXE A;  1YJW P;  2I1K A;  1IFI A;  4U3F G;  2XU6 A;  5AW1 B;  3L74 E;  1SQV K;  2A06 E;  1Q81 Q;  1H0T A;  1HUC A;  1RQU A;  3MUD A;  1JY3 O;  1AVO A;  4IFM A;  1LP1 B;  1SQX D;  3L74 G;  2WPR A;  1YQ3 C;  5KLV K;  5GAH a;  3HE4 B;  1PL5 A;  2HLO A;  1VQO P;  1RY3 A;  4GKG A;  1QL2 A;  1R6Q C;  1KIL E;  3W7U A;  1VQQ A;  1VQ8 W;  3KYQ A;  1ZP0 C;  1N7S B;  1EDK A;  4O9B A;  4IOA W;  4DZO A;  1JOC A;  1NO4 A;  3L73 E;  3I55 W;  3L71 D;  1Z56 A;  3IN6 A;  3H25 A;  2V7Q H;  4I6M C;  3VP8 A;  5KKZ B;  1OVU A;  1H0T B;  1VQK P;  3G6E W;  4YXD C;  4ZKP A;  2KNC B;  3QWO C;  1CTF A;  3CCR P;  4BXL A;  4DKI A;  1URQ D;  3CCV W;  1L0L K;  1NAF A;  3R4Y A;  2A45 H;  4IL6 X;  2IPP A;  1M57 D;  2A45 G;  2QEX P;  5M19 A;  1WT6 A;  2V4H A;  1XTG B;  1S9K D;  1A02 J;  3D70 A;  3MGN A;  2AXC A;  3GQ0 A;  3HUS C;  4YXW H;  1OW6 A;  2B89 A;  1DEE G;  3CX5 I;  2AEF A;  5B66 E;  1KQL A;  2W90 A;  3JC2 2;  4OWF A;  2O1K A;  3VYI A;  2OTK E;  1QL1 A;  3B5N D;  2WA9 A;  2VRS A;  4YJM A;  1YIT W;  2KNC A;  4OGQ B;  2M0B A;  2FBW C;  3I55 P;  1S2E A;  2YIU C;  3BCC G;  1BSN A;  1S5L E;  2W9R A;  1T2K D;  2O01 H;  4C7R A;  3A0H H;  5APS A;  2E75 B;  2Y9Y A;  3TF5 A;  1SFC A;  5KLV D;  1PZQ A;  2MKV A;  5BU8 B;  5KKZ C;  1VQN P;  1QVF V;  4Y99 B;  1FZC C;  1J2J B;  3O2B A;  2R3C A;  2M8R A;  3I56 P;  3Q2Y A;  4AQR D;  3HE5 B;  3L72 J;  1OX3 A;  1JY3 N;  3FWL A;  3OA7 A;  1NU1 J;  2HOD B;  3H1K E;  2Q9I A;  1T8Z A;  1KYO I;  4WBA A;  3AEF C;  1GDT A;  2WTY A;  2D2C B;  3CLQ A;  1SQV E;  3OAK A;  5M18 A;  3W67 A;  1JUN A;  1LT9 A;  1MBV B;  1WMK A;  2QA4 P;  3RK2 B;  3CCE W;  1G1J A;  5GTI H;  2YNY A;  2QM7 A;  1N7L A;  1USE A;  1YYC A;  3E1I A;  1M7L A;  3BAS A;  1NWQ A;  1S9K E;  4IOI H;  5E79 E;  1LTS C;  1VQ9 P;  1N7S C;  2ZT9 D;  3BCC E;  2I1J A;  2K88 A;  1MBU C;  2AEM A;  1NOH A;  5KLV J;  5KJ7 D;  3J7Z Z;  3HD7 B;  3H32 B;  5CCH C;  1FZG A;  2YIU B;  4W7Y A;  1AJY A;  3CXH D;  1NTM D;  1LWU A;  3G19 A;  3CC2 W;  1DD3 A;  4DJG A;  4U3F J;  1LT9 C;  1NTK G;  5BU5 A;  2JP3 A;  1L0N E;  1L4A C;  1MWT A;  2B87 B;  3M9B A;  1FOS F;  1P84 I;  3NXS A;  1PP9 G;  3L73 D;  1BDD A;  1CZQ A;  3L71 E;  3BVH A;  4BRY A;  3O6Q A;  1VQ6 W;  1VQ8 P;  4WY4 C;  3HE5 A;  5AVV B;  3SWF A;  1K73 X;  1Q90 D;  4KHX A;  3CWB J;  2K9Y A;  3CMA W;  2OAR A;  1JB0 J;  1KQG B;  2E74 C;  2ZT9 C;  3KDP B;  1FDI A;  1VQN W;  1GK6 A;  1G1I A;  2O1J A;  2H89 C;  5AVU B;  3CCE P;  1NTK K;  2QIW A;  3EFF K;  3ABV C;  1ZME C;  3L70 G;  2M3B A;  4KT0 J;  1GU5 A;  1K8A X;  2DW3 A;  1LTA C;  1BCC J;  1HGV A;  3V6I A;  1OIP A;  3RK3 E;  5DJT B;  1Y9B A;  1YIT P;  2M5A A;  1NAY A;  2KSE A;  1IK7 A;  3S9O A;  5CMZ A;  3LW5 J;  1VPC A;  5GTH E;  1NU1 K;  3CX5 E;  1NTM E;  1VQO W;  3I56 W;  1LJ2 A;  2AEJ A;  4KJM A;  1ZW0 A;  1JEK A;  2V7Q J;  1NTK J;  1SQV G;  1KQS V;  2OTL W;  3D71 A;  2Y0D A;  1N73 A;  1H88 A;  2OYI A;  4YPC A;  4LGD E;  3C8V A;  1JY2 P;  1SQB G;  1LZW A;  3AED C;  3G71 P;  1FZC B;  2QRX A;  1L4A B;  1J1D B;  2R5D A;  1J1E B;  1SQB D;  2E42 A;  5CBO A;  1DEB A;  1GD2 E;  1HH0 A;  2ITA A;  2XND H;  1NTZ J;  2GUS A;  5GTI E;  3L72 D;  1IO4 A;  1RHZ B;  3FWN A;  1JTH B;  1ZLL A;  1VQ5 P;  2OGU A;  3L74 D;  3HTK A;  1YJN W;  2AXT E;  2ZVN B;  1SQQ D;  3D6Y A;  4ZNC A;  1M8O B;  2WT7 A;  1KD1 X;  2FXO A;  2CK3 H;  3L71 J;  2YXR B;  4ZKU A;  2ZJQ W;  4ZMD A;  4U3F D;  1PGQ A;  1QVF O;  1KV4 A;  1ZRT D;  3JCU H;  1URQ A;  3H1I D;  1Y8A A;  3C1L A;  1SQX G;  3MTU E;  2HR3 A;  1S1C X;  1U57 A;  1N8R X;  1KMI Z;  1FZC A;  1FZF A;  5AW0 B;  2KLV A;  3IF4 A;  4H44 D;  2N1T B;  3TGU D;  3CD6 W;  3E1R A;  1AQ5 A;  1UII A;  4H0L C;  1USD A;  2IBZ I;  1MWS A;  3A0H E;  1K04 A;  3M06 A;  4I7Z B;  2Q3I A;  2PGD A;  1FDO A;  4IFF A;  3AEC C;  1NU1 G;  1QVG V;  1JY2 O;  3V2N A;  3L70 J;  1HWT C;  2JKV A;  2BEZ F;  2IYO A;  2K9J A;  2W6A A;  1U7J A;  1VF5 D;  2W8Z A;  1SQX K;  1R8E A;  4H13 B;  3GW1 A;  4L75 A;  1K9M Q;  1KN7 A;  2O3J A;  1LTG C;  3M91 A;  1GL2 D;  1CI6 B;  2ZXE B;  4HB1 A;  3ZDM A;  1KB9 H;  3MHV A;  4H44 B;  2KZI A;  1SQP G;  5AVQ B;  4RKU J;  3G6E P;  3H1J D;  3MUD C;  1LTI C;  3WUU A;  1Q81 X;  4WVZ A;  3A7O A;  3H1J E;  3IR9 A;  1FJK A;  3RL0 g;  1OW7 A;  4RES B;  1S72 W;  1SQQ J;  4PJ0 E;  3TK1 A;  3B4S A;  2HOD A;  2FY8 A;  1OVV A;  1RQS A;  2IFN A;  4NPF X;  5AW8 B;  5CCH D;  4Z1M H;  3AEA C;  1NTZ D;  3B5N C;  4I7Z C;  3S1K A;  3FGA D;  3M9Q A;  3CC4 P;  1KYO H;  3L37 A;  2IBZ G;  2NPS A;  1SP4 A;  1BGY G;  2ZYA A;  3B71 A;  3O6Q B;  1KD1 Q;  2KP8 A;  2K3R A;  1PFI A;  3G1B A;  1OXZ A;  3L75 E;  2QJK C;  2LKM A;  3MP7 B;  1VQL P;  3EQ2 A;  1QGK B;  3RK3 C;  2P7J A;  1JNM A;  4N78 E;  2JO1 A;  3D3I A;  2WVR A;  4HKZ H;  4BRY B;  4I2L C;  3H1J J;  1GK4 A;  3LIE A;  2FKW B;  1RE3 C;  3WMM 0;  1LNQ A;  3AE6 C;  3CF5 W;  5AVT B;  1IZN B;  2ZT9 B;  3CCS W;  2FFD A;  4WB4 A;  4IFD K;  4D6T E;  4R4M A;  3EWK A;  3H1H E;  2J58 A;  3NFQ A;  1SQQ K;  2M5A B;  3H1H J;  2XV5 A;  1LT1 A;  1JY2 N;  3CCV P;  2FFD C;  3CPW O;  2YKP A;  3O1F A;  2WSS H;  5M1A A;  2RKL A;  1FJP A;  1Q86 X;  2QJY B;  1SQV J;  2L5G B;  4RO0 A;  3L75 G;  1AFO A;  2PAJ A;  3H1L J;  3RK2 D;  3PIP W;  1VQ7 W;  1HVV A;  3G71 W;  2R44 A;  4JQ0 D;  1OMI A;  1SQX J;  3A3Y B;  2ZYG A;  3QH9 A;  1KIL D;  3HTK B;  3JSV C;  2W6B A;  2WIT A;  3O8Z A;  1NYH A;  3KQG A;  2OYH C;  2MJZ A;  1VQ6 P;  2GM4 A;  3H1H G;  1GZL A;  3PP5 A;  4UY8 Z;  3Q1M A;  3CCS P;  1SQP K;  2P1J A;  3L36 A;  2ZJS E;  3H1J G;  4Y99 C;  1YHQ P;  1SQP D;  1W2B O;  3CX5 H;  5CCH A;  2WSF J;  2E76 C;  4YTP C;  1AQT A;  4U67 W;  2WSC J;  1YQ4 C;  3I5C A;  4H44 C;  2KXP B;  1DIP A;  1BXY A;  1RE3 A;  3PH0 A;  3U1A A;  3H1I J;  3D6Z A;  1SQV D;  2E76 B;  1KIL C;  4D6T D;  1EZV D;  2IZ1 A;  1JCC A;  1KFN A;  5AVX B;  3HD7 A;  2OYI B;  2FFD B;  1EZV E;  5APT A;  5KLI B;  1KOR A;  3WUV A;  5AW3 B;  2J59 M;  2W83 C;  5CCG A;  5EFW B;  1DD4 A;  1KIL A;  3RK2 C;  1ZRT E;  3P8M C;  1ZOY C;  2OYH A;  3H1I G;  1KYO D;  1AV1 A;  1YI2 P;  1LT9 B;  4WFA W;  2K9J B;  2IZ0 A;  2HG5 D;  1PIX A;  1N73 B;  2JDI H;  3G4S P;  3W7W A;  4IL6 E;  1GL2 B;  1M56 D;  1MG9 A;  3H1K G;  4WWI A;  2FYU E;  3O2H A;  3NTN A;  1JMM A;  2FYZ A;  1LGH B;  3CWB G;  2KUB A;  1FZB A;  1KB9 D;  3TYY A;  2OYI C;  2Y0C A;  1PP9 D;  1L0L D;  1L2P A;  2J5U A;  1VQL W;  3VMZ A;  1N2D C;  3EFG A;  5K5G B;  2W6J H;  1NTM K;  1LTJ B;  2OTL P;  3CCL P;  2GUV A;  2NRG A;  3RL0 C;  1MZ9 A;  1M1J A;  5GAE a;  1EXJ A;  4C7N A;  3WUT A;  2XNX A;  4PD4 I;  4EDF A;  2KLU A;  3L72 E;  2C9N Y;  4C46 A;  3CI9 A;  5HL7 W;  2D2C D;  3KZI E;  5AW7 B;  1FS0 E;  2P58 A;  1FE6 A;  4BL2 A;  4TLF A;  1NKZ B;  1K9M X;  2A06 D;  1BCC D;  3W7X A;  1PGP A;  3C9I A;  5C39 A;  2G3A A;  4UB6 E;  5APU A;  5GTH H;  1A02 F;  2K37 A;  2A45 I;  4D6T J;  5GAD a;  1R5S A;  2C9L Y;  2G8Y A;  1KTM A;  4U3F E;  4H13 D;  2I8D A;  3AE7 C;  1WRG A;  2UWJ E;  2O01 N;  4EI2 A;  2NPS D;  1YJN P;  1RF0 C;  1Q2N A;  3CXC V;  1T3U A;  3CC4 W;  4LLH A;  1GW3 A;  1YIJ W;  3A2A A;  2OTJ W;  4GOE A;  3SFE C;  3L70 E;  3KXD A;  2GA1 A;  1FBM A;  1NVO A;  1R5L A;  2KZJ A;  3Q3D A;  1VQM W;  1EDL A;  4HJG H;  1RE4 C;  2K1A A;  1L0L E;  1XTC C;  5JVG W;  3S4R A;  2HPC B;  1PGO A;  4B86 A;  1S3J A;  4XA4 A;  1EZV I;  2NPS B;  3ZG0 A;  2N1T A;  3R2P A;  5AW9 B;  2R3S A;  5H2F H;  1BGY J;  2JR8 A;  2KI7 B;  2NPS C;  2PFX A;  1MV8 A;  3CWB E;  1VQ4 W;  5GW7 A;  3K5B A;  1BE3 D;  2WPQ A;  1LP1 A;  5KAI H;  2B9B A;  3USS A;  4N3Y B;  2WSE H;  2KK7 A;  3A0B H;  3AE2 C;  3GG2 A;  3GF7 A;  5CJ4 A;  4UB8 H;  2QVA A;  2WPS A;  2LR2 A;  1W2E A;  4PD4 H;  1X79 B;  1FDM A;  1MBX C;  4YJX A;  3RK3 D;  3OJA B;  1NTZ E;  3U1C A;  1NTM G;  5TIS H;  1Q7Y Q;  5KTB A;  1N7S D;  3AE3 C;  3AEG C;  3WU2 E;  2AXT H;  2WSE J;  3L72 G;  1M1K Q;  3CCM W;  1EQ7 A;  2FYN B;  3KZI H;  1IFP A;  3P8C D;  1URQ C;  5TJH A;  1BCC G;  3F89 A;  1KB9 I;  5H2F E;  3P32 A;  2PRR A;  1Q86 Q;  3TSI A;  3MZW B;  4U7J A;  4L73 A;  2BCC E;  2FYU D;  2E76 D;  4K3A A;  2OQQ A;  3PRJ A;  1LWU B;  1M90 X;  1W5C E;  5CHX A;  3H6P A;  5AVS B;  1EC5 A;  2H88 C;  3L71 G;  3FX0 A;  2LXC B;  1PP9 E;  3SSU A;  1ZN5 A;  3TDK A;  1AA0 A;  1T6A A;  3VTP C;  3IFM A;  2Z4E A;  2P2U A;  5JVH W;  1AVY A;  1NTZ K;  2ZFC A;  3GF3 A;  3Q5P A;  1L4A D;  1G2C B;  4TT3 H;  2QJY C;  1NU1 D;  2JJL A;  5AW5 B;  2W27 A;  3CL3 D;  5APV A;  3M0A A;  4IOC W;  1M1J B;  3O2O A;  5AW2 B;  4GOF A;  4WY4 A;  2C0X A;  2KS1 A;  3BCC D;  4AYC A;  2KYV A;  1HJB A;  1RE4 A;  2QG4 A;  3Q5S A;  3E7K A;  3T97 B;  3TGU J;  1IFM A;  1X8Y A;  1IFD A;  1JTH A;  3PLN A;  1KYO E;  2OYO A;  4PV1 C;  4UB6 H;  4PD4 E;  2CPB A;  3CCR W;  2Q7C A;  4H13 C;  3CME W;  3GHG B;  4JYC A;  4ASV A;  1JY3 P;  2B88 A;  1VQK W;  4D6T G;  3CCJ P;  1MFZ A;  1OW8 A;  1FZE A;  5APQ A;  2BAS A;  3PHL A;  2N9Y B;  1L0N K;  2BCC J;  1E5W A;  3CCM P;  1CSB A;  2KSJ A;  4L74 A;  3RL0 D;  1GU4 A;  1DH3 A;  2XDJ A;  2SPZ A;  3GHG C;  2RH0 A;  3ITK A;  1KIL B;  1DX7 A;  1JMB A;  1L0N G;  1NTK E;  2D2C C;  3GLM A;  2ZJR W;  1YJ9 P;  1OWA A;  1CI6 A;  1NTK D;  4OGQ C;  3SFD C;  4GOD A;  4NPE A;  4M3L A;  3U59 A;  1Q82 Q;  3B5N B;  1YTZ I;  2YKO A;  3H1H D;  3DLL W;  1BCC E;  2Z5H A;  1FZA A;  2WA8 A;  4OH8 B;  1X0T A;  1LWU C;  3M0D A;  1KQS O;  1YJW W;  4JYB A;  3AE1 C;  4HH2 A;  3GHG A;  3KPE A;  4H0L B;  2QA4 W;  4C7N B;  1Y47 A;  1NJI X;  1HTL C;  3CCL W;  2R32 A;  1S5L X;  3BRV B;  2XKM A;  1JJ2 V;  5GAG a;  2QJP B;  3VMY A;  2KS1 B;  4YKA A;  3L70 D;  1T3J A;  1VQ9 W;  1VQ4 P;  2CPS A;  2IFM A;  1S5L H;  1SVF A;  3HUS A;  4GDO A;  1BE3 G;  3VP9 A;  1M1J C;  1R6O C;  2YMY A;  3SWK A;  3G9R A;  3JCU E;  2H43 A;  3BRT B;  3CXH H;  3VMA A;  2C0W A;  1VF5 C;  2LXB A;  2ZYD A;  1SFC B;  4RJT A;  1H8A A;  3W68 A;  2YKQ A;  1N73 C;  5TIS E;  5APY A;  4PV1 B;  3N7N A;  1NKN A;  2YO2 A;  1H89 A;  1PP9 J;  3RL0 B;  2NZ2 A;  1RH5 B;  1IK9 A;  1S4X A;  4LC1 A;  3UIA A;  1RQV A;  3L73 G;  2IYP A;  1N8R Q;  1SFC C;  4GIF A;  3P7K A;  3LW5 H;  4BWN A;  3A0B E;  4NPD A;  1J1D C;  3RBX A;  3H32 A;  1YTZ T;  3HD7 D;  3CC2 P;  1X9V A;  3GW6 A;  3OW2 O;  2P10 A;  5KLI C;  1KC8 X;  1SS1 A;  4IL6 H;  5M1B A;  4IO9 W;  3FXD A;  3VN0 A;  1NGM B;  1KC8 Q;  1TU3 F;  2A06 G;  1T2K C;  1BGY D;  1RF1 B;  2N1T C;  3MIW A;  2KOG A;  1FC2 C;  1BDC A;  3KHU A;  3P8C E;  5AVY B;  4WFN W;  3DNJ A;  3CME P;  1W2B V;  3G3P A;  1KFM A;  1PPJ D;  2KIK A;  5KAF H;  1CW5 A;  1JO5 A;  5BVZ A;  1NJI Q;  4EYY Q;  4W80 A;  3V4W A;  4DT0 A;  1L0L G;  2E5Y A;  2YO3 A;  2WQY C;  2BCC D;  2BEQ D;  4N78 D;  2OTJ P;  2FYU J;  4WFB W;  5KJ7 C;  5CA3 A;  2JWD A;  4DCK A;  1RF0 A;  3RBZ A;  2FYN C;  2RN0 A;  1SQB E;  5AVR B;  1EDJ A;  1MKM A;  3H1K D;  3CC7 P;  4CPG A; 
#chains in the Genus database with same CATH homology
 3GF3 A;  1FDI A;  3Q5P A;  2NZ2 A;  4RKU J;  3AE8 C;  1MBV B;  3AEB C;  1WMK A;  3D6Z A;  4TT3 H;  2H89 C;  1RQV A;  2QIW A;  4R4M A;  2E76 B;  2QJY C;  3EWK A;  4XFJ A;  2YMK A;  2D2C D;  3RL0 g;  1KQF B;  1OW7 A;  3ABV C;  1ZME C;  1KOR A;  3AE2 C;  3D70 A;  3GF7 A;  2WA8 A;  1HJ0 A;  3AEE C;  2P10 A;  4KT0 J;  3GQ0 A;  1RQS A;  3O1F B;  3O2O A;  1OW6 A;  1VL2 A;  5KLI C;  3D6Y A;  1DIP A;  4H0L D;  3O1F A;  4Z1M H;  3AEA C;  5M1B A;  3RK3 E;  2O01 J;  4PV1 D;  3AE1 C;  1Y9B A;  1RQU A;  2G3A A;  2ZT9 D;  4I7Z C;  1DD4 A;  1NGM B;  1GMJ A;  1MBX C;  4YJX A;  3Q5S A;  1TU3 F;  2QJP C;  1ZRT E;  3FGA D;  1IK7 A;  3T97 B;  1MBU C;  2WA9 A;  3S9O A;  1ZOY C;  3LW5 J;  4YJM A;  2E75 C;  4H0L B;  2G8Y A;  1KTM A;  3AE3 C;  4H13 D;  4OGQ B;  3AEG C;  3AE7 C;  1YQ3 C;  3SFD C;  2E75 D;  3B71 A;  2WSE J;  5L8R J;  1AJY A;  4PV1 C;  1PIX A;  3Q5R A;  2V7Q J;  1S1C X;  3G19 A;  2FBW C;  1U57 A;  1PL5 A;  1OMI A;  3G1B A;  1KMI Z;  1DD3 A;  4H44 D;  2YIU C;  3D71 A;  2QJK C;  2W9R A;  1UIX A;  3DNJ A;  1VF5 B;  4H0L C;  1R6Q C;  2E75 B;  4H13 C;  3G3P A;  1KIL E;  1NYH A;  3IAO A;  1S5L X;  1MG9 A;  2JP3 A;  1PV3 A;  2QSI A;  4YKA A;  2MKV A;  5KKZ C;  3C8V A;  1ZP0 C;  1K04 A;  2E74 D;  4I7Z B;  4R4L A;  3AE9 C;  3O2H A;  4U7J A;  3O2B A;  2FXP A;  3SFE C;  1FDO A;  3Q1M A;  2IDB A;  2E76 D;  3AEC C;  1OW8 A;  3Q3D A;  3GQ1 A;  4GDO A;  2OQQ A;  3Q2Y A;  2WQY C;  3IN6 A;  3H25 A;  1R6O C;  2BEZ F;  1LZW A;  2JO1 A;  2BEQ D;  3AED C;  4Y28 J;  3G9R A;  3AE5 C;  1VF5 D;  3AE4 C;  3O6Q A;  1R8E A;  4H13 B;  2H88 C;  4OGQ D;  3GW1 A;  2WPV B;  1VF5 C;  4YXD C;  2WSF J;  1K05 A;  2E76 C;  2J5U A;  4YTP C;  1CTF A;  3GMA A;  2FYN C;  2WSC J;  1Q90 D;  1YQ4 C;  3AE6 C;  2K9Y A;  1HF9 A;  4PV1 B;  4H44 C;  3R4Y A;  1MKM A;  2D2C C;  1JB0 J;  3GLM A;  3AEF C;  1KQG B;  2E74 C;  2E74 B;  2ZT9 C;  2ZT9 B;  4IL6 X;  1EXJ A;  1EXI A;  2D2C B;  4H44 B;  4OGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...