1RQUA

Nmr structure of l7 dimer from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7/L12
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rquA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rquA02
4YKAA 3DNJA 2WA9A 1DD3A 3O1FA 1R6QC 3O2BA 1MBUC 1RQUA 1R6OC 3O1FB 4YJXA 3GQ0A 3O2HA 1MBXC 1DD4A 1MG9A 3GQ1A 1MBVB 3O2OA 3GW1A 3G3PA 2WA8A 3G1BA 1RQSA 1CTFA 1LZWA 2W9RA 4YJMA 1RQVA 3G19A
chains in the Genus database with same CATH superfamily
1VQOW 4RKUJ 1IFJA 4OWFA 1AFOA 2G8YA 3RK3C 1MWTA 2ZJPW 3M9BA 2QEXP 1GDTA 1RE3C 3SWFA 3L71G 3HE5B 5TJHA 1LZWA 4QMAA 1GK4A 2G3AA 5JVGW 4IFMA 3O2BA 3HD7B 1VQ6W 1YJNW 2N1TD 3L4FA 3L72G 2A45G 2H43A 4ZNCA 2FYUJ 3MGNA 1BE3J 3AEBC 3H1LG 3E1RA 1DH3A 4EDFA 1LWUB 1CTFA 3L70J 3NXSA 5AW5B 2R5BA 1YJ9P 3BRVB 1U7MA 1RHZB 4XA4A 1P84H 3CCJW 1S2EA 1VL2A 3H1HE 1CI6B 1GW3A 3CPWO 1JY3N 2A06E 1K8AQ 2W9RA 3I55W 5APUA 3L74G 1AA0A 3V6IA 3W7SA 1EDJA 1FZGA 2LKMA 1NO4A 1NJIQ 4WF9W 1S5LE 3G9RA 1L0NE 2WSFH 3L75J 2IYPA 5AW3B 2OYOA 3GW6A 3CC7P 1JTHB 3KQGA 4LC1A 5AVVB 2KLVA 2H8PD 2N9BA 1ZR4A 3B5NA 3VMZA 2P58A 4IOIH 3U59A 4AUWA 2JWAA 1OZHA 2ZJSE 3M0DA 4Y99C 3GQ1A 4WY4C 1CW5A 3F5HA 2YIUC 2YKPA 4L74A 1VQNW 3BCCD 2KS1A 3G19A 5GTHE 3O1FA 3M9QA 3CCVP 1N7SB 2ZXXA 3AE5C 3MD0A 4JYCA 5B5EH 4DCKA 4CPGA 3AE4C 3ABVC 2FXMA 1ZN5A 1KILD 5CCGA 5AVUB 1G2CB 1S72P 3AECC 2WPSA 3KHUA 1D7MA 1W2BV 1KYOH 4DOJA 2KSEA 4H0LB 1KILC 1ZRTD 2QIWA 3I5CA 5TISH 2HODB 2BCCE 1PPJE 1MWSA 3C1LA 3AE3C 1KB9H 1AQ5A 2W83C 3EFFK 3ZFZA 2WSEJ 3RL0g 4PJ0H 3GHGC 2I8DA 1N7SD 5C39A 3D3IA 2H7HA 2KNCA 4O9BA 1SQVK 3ITKA 3CCMP 1M1JB 3G1BA 1QEXA 4YKAA 2Z4EA 1SQVD 3H1JJ 3G6EP 1GU4A 1VQ8P 3L35A 3FXEA 1RQUA 1K8AX 4K3AA 2KLUA 5DJUB 2JR8A 2WZ7A 1KZUB 3MHVA 1NJIX 2K88A 4PV1D 1L0LE 2FY8A 3U1AA 1M1KQ 4PV1C 1USEA 2OTLP 1QX8A 2QJPC 3H1HJ 4IFFA 2WT7A 1RF1A 2HG5D 2ZT9B 2YMYA 1KC8X 2D2CB 3O6QA 2E74D 2E76D 1ZV8A 3VMYA 2PP6A 2E74C 1L0NJ 1SQXK 1JO5A 1QLED 3MUDA 3CPWV 1P84E 2Y9ZA 1SQXD 4OGQD 4RO0A 1S4XA 5M1AA 1SQPE 2PRRA 4OGQC 5JVHW 1N73B 3E7KA 2KSJA 1P84I 2M5AA 1R5SA 2W90A 2A45H 1ZLLA 3C9IA 1S1CX 5APVA 3H1KD 2Y9YA 1L4AA 1YQ4C 2D2CD 2W27A 3CCJP 1FZCB 2B87B 1VQLW 1EDLA 5AW8B 2B89A 3PIPW 2QA4W 4GDOA 3I55P 5AW6B 1Q90D 1WRGA 2XKMA 3AE1C 2KYVA 2HR3A 2XV5A 1PGPA 5AW9B 3B71A 5BVZA 3AE8C 1EZVE 3W7UA 1BXYA 2IBZD 3AE2C 3HUSB 3WUTA 1BCCD 2QRXA 1EZVI 2JWDA 3L73G 1R6OC 2KIKA 3H1ID 2BCCJ 2E5TA 3L37A 1OX3A 3G71P 4UB6H 2KB7P 4N78D 1N2DC 2QJKC 3A5TA 5AVQB 4YJXA 1YIJP 2WA9A 4U3FG 4I6MC 1FBMA 3RK2D 1Y47A 4C7RA 4DT0A 2L91A 2Q9IA 1LP1B 3MP7B 3RK2C 1NU1K 4WFAW 1Q86Q 2IBZG 1SFCB 2KOGA 3JCUE 1FZAA 1SP4A 1M90Q 3EFGA 1KB9E 1BCCG 1NU1D 3W67A 2BEZF 1GL2A 4IFDK 4YXDC 2Y0EA 2ZVNB 4N6JA 1J1EC 4PJ0E 1L0LJ 3W68A 3AE7C 1VF5B 1KB9I 3KDPB 4IO9W 1R8EA 2NPSB 1MWUA 2FFDB 1J2JB 3GLMA 1H0TA 1GZLA 1ZR2A 3SFDC 3CCEW 2C9NY 4H44B 4IL6H 3HTKB 4NPDA 1KYOD 5CBNA 1SQBE 1SS1A 1NTMK 1YYCA 3ZDMA 5AW4B 3T97A 3BVHA 1NTMD 1NU1G 3K5BA 5KLVG 3CX5D 1SQPJ 1SQQE 3N4XA 2K9JB 1BDDA 4EIJA 3CC4W 3CF5W 1FC2C 3P8CD 1J1DC 2I1JA 2AXTH 2K9YA 4M3LA 2WSFJ 2C9LY 1RE4C 2KP8A 1FZBA 3L71E 5KAFH 4YXWH 3CCQP 4H13B 5H2FE 2FYNB 3M91A 1YITW 1M7LA 1HUCA 2E43A 3Q3DA 3W7WA 1WT6A 1NGMB 2CPSA 4H44D 2OYIA 2W6JH 1JJ2V 1NTMG 2KXPB 3L72E 5KLIB 3S1KA 4W7YA 5CBOA 3PH0A 4WFNW 3A0BH 5CA3A 3RK3E 1IK9A 3H1LE 2N9YB 2R32A 1Q81Q 1G1JA 3V2PA 1LTBC 1A02J 1JY2O 3WMM0 1LTJC 1RE3A 2R3SA 4WB4A 1VDFA 2M3BA 3WU2H 3IN6A 1Q86X 3AEGC 3NTNA 3OAKA 5GAHa 4AQRD 5CJ0A 3WUUA 4YTPC 1X0TA 1FOSE 1LT9C 1PP9D 3CD6P 1JMBA 3KYQA 1BE3G 1URQC 4KHXA 2Q5UA 3L70G 1VQLP 1K04A 2OYHA 3V4WA 3CXCV 4NPFX 4I7ZC 4GKGA 2WSCH 3TYYA 1CZQA 2JO1A 1T2KD 1VQ5W 1X79B 5CMZA 2V7QH 1HF9A 1Y9BA 1IJDB 1E79H 1RF0C 2XZRA 3TDKA 3L74D 4Z1MH 1PP9G 1HJ0A 3CXHH 3H1JE 3L75G 2N1TC 2IDBA 1Q2NA 3EQ2A 1X9VA 1NOHA 1SQBJ 2OYHC 1RQVA 2OTJP 2OARA 2Q7CA 3Q5PA 3M06A 3H32A 4JQ0D 2HPCA 2K1AA 5BU5A 1W5CE 2J5UA 2ZJRW 1VQMW 3CCSP 2KI7B 1SQQJ 4WY4A 1VQPP 3BCCE 4IL6E 2FBWC 3TK1A 5GAGa 1HJBA 2GUVA 1NWQA 3D6YA 3LW5H 4HKZH 1Q81X 2QM7A 3L71J 3HD7D 3A7OA 3I56P 1EQ7A 1OVUA 2YXRB 1JY2N 4XFJA 3IR9A 3NFQA 3HD7C 2FXOA 5APWA 1IK7A 2WTYA 2K3RA 2YKQA 1IZNB 1PZQA 1PGJA 1KC8Q 3L72J 1WMKA 4DZOA 2AXTE 3B5NB 1LWUC 1KILE 5AVRB 3H1LJ 1VQ7W 1VQ9W 5HL7W 3FWLA 2YXQB 5KAFE 1ZRTE 3AE9C 2M0BA 1KILA 2WMMA 2Y0CA 1W2EA 2KS1B 2PFXA 3ZG5A 4IOAW 4IL6X 3SFEC 3CCUW 3CLQA 3O1FB 3PIOW 3A0BE 3SWKA 5APSA 3KXDA 2C0XA 3GHGA 4R4MA 5M18A 3PLNA 2ZYDA 2P2UA 5M1BA 1HGZA 5E79E 3P7KA 1SQVE 5B66H 1JCCA 1LGHB 3MZWB 1YITP 1IFDA 3D71A 2IYOA 1YJWW 3B5ND 1FS0E 3OA7A 5AVXB 2O1JA 3Q5RA 5APQA 4AYCA 5AW0B 5EFWB 1OW7A 2W8ZA 3ZG0A 1T8ZA 1OW8A 1YTZI 2UWJE 3A0HH 4NPEA 3TF5A 3CX5H 1PL5A 3H1HG 3CMEW 1AQTA 2A06G 1DD4A 1YQ3C 3SWYA 3GG2A 2K37A 1MFZA 2KNCB 4DKIA 1USDA 1N7SC 1L0NG 2SPZA 2M8RA 2E75B 1DX7A 4N3YB 2O01J 3C8VA 1CSBA 1SQXE 3L36A 3MTUE 4JPZB 5KJ7D 2YMKA 4HJGH 3B8EB 1DEEG 2QJYB 1YHQP 4H0LD 1QVFO 4EI2A 1HH0A 1T3UA 1BGYD 2B88A 1VQOP 3VTPC 4H0LC 4GOFA 1GU5A 3AEEC 1IFNA 2WT7B 1OIPA 2DW3A 2AEFA 3BCCJ 3H1KE 1RF1B 2ZFCA 3AEAC 3O6QB 3TSIA 2E76C 1Q82Q 1MWRA 1UIIA 4ASWA 1ZP0C 5GTIH 5APTA 2E75D 4UB8H 1VQ6P 1YJNP 3AE6C 1MFTA 4JF7A 1OXZA 2JDIH 1NTZK 2P7JA 1IO4A 1BGYG 2IBZE 2M5AB 1NTZD 3AEFC 1IFIA 1BCCE 3CXHD 1AVOA 2M3EA 2CPBA 3L73D 1H88A 3H1IE 2HFED 2IBZI 3TGUD 3CCLW 2ZT9D 3O2OA 1S9KD 1PPJG 1L4AB 4N78E 3CMAW 2ZT9C 2IX7C 3G4SW 2D2CC 2IPPA 3V2RA 2OTKE 2ZVOB 3RL0B 4U3FD 4PD4D 4B86A 3V2QA 1JMMA 5DM7W 4C7NA 5M19A 3P8MC 5CHXA 2WPVB 1SQVJ 4L73A 1BSNA 1NTZG 1NU1E 1S3JA 3HE4A 1ZXGA 5AVWB 1AVYA 1N73C 3BRTB 3TGUG 4ZKUA 5B5EE 1L0LG 4LGDE 1VQ7P 1IFMA 3GF7A 1NTKK 3VYIA 2QG4A 5KAIH 5B66E 1L4AD 1OVRA 2KUBA 1OW6A 5AW7B 1VQNP 2H88C 1JY3P 1NTKD 1XTGB 3CL3D 4U7JA 3RL0D 1FZCC 1KYOE 2P67A 3CC2W 5TISE 2ZYAA 2BEQD 3IAOA 5KLVK 1NTME 3PJSK 4GIFA 5CCHD 3QH9A 1SQXJ 1KYOI 1YJ9W 3A0HE 3CX5E 2V7QJ 2R44A 5KLVD 1GL2B 5CCHC 1Q82X 1X8YA 3TNUA 3U1CA 3HUSC 3P8CE 1YJWP 3CX5I 2V4HA 2Y0DA 1GMJA 1PV3A 4D6TD 1FZFA 1N8RX 3Q1MA 1RE4A 1Y8AA 1NTKG 3E1IA 4OH8B 3H1KJ 3CWBD 5CJ4A 1H0TB 1QL2A 3GQ0A 1QVFV 5KKZB 3FXDA 2LR2A 4DJGA 1YTZT 3CC7W 3USSA 3FGAD 3T97B 1EDIA 1SFCD 3F89A 2FXPA 4ZMDA 4BRYA 3H25A 2MJZA 4ASVA 4RJTA 1LNQA 2WSSH 1GL2D 4RESB 2WPQA 4R4LA 4EYYQ 1S5LH 1U57A 1GD2E 2LXBA 4WVZA 3LW5J 4D6TG 4K35A 1RH5B 1BCCJ 1VF5D 1FJPA 2W6BA 2OGUA 1LTJA 1A02F 3H1IJ 2NPSD 3CWBG 5GTIE 2WWWA 1VF5C 4UB8E 3CCVW 2IFNA 2AEJA 4ZKPA 2XNDH 2NPSC 4HH2A 2FYUK 2OYIB 1PP9E 2JKVA 3M0AA 1FDIA 4H44C 1LT9A 1XTCC 1MV8A 2FYUD 3VMAA 1KFMA 1BE3D 2WITA 1URQA 3II6A 3L70D 1HVVA 2A45I 3UIAA 3RK3B 2FKWB 1KQLA 3OJAB 1NU1J 1HWTC 1FJKA 4L76A 1N86A 1UIXA 2J59M 1H89A 4H13D 4W80A 3PP5A 3L74E 2E42A 1RF0A 1AV1A 4GT1A 2ZYGA 2QVAA 4H13C 3CCMW 1X22A 2FYNC 1MG9A 1LJ2A 1MBVB 1BSHA 2R5DA 4XE5B 5AVTB 2FYUG 3CCLP 3L75D 2BASA 3G6EW 2N1TA 1VQ8W 4BL2A 1SQBG 1MZ9A 2XU6A 2QA4P 1KTMA 2OYHB 3O2HA 1NTMJ 1NAYA 4UB6E 1E5WA 4WBAA 5KAIE 3A3YB 1QGKB 4BWNA 3RGUA 1T2KC 1QVGO 1IC2A 3R4YA 3HE5A 3VP8A 4KT0J 4BXLA 2WVRA 3HD7A 4LLHA 1LTIC 1TU3F 3H32B 2HPCB 1NAFA 4PD4H 1LWUA 3CC2P 5GW7A 5AW2B 4YJMA 1SVFA 4Y99B 1VQ4W 4WY4B 2E5YA 1MUUA 1NHLA 1GK6A 2YIUB 3D70A 1ZOYC 5AVYB 5GAEa 3VMXA 1CI6A 3CI9A 3N7NA 1FZEA 5APYA 1JEKA 3GF3A 2RKLA 3VOPA 4OVNF 2QM8A 4BL3A 2IFMA 1R6QC 1PP9J 4WFBW 3Q5SA 3CCEP 3H1JD 1K73Q 2PAJA 3M9HA 1FOSF 1JCDA 1JTHA 1KFNA 1DIPA 3KPEA 4JYBA 1VPCA 4CPKA 1KILB 2L5GB 4WY4D 3H6PA 3PHLA 3G71W 3CC4P 3H1HD 2AXCA 4EOTA 4IOCW 1VQKW 2A06D 2WA8A 1YIJW 1RQSA 4TLFA 1K9MQ 3L74J 1L0NK 3GHGB 3G3ZA 1KD1Q 3PRJA 4WWIA 2PGDA 1JUNA 1L0ND 1N7SA 3H1JG 1QL1A 1S5LX 5AVZB 3V2NA 2NRGA 3NMDA 1NH4A 3WU2E 1GW4A 3B5NC 4C46A 1PGOA 1KN7A 3W7TA 3DNJA 1GTWA 1BGYE 1MBUC 5KJ7A 1G2CA 3M0DC 2I1KA 2Q3EA 4PV1B 3S4RA 2QJPB 3BCCG 1L2PA 2HODA 3FX0A 1T3JA 4W7ZA 1T6AA 2KZJA 3JCUH 1OWAA 1U7JA 1ZMEC 2O01N 2E74B 2E76B 4TT3H 3SSUA 1YI2W 1QVGV 1M1JA 5CCGD 2WQYC 3EWKA 2QSIA 1OVVA 3W7XA 4L75A 4GOEA 5KJ7C 3HRNA 4Y28J 5CCGC 1ZW0A 4OGQB 1NTZE 1Z56A 3FWNA 2MKVA 3CXHE 2O1KA 3L73E 3TGUE 3CCQW 1H8AA 2XDJA 1NKZB 1S9KE 2BCCD 3IFMA 3CXHI 1PPJD 1VQ5P 1K73X 4HYTB 3A2AA 1KORA 1NVOA 1R5LA 3KZIH 4PD4E 4U3FE 1M1JC 2GUSA 3GMAA 1K05A 2B9BA 1N8RQ 1HGVA 3JC22 2E75C 1KQSO 5AVSB 1SQVG 1JOCA 4PD4I 1YBKA 3VP9A 5H2FH 1K9MX 2AEMA 3V5BA 3OW2O 1L0LK 2QJYC 1KD1X 1MBXC 3CCRW 2VRSA 2P10A 1N73A 1L0LD 2BCCG 4I2LC 1VQMP 2J58A 4WCEW 2ZAEB 5KTBA 1M57D 1RF1C 1MKMA 1VQ4P 1NTKE 1EC5A 2QJKB 3CD6W 1FDMA 2IZ0A 1FZCA 2B87A 5APXA 3JSVC 3V4QA 4C7NB 1NKNA 2RN0A 2Q3IA 1LTGC 3MUDC 3RK2B 2C0WA 3MIWA 2JEEA 3QWOC 1SQPK 1SQXG 4HB1A 1P84D 5KLVE 1Q7YQ 2HYNA 3HE4B 2QEXW 2Z5HA 1SQPD 2NZ2A 5CCHA 2Z5IA 2ZXEB 1J1EB 1BGYJ 2YO3A 1NYHA 1VQ9P 2WPRA 3HUSA 3O8ZA 4D6TE 1OFCX 1HBWA 2YNYA 1AJYA 2YO2A 3CWBE 3H1KG 1L4AC 2FYZA 3CCUP 1LTTC 1EXIA 2OTJW 3RL0C 2GA1A 1RY3A 2WSCJ 1VQKP 3PTZA 1JY2P 2WSEH 5K5GB 2JP3A 1M1KX 1KQGB 1LP1A 2OQQA 1SQPG 1EXJA 3CCSW 1EZVD 1SFCA 1N7LA 3TNUB 1VQPW 1LT1A 2LXCB 1NTZJ 2POHA 3LIDA 3WUVA 1FU1A 5GADa 1J1DB 2O01H 2IZ1A 3L73J 1KQFB 1DD3A 1LTAC 4MN4C 3P32A 3H1IG 4GODA 3TGUJ 1BDCA 3I56W 5BU8B 2KK7A 4U67W 3BATA 3S9OA 2JJLA 3CMEP 2NPSA 3B4SA 1FE6A 2FFDA 1M8OB 5L8RJ 3R2PA 1JB0J 4U3FJ 2FYUE 1EDKA 1BE3E 2W6AA 3HTKA 4JBZA 2P1JA 3L70E 2Q6QA 4YPCA 4BRYB 3D6ZA 1EZVG 2XNXA 1SFCC 4UY8Z 1KV4A 3Q2YA 1YI2P 3GW1A 4I1LA 1M56D 1GL2C 1KB9D 2HLOA 2K9JA 3KZIE 2QE7H 2ITAA 4A7PA 1LTJB 1KQSV 2Q1KA 2H89C 3VN0A 1Q7YX 2FFDC 3OW2V 1VQQA 1NTKJ 3AEDC 1SQBK 3L75E 1LT9B 5KKZC 2GM4A 1S72W 1SQBD 1JM0A 2O3JA 1URQB 5GTHH 2R3CA 1JNMA 1PGQA 2ZJQW 4CJNA 5AW1B 1LTSC 1SQQK 5KLVJ 4I7ZB 1JY3O 3DLLW 5DM6W 1SQQD 2KZIA 2RMZA 3J7ZZ 1PIXA 5E79H 1HTLC 3IF4A 3LIEA 4D6TJ 1PFIA 2RH0A 3CCRP 4KJMA 1G1IA 3G3PA 3L71D 1DEBA 3CWBJ 2CK3H 1OMIA 2N1TB 3RBZA 5DJTB 3BASA 3CMAP 2OYIC 1W2BO 1FAVA 1M90X 5KLIC 3G4SP 1URQD 3L72D 1YHQW 1IFPA 1KMIZ 1SLQA 1FDOA 2YKOA 3RK3D 3H1LD 3RBXA 1SQQG 2OTLW
chains in the Genus database with same CATH topology
3IN6A 4GDOA 4RKUJ 4YKAA 3GLMA 2V7QJ 1AJYA 3AEFC 2G8YA 3AEGC 3SFDC 1Q90D 1OW8A 2FBWC 1KORA 4H44B 1RQUA 3AE1C 3D6YA 1PL5A 1TU3F 2H89C 4YTPC 1S5LX 3B71A 3AE8C 3GMAA 1DD4A 3GQ1A 1K05A 1YQ3C 4PV1D 2ZT9D 3O2OA 1EXIA 2YIUC 4XFJA 1GMJA 1PV3A 1LZWA 2E75C 2WSCJ 3AEDC 3AE2C 4YJMA 3Q1MA 3G19A 2G3AA 4PV1C 2ZT9C 3DNJA 1K04A 5KKZC 2D2CC 1IK7A 1UIXA 2JP3A 3O1FA 4H13D 3O2BA 3D70A 1MBUC 1KQGB 2QJPC 1WMKA 1ZOYC 2E75B 1R6OC 2O01J 3C8VA 3GQ0A 2OQQA 2QJYC 1KILE 4I7ZC 4PV1B 2ZT9B 1EXJA 1MBXC 3AE5C 2D2CB 3O6QA 2E74D 2E76D 4H13C 2FYNC 2K9YA 2YMKA 1MG9A 1MBVB 2P10A 2WSFJ 2JO1A 3AEBC 2WPVB 1ZRTE 1HF9A 3FGAD 4I7ZB 3T97B 1Y9BA 3AE9C 1CTFA 4H0LD 2E74C 2QJKC 3GF3A 4H13B 4YJXA 3AE4C 1KQFB 2FXPA 2WA9A 1DD3A 1ZMEC 3ABVC 3H25A 1MKMA 1R6QC 4IL6X 1KTMA 4H0LC 1PIXA 3SFEC 4Z1MH 3Q3DA 2E74B 2E76B 3O1FB 3Q5SA 3O2HA 1NGMB 4H44D 4OGQD 4R4LA 1HJ0A 3AEEC 4TT3H 1U57A 3AECC 3AEAC 1VL2A 4H0LB 3LW5J 3S9OA 2WQYC 3EWKA 2QSIA 3GF7A 3G3PA 4OGQC 2IDBA 1VF5D 1DIPA 2QIWA 4R4MA 3RK3E 2W9RA 5L8RJ 1JB0J 5M1BA 2E76C 1RQVA 4Y28J 1OW6A 2BEZF 1OMIA 4YXDC 3AE3C 1VF5C 2H88C 4OGQB 3Q5PA 5KLIC 2MKVA 1S1CX 1ZP0C 3G9RA 3D6ZA 2WSEJ 3AE7C 3R4YA 4U7JA 3D71A 3RL0g 2E75D 2NZ2A 3AE6C 1VF5B 2J5UA 3Q5RA 1YQ4C 2D2CD 1KMIZ 3Q2YA 1FDOA 1R8EA 3GW1A 2BEQD 3IAOA 1FDIA 1NYHA 1RQSA 4H44C 2WA8A 3G1BA 4KT0J 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKA A;  3DNJ A;  2WA9 A;  1DD3 A;  3O1F A;  1R6Q C;  3O2B A;  1MBU C;  1RQU A;  1R6O C;  3O1F B;  4YJX A;  3GQ0 A;  3O2H A;  1MBX C;  1DD4 A;  1MG9 A;  3GQ1 A;  1MBV B;  3O2O A;  3GW1 A;  3G3P A;  2WA8 A;  3G1B A;  1RQS A;  1CTF A;  1LZW A;  2W9R A;  4YJM A;  1RQV A;  3G19 A; 
#chains in the Genus database with same CATH topology
 1VQO W;  4RKU J;  1IFJ A;  4OWF A;  1AFO A;  2G8Y A;  3RK3 C;  1MWT A;  2ZJP W;  3M9B A;  2QEX P;  1GDT A;  1RE3 C;  3SWF A;  3L71 G;  3HE5 B;  5TJH A;  1LZW A;  4QMA A;  1GK4 A;  2G3A A;  5JVG W;  4IFM A;  3O2B A;  3HD7 B;  1VQ6 W;  1YJN W;  2N1T D;  3L4F A;  3L72 G;  2A45 G;  2H43 A;  4ZNC A;  2FYU J;  3MGN A;  1BE3 J;  3AEB C;  3H1L G;  3E1R A;  1DH3 A;  4EDF A;  1LWU B;  1CTF A;  3L70 J;  3NXS A;  5AW5 B;  2R5B A;  1YJ9 P;  3BRV B;  1U7M A;  1RHZ B;  4XA4 A;  1P84 H;  3CCJ W;  1S2E A;  1VL2 A;  3H1H E;  1CI6 B;  1GW3 A;  3CPW O;  1JY3 N;  2A06 E;  1K8A Q;  2W9R A;  3I55 W;  5APU A;  3L74 G;  1AA0 A;  3V6I A;  3W7S A;  1EDJ A;  1FZG A;  2LKM A;  1NO4 A;  1NJI Q;  4WF9 W;  1S5L E;  3G9R A;  1L0N E;  2WSF H;  3L75 J;  2IYP A;  5AW3 B;  2OYO A;  3GW6 A;  3CC7 P;  1JTH B;  3KQG A;  4LC1 A;  5AVV B;  2KLV A;  2H8P D;  2N9B A;  1ZR4 A;  3B5N A;  3VMZ A;  2P58 A;  4IOI H;  3U59 A;  4AUW A;  2JWA A;  1OZH A;  2ZJS E;  3M0D A;  4Y99 C;  3GQ1 A;  4WY4 C;  1CW5 A;  3F5H A;  2YIU C;  2YKP A;  4L74 A;  1VQN W;  3BCC D;  2KS1 A;  3G19 A;  5GTH E;  3O1F A;  3M9Q A;  3CCV P;  1N7S B;  2ZXX A;  3AE5 C;  3MD0 A;  4JYC A;  5B5E H;  4DCK A;  4CPG A;  3AE4 C;  3ABV C;  2FXM A;  1ZN5 A;  1KIL D;  5CCG A;  5AVU B;  1G2C B;  1S72 P;  3AEC C;  2WPS A;  3KHU A;  1D7M A;  1W2B V;  1KYO H;  4DOJ A;  2KSE A;  4H0L B;  1KIL C;  1ZRT D;  2QIW A;  3I5C A;  5TIS H;  2HOD B;  2BCC E;  1PPJ E;  1MWS A;  3C1L A;  3AE3 C;  1KB9 H;  1AQ5 A;  2W83 C;  3EFF K;  3ZFZ A;  2WSE J;  3RL0 g;  4PJ0 H;  3GHG C;  2I8D A;  1N7S D;  5C39 A;  3D3I A;  2H7H A;  2KNC A;  4O9B A;  1SQV K;  3ITK A;  3CCM P;  1M1J B;  3G1B A;  1QEX A;  4YKA A;  2Z4E A;  1SQV D;  3H1J J;  3G6E P;  1GU4 A;  1VQ8 P;  3L35 A;  3FXE A;  1RQU A;  1K8A X;  4K3A A;  2KLU A;  5DJU B;  2JR8 A;  2WZ7 A;  1KZU B;  3MHV A;  1NJI X;  2K88 A;  4PV1 D;  1L0L E;  2FY8 A;  3U1A A;  1M1K Q;  4PV1 C;  1USE A;  2OTL P;  1QX8 A;  2QJP C;  3H1H J;  4IFF A;  2WT7 A;  1RF1 A;  2HG5 D;  2ZT9 B;  2YMY A;  1KC8 X;  2D2C B;  3O6Q A;  2E74 D;  2E76 D;  1ZV8 A;  3VMY A;  2PP6 A;  2E74 C;  1L0N J;  1SQX K;  1JO5 A;  1QLE D;  3MUD A;  3CPW V;  1P84 E;  2Y9Z A;  1SQX D;  4OGQ D;  4RO0 A;  1S4X A;  5M1A A;  1SQP E;  2PRR A;  4OGQ C;  5JVH W;  1N73 B;  3E7K A;  2KSJ A;  1P84 I;  2M5A A;  1R5S A;  2W90 A;  2A45 H;  1ZLL A;  3C9I A;  1S1C X;  5APV A;  3H1K D;  2Y9Y A;  1L4A A;  1YQ4 C;  2D2C D;  2W27 A;  3CCJ P;  1FZC B;  2B87 B;  1VQL W;  1EDL A;  5AW8 B;  2B89 A;  3PIP W;  2QA4 W;  4GDO A;  3I55 P;  5AW6 B;  1Q90 D;  1WRG A;  2XKM A;  3AE1 C;  2KYV A;  2HR3 A;  2XV5 A;  1PGP A;  5AW9 B;  3B71 A;  5BVZ A;  3AE8 C;  1EZV E;  3W7U A;  1BXY A;  2IBZ D;  3AE2 C;  3HUS B;  3WUT A;  1BCC D;  2QRX A;  1EZV I;  2JWD A;  3L73 G;  1R6O C;  2KIK A;  3H1I D;  2BCC J;  2E5T A;  3L37 A;  1OX3 A;  3G71 P;  4UB6 H;  2KB7 P;  4N78 D;  1N2D C;  2QJK C;  3A5T A;  5AVQ B;  4YJX A;  1YIJ P;  2WA9 A;  4U3F G;  4I6M C;  1FBM A;  3RK2 D;  1Y47 A;  4C7R A;  4DT0 A;  2L91 A;  2Q9I A;  1LP1 B;  3MP7 B;  3RK2 C;  1NU1 K;  4WFA W;  1Q86 Q;  2IBZ G;  1SFC B;  2KOG A;  3JCU E;  1FZA A;  1SP4 A;  1M90 Q;  3EFG A;  1KB9 E;  1BCC G;  1NU1 D;  3W67 A;  2BEZ F;  1GL2 A;  4IFD K;  4YXD C;  2Y0E A;  2ZVN B;  4N6J A;  1J1E C;  4PJ0 E;  1L0L J;  3W68 A;  3AE7 C;  1VF5 B;  1KB9 I;  3KDP B;  4IO9 W;  1R8E A;  2NPS B;  1MWU A;  2FFD B;  1J2J B;  3GLM A;  1H0T A;  1GZL A;  1ZR2 A;  3SFD C;  3CCE W;  2C9N Y;  4H44 B;  4IL6 H;  3HTK B;  4NPD A;  1KYO D;  5CBN A;  1SQB E;  1SS1 A;  1NTM K;  1YYC A;  3ZDM A;  5AW4 B;  3T97 A;  3BVH A;  1NTM D;  1NU1 G;  3K5B A;  5KLV G;  3CX5 D;  1SQP J;  1SQQ E;  3N4X A;  2K9J B;  1BDD A;  4EIJ A;  3CC4 W;  3CF5 W;  1FC2 C;  3P8C D;  1J1D C;  2I1J A;  2AXT H;  2K9Y A;  4M3L A;  2WSF J;  2C9L Y;  1RE4 C;  2KP8 A;  1FZB A;  3L71 E;  5KAF H;  4YXW H;  3CCQ P;  4H13 B;  5H2F E;  2FYN B;  3M91 A;  1YIT W;  1M7L A;  1HUC A;  2E43 A;  3Q3D A;  3W7W A;  1WT6 A;  1NGM B;  2CPS A;  4H44 D;  2OYI A;  2W6J H;  1JJ2 V;  1NTM G;  2KXP B;  3L72 E;  5KLI B;  3S1K A;  4W7Y A;  5CBO A;  3PH0 A;  4WFN W;  3A0B H;  5CA3 A;  3RK3 E;  1IK9 A;  3H1L E;  2N9Y B;  2R32 A;  1Q81 Q;  1G1J A;  3V2P A;  1LTB C;  1A02 J;  1JY2 O;  3WMM 0;  1LTJ C;  1RE3 A;  2R3S A;  4WB4 A;  1VDF A;  2M3B A;  3WU2 H;  3IN6 A;  1Q86 X;  3AEG C;  3NTN A;  3OAK A;  5GAH a;  4AQR D;  5CJ0 A;  3WUU A;  4YTP C;  1X0T A;  1FOS E;  1LT9 C;  1PP9 D;  3CD6 P;  1JMB A;  3KYQ A;  1BE3 G;  1URQ C;  4KHX A;  2Q5U A;  3L70 G;  1VQL P;  1K04 A;  2OYH A;  3V4W A;  3CXC V;  4NPF X;  4I7Z C;  4GKG A;  2WSC H;  3TYY A;  1CZQ A;  2JO1 A;  1T2K D;  1VQ5 W;  1X79 B;  5CMZ A;  2V7Q H;  1HF9 A;  1Y9B A;  1IJD B;  1E79 H;  1RF0 C;  2XZR A;  3TDK A;  3L74 D;  4Z1M H;  1PP9 G;  1HJ0 A;  3CXH H;  3H1J E;  3L75 G;  2N1T C;  2IDB A;  1Q2N A;  3EQ2 A;  1X9V A;  1NOH A;  1SQB J;  2OYH C;  1RQV A;  2OTJ P;  2OAR A;  2Q7C A;  3Q5P A;  3M06 A;  3H32 A;  4JQ0 D;  2HPC A;  2K1A A;  5BU5 A;  1W5C E;  2J5U A;  2ZJR W;  1VQM W;  3CCS P;  2KI7 B;  1SQQ J;  4WY4 A;  1VQP P;  3BCC E;  4IL6 E;  2FBW C;  3TK1 A;  5GAG a;  1HJB A;  2GUV A;  1NWQ A;  3D6Y A;  3LW5 H;  4HKZ H;  1Q81 X;  2QM7 A;  3L71 J;  3HD7 D;  3A7O A;  3I56 P;  1EQ7 A;  1OVU A;  2YXR B;  1JY2 N;  4XFJ A;  3IR9 A;  3NFQ A;  3HD7 C;  2FXO A;  5APW A;  1IK7 A;  2WTY A;  2K3R A;  2YKQ A;  1IZN B;  1PZQ A;  1PGJ A;  1KC8 Q;  3L72 J;  1WMK A;  4DZO A;  2AXT E;  3B5N B;  1LWU C;  1KIL E;  5AVR B;  3H1L J;  1VQ7 W;  1VQ9 W;  5HL7 W;  3FWL A;  2YXQ B;  5KAF E;  1ZRT E;  3AE9 C;  2M0B A;  1KIL A;  2WMM A;  2Y0C A;  1W2E A;  2KS1 B;  2PFX A;  3ZG5 A;  4IOA W;  4IL6 X;  3SFE C;  3CCU W;  3CLQ A;  3O1F B;  3PIO W;  3A0B E;  3SWK A;  5APS A;  3KXD A;  2C0X A;  3GHG A;  4R4M A;  5M18 A;  3PLN A;  2ZYD A;  2P2U A;  5M1B A;  1HGZ A;  5E79 E;  3P7K A;  1SQV E;  5B66 H;  1JCC A;  1LGH B;  3MZW B;  1YIT P;  1IFD A;  3D71 A;  2IYO A;  1YJW W;  3B5N D;  1FS0 E;  3OA7 A;  5AVX B;  2O1J A;  3Q5R A;  5APQ A;  4AYC A;  5AW0 B;  5EFW B;  1OW7 A;  2W8Z A;  3ZG0 A;  1T8Z A;  1OW8 A;  1YTZ I;  2UWJ E;  3A0H H;  4NPE A;  3TF5 A;  3CX5 H;  1PL5 A;  3H1H G;  3CME W;  1AQT A;  2A06 G;  1DD4 A;  1YQ3 C;  3SWY A;  3GG2 A;  2K37 A;  1MFZ A;  2KNC B;  4DKI A;  1USD A;  1N7S C;  1L0N G;  2SPZ A;  2M8R A;  2E75 B;  1DX7 A;  4N3Y B;  2O01 J;  3C8V A;  1CSB A;  1SQX E;  3L36 A;  3MTU E;  4JPZ B;  5KJ7 D;  2YMK A;  4HJG H;  3B8E B;  1DEE G;  2QJY B;  1YHQ P;  4H0L D;  1QVF O;  4EI2 A;  1HH0 A;  1T3U A;  1BGY D;  2B88 A;  1VQO P;  3VTP C;  4H0L C;  4GOF A;  1GU5 A;  3AEE C;  1IFN A;  2WT7 B;  1OIP A;  2DW3 A;  2AEF A;  3BCC J;  3H1K E;  1RF1 B;  2ZFC A;  3AEA C;  3O6Q B;  3TSI A;  2E76 C;  1Q82 Q;  1MWR A;  1UII A;  4ASW A;  1ZP0 C;  5GTI H;  5APT A;  2E75 D;  4UB8 H;  1VQ6 P;  1YJN P;  3AE6 C;  1MFT A;  4JF7 A;  1OXZ A;  2JDI H;  1NTZ K;  2P7J A;  1IO4 A;  1BGY G;  2IBZ E;  2M5A B;  1NTZ D;  3AEF C;  1IFI A;  1BCC E;  3CXH D;  1AVO A;  2M3E A;  2CPB A;  3L73 D;  1H88 A;  3H1I E;  2HFE D;  2IBZ I;  3TGU D;  3CCL W;  2ZT9 D;  3O2O A;  1S9K D;  1PPJ G;  1L4A B;  4N78 E;  3CMA W;  2ZT9 C;  2IX7 C;  3G4S W;  2D2C C;  2IPP A;  3V2R A;  2OTK E;  2ZVO B;  3RL0 B;  4U3F D;  4PD4 D;  4B86 A;  3V2Q A;  1JMM A;  5DM7 W;  4C7N A;  5M19 A;  3P8M C;  5CHX A;  2WPV B;  1SQV J;  4L73 A;  1BSN A;  1NTZ G;  1NU1 E;  1S3J A;  3HE4 A;  1ZXG A;  5AVW B;  1AVY A;  1N73 C;  3BRT B;  3TGU G;  4ZKU A;  5B5E E;  1L0L G;  4LGD E;  1VQ7 P;  1IFM A;  3GF7 A;  1NTK K;  3VYI A;  2QG4 A;  5KAI H;  5B66 E;  1L4A D;  1OVR A;  2KUB A;  1OW6 A;  5AW7 B;  1VQN P;  2H88 C;  1JY3 P;  1NTK D;  1XTG B;  3CL3 D;  4U7J A;  3RL0 D;  1FZC C;  1KYO E;  2P67 A;  3CC2 W;  5TIS E;  2ZYA A;  2BEQ D;  3IAO A;  5KLV K;  1NTM E;  3PJS K;  4GIF A;  5CCH D;  3QH9 A;  1SQX J;  1KYO I;  1YJ9 W;  3A0H E;  3CX5 E;  2V7Q J;  2R44 A;  5KLV D;  1GL2 B;  5CCH C;  1Q82 X;  1X8Y A;  3TNU A;  3U1C A;  3HUS C;  3P8C E;  1YJW P;  3CX5 I;  2V4H A;  2Y0D A;  1GMJ A;  1PV3 A;  4D6T D;  1FZF A;  1N8R X;  3Q1M A;  1RE4 A;  1Y8A A;  1NTK G;  3E1I A;  4OH8 B;  3H1K J;  3CWB D;  5CJ4 A;  1H0T B;  1QL2 A;  3GQ0 A;  1QVF V;  5KKZ B;  3FXD A;  2LR2 A;  4DJG A;  1YTZ T;  3CC7 W;  3USS A;  3FGA D;  3T97 B;  1EDI A;  1SFC D;  3F89 A;  2FXP A;  4ZMD A;  4BRY A;  3H25 A;  2MJZ A;  4ASV A;  4RJT A;  1LNQ A;  2WSS H;  1GL2 D;  4RES B;  2WPQ A;  4R4L A;  4EYY Q;  1S5L H;  1U57 A;  1GD2 E;  2LXB A;  4WVZ A;  3LW5 J;  4D6T G;  4K35 A;  1RH5 B;  1BCC J;  1VF5 D;  1FJP A;  2W6B A;  2OGU A;  1LTJ A;  1A02 F;  3H1I J;  2NPS D;  3CWB G;  5GTI E;  2WWW A;  1VF5 C;  4UB8 E;  3CCV W;  2IFN A;  2AEJ A;  4ZKP A;  2XND H;  2NPS C;  4HH2 A;  2FYU K;  2OYI B;  1PP9 E;  2JKV A;  3M0A A;  1FDI A;  4H44 C;  1LT9 A;  1XTC C;  1MV8 A;  2FYU D;  3VMA A;  1KFM A;  1BE3 D;  2WIT A;  1URQ A;  3II6 A;  3L70 D;  1HVV A;  2A45 I;  3UIA A;  3RK3 B;  2FKW B;  1KQL A;  3OJA B;  1NU1 J;  1HWT C;  1FJK A;  4L76 A;  1N86 A;  1UIX A;  2J59 M;  1H89 A;  4H13 D;  4W80 A;  3PP5 A;  3L74 E;  2E42 A;  1RF0 A;  1AV1 A;  4GT1 A;  2ZYG A;  2QVA A;  4H13 C;  3CCM W;  1X22 A;  2FYN C;  1MG9 A;  1LJ2 A;  1MBV B;  1BSH A;  2R5D A;  4XE5 B;  5AVT B;  2FYU G;  3CCL P;  3L75 D;  2BAS A;  3G6E W;  2N1T A;  1VQ8 W;  4BL2 A;  1SQB G;  1MZ9 A;  2XU6 A;  2QA4 P;  1KTM A;  2OYH B;  3O2H A;  1NTM J;  1NAY A;  4UB6 E;  1E5W A;  4WBA A;  5KAI E;  3A3Y B;  1QGK B;  4BWN A;  3RGU A;  1T2K C;  1QVG O;  1IC2 A;  3R4Y A;  3HE5 A;  3VP8 A;  4KT0 J;  4BXL A;  2WVR A;  3HD7 A;  4LLH A;  1LTI C;  1TU3 F;  3H32 B;  2HPC B;  1NAF A;  4PD4 H;  1LWU A;  3CC2 P;  5GW7 A;  5AW2 B;  4YJM A;  1SVF A;  4Y99 B;  1VQ4 W;  4WY4 B;  2E5Y A;  1MUU A;  1NHL A;  1GK6 A;  2YIU B;  3D70 A;  1ZOY C;  5AVY B;  5GAE a;  3VMX A;  1CI6 A;  3CI9 A;  3N7N A;  1FZE A;  5APY A;  1JEK A;  3GF3 A;  2RKL A;  3VOP A;  4OVN F;  2QM8 A;  4BL3 A;  2IFM A;  1R6Q C;  1PP9 J;  4WFB W;  3Q5S A;  3CCE P;  3H1J D;  1K73 Q;  2PAJ A;  3M9H A;  1FOS F;  1JCD A;  1JTH A;  1KFN A;  1DIP A;  3KPE A;  4JYB A;  1VPC A;  4CPK A;  1KIL B;  2L5G B;  4WY4 D;  3H6P A;  3PHL A;  3G71 W;  3CC4 P;  3H1H D;  2AXC A;  4EOT A;  4IOC W;  1VQK W;  2A06 D;  2WA8 A;  1YIJ W;  1RQS A;  4TLF A;  1K9M Q;  3L74 J;  1L0N K;  3GHG B;  3G3Z A;  1KD1 Q;  3PRJ A;  4WWI A;  2PGD A;  1JUN A;  1L0N D;  1N7S A;  3H1J G;  1QL1 A;  1S5L X;  5AVZ B;  3V2N A;  2NRG A;  3NMD A;  1NH4 A;  3WU2 E;  1GW4 A;  3B5N C;  4C46 A;  1PGO A;  1KN7 A;  3W7T A;  3DNJ A;  1GTW A;  1BGY E;  1MBU C;  5KJ7 A;  1G2C A;  3M0D C;  2I1K A;  2Q3E A;  4PV1 B;  3S4R A;  2QJP B;  3BCC G;  1L2P A;  2HOD A;  3FX0 A;  1T3J A;  4W7Z A;  1T6A A;  2KZJ A;  3JCU H;  1OWA A;  1U7J A;  1ZME C;  2O01 N;  2E74 B;  2E76 B;  4TT3 H;  3SSU A;  1YI2 W;  1QVG V;  1M1J A;  5CCG D;  2WQY C;  3EWK A;  2QSI A;  1OVV A;  3W7X A;  4L75 A;  4GOE A;  5KJ7 C;  3HRN A;  4Y28 J;  5CCG C;  1ZW0 A;  4OGQ B;  1NTZ E;  1Z56 A;  3FWN A;  2MKV A;  3CXH E;  2O1K A;  3L73 E;  3TGU E;  3CCQ W;  1H8A A;  2XDJ A;  1NKZ B;  1S9K E;  2BCC D;  3IFM A;  3CXH I;  1PPJ D;  1VQ5 P;  1K73 X;  4HYT B;  3A2A A;  1KOR A;  1NVO A;  1R5L A;  3KZI H;  4PD4 E;  4U3F E;  1M1J C;  2GUS A;  3GMA A;  1K05 A;  2B9B A;  1N8R Q;  1HGV A;  3JC2 2;  2E75 C;  1KQS O;  5AVS B;  1SQV G;  1JOC A;  4PD4 I;  1YBK A;  3VP9 A;  5H2F H;  1K9M X;  2AEM A;  3V5B A;  3OW2 O;  1L0L K;  2QJY C;  1KD1 X;  1MBX C;  3CCR W;  2VRS A;  2P10 A;  1N73 A;  1L0L D;  2BCC G;  4I2L C;  1VQM P;  2J58 A;  4WCE W;  2ZAE B;  5KTB A;  1M57 D;  1RF1 C;  1MKM A;  1VQ4 P;  1NTK E;  1EC5 A;  2QJK B;  3CD6 W;  1FDM A;  2IZ0 A;  1FZC A;  2B87 A;  5APX A;  3JSV C;  3V4Q A;  4C7N B;  1NKN A;  2RN0 A;  2Q3I A;  1LTG C;  3MUD C;  3RK2 B;  2C0W A;  3MIW A;  2JEE A;  3QWO C;  1SQP K;  1SQX G;  4HB1 A;  1P84 D;  5KLV E;  1Q7Y Q;  2HYN A;  3HE4 B;  2QEX W;  2Z5H A;  1SQP D;  2NZ2 A;  5CCH A;  2Z5I A;  2ZXE B;  1J1E B;  1BGY J;  2YO3 A;  1NYH A;  1VQ9 P;  2WPR A;  3HUS A;  3O8Z A;  4D6T E;  1OFC X;  1HBW A;  2YNY A;  1AJY A;  2YO2 A;  3CWB E;  3H1K G;  1L4A C;  2FYZ A;  3CCU P;  1LTT C;  1EXI A;  2OTJ W;  3RL0 C;  2GA1 A;  1RY3 A;  2WSC J;  1VQK P;  3PTZ A;  1JY2 P;  2WSE H;  5K5G B;  2JP3 A;  1M1K X;  1KQG B;  1LP1 A;  2OQQ A;  1SQP G;  1EXJ A;  3CCS W;  1EZV D;  1SFC A;  1N7L A;  3TNU B;  1VQP W;  1LT1 A;  2LXC B;  1NTZ J;  2POH A;  3LID A;  3WUV A;  1FU1 A;  5GAD a;  1J1D B;  2O01 H;  2IZ1 A;  3L73 J;  1KQF B;  1DD3 A;  1LTA C;  4MN4 C;  3P32 A;  3H1I G;  4GOD A;  3TGU J;  1BDC A;  3I56 W;  5BU8 B;  2KK7 A;  4U67 W;  3BAT A;  3S9O A;  2JJL A;  3CME P;  2NPS A;  3B4S A;  1FE6 A;  2FFD A;  1M8O B;  5L8R J;  3R2P A;  1JB0 J;  4U3F J;  2FYU E;  1EDK A;  1BE3 E;  2W6A A;  3HTK A;  4JBZ A;  2P1J A;  3L70 E;  2Q6Q A;  4YPC A;  4BRY B;  3D6Z A;  1EZV G;  2XNX A;  1SFC C;  4UY8 Z;  1KV4 A;  3Q2Y A;  1YI2 P;  3GW1 A;  4I1L A;  1M56 D;  1GL2 C;  1KB9 D;  2HLO A;  2K9J A;  3KZI E;  2QE7 H;  2ITA A;  4A7P A;  1LTJ B;  1KQS V;  2Q1K A;  2H89 C;  3VN0 A;  1Q7Y X;  2FFD C;  3OW2 V;  1VQQ A;  1NTK J;  3AED C;  1SQB K;  3L75 E;  1LT9 B;  5KKZ C;  2GM4 A;  1S72 W;  1SQB D;  1JM0 A;  2O3J A;  1URQ B;  5GTH H;  2R3C A;  1JNM A;  1PGQ A;  2ZJQ W;  4CJN A;  5AW1 B;  1LTS C;  1SQQ K;  5KLV J;  4I7Z B;  1JY3 O;  3DLL W;  5DM6 W;  1SQQ D;  2KZI A;  2RMZ A;  3J7Z Z;  1PIX A;  5E79 H;  1HTL C;  3IF4 A;  3LIE A;  4D6T J;  1PFI A;  2RH0 A;  3CCR P;  4KJM A;  1G1I A;  3G3P A;  3L71 D;  1DEB A;  3CWB J;  2CK3 H;  1OMI A;  2N1T B;  3RBZ A;  5DJT B;  3BAS A;  3CMA P;  2OYI C;  1W2B O;  1FAV A;  1M90 X;  5KLI C;  3G4S P;  1URQ D;  3L72 D;  1YHQ W;  1IFP A;  1KMI Z;  1SLQ A;  1FDO A;  2YKO A;  3RK3 D;  3H1L D;  3RBX A;  1SQQ G;  2OTL W; 
#chains in the Genus database with same CATH homology
 3IN6 A;  4GDO A;  4RKU J;  4YKA A;  3GLM A;  2V7Q J;  1AJY A;  3AEF C;  2G8Y A;  3AEG C;  3SFD C;  1Q90 D;  1OW8 A;  2FBW C;  1KOR A;  4H44 B;  1RQU A;  3AE1 C;  3D6Y A;  1PL5 A;  1TU3 F;  2H89 C;  4YTP C;  1S5L X;  3B71 A;  3AE8 C;  3GMA A;  1DD4 A;  3GQ1 A;  1K05 A;  1YQ3 C;  4PV1 D;  2ZT9 D;  3O2O A;  1EXI A;  2YIU C;  4XFJ A;  1GMJ A;  1PV3 A;  1LZW A;  2E75 C;  2WSC J;  3AED C;  3AE2 C;  4YJM A;  3Q1M A;  3G19 A;  2G3A A;  4PV1 C;  2ZT9 C;  3DNJ A;  1K04 A;  5KKZ C;  2D2C C;  1IK7 A;  1UIX A;  2JP3 A;  3O1F A;  4H13 D;  3O2B A;  3D70 A;  1MBU C;  1KQG B;  2QJP C;  1WMK A;  1ZOY C;  2E75 B;  1R6O C;  2O01 J;  3C8V A;  3GQ0 A;  2OQQ A;  2QJY C;  1KIL E;  4I7Z C;  4PV1 B;  2ZT9 B;  1EXJ A;  1MBX C;  3AE5 C;  2D2C B;  3O6Q A;  2E74 D;  2E76 D;  4H13 C;  2FYN C;  2K9Y A;  2YMK A;  1MG9 A;  1MBV B;  2P10 A;  2WSF J;  2JO1 A;  3AEB C;  2WPV B;  1ZRT E;  1HF9 A;  3FGA D;  4I7Z B;  3T97 B;  1Y9B A;  3AE9 C;  1CTF A;  4H0L D;  2E74 C;  2QJK C;  3GF3 A;  4H13 B;  4YJX A;  3AE4 C;  1KQF B;  2FXP A;  2WA9 A;  1DD3 A;  1ZME C;  3ABV C;  3H25 A;  1MKM A;  1R6Q C;  4IL6 X;  1KTM A;  4H0L C;  1PIX A;  3SFE C;  4Z1M H;  3Q3D A;  2E74 B;  2E76 B;  3O1F B;  3Q5S A;  3O2H A;  1NGM B;  4H44 D;  4OGQ D;  4R4L A;  1HJ0 A;  3AEE C;  4TT3 H;  1U57 A;  3AEC C;  3AEA C;  1VL2 A;  4H0L B;  3LW5 J;  3S9O A;  2WQY C;  3EWK A;  2QSI A;  3GF7 A;  3G3P A;  4OGQ C;  2IDB A;  1VF5 D;  1DIP A;  2QIW A;  4R4M A;  3RK3 E;  2W9R A;  5L8R J;  1JB0 J;  5M1B A;  2E76 C;  1RQV A;  4Y28 J;  1OW6 A;  2BEZ F;  1OMI A;  4YXD C;  3AE3 C;  1VF5 C;  2H88 C;  4OGQ B;  3Q5P A;  5KLI C;  2MKV A;  1S1C X;  1ZP0 C;  3G9R A;  3D6Z A;  2WSE J;  3AE7 C;  3R4Y A;  4U7J A;  3D71 A;  3RL0 g;  2E75 D;  2NZ2 A;  3AE6 C;  1VF5 B;  2J5U A;  3Q5R A;  1YQ4 C;  2D2C D;  1KMI Z;  3Q2Y A;  1FDO A;  1R8E A;  3GW1 A;  2BEQ D;  3IAO A;  1FDI A;  1NYH A;  1RQS A;  4H44 C;  2WA8 A;  3G1B A;  4KT0 J;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...