1RQUA

Nmr structure of l7 dimer from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7/L12
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rquA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rquA02
1RQSA 3GW1A 3GQ0A 4YJXA 3O1FB 1R6QC 4YJMA 2W9RA 1RQVA 1MBUC 3G3PA 4YKAA 1MBVB 1RQUA 3GQ1A 3O2HA 3G19A 3O2OA 1DD3A 1MG9A 2WA9A 1CTFA 1MBXC 1LZWA 2WA8A 1R6OC 1DD4A 3O1FA 3G1BA 3O2BA 3DNJA
chains in the Genus database with same CATH superfamily
4H0LD 1SQXE 1SFCD 3H1JG 2IBZD 1W2BO 1LTJB 3P8CE 5GADa 2Z5IA 2GUSA 5KLVE 5KLVJ 1RF1C 1LZWA 1LTBC 4AQRD 3Q5RA 3O1FA 1SP4A 2E74D 2XZRA 4IFFA 3L4FA 4U3FE 2PP6A 2KNCB 4IL6E 3I56W 3PH0A 2Z4EA 1NKNA 3H32A 3A0BE 3V2QA 3MTUE 5EFWB 1KB9I 1VPCA 5AW2B 3F5HA 3TK1A 1L0NK 1SQBD 1GK6A 4BRYA 2W8ZA 2HLOA 2KLVA 2PGDA 4MN4C 2OTJW 2W6JH 3BCCD 1PIXA 3RK3C 1NTZG 3MUDC 1URQD 4CPKA 1YIJW 2ZJSE 3ITKA 2QEXP 3CCEW 2M5AA 3CMEP 3H1KE 2N1TC 3H1KJ 2ZXXA 2AXCA 3KXDA 2K9JA 3H1HG 3R4YA 3SWYA 1FZCA 2W6BA 2YMYA 1L4AB 3ABVC 1LTGC 1FDOA 3DLLW 4WY4B 1U7MA 1L4AC 1SQPJ 3ZG5A 1LJ2A 1K73Q 4H13B 5C39A 4NPDA 2H8PD 3VTPC 3L73G 1YI2W 3H25A 1JY2O 5CHXA 1AFOA 1NTKD 3M9QA 4ZKUA 4EDFA 1NTMK 2KIKA 3SFDC 1Q86X 2IBZI 2RH0A 2YIUB 3W7XA 3CCUW 4H0LC 1T6AA 1SFCC 1VQOP 1GW3A 3E7KA 3CCVP 3H1LG 1IFIA 2OGUA 2BCCE 4UB6H 1BGYG 1U7JA 2Q6QA 4ZMDA 1S3JA 1ZMEC 3L37A 1LTAC 2E74C 3JSVC 1N7SD 1KILE 5CBOA 4IL6X 3CX5H 1ZW0A 1YTZT 2KLUA 4U7JA 3CL3D 4L73A 3WUTA 1H0TA 1PV3A 1YQ4C 3M91A 2PAJA 1SVFA 4DKIA 2OYIA 1BE3D 2A06D 2WA8A 1OVUA 3USSA 1OW6A 1PP9D 4UB6E 2O01N 3GHGC 1L0LK 3B5ND 3VN0A 4U3FD 1URQC 2FYZA 2KOGA 2R32A 3CWBG 4GIFA 1JNMA 1N73C 1HGZA 1AVYA 2QJYC 5DJTB 2LR2A 1BCCG 2AEFA 3V2PA 1FJPA 3CCJP 3W67A 1BSHA 1HTLC 1RF0C 4PD4D 5AW3B 1FU1A 2LXBA 3FWNA 1L0NJ 2ZFCA 3AE2C 3WU2H 3V4WA 4JYBA 2KNCA 2FFDB 4TT3H 3W7WA 2C0WA 4DOJA 1DIPA 3VYIA 2Q5UA 2A45H 5AW5B 3O6QB 1S5LH 3MUDA 1MFZA 1R8EA 1M7LA 2IBZG 1AQ5A 1GL2D 2N1TA 2N9YB 1LTSC 4XA4A 2R5DA 2E75D 3AE5C 3I56P 2E42A 5AW7B 2FYUG 3Q2YA 2YO3A 3CF5W 2M8RA 3WU2E 1VQ5W 4YTPC 3KYQA 3N4XA 1NU1D 3WMM0 4C7RA 3C9IA 1DX7A 1L4AA 3QWOC 5APUA 5KAIH 1MBUC 4JPZB 1N7SC 3S1KA 4WFNW 1VQMW 1EDIA 5KLIC 4ZNCA 4WY4A 1LWUC 4BL3A 3OJAB 3CD6W 1YIJP 1JM0A 1NTZD 4DZOA 1IJDB 1JOCA 1MZ9A 3HD7D 1YBKA 1NTMJ 3AE7C 3RL0D 4DT0A 3AEAC 1T3UA 2R44A 3H1HD 3W68A 1KC8Q 3TYYA 1XTGB 1YHQP 2GUVA 4PV1C 3PIPW 1SFCA 3PJSK 2B87A 2WPVB 2KS1B 3B5NC 5KAIE 2V4HA 2JKVA 3G71W 2ZYGA 2YKOA 3WUUA 1KC8X 3HUSB 4L76A 1YI2P 3L75E 1QVFV 1VQ6P 1EZVE 1DD4A 3L73D 5DM7W 4PD4I 5L8RJ 1PZQA 1U57A 3CC4W 3L71D 2N9BA 1ZR2A 3A7OA 3ZDMA 5TISH 2LKMA 3V4QA 1FDMA 1NTKG 3GG2A 1KD1Q 1MWSA 2ITAA 1L0LE 2YKPA 1AQTA 5CA3A 1GL2B 3FXDA 1JB0J 2O3JA 3HTKA 3GHGA 4LC1A 1VQPW 4LLHA 1QVGV 1URQA 2E75B 3L70G 1KFMA 3CCQW 1N73A 5AVTB 1SQBJ 3B71A 1KD1X 1YJNW 3BCCJ 3AECC 2IFMA 1P84H 1MKMA 3L72J 4CPGA 2IX7C 5TISE 1SQPK 3F89A 2NPSB 1SQVG 1RF0A 1D7MA 4HKZH 1VQLW 4IOAW 1JY2N 2HR3A 1SQXG 1S5LX 3U1CA 5APTA 3G4SW 3HRNA 1BE3G 2WTYA 3RK2B 3N7NA 2Y0DA 2M0BA 3HD7C 1NGMB 2OYHB 2NRGA 4N78D 1K8AX 3CWBD 2C9LY 2SPZA 3RL0C 1P84E 2JO1A 2MJZA 3E1IA 3CC7P 4U3FG 2POHA 2QVAA 4HYTB 4WVZA 2OTLW 2QM8A 2RN0A 5B66E 2XNXA 1BCCD 2WSSH 3EFFK 3KQGA 2WA9A 1JO5A 3CCMW 2ZAEB 1VQ4W 1FZAA 3G6EW 3CI9A 3DNJA 1IFNA 1ZLLA 1G2CB 3MD0A 3D70A 4EYYQ 2K37A 1K9MX 4H13D 2BASA 2WQYC 2WITA 2JP3A 4O9BA 1NYHA 2QJPB 1N7SA 1S9KD 5AVRB 1MWUA 1J2JB 2YXQB 2WT7B 3L74D 1GW4A 3TDKA 2J59M 2C0XA 5BU8B 5H2FE 4WWIA 1OIPA 3W7TA 1S2EA 1LTJC 2FYUD 2YNYA 3WUVA 3P32A 3I55W 2KXPB 3M9BA 5AVVB 1RE4A 3B5NA 3CXHD 2YMKA 5E79H 3AEEC 3GMAA 3D71A 4GDOA 1PPJE 5APVA 4Z1MH 1NU1G 5TJHA 1PP9J 3CD6P 2OTKE 3TGUD 1CSBA 4KHXA 4H44D 3FX0A 2Y0EA 4LGDE 3OA7A 3HE5B 1N8RQ 1USEA 1X79B 3H1IE 3H1IJ 2XDJA 1DEEG 1MV8A 3PIOW 1QVFO 4AUWA 4GKGA 1Y8AA 5E79E 2FKWB 3U1AA 4D6TD 3MP7B 3G71P 5APYA 4M3LA 2BCCG 1VQNW 1HGVA 1N8RX 1YJWW 3T97A 3VOPA 3HE4B 2WSEJ 3AEBC 1GL2A 3E1RA 1JTHA 1IZNB 1OXZA 3H1JJ 2IZ1A 1MWTA 4YJMA 1SQPE 1MFTA 5KKZB 2FXPA 2QG4A 3QH9A 3KHUA 4WY4C 1KQSV 3A3YB 4C7NB 1JMBA 2D2CB 5HL7W 3L71G 1HJBA 1JY2P 1LTTC 4H13C 2B9BA 1KYOH 1K73X 2FY8A 2L91A 2K1AA 1YJ9W 1VQPP 3IN6A 1G1JA 2O01H 1NU1J 3GF7A 5KJ7D 1RE3C 3HD7A 1VQKW 3L70D 1DEBA 1S72W 2Y0CA 1YJNP 1KQGB 3Q1MA 1T3JA 2YIUC 3R2PA 2WVRA 1AV1A 1KN7A 1CZQA 1NTZJ 3CXHI 2KP8A 2Q3EA 2KI7B 1OFCX 1KYOE 1SQVD 4KJMA 1SQQD 3H1HJ 3MZWB 1Y47A 2KZIA 2B88A 1AA0A 4H44B 1SQXD 2O01J 1RQUA 1NKZB 1H88A 4A7PA 3P8CD 3TSIA 1OW7A 1FOSF 2H88C 1LP1B 4K3AA 3OW2V 2FYUK 5KLVD 4Y99B 2KB7P 3CCLW 4GOEA 2K88A 5GTIH 2NZ2A 2OTLP 1X9VA 2P67A 2E5TA 5AVWB 1LT9B 1R5LA 3G9RA 3L73J 2WT7A 1AVOA 5GTHH 2WPSA 3CCMP 1T8ZA 1VQ4P 3CPWV 1J1DB 2GA1A 3CX5E 3G6EP 1VL2A 1HVVA 1LTJA 3AEDC 3I5CA 1SQBK 2A45G 1KB9H 2QA4W 3RGUA 1ZRTE 1OVVA 4TLFA 1N7LA 2C9NY 1L0NE 1G1IA 1H89A 2YKQA 3PRJA 5GTIE 2OQQA 3H1LJ 3H1LE 2HPCB 3H1KD 1FE6A 3K5BA 1BGYJ 2W83C 3O2HA 1OVRA 2JDIH 4IOIH 5CJ0A 3BRVB 1MG9A 2P7JA 3S4RA 2FFDC 4YXDC 3L74G 1KB9E 3I55P 1EDJA 2W9RA 4I7ZB 5M19A 3G3PA 3HE5A 3RK3E 1X22A 1VQ9W 1M1KQ 5B5EH 5JVGW 3L75G 2W27A 2ZYAA 5CMZA 1GD2E 3JC22 1GMJA 1NTKK 1FDIA 5BVZA 4N3YB 4WB4A 2H7HA 4OGQD 3P7KA 1M1JB 2NPSD 1VQ8W 1S5LE 2OTJP 4B86A 3CWBJ 1VDFA 4JYCA 3TGUG 2J58A 3LIEA 1R5SA 1GU4A 1LT1A 3O8ZA 3PLNA 3CCEP 2BEQD 1JUNA 1L0LG 2RMZA 3W7SA 2CPBA 3OAKA 1BCCJ 4OVNF 1J1EB 1NTME 4AYCA 3II6A 2QIWA 5B5EE 1VQNP 2RKLA 3AE6C 1OW8A 3RK2D 1KZUB 1YJWP 1ZR4A 2BCCD 1QX8A 3VMZA 2ZJQW 1RE3A 4D6TG 3V2RA 1Q2NA 3O1FB 1RE4C 1KILD 4GOFA 1A02F 3KZIH 2G8YA 1IK9A 1IFDA 1Q7YQ 2ZT9B 1Z56A 2ZVNB 5K5GB 2ZJRW 2WSFH 2IBZE 1QL1A 2YO2A 5CCHD 2OARA 3HUSC 3FGAD 1ZV8A 4L75A 2B89A 1YJ9P 3VP8A 2FYUJ 3G19A 2CPSA 3VMYA 2QJKB 2QM7A 5AVZB 2R5BA 1JCDA 2I1JA 2E76D 4ASVA 3CCUP 4NPFX 4YXWH 4XE5B 1NH4A 4OH8B 5KAFH 1S72P 4YJXA 2M5AB 3KZIE 3NXSA 1VF5B 1QLED 3L36A 1FZCB 1ZP0C 1GDTA 1LP1A 3AE8C 2Q9IA 2WSFJ 1Y9BA 3V2NA 2V7QH 2HFED 1GL2C 1SQBE 1R6OC 3G1BA 4IOCW 3IFMA 3SWKA 3OW2O 3GW1A 4EIJA 1L0ND 2WPQA 3A0HH 3BCCE 1LT9A 2E75C 5AW4B 4K35A 3L72E 4I1LA 4OGQB 3AE3C 5DJUB 3CMAW 3TF5A 3M9HA 1SQQG 1M8OB 5KAFE 4D6TJ 5APQA 3V6IA 1M90Q 2NPSC 1CW5A 2ZXEB 2E43A 4HH2A 3BVHA 3M0DA 2M3BA 2V7QJ 5KLVG 1DH3A 1WRGA 4BXLA 1E79H 5AVXB 1CTFA 1JEKA 2O1KA 2FFDA 1PGJA 3O2BA 2HPCA 1NU1K 2YXRB 3A0HE 3CCSW 2R3CA 1M90X 1R6QC 2I8DA 4BL2A 1KILB 3RK2C 1JY3O 3O6QA 2OYHC 1BXYA 5KJ7A 1PPJG 4GT1A 1FZFA 1NTKE 1NTKJ 1NTZK 2ZYDA 1FC2C 3M0AA 1VQQA 2WZ7A 4W7ZA 2L5GB 3U59A 2IPPA 2FYNB 1NTMD 1H0TB 2R3SA 3L70J 2W6AA 1NJIQ 1MBXC 2D2CD 3NFQA 5CCHC 2E76B 2OYIB 5AVSB 3BATA 4EOTA 3H1KG 2KK7A 4HJGH 3CXCV 2QE7H 2QJPC 1K05A 1HH0A 1FS0E 1MBVB 3CC2W 2H89C 2K3RA 1X0TA 1SQVJ 1LTIC 1USDA 2XU6A 3P8MC 2JJLA 5AVUB 1KQLA 3H6PA 1PFIA 3IAOA 5JVHW 1VQ5P 1SQXJ 1RF1B 3L75D 1EZVD 3EQ2A 1SQPG 2P58A 3MHVA 5AW9B 1BE3J 1BE3E 2A06E 1FOSE 1VQ8P 4PD4H 1H8AA 1KTMA 1VQMP 1N2DC 4Y28J 3GF3A 2KS1A 1PP9E 1BDCA 2W90A 4EI2A 1L2PA 2WSEH 5GAGa 2KYVA 4U3FJ 1HWTC 4PJ0H 3RBZA 4WFAW 1L0LD 3HUSA 3SSUA 4XFJA 3ZFZA 5DM6W 4QMAA 3RK3B 1EQ7A 1BSNA 5CJ4A 2KZJA 1Q82Q 3SWFA 2WSCH 2N1TB 3CCRW 3Q5PA 4PD4E 4OWFA 2Y9YA 3AE4C 3BRTB 1EDLA 3PTZA 3L72D 2DW3A 4PJ0E 1NO4A 2A45I 1Q82X 1RY3A 3G3ZA 3H1JE 1PGOA 3CC4P 5M18A 1Q90D 2KUBA 1WMKA 1YHQW 3MGNA 4WBAA 1QVGO 5KKZC 2WSCJ 4JQ0D 3A5TA 1HUCA 2HG5D 1GZLA 3D6ZA 1W5CE 3CLQA 2NPSA 1NAFA 1P84D 1IK7A 3S9OA 2D2CC 4YPCA 1Q86Q 1YQ3C 3L35A 1NU1E 1VQ6W 4IO9W 2JR8A 3CCQP 1FAVA 4H0LB 2HODB 1SFCB 1N86A 2B87B 3AEGC 1RH5B 2JWDA 1EZVI 2OYHA 5AW0B 1NTZE 3CMAP 1OMIA 1YITW 1DD3A 3J7ZZ 2PRRA 3IR9A 1KQFB 1L0NG 1S1CX 1PL5A 2KSEA 2E74B 1KILA 1VQLP 1RHZB 3H1HE 3AEFC 2E5YA 3G4SP 1RQVA 2BCCJ 3LW5H 1M56D 2P2UA 3PHLA 4W80A 5CCGD 5APSA 3LIDA 1VQ7W 3VMAA 1CI6B 1G2CA 4H44C 5CCHA 1A02J 3CCSP 5AW8B 1FJKA 4UY8Z 2WPRA 2XNDH 4JF7A 3JCUH 1XTCC 3HTKB 3GQ1A 2AEMA 3GHGB 3L73E 3B4SA 4Y99C 1URQB 1E5WA 2MKVA 1PPJD 3L71E 3L71J 1GTWA 1N73B 1QGKB 3EWKA 1HF9A 4PV1D 1LT9C 3LW5J 2QJYB 2ZT9D 2BEZF 1J1DC 3ZG0A 5KTBA 3Q3DA 1RF1A 2VRSA 5AW1B 1EDKA 3CC7W 3NTNA 3H1ID 3EFGA 3NMDA 1NTMG 3JCUE 3M0DC 1BGYE 3CC2P 3A2AA 5GTHE 1OX3A 1EC5A 1P84I 2CK3H 4ASWA 2P10A 2GM4A 1HJ0A 1VF5D 4IFMA 3H1JD 4C46A 1MWRA 5KJ7C 1SQPD 3IF4A 1KORA 3PP5A 1JY3N 2XV5A 1OZHA 3TNUB 2ZJPW 3C1LA 3GW6A 4N6JA 1EZVG 1IFPA 4I7ZC 1JCCA 2Q1KA 1T2KD 3HE4A 4N78E 1M1KX 1KMIZ 3CWBE 1QEXA 2WWWA 1IFMA 1N7SB 3MIWA 1ZXGA 5CBNA 5KLIB 1W2BV 3GLMA 1LWUB 4GODA 1M1JC 2UWJE 3BASA 1BCCE 5CCGC 4BWNA 3CCRP 4WCEW 4C7NA 2PFXA 4L74A 4HB1A 3KPEA 2HYNA 5M1BA 1SQBG 1J1EC 2G3AA 1ZOYC 2FBWC 2FXMA 1SQVK 4WFBW 3AE1C 2JWAA 1SQQK 3CXHH 1KQSO 4DJGA 4CJNA 2O1JA 3BCCG 4PV1B 1AJYA 1S9KE 1KYOD 4UB8H 1SQXK 3L72G 1NOHA 3B5NB 1K04A 3SFEC 3VP9A 3V5BA 4WF9W 2Q3IA 4JBZA 2HODA 2QEXW 3C8VA 3CMEW 5KLVK 3H32B 3L74E 3L74J 4DCKA 2ZT9C 1MUUA 1FZEA 1SS1A 2ZVOB 1Q7YX 4RKUJ 4BRYB 2FYUE 2XKMA 2FXOA 3L75J 3CXHE 3VMXA 3M06A 1JJ2V 1VQKP 4KT0J 3KDPB 4UB8E 1NAYA 1TU3F 2IZ0A 3CX5D 2WMMA 2QJKC 2K9JB 5AVYB 5AW6B 1LNQA 2KSJA 3Q5SA 3TGUJ 1CI6A 3TGUE 2IYOA 1SLQA 1YITP 2IDBA 5AVQB 1VF5C 1S4XA 1ZRTD 3T97B 1L0LJ 2IYPA 1RQSA 1FZCC 1ZN5A 5GAEa 1JTHB 5APWA 1W2EA 4NPEA 4RJTA 1EXIA 3H1LD 3UIAA 5BU5A 1IO4A 1BGYD 1FZGA 2I1KA 2QSIA 1VQ7P 4I6MC 1UIXA 3FWLA 1VQOW 2JEEA 4D6TE 3CCVW 1FZBA 1X8YA 4U67W 1KFNA 3CPWO 4OGQC 1T2KC 1KV4A 2QRXA 3CCLP 4R4LA 4R4MA 1KB9D 1GU5A 4RO0A 1QL2A 1NHLA 1JMMA 2LXCB 5B66H 3B8EB 3RK3D 5M1AA 2IFNA 1K8AQ 1Q81Q 3GQ0A 3HD7B 2J5UA 2N1TD 3RL0B 4YKAA 2A06G 1BDDA 3RL0g 3FXEA 2QA4P 1JY3P 3AE9C 1KYOI 2AXTH 1PP9G 1YTZI 1Q81X 1IFJA 1KILC 3W7UA 4ZKPA 2Q7CA 2Y9ZA 1K9MQ 5GAHa 4RESB 1L4AD 3RBXA 4I2LC 4W7YA 1NVOA 3TNUA 1PGPA 1LGHB 5APXA 4IFDK 1M57D 3L70E 5H2FH 2Z5HA 2AEJA 1FBMA 3H1IG 1OWAA 1UIIA 4WY4D 1NWQA 5GW7A 3D3IA 1PGQA 1GK4A 1IC2A 2FYNC 1EXJA 1HBWA 1M1JA 1WT6A 2H43A 5CCGA 1YYCA 3CCJW 4IL6H 2E76C 2M3EA 2OYIC 2AXTE 1VQ9P 3CX5I 1NJIX 3O2OA 3D6YA 2OYOA 1SQVE 2K9YA 1LWUA 1SQQE 1SQQJ 3A0BH 2P1JA
chains in the Genus database with same CATH topology
3AE1C 1OW6A 4H0LD 4H0LB 3D70A 4OGQC 1R6QC 1JB0J 2W9RA 4PV1B 1AJYA 3AEGC 4I7ZB 4H44B 3FGAD 4H13D 2WQYC 3O6QA 1MBUC 4R4LA 4H13B 3G3PA 1K04A 2O01J 1RQUA 4R4MA 2JP3A 3RK3E 3SFEC 1NYHA 2E75B 4XFJA 1OW7A 3G19A 2H88C 1OMIA 5KLIC 1DD3A 3H25A 2E76D 1LZWA 3B71A 2WSEJ 3C8VA 3AEBC 1KQFB 1GMJA 3Q5RA 1S1CX 2E74D 1PL5A 3O1FA 2P10A 2E74B 3GQ0A 3O2BA 1HJ0A 1VF5D 2QJYC 4YJXA 1VF5B 2ZT9C 1FDIA 2J5UA 4YJMA 3AECC 3AEFC 3AE7C 1MKMA 1RQVA 3AEAC 4OGQD 3Q5PA 1ZP0C 2NZ2A 2FXPA 4YKAA 3SFDC 3AE4C 3AE8C 4RKUJ 3RL0g 3G9RA 1KORA 2WSFJ 1Y9BA 3AE9C 1MBXC 2D2CD 4H0LC 2D2CB 2E76B 1R6OC 3G1BA 3AE2C 4PV1C 4I7ZC 4H44C 1VL2A 2BEQD 3GW1A 2WPVB 3AEDC 4KT0J 1S5LX 4H13C 4TT3H 1TU3F 1DIPA 2YMKA 2E75C 2QJPC 1K05A 2QJKC 3AEEC 1Q90D 1MBVB 2QIWA 3GMAA 4OGQB 1WMKA 3IN6A 3AE6C 2H89C 3AE3C 3D71A 1ZRTE 1PIXA 4GDOA 1OW8A 3DNJA 3GQ1A 1ZMEC 3Q5SA 1KMIZ 4Z1MH 2E74C 3GF7A 2IDBA 1NGMB 2MKVA 1KILE 1VF5C 1R8EA 3T97B 1DD4A 3IAOA 1RQSA 3GLMA 4IL6X 5KKZC 2WSCJ 3EWKA 1HF9A 2JO1A 1KQGB 4PV1D 2FYNC 4U7JA 5L8RJ 3R4YA 4H44D 3Q1MA 3O1FB 2OQQA 1EXJA 1U57A 3LW5J 3D6ZA 2YIUC 1PV3A 2G8YA 2ZT9D 2BEZF 1EXIA 1IK7A 2ZT9B 2E75D 3AE5C 3S9OA 2D2CC 3ABVC 1YQ3C 3O2HA 2E76C 2V7QJ 1YQ4C 1KTMA 3Q2YA 3O2OA 1FDOA 3D6YA 2K9YA 3Q3DA 1MG9A 2WA9A 2QSIA 1CTFA 5M1BA 1UIXA 3GF3A 4Y28J 2WA8A 4YTPC 4YXDC 2G3AA 1ZOYC 2FBWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQS A;  3GW1 A;  3GQ0 A;  4YJX A;  3O1F B;  1R6Q C;  4YJM A;  2W9R A;  1RQV A;  1MBU C;  3G3P A;  4YKA A;  1MBV B;  1RQU A;  3GQ1 A;  3O2H A;  3G19 A;  3O2O A;  1DD3 A;  1MG9 A;  2WA9 A;  1CTF A;  1MBX C;  1LZW A;  2WA8 A;  1R6O C;  1DD4 A;  3O1F A;  3G1B A;  3O2B A;  3DNJ A; 
#chains in the Genus database with same CATH topology
 4H0L D;  1SQX E;  1SFC D;  3H1J G;  2IBZ D;  1W2B O;  1LTJ B;  3P8C E;  5GAD a;  2Z5I A;  2GUS A;  5KLV E;  5KLV J;  1RF1 C;  1LZW A;  1LTB C;  4AQR D;  3Q5R A;  3O1F A;  1SP4 A;  2E74 D;  2XZR A;  4IFF A;  3L4F A;  4U3F E;  2PP6 A;  2KNC B;  4IL6 E;  3I56 W;  3PH0 A;  2Z4E A;  1NKN A;  3H32 A;  3A0B E;  3V2Q A;  3MTU E;  5EFW B;  1KB9 I;  1VPC A;  5AW2 B;  3F5H A;  3TK1 A;  1L0N K;  1SQB D;  1GK6 A;  4BRY A;  2W8Z A;  2HLO A;  2KLV A;  2PGD A;  4MN4 C;  2OTJ W;  2W6J H;  3BCC D;  1PIX A;  3RK3 C;  1NTZ G;  3MUD C;  1URQ D;  4CPK A;  1YIJ W;  2ZJS E;  3ITK A;  2QEX P;  3CCE W;  2M5A A;  3CME P;  3H1K E;  2N1T C;  3H1K J;  2ZXX A;  2AXC A;  3KXD A;  2K9J A;  3H1H G;  3R4Y A;  3SWY A;  1FZC A;  2W6B A;  2YMY A;  1L4A B;  3ABV C;  1LTG C;  1FDO A;  3DLL W;  4WY4 B;  1U7M A;  1L4A C;  1SQP J;  3ZG5 A;  1LJ2 A;  1K73 Q;  4H13 B;  5C39 A;  4NPD A;  2H8P D;  3VTP C;  3L73 G;  1YI2 W;  3H25 A;  1JY2 O;  5CHX A;  1AFO A;  1NTK D;  3M9Q A;  4ZKU A;  4EDF A;  1NTM K;  2KIK A;  3SFD C;  1Q86 X;  2IBZ I;  2RH0 A;  2YIU B;  3W7X A;  3CCU W;  4H0L C;  1T6A A;  1SFC C;  1VQO P;  1GW3 A;  3E7K A;  3CCV P;  3H1L G;  1IFI A;  2OGU A;  2BCC E;  4UB6 H;  1BGY G;  1U7J A;  2Q6Q A;  4ZMD A;  1S3J A;  1ZME C;  3L37 A;  1LTA C;  2E74 C;  3JSV C;  1N7S D;  1KIL E;  5CBO A;  4IL6 X;  3CX5 H;  1ZW0 A;  1YTZ T;  2KLU A;  4U7J A;  3CL3 D;  4L73 A;  3WUT A;  1H0T A;  1PV3 A;  1YQ4 C;  3M91 A;  2PAJ A;  1SVF A;  4DKI A;  2OYI A;  1BE3 D;  2A06 D;  2WA8 A;  1OVU A;  3USS A;  1OW6 A;  1PP9 D;  4UB6 E;  2O01 N;  3GHG C;  1L0L K;  3B5N D;  3VN0 A;  4U3F D;  1URQ C;  2FYZ A;  2KOG A;  2R32 A;  3CWB G;  4GIF A;  1JNM A;  1N73 C;  1HGZ A;  1AVY A;  2QJY C;  5DJT B;  2LR2 A;  1BCC G;  2AEF A;  3V2P A;  1FJP A;  3CCJ P;  3W67 A;  1BSH A;  1HTL C;  1RF0 C;  4PD4 D;  5AW3 B;  1FU1 A;  2LXB A;  3FWN A;  1L0N J;  2ZFC A;  3AE2 C;  3WU2 H;  3V4W A;  4JYB A;  2KNC A;  2FFD B;  4TT3 H;  3W7W A;  2C0W A;  4DOJ A;  1DIP A;  3VYI A;  2Q5U A;  2A45 H;  5AW5 B;  3O6Q B;  1S5L H;  3MUD A;  1MFZ A;  1R8E A;  1M7L A;  2IBZ G;  1AQ5 A;  1GL2 D;  2N1T A;  2N9Y B;  1LTS C;  4XA4 A;  2R5D A;  2E75 D;  3AE5 C;  3I56 P;  2E42 A;  5AW7 B;  2FYU G;  3Q2Y A;  2YO3 A;  3CF5 W;  2M8R A;  3WU2 E;  1VQ5 W;  4YTP C;  3KYQ A;  3N4X A;  1NU1 D;  3WMM 0;  4C7R A;  3C9I A;  1DX7 A;  1L4A A;  3QWO C;  5APU A;  5KAI H;  1MBU C;  4JPZ B;  1N7S C;  3S1K A;  4WFN W;  1VQM W;  1EDI A;  5KLI C;  4ZNC A;  4WY4 A;  1LWU C;  4BL3 A;  3OJA B;  3CD6 W;  1YIJ P;  1JM0 A;  1NTZ D;  4DZO A;  1IJD B;  1JOC A;  1MZ9 A;  3HD7 D;  1YBK A;  1NTM J;  3AE7 C;  3RL0 D;  4DT0 A;  3AEA C;  1T3U A;  2R44 A;  3H1H D;  3W68 A;  1KC8 Q;  3TYY A;  1XTG B;  1YHQ P;  2GUV A;  4PV1 C;  3PIP W;  1SFC A;  3PJS K;  2B87 A;  2WPV B;  2KS1 B;  3B5N C;  5KAI E;  2V4H A;  2JKV A;  3G71 W;  2ZYG A;  2YKO A;  3WUU A;  1KC8 X;  3HUS B;  4L76 A;  1YI2 P;  3L75 E;  1QVF V;  1VQ6 P;  1EZV E;  1DD4 A;  3L73 D;  5DM7 W;  4PD4 I;  5L8R J;  1PZQ A;  1U57 A;  3CC4 W;  3L71 D;  2N9B A;  1ZR2 A;  3A7O A;  3ZDM A;  5TIS H;  2LKM A;  3V4Q A;  1FDM A;  1NTK G;  3GG2 A;  1KD1 Q;  1MWS A;  2ITA A;  1L0L E;  2YKP A;  1AQT A;  5CA3 A;  1GL2 B;  3FXD A;  1JB0 J;  2O3J A;  3HTK A;  3GHG A;  4LC1 A;  1VQP W;  4LLH A;  1QVG V;  1URQ A;  2E75 B;  3L70 G;  1KFM A;  3CCQ W;  1N73 A;  5AVT B;  1SQB J;  3B71 A;  1KD1 X;  1YJN W;  3BCC J;  3AEC C;  2IFM A;  1P84 H;  1MKM A;  3L72 J;  4CPG A;  2IX7 C;  5TIS E;  1SQP K;  3F89 A;  2NPS B;  1SQV G;  1RF0 A;  1D7M A;  4HKZ H;  1VQL W;  4IOA W;  1JY2 N;  2HR3 A;  1SQX G;  1S5L X;  3U1C A;  5APT A;  3G4S W;  3HRN A;  1BE3 G;  2WTY A;  3RK2 B;  3N7N A;  2Y0D A;  2M0B A;  3HD7 C;  1NGM B;  2OYH B;  2NRG A;  4N78 D;  1K8A X;  3CWB D;  2C9L Y;  2SPZ A;  3RL0 C;  1P84 E;  2JO1 A;  2MJZ A;  3E1I A;  3CC7 P;  4U3F G;  2POH A;  2QVA A;  4HYT B;  4WVZ A;  2OTL W;  2QM8 A;  2RN0 A;  5B66 E;  2XNX A;  1BCC D;  2WSS H;  3EFF K;  3KQG A;  2WA9 A;  1JO5 A;  3CCM W;  2ZAE B;  1VQ4 W;  1FZA A;  3G6E W;  3CI9 A;  3DNJ A;  1IFN A;  1ZLL A;  1G2C B;  3MD0 A;  3D70 A;  4EYY Q;  2K37 A;  1K9M X;  4H13 D;  2BAS A;  2WQY C;  2WIT A;  2JP3 A;  4O9B A;  1NYH A;  2QJP B;  1N7S A;  1S9K D;  5AVR B;  1MWU A;  1J2J B;  2YXQ B;  2WT7 B;  3L74 D;  1GW4 A;  3TDK A;  2J59 M;  2C0X A;  5BU8 B;  5H2F E;  4WWI A;  1OIP A;  3W7T A;  1S2E A;  1LTJ C;  2FYU D;  2YNY A;  3WUV A;  3P32 A;  3I55 W;  2KXP B;  3M9B A;  5AVV B;  1RE4 A;  3B5N A;  3CXH D;  2YMK A;  5E79 H;  3AEE C;  3GMA A;  3D71 A;  4GDO A;  1PPJ E;  5APV A;  4Z1M H;  1NU1 G;  5TJH A;  1PP9 J;  3CD6 P;  2OTK E;  3TGU D;  1CSB A;  4KHX A;  4H44 D;  3FX0 A;  2Y0E A;  4LGD E;  3OA7 A;  3HE5 B;  1N8R Q;  1USE A;  1X79 B;  3H1I E;  3H1I J;  2XDJ A;  1DEE G;  1MV8 A;  3PIO W;  1QVF O;  4AUW A;  4GKG A;  1Y8A A;  5E79 E;  2FKW B;  3U1A A;  4D6T D;  3MP7 B;  3G71 P;  5APY A;  4M3L A;  2BCC G;  1VQN W;  1HGV A;  1N8R X;  1YJW W;  3T97 A;  3VOP A;  3HE4 B;  2WSE J;  3AEB C;  1GL2 A;  3E1R A;  1JTH A;  1IZN B;  1OXZ A;  3H1J J;  2IZ1 A;  1MWT A;  4YJM A;  1SQP E;  1MFT A;  5KKZ B;  2FXP A;  2QG4 A;  3QH9 A;  3KHU A;  4WY4 C;  1KQS V;  3A3Y B;  4C7N B;  1JMB A;  2D2C B;  5HL7 W;  3L71 G;  1HJB A;  1JY2 P;  1LTT C;  4H13 C;  2B9B A;  1KYO H;  1K73 X;  2FY8 A;  2L91 A;  2K1A A;  1YJ9 W;  1VQP P;  3IN6 A;  1G1J A;  2O01 H;  1NU1 J;  3GF7 A;  5KJ7 D;  1RE3 C;  3HD7 A;  1VQK W;  3L70 D;  1DEB A;  1S72 W;  2Y0C A;  1YJN P;  1KQG B;  3Q1M A;  1T3J A;  2YIU C;  3R2P A;  2WVR A;  1AV1 A;  1KN7 A;  1CZQ A;  1NTZ J;  3CXH I;  2KP8 A;  2Q3E A;  2KI7 B;  1OFC X;  1KYO E;  1SQV D;  4KJM A;  1SQQ D;  3H1H J;  3MZW B;  1Y47 A;  2KZI A;  2B88 A;  1AA0 A;  4H44 B;  1SQX D;  2O01 J;  1RQU A;  1NKZ B;  1H88 A;  4A7P A;  3P8C D;  3TSI A;  1OW7 A;  1FOS F;  2H88 C;  1LP1 B;  4K3A A;  3OW2 V;  2FYU K;  5KLV D;  4Y99 B;  2KB7 P;  3CCL W;  4GOE A;  2K88 A;  5GTI H;  2NZ2 A;  2OTL P;  1X9V A;  2P67 A;  2E5T A;  5AVW B;  1LT9 B;  1R5L A;  3G9R A;  3L73 J;  2WT7 A;  1AVO A;  5GTH H;  2WPS A;  3CCM P;  1T8Z A;  1VQ4 P;  3CPW V;  1J1D B;  2GA1 A;  3CX5 E;  3G6E P;  1VL2 A;  1HVV A;  1LTJ A;  3AED C;  3I5C A;  1SQB K;  2A45 G;  1KB9 H;  2QA4 W;  3RGU A;  1ZRT E;  1OVV A;  4TLF A;  1N7L A;  2C9N Y;  1L0N E;  1G1I A;  1H89 A;  2YKQ A;  3PRJ A;  5GTI E;  2OQQ A;  3H1L J;  3H1L E;  2HPC B;  3H1K D;  1FE6 A;  3K5B A;  1BGY J;  2W83 C;  3O2H A;  1OVR A;  2JDI H;  4IOI H;  5CJ0 A;  3BRV B;  1MG9 A;  2P7J A;  3S4R A;  2FFD C;  4YXD C;  3L74 G;  1KB9 E;  3I55 P;  1EDJ A;  2W9R A;  4I7Z B;  5M19 A;  3G3P A;  3HE5 A;  3RK3 E;  1X22 A;  1VQ9 W;  1M1K Q;  5B5E H;  5JVG W;  3L75 G;  2W27 A;  2ZYA A;  5CMZ A;  1GD2 E;  3JC2 2;  1GMJ A;  1NTK K;  1FDI A;  5BVZ A;  4N3Y B;  4WB4 A;  2H7H A;  4OGQ D;  3P7K A;  1M1J B;  2NPS D;  1VQ8 W;  1S5L E;  2OTJ P;  4B86 A;  3CWB J;  1VDF A;  4JYC A;  3TGU G;  2J58 A;  3LIE A;  1R5S A;  1GU4 A;  1LT1 A;  3O8Z A;  3PLN A;  3CCE P;  2BEQ D;  1JUN A;  1L0L G;  2RMZ A;  3W7S A;  2CPB A;  3OAK A;  1BCC J;  4OVN F;  1J1E B;  1NTM E;  4AYC A;  3II6 A;  2QIW A;  5B5E E;  1VQN P;  2RKL A;  3AE6 C;  1OW8 A;  3RK2 D;  1KZU B;  1YJW P;  1ZR4 A;  2BCC D;  1QX8 A;  3VMZ A;  2ZJQ W;  1RE3 A;  4D6T G;  3V2R A;  1Q2N A;  3O1F B;  1RE4 C;  1KIL D;  4GOF A;  1A02 F;  3KZI H;  2G8Y A;  1IK9 A;  1IFD A;  1Q7Y Q;  2ZT9 B;  1Z56 A;  2ZVN B;  5K5G B;  2ZJR W;  2WSF H;  2IBZ E;  1QL1 A;  2YO2 A;  5CCH D;  2OAR A;  3HUS C;  3FGA D;  1ZV8 A;  4L75 A;  2B89 A;  1YJ9 P;  3VP8 A;  2FYU J;  3G19 A;  2CPS A;  3VMY A;  2QJK B;  2QM7 A;  5AVZ B;  2R5B A;  1JCD A;  2I1J A;  2E76 D;  4ASV A;  3CCU P;  4NPF X;  4YXW H;  4XE5 B;  1NH4 A;  4OH8 B;  5KAF H;  1S72 P;  4YJX A;  2M5A B;  3KZI E;  3NXS A;  1VF5 B;  1QLE D;  3L36 A;  1FZC B;  1ZP0 C;  1GDT A;  1LP1 A;  3AE8 C;  2Q9I A;  2WSF J;  1Y9B A;  3V2N A;  2V7Q H;  2HFE D;  1GL2 C;  1SQB E;  1R6O C;  3G1B A;  4IOC W;  3IFM A;  3SWK A;  3OW2 O;  3GW1 A;  4EIJ A;  1L0N D;  2WPQ A;  3A0H H;  3BCC E;  1LT9 A;  2E75 C;  5AW4 B;  4K35 A;  3L72 E;  4I1L A;  4OGQ B;  3AE3 C;  5DJU B;  3CMA W;  3TF5 A;  3M9H A;  1SQQ G;  1M8O B;  5KAF E;  4D6T J;  5APQ A;  3V6I A;  1M90 Q;  2NPS C;  1CW5 A;  2ZXE B;  2E43 A;  4HH2 A;  3BVH A;  3M0D A;  2M3B A;  2V7Q J;  5KLV G;  1DH3 A;  1WRG A;  4BXL A;  1E79 H;  5AVX B;  1CTF A;  1JEK A;  2O1K A;  2FFD A;  1PGJ A;  3O2B A;  2HPC A;  1NU1 K;  2YXR B;  3A0H E;  3CCS W;  2R3C A;  1M90 X;  1R6Q C;  2I8D A;  4BL2 A;  1KIL B;  3RK2 C;  1JY3 O;  3O6Q A;  2OYH C;  1BXY A;  5KJ7 A;  1PPJ G;  4GT1 A;  1FZF A;  1NTK E;  1NTK J;  1NTZ K;  2ZYD A;  1FC2 C;  3M0A A;  1VQQ A;  2WZ7 A;  4W7Z A;  2L5G B;  3U59 A;  2IPP A;  2FYN B;  1NTM D;  1H0T B;  2R3S A;  3L70 J;  2W6A A;  1NJI Q;  1MBX C;  2D2C D;  3NFQ A;  5CCH C;  2E76 B;  2OYI B;  5AVS B;  3BAT A;  4EOT A;  3H1K G;  2KK7 A;  4HJG H;  3CXC V;  2QE7 H;  2QJP C;  1K05 A;  1HH0 A;  1FS0 E;  1MBV B;  3CC2 W;  2H89 C;  2K3R A;  1X0T A;  1SQV J;  1LTI C;  1USD A;  2XU6 A;  3P8M C;  2JJL A;  5AVU B;  1KQL A;  3H6P A;  1PFI A;  3IAO A;  5JVH W;  1VQ5 P;  1SQX J;  1RF1 B;  3L75 D;  1EZV D;  3EQ2 A;  1SQP G;  2P58 A;  3MHV A;  5AW9 B;  1BE3 J;  1BE3 E;  2A06 E;  1FOS E;  1VQ8 P;  4PD4 H;  1H8A A;  1KTM A;  1VQM P;  1N2D C;  4Y28 J;  3GF3 A;  2KS1 A;  1PP9 E;  1BDC A;  2W90 A;  4EI2 A;  1L2P A;  2WSE H;  5GAG a;  2KYV A;  4U3F J;  1HWT C;  4PJ0 H;  3RBZ A;  4WFA W;  1L0L D;  3HUS A;  3SSU A;  4XFJ A;  3ZFZ A;  5DM6 W;  4QMA A;  3RK3 B;  1EQ7 A;  1BSN A;  5CJ4 A;  2KZJ A;  1Q82 Q;  3SWF A;  2WSC H;  2N1T B;  3CCR W;  3Q5P A;  4PD4 E;  4OWF A;  2Y9Y A;  3AE4 C;  3BRT B;  1EDL A;  3PTZ A;  3L72 D;  2DW3 A;  4PJ0 E;  1NO4 A;  2A45 I;  1Q82 X;  1RY3 A;  3G3Z A;  3H1J E;  1PGO A;  3CC4 P;  5M18 A;  1Q90 D;  2KUB A;  1WMK A;  1YHQ W;  3MGN A;  4WBA A;  1QVG O;  5KKZ C;  2WSC J;  4JQ0 D;  3A5T A;  1HUC A;  2HG5 D;  1GZL A;  3D6Z A;  1W5C E;  3CLQ A;  2NPS A;  1NAF A;  1P84 D;  1IK7 A;  3S9O A;  2D2C C;  4YPC A;  1Q86 Q;  1YQ3 C;  3L35 A;  1NU1 E;  1VQ6 W;  4IO9 W;  2JR8 A;  3CCQ P;  1FAV A;  4H0L B;  2HOD B;  1SFC B;  1N86 A;  2B87 B;  3AEG C;  1RH5 B;  2JWD A;  1EZV I;  2OYH A;  5AW0 B;  1NTZ E;  3CMA P;  1OMI A;  1YIT W;  1DD3 A;  3J7Z Z;  2PRR A;  3IR9 A;  1KQF B;  1L0N G;  1S1C X;  1PL5 A;  2KSE A;  2E74 B;  1KIL A;  1VQL P;  1RHZ B;  3H1H E;  3AEF C;  2E5Y A;  3G4S P;  1RQV A;  2BCC J;  3LW5 H;  1M56 D;  2P2U A;  3PHL A;  4W80 A;  5CCG D;  5APS A;  3LID A;  1VQ7 W;  3VMA A;  1CI6 B;  1G2C A;  4H44 C;  5CCH A;  1A02 J;  3CCS P;  5AW8 B;  1FJK A;  4UY8 Z;  2WPR A;  2XND H;  4JF7 A;  3JCU H;  1XTC C;  3HTK B;  3GQ1 A;  2AEM A;  3GHG B;  3L73 E;  3B4S A;  4Y99 C;  1URQ B;  1E5W A;  2MKV A;  1PPJ D;  3L71 E;  3L71 J;  1GTW A;  1N73 B;  1QGK B;  3EWK A;  1HF9 A;  4PV1 D;  1LT9 C;  3LW5 J;  2QJY B;  2ZT9 D;  2BEZ F;  1J1D C;  3ZG0 A;  5KTB A;  3Q3D A;  1RF1 A;  2VRS A;  5AW1 B;  1EDK A;  3CC7 W;  3NTN A;  3H1I D;  3EFG A;  3NMD A;  1NTM G;  3JCU E;  3M0D C;  1BGY E;  3CC2 P;  3A2A A;  5GTH E;  1OX3 A;  1EC5 A;  1P84 I;  2CK3 H;  4ASW A;  2P10 A;  2GM4 A;  1HJ0 A;  1VF5 D;  4IFM A;  3H1J D;  4C46 A;  1MWR A;  5KJ7 C;  1SQP D;  3IF4 A;  1KOR A;  3PP5 A;  1JY3 N;  2XV5 A;  1OZH A;  3TNU B;  2ZJP W;  3C1L A;  3GW6 A;  4N6J A;  1EZV G;  1IFP A;  4I7Z C;  1JCC A;  2Q1K A;  1T2K D;  3HE4 A;  4N78 E;  1M1K X;  1KMI Z;  3CWB E;  1QEX A;  2WWW A;  1IFM A;  1N7S B;  3MIW A;  1ZXG A;  5CBN A;  5KLI B;  1W2B V;  3GLM A;  1LWU B;  4GOD A;  1M1J C;  2UWJ E;  3BAS A;  1BCC E;  5CCG C;  4BWN A;  3CCR P;  4WCE W;  4C7N A;  2PFX A;  4L74 A;  4HB1 A;  3KPE A;  2HYN A;  5M1B A;  1SQB G;  1J1E C;  2G3A A;  1ZOY C;  2FBW C;  2FXM A;  1SQV K;  4WFB W;  3AE1 C;  2JWA A;  1SQQ K;  3CXH H;  1KQS O;  4DJG A;  4CJN A;  2O1J A;  3BCC G;  4PV1 B;  1AJY A;  1S9K E;  1KYO D;  4UB8 H;  1SQX K;  3L72 G;  1NOH A;  3B5N B;  1K04 A;  3SFE C;  3VP9 A;  3V5B A;  4WF9 W;  2Q3I A;  4JBZ A;  2HOD A;  2QEX W;  3C8V A;  3CME W;  5KLV K;  3H32 B;  3L74 E;  3L74 J;  4DCK A;  2ZT9 C;  1MUU A;  1FZE A;  1SS1 A;  2ZVO B;  1Q7Y X;  4RKU J;  4BRY B;  2FYU E;  2XKM A;  2FXO A;  3L75 J;  3CXH E;  3VMX A;  3M06 A;  1JJ2 V;  1VQK P;  4KT0 J;  3KDP B;  4UB8 E;  1NAY A;  1TU3 F;  2IZ0 A;  3CX5 D;  2WMM A;  2QJK C;  2K9J B;  5AVY B;  5AW6 B;  1LNQ A;  2KSJ A;  3Q5S A;  3TGU J;  1CI6 A;  3TGU E;  2IYO A;  1SLQ A;  1YIT P;  2IDB A;  5AVQ B;  1VF5 C;  1S4X A;  1ZRT D;  3T97 B;  1L0L J;  2IYP A;  1RQS A;  1FZC C;  1ZN5 A;  5GAE a;  1JTH B;  5APW A;  1W2E A;  4NPE A;  4RJT A;  1EXI A;  3H1L D;  3UIA A;  5BU5 A;  1IO4 A;  1BGY D;  1FZG A;  2I1K A;  2QSI A;  1VQ7 P;  4I6M C;  1UIX A;  3FWL A;  1VQO W;  2JEE A;  4D6T E;  3CCV W;  1FZB A;  1X8Y A;  4U67 W;  1KFN A;  3CPW O;  4OGQ C;  1T2K C;  1KV4 A;  2QRX A;  3CCL P;  4R4L A;  4R4M A;  1KB9 D;  1GU5 A;  4RO0 A;  1QL2 A;  1NHL A;  1JMM A;  2LXC B;  5B66 H;  3B8E B;  3RK3 D;  5M1A A;  2IFN A;  1K8A Q;  1Q81 Q;  3GQ0 A;  3HD7 B;  2J5U A;  2N1T D;  3RL0 B;  4YKA A;  2A06 G;  1BDD A;  3RL0 g;  3FXE A;  2QA4 P;  1JY3 P;  3AE9 C;  1KYO I;  2AXT H;  1PP9 G;  1YTZ I;  1Q81 X;  1IFJ A;  1KIL C;  3W7U A;  4ZKP A;  2Q7C A;  2Y9Z A;  1K9M Q;  5GAH a;  4RES B;  1L4A D;  3RBX A;  4I2L C;  4W7Y A;  1NVO A;  3TNU A;  1PGP A;  1LGH B;  5APX A;  4IFD K;  1M57 D;  3L70 E;  5H2F H;  2Z5H A;  2AEJ A;  1FBM A;  3H1I G;  1OWA A;  1UII A;  4WY4 D;  1NWQ A;  5GW7 A;  3D3I A;  1PGQ A;  1GK4 A;  1IC2 A;  2FYN C;  1EXJ A;  1HBW A;  1M1J A;  1WT6 A;  2H43 A;  5CCG A;  1YYC A;  3CCJ W;  4IL6 H;  2E76 C;  2M3E A;  2OYI C;  2AXT E;  1VQ9 P;  3CX5 I;  1NJI X;  3O2O A;  3D6Y A;  2OYO A;  1SQV E;  2K9Y A;  1LWU A;  1SQQ E;  1SQQ J;  3A0B H;  2P1J A; 
#chains in the Genus database with same CATH homology
 3AE1 C;  1OW6 A;  4H0L D;  4H0L B;  3D70 A;  4OGQ C;  1R6Q C;  1JB0 J;  2W9R A;  4PV1 B;  1AJY A;  3AEG C;  4I7Z B;  4H44 B;  3FGA D;  4H13 D;  2WQY C;  3O6Q A;  1MBU C;  4R4L A;  4H13 B;  3G3P A;  1K04 A;  2O01 J;  1RQU A;  4R4M A;  2JP3 A;  3RK3 E;  3SFE C;  1NYH A;  2E75 B;  4XFJ A;  1OW7 A;  3G19 A;  2H88 C;  1OMI A;  5KLI C;  1DD3 A;  3H25 A;  2E76 D;  1LZW A;  3B71 A;  2WSE J;  3C8V A;  3AEB C;  1KQF B;  1GMJ A;  3Q5R A;  1S1C X;  2E74 D;  1PL5 A;  3O1F A;  2P10 A;  2E74 B;  3GQ0 A;  3O2B A;  1HJ0 A;  1VF5 D;  2QJY C;  4YJX A;  1VF5 B;  2ZT9 C;  1FDI A;  2J5U A;  4YJM A;  3AEC C;  3AEF C;  3AE7 C;  1MKM A;  1RQV A;  3AEA C;  4OGQ D;  3Q5P A;  1ZP0 C;  2NZ2 A;  2FXP A;  4YKA A;  3SFD C;  3AE4 C;  3AE8 C;  4RKU J;  3RL0 g;  3G9R A;  1KOR A;  2WSF J;  1Y9B A;  3AE9 C;  1MBX C;  2D2C D;  4H0L C;  2D2C B;  2E76 B;  1R6O C;  3G1B A;  3AE2 C;  4PV1 C;  4I7Z C;  4H44 C;  1VL2 A;  2BEQ D;  3GW1 A;  2WPV B;  3AED C;  4KT0 J;  1S5L X;  4H13 C;  4TT3 H;  1TU3 F;  1DIP A;  2YMK A;  2E75 C;  2QJP C;  1K05 A;  2QJK C;  3AEE C;  1Q90 D;  1MBV B;  2QIW A;  3GMA A;  4OGQ B;  1WMK A;  3IN6 A;  3AE6 C;  2H89 C;  3AE3 C;  3D71 A;  1ZRT E;  1PIX A;  4GDO A;  1OW8 A;  3DNJ A;  3GQ1 A;  1ZME C;  3Q5S A;  1KMI Z;  4Z1M H;  2E74 C;  3GF7 A;  2IDB A;  1NGM B;  2MKV A;  1KIL E;  1VF5 C;  1R8E A;  3T97 B;  1DD4 A;  3IAO A;  1RQS A;  3GLM A;  4IL6 X;  5KKZ C;  2WSC J;  3EWK A;  1HF9 A;  2JO1 A;  1KQG B;  4PV1 D;  2FYN C;  4U7J A;  5L8R J;  3R4Y A;  4H44 D;  3Q1M A;  3O1F B;  2OQQ A;  1EXJ A;  1U57 A;  3LW5 J;  3D6Z A;  2YIU C;  1PV3 A;  2G8Y A;  2ZT9 D;  2BEZ F;  1EXI A;  1IK7 A;  2ZT9 B;  2E75 D;  3AE5 C;  3S9O A;  2D2C C;  3ABV C;  1YQ3 C;  3O2H A;  2E76 C;  2V7Q J;  1YQ4 C;  1KTM A;  3Q2Y A;  3O2O A;  1FDO A;  3D6Y A;  2K9Y A;  3Q3D A;  1MG9 A;  2WA9 A;  2QSI A;  1CTF A;  5M1B A;  1UIX A;  3GF3 A;  4Y28 J;  2WA8 A;  4YTP C;  4YXD C;  2G3A A;  1ZOY C;  2FBW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...