1RQUA

Nmr structure of l7 dimer from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 50S ribosomal protein L7/L12
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rquA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rquA02
1MBUC 1MG9A 1DD4A 3GQ0A 2W9RA 1R6OC 1RQUA 3GQ1A 1MBXC 1DD3A 3O2BA 3G3PA 1CTFA 3O2HA 1R6QC 3G1BA 4YJXA 2WA9A 3O1FB 4YJMA 1RQSA 3G19A 3O2OA 1MBVB 1RQVA 2WA8A 4YKAA 3GW1A 3O1FA 1LZWA 3DNJA
chains in the Genus database with same CATH superfamily
1L0LK 1Y47A 3CC4W 5GTHE 3FXEA 2M3EA 3H1IG 1DH3A 2JWAA 3TDKA 3H1ID 5KKZC 5CCGC 2YO2A 3LW5H 3CMEP 4YJMA 4C46A 3G4SP 2QA4W 3JC22 2A45I 1JB0J 2QE7H 3CMAW 3JSVC 2V4HA 1NJIQ 2ZT9C 1JUNA 3HE5B 3AE6C 3G71P 4WFNW 1M1KX 1NKNA 1VF5D 3CI9A 1NGMB 5CMZA 2O01H 1EXIA 2WT7B 2ZVOB 5CBOA 3BRVB 3B5ND 3L74G 3SWKA 1M56D 1RQUA 2B88A 3KZIE 1YI2W 1SS1A 1R5SA 3Q1MA 3CCUP 1A02F 1QVGV 2O01J 4N3YB 1SQXE 3ZFZA 3CCLP 5HL7W 5KLVD 3II6A 1EZVD 1S1CX 1GU4A 3CWBD 5AVSB 4CPGA 1R6OC 1PV3A 3H1HE 2MKVA 2PP6A 2Y9YA 2NPSD 4DZOA 2XNXA 3CMEW 1LTBC 4RESB 1SQXK 1WMKA 2KB7P 1VQLW 2FYUE 2WPSA 3WU2E 3L73G 1LTJA 1KV4A 1DD4A 1SQBK 4AYCA 1EDKA 2WMMA 2OTLP 1AV1A 3AE7C 1LTJC 4HB1A 1IO4A 4H0LB 4MN4C 3JCUE 3S4RA 1HGZA 1MG9A 3H1LG 4ZNCA 1VQ8P 3AE1C 3SSUA 5APTA 1MV8A 2WPQA 3O2BA 2O01N 3RL0B 3CCEP 3EWKA 1P84D 3M0AA 1VQLP 3OW2V 3EQ2A 3RL0g 4ASVA 2Q6QA 5CJ0A 1NTZK 3HD7C 3OJAB 1OIPA 4IOIH 4W7ZA 1N73C 1PL5A 4H0LD 1U7MA 2E43A 2QG4A 2K88A 3HD7A 3L36A 3ZG5A 3CC4P 5H2FH 1N7SD 1OVVA 1MWRA 1ZLLA 4JBZA 3GG2A 5DJTB 4CPKA 3H25A 2D2CD 2OTLW 3CCRP 1URQD 1VQOW 1BSNA 3RK3D 3H32A 1MWSA 2GUVA 2IPPA 2A45H 2HG5D 4WY4B 3V2NA 5DM7W 3Q3DA 2LR2A 1PPJD 1U7JA 2Y0EA 3QH9A 1HH0A 1DX7A 2BCCG 3DLLW 1BE3D 2FXOA 3GHGB 5KLVJ 4IOCW 1SQXD 4WF9W 2E74D 1FOSF 2IBZD 2WSSH 1YQ4C 3HE4A 2HODA 2OTKE 2P7JA 3ITKA 2W8ZA 3SWYA 1T2KC 4UB6E 2SPZA 2M3BA 1ZMEC 3CCLW 1IFMA 4I1LA 1NHLA 3G19A 3GLMA 4PV1C 2E76B 3U1AA 3CLQA 1KILB 3FX0A 1FJPA 4PV1D 1FBMA 3CF5W 5KAIH 1VQOP 3JCUH 1UIIA 3D6YA 3AEEC 3O2OA 1W2EA 3VP8A 1M1JB 1E79H 3L72D 3U59A 1SQPG 1YYCA 1HJBA 2A06G 3LW5J 1SQQG 1VF5B 1NTZD 2KIKA 4ZKUA 1VQPW 5L8RJ 3GHGC 2C9LY 1SQQD 1NTZG 2BEZF 1GL2B 2C0XA 1U57A 3CPWO 2I8DA 1FC2C 4XFJA 3MUDC 2KS1B 2Z4EA 1YJWW 2YMYA 1VQ8W 4YXWH 4B86A 5KLIB 3AE8C 1YHQW 3HUSC 5KJ7D 3G4SW 4IFFA 1NTKG 1KYOI 1SFCB 1UIXA 3AEBC 4KJMA 1J1DC 4GOFA 3CCSW 4KHXA 3WU2H 3CXHD 4Z1MH 1D7MA 2FYUG 2BASA 2OYHC 1SQBG 4GT1A 3L72E 2N9YB 4H0LC 1HF9A 1LP1A 5GAEa 1LWUB 2Q5UA 1R8EA 1LJ2A 4RKUJ 3DNJA 2Z5IA 1JY2O 3RL0C 1DIPA 2KSJA 5GTHH 2FY8A 1KMIZ 4DKIA 4U7JA 1S2EA 2J58A 4TLFA 5KAFE 1IFDA 4UB8E 2XV5A 5BU5A 2ZJRW 4BWNA 1JO5A 4EIJA 5APUA 2B87B 1LWUA 4PD4E 3W7SA 4BL3A 2WQYC 4WY4D 2P67A 5APQA 1FZGA 3CWBG 3CL3D 3RK2C 2IBZE 4OGQD 5JVHW 4NPFX 2W6BA 1GL2D 3OAKA 1EDIA 3H1KD 1Q86X 5AW9B 1A02J 1L0LD 3VMZA 1T6AA 1LT1A 1NU1K 1Q82Q 5CCHD 3A0HH 1ZV8A 1N7SA 3RK3E 2E42A 3PIOW 4D6TG 4OGQB 1XTCC 2RH0A 3MP7B 4PD4H 3IF4A 3CXCV 3R4YA 3EFFK 2MJZA 1N2DC 4W80A 3HUSB 3HRNA 2D2CB 3H1LD 2HPCA 3KDPB 1BCCG 3L75D 1FAVA 3C1LA 2FFDA 3WUTA 4D6TJ 4ZKPA 3L75G 1JTHA 3VMXA 2BCCE 1CSBA 1OVUA 1H0TA 2R5DA 1FZCC 4JYBA 4LGDE 3MIWA 2IZ0A 1VQ9W 1P84E 1QGKB 1JMBA 3VP9A 4YTPC 1KILE 5AVUB 2OYOA 4GKGA 3BCCE 2M8RA 4PD4D 5AW7B 2PGDA 1RF0C 1DEBA 1LTIC 1KN7A 1HGVA 1M1JC 3VOPA 3N4XA 4PV1B 2KNCB 3ABVC 1KYOH 4BL2A 1BSHA 1SP4A 1MWTA 2AEMA 4U3FE 5CA3A 4PJ0E 4N78D 1VDFA 3RK2B 2WSCH 4K35A 3UIAA 1VQKP 2WA9A 3O6QA 1P84H 2W90A 5CHXA 3CCVP 2YMKA 4CJNA 2BEQD 1BE3G 5DJUB 1JJ2V 1SQBJ 5GAHa 1QL2A 5GTIH 3PH0A 1RY3A 2JEEA 4H44D 4BRYB 4JPZB 3TSIA 3MUDA 2Q3EA 1NTKE 4HJGH 2JP3A 4YPCA 3GQ0A 1EC5A 1M90X 5AW1B 2Z5HA 3BATA 1M90Q 1EZVG 3D71A 2M0BA 3V6IA 1K04A 3L72G 3H1HG 3HD7B 4AUWA 1DEEG 3NFQA 3P8CE 4A7PA 1VQKW 3Q2YA 3H1JG 1YI2P 5B66H 4LLHA 2WWWA 2XZRA 1H8AA 2ZYGA 1YTZI 1X79B 4PD4I 2W9RA 1MFTA 1PFIA 3L70D 3OA7A 2K37A 2WSFH 3CCSP 4YJXA 1BCCE 1URQC 1IK7A 2FBWC 4IL6H 1LTSC 3P8CD 4IFMA 1QEXA 3I55W 4RO0A 1KFNA 2GA1A 1VQ9P 1G1JA 3TYYA 2IX7C 3W7WA 2QVAA 3RBXA 1LT9A 3GF3A 2J5UA 2V7QH 5CBNA 1MBUC 3C9IA 2ZVNB 1ZRTE 3VN0A 3D3IA 5B5EH 2IYOA 3HE5A 2IFNA 1JCDA 3RBZA 3M9QA 3AE5C 4W7YA 3C8VA 1N7SC 4N78E 3FGAD 1SQQK 1KD1Q 5BU8B 5AVRB 1RF1B 1SQVK 2QSIA 1KQSO 3IFMA 4XE5B 2FYUJ 1RHZB 1X8YA 1Q7YQ 3VMYA 1Q7YX 1EDJA 1GTWA 3H1HJ 1P84I 3MZWB 3B5NA 1JY2P 1GK6A 1J2JB 4UB6H 1QVFO 2YIUC 1FDMA 1BDCA 1SQXJ 1IFJA 2H89C 2QJKC 2K9YA 3CCMW 2FYNB 3V2QA 5KKZB 3S9OA 3CCRW 2H7HA 3P32A 4WWIA 3VTPC 3TK1A 1SQQJ 3KZIH 1BGYE 2N1TA 1CTFA 1L4AD 3AEGC 4L76A 2WITA 1JOCA 3O1FB 4WCEW 4NPDA 1ZR4A 1JNMA 1M7LA 1GL2C 4H13B 3U1CA 3LIEA 1L0ND 2OQQA 3SWFA 4HYTB 1L0NG 3HTKA 3B5NC 1NOHA 1SFCD 1FZCB 3O2HA 1SQPE 3L73J 4K3AA 1LTAC 3FWLA 1NU1D 3E1IA 3T97B 1JY2N 1SQPD 3GW1A 3CWBE 3KYQA 3GW6A 3O1FA 4H13D 4R4MA 5TISH 1NTKK 1PP9D 2A06D 2QM8A 4EYYQ 4TT3H 3O6QB 1USDA 3ZDMA 5B66E 1VQ6W 2R3SA 3M9BA 1K8AX 1AJYA 4WFAW 3W7UA 3CCMP 2YO3A 1K8AQ 5EFWB 1G2CB 3A0BE 5KAFH 3CX5E 5M1BA 4BRYA 3CX5H 3AEDC 1FZEA 2K9JA 3AE4C 3T97A 1RE3C 2E76D 3I55P 1ZR2A 3IN6A 3B4SA 2AXTH 1Y9BA 4R4LA 3CCVW 1LT9C 2KZIA 2KLUA 3AECC 1M1JA 3E1RA 4XA4A 3CC7W 4RJTA 1KORA 1S72W 2ZT9D 2CPSA 2YKOA 3NTNA 2KOGA 3J7ZZ 1IZNB 3LIDA 1OW8A 3M0DC 2FYUD 1TU3F 3G3ZA 5CCGD 1VQ5W 1M1KQ 2GM4A 3CC2P 3V4QA 1YJNP 3AE3C 1NU1E 2OARA 1SQBE 2ZFCA 3Q5SA 2QA4P 1KB9E 2LXCB 1YTZT 4L73A 3D6ZA 2JDIH 4L74A 4GDOA 1GU5A 2VRSA 2WSEH 1RH5B 1NO4A 1H0TB 5CJ4A 2I1KA 2OYIB 2YNYA 2R5BA 1AQ5A 3H1IJ 3L71J 4C7RA 5KLIC 1L4AA 1EXJA 2QIWA 2N1TD 2OTJP 2POHA 4IOAW 4DCKA 1CI6B 3Q5RA 1JY3O 1JM0A 3L35A 2HLOA 1LT9B 4H13C 1KFMA 2LXBA 1VQ5P 2O1JA 4EOTA 1BXYA 3M0DA 1GW4A 1J1EC 2WSFJ 3CPWV 2HODB 5AVWB 2P10A 4NPEA 1VQNW 1MUUA 1IFPA 4DT0A 3H1HD 3H1LJ 2QEXW 2WT7A 2CK3H 2FKWB 2XNDH 1FZAA 1ZW0A 2E5YA 1PZQA 1CI6A 1VQ7W 3TGUE 3H1JD 2JO1A 3A2AA 4C7NB 3H1KG 1Q86Q 2NZ2A 4HH2A 4OWFA 1YITW 2KYVA 3L71E 3CC2W 2QM7A 1BGYG 3GQ1A 1QVFV 3PRJA 2BCCJ 1VQMP 1J1EB 5AW5B 1AVOA 4OGQC 1GL2A 2YIUB 1S3JA 3RK2D 1KILA 3PIPW 1SQPK 3AE9C 1NU1J 3AEFC 5M19A 3L70E 1NTZE 2JR8A 1KB9D 1S5LH 2J59M 1NH4A 3BRTB 1R6QC 5JVGW 1NVOA 2QJPC 1WRGA 1MWUA 1MFZA 2H8PD 1ZRTD 3H6PA 2UWJE 4C7NA 3MGNA 1IC2A 1VQNP 3W67A 2RMZA 3VYIA 2ZXEB 1OVRA 1RF1A 1LTGC 4N6JA 2QJKB 1AA0A 4L75A 1HWTC 2Y0DA 2ZJQW 3CX5D 3G6EW 3CX5I 1KC8Q 1R5LA 3A0BH 3G9RA 1EZVI 2IDBA 1SFCA 3O8ZA 2QRXA 1AFOA 1K73Q 1X22A 1K73X 2KUBA 3OW2O 5AW3B 3HUSA 2FXMA 2Q9IA 5KJ7C 1SQPJ 3L73E 2WTYA 1LZWA 5TISE 1H89A 1EQ7A 1PPJG 3HE4B 3TNUB 1AVYA 3V4WA 1RE3A 1RE4A 1YJ9P 3I56W 2IBZG 2L5GB 2QJYB 1NAFA 2WA8A 1FZBA 1SQXG 2KSEA 1K9MQ 3L37A 1Q81X 3M06A 1Q81Q 3MD0A 3L4FA 4BXLA 2R44A 2KI7B 1L2PA 5M1AA 5H2FE 3L70J 5CCHA 2O3JA 1J1DB 2DW3A 5AVVB 1BE3J 1JY3N 2ZT9B 1FZFA 1KYOE 3A3YB 1KYOD 2OYHB 3KHUA 2A06E 1MKMA 1HTLC 1NU1G 1YITP 1KQGB 3NXSA 3L74J 1YIJW 1PP9G 2HR3A 1NTMK 2N1TC 2FYUK 2WPVB 1GW3A 3CMAP 2O1KA 2AEJA 3WUUA 1KZUB 3BASA 4WY4A 3CCQP 3I56P 1YJ9W 1S5LE 3H1LE 3GF7A 1CZQA 3Q5PA 3G71W 4Y28J 1NWQA 2WZ7A 1OW6A 1VQ6P 3L70G 4WVZA 2C9NY 1VQPP 2JWDA 3RK3B 1KQFB 5KTBA 2JJLA 1NTMD 2ZYAA 3PJSK 1ZP0C 1NTMG 1IJDB 2Y9ZA 2NPSB 2WVRA 5TJHA 1FDOA 2E5TA 2OYHA 1YJNW 4LC1A 3CCJW 1ZXGA 1YHQP 1GK4A 5APXA 3FWNA 2OYIC 3KXDA 1L0LE 3H1KE 4AQRD 1SQBD 3BCCD 1JY3P 1L0NE 1S72P 3E7KA 2XDJA 5KLVE 2E76C 1PIXA 2FXPA 2CPBA 1BCCJ 1N86A 4HKZH 4JYCA 2E75C 2OTJW 3PTZA 3G6EP 5GW7A 3L74D 2P2UA 3HD7D 2KXPB 3W7XA 4GODA 3B5NB 3M91A 1M57D 2M5AA 3K5BA 1USEA 1VL2A 3PHLA 5APWA 2IFMA 5AVTB 3CD6W 1QLED 3GHGA 1URQB 2RN0A 1N73B 2HYNA 1WT6A 2V7QJ 2KS1A 1Q2NA 5M18A 3G1BA 4OVNF 4IL6E 5E79E 4Y99C 2ZYDA 1FDIA 1N7SB 3W7TA 1BDDA 3F89A 3B71A 1KQLA 3CXHE 4ZMDA 3CXHH 2ZJSE 1URQA 5GADa 3L73D 3CWBJ 3W68A 5AVQB 1L4AC 5AVYB 1Q82X 1FE6A 2B89A 1HUCA 1L0LG 4D6TD 1N7LA 1CW5A 3CD6P 3AE2C 3TNUA 4I7ZB 2W27A 2W6JH 1VPCA 3HTKB 1Z56A 4EI2A 3F5HA 3A7OA 1FZCA 2Q3IA 5AVXB 5AW8B 1T8ZA 3MTUE 1QVGO 4WB4A 4WY4C 2IYPA 3H32B 5CCHC 2FFDC 1SVFA 5APYA 3SFEC 1BCCD 3TGUD 2IBZI 2E75B 3FXDA 1QL1A 3NMDA 1L0NJ 3TGUG 3GMAA 2Q1KA 1BGYJ 3ZG0A 1SQQE 3H1KJ 1L0LJ 1S9KE 2E75D 1FJKA 2C0WA 2NRGA 1LTJB 1LTTC 1XTGB 4U3FJ 2WSEJ 5AW6B 3PP5A 1YBKA 1SQVG 1T3JA 2KNCA 4I2LC 1SQVD 2G8YA 4I7ZC 2ZAEB 2RKLA 1HJ0A 2YKPA 1AQTA 4OH8B 4IFDK 2YKQA 2I1JA 5KJ7A 5APVA 3BCCJ 2W83C 5AVZB 3RL0D 1X0TA 3L71G 3RGUA 1VF5C 5KAIE 3L74E 4YXDC 3V2PA 3L71D 4IL6X 2P58A 2K3RA 5B5EE 3MHVA 4IO9W 4JF7A 1MBXC 2LKMA 2N9BA 2OYIA 1IFIA 2L91A 1VQ7P 1NYHA 4D6TE 1S9KD 1BE3E 1LNQA 1NJIX 2BCCD 2HPCB 3V2RA 4WFBW 1S5LX 1EDLA 2GUSA 1PGPA 1G2CA 1SFCC 1K9MX 3WMM0 1PGJA 2AXTE 2KK7A 4H44B 2FFDB 1L0NK 1OXZA 4DOJA 2WPRA 2XKMA 1RF1C 4I6MC 1KTMA 2A45G 1PGOA 5GTIE 2QJYC 5KLVG 2ZJPW 3BVHA 1K05A 1S4XA 3IAOA 1M8OB 2B9BA 1OFCX 1OWAA 2NPSA 3CXHI 1LGHB 2PFXA 1OX3A 1FS0E 2PAJA 1FU1A 1T2KD 3P8MC 1PPJE 3WUVA 1RQVA 2HFED 1KILC 3KPEA 2Y0CA 3SFDC 3AEAC 2G3AA 1BGYD 2R3CA 1KB9H 3L75E 3TF5A 3H1JJ 3G3PA 1FOSE 3CCQW 2K1AA 1W5CE 2E74C 4H44C 3CCJP 1YQ3C 4Y99B 5KLVK 1NTKD 2PRRA 1W2BO 1OW7A 3EFGA 1MZ9A 5DM6W 1RE4C 2QEXP 1VQ4P 1MBVB 3IR9A 3L72J 1PGQA 1GMJA 1GDTA 1NTKJ 1PP9E 5APSA 2N1TB 1NKZB 5AW4B 4JQ0D 3BCCG 1HBWA 5CCGA 2W6AA 1VQMW 1SLQA 1LWUC 2D2CC 1NTZJ 2ITAA 2AEFA 1GZLA 2K9JB 2YXRB 3A5TA 1KQSV 1NTME 1SQVJ 2Q7CA 1VQ4W 4U3FG 3VMAA 2E74B 4U3FD 5C39A 1N8RQ 1N8RX 1KC8X 1KD1X 2WSCJ 3I5CA 1OMIA 3TGUJ 1YJWP 1LP1B 1VQQA 3P7KA 2IZ1A 3QWOC 5K5GB 3CCUW 2AXCA 1T3UA 1G1IA 4EDFA 4DJGA 2R32A 1IK9A 1YIJP 1KILD 3N7NA 4PJ0H 3KQGA 1SQVE 1NTMJ 3B8EB 2ZXXA 2H43A 5GAGa 4M3LA 1IFNA 1Q90D 1N73A 4GIFA 2KLVA 1ZN5A 4KT0J 1RQSA 2QJPB 2NPSC 3PLNA 3H1IE 2JKVA 1EZVE 4UB8H 1PP9J 2H88C 2P1JA 5E79H 1QX8A 4GOEA 3S1KA 4O9BA 1W2BV 3H1JE 5AW2B 1L4AB 3M9HA 3L75J 2M5AB 1H88A 1NAYA 4ASWA 1DD3A 2FYZA 3D70A 3CCEW 4U67W 4UY8Z 1ZOYC 4YKAA 1HVVA 2KP8A 1OZHA 1Y8AA 2XU6A 3A0HE 2B87A 3V5BA 1E5WA 2YXQB 1X9VA 1RF0A 1JMMA 5BVZA 2FYNC 1JCCA 2OGUA 1KB9I 3R2PA 1JTHB 3USSA 4WBAA 4QMAA 1JEKA 3CC7P 5AW0B 2KZJA 3RK3C 1GD2E
chains in the Genus database with same CATH topology
2NZ2A 2E76D 1DD4A 3IN6A 3AE8C 2W9RA 2YIUC 3GQ1A 1KQFB 1MBXC 1Q90D 3Q3DA 1Y9BA 4R4LA 3G3PA 2E74C 1ZP0C 4H44C 3AECC 1YQ3C 5KKZC 1NYHA 4YJXA 3AE2C 4OGQC 2WA9A 2H89C 3O6QA 4I7ZB 1IK7A 1UIXA 1OW7A 2QJKC 3AE7C 1FDOA 2FBWC 3AEBC 4KT0J 2K9YA 1KORA 3RK3E 2ZT9D 4H0LB 1RQSA 4OGQB 1MBVB 3S9OA 2WA8A 1JB0J 2YMKA 1S5LX 2E74D 2BEQD 1LZWA 2ZT9C 1OW8A 1GMJA 3R4YA 3AE9C 3AEFC 1MG9A 1TU3F 3AE6C 4Z1MH 3AE1C 1YQ4C 4YJMA 4H44D 2D2CB 3O2BA 3AE3C 3SFEC 2H88C 1CTFA 3Q5SA 1VF5D 1NGMB 3AEGC 1R6QC 3EWKA 4IL6X 3O1FB 2E75B 2QJPC 2E76C 4H0LC 1ZMEC 1PIXA 3RL0g 3D6ZA 1HF9A 3G19A 3GLMA 1EXIA 3GMAA 4GDOA 4PV1C 2FXPA 3GF3A 4H13B 1R8EA 4RKUJ 4H44B 2D2CC 2E76B 2E75C 2J5UA 3DNJA 1MBUC 1DIPA 2JP3A 3GQ0A 1ZRTE 2OQQA 1RQUA 2E75D 5KLIC 1DD3A 1EXJA 2QIWA 1KMIZ 4U7JA 3O2HA 4PV1D 3Q1MA 3AE5C 1PL5A 1KTMA 2WSEJ 2O01J 3C8VA 2ZT9B 4H0LD 3Q5RA 3D70A 1VL2A 3D6YA 2QJYC 3AEEC 4YTPC 2E74B 1KILE 4H13C 3O2OA 1K05A 3FGAD 1ZOYC 3D71A 4YKAA 3T97B 1MKMA 2G8YA 2WQYC 4I7ZC 3AE4C 3GW1A 3O1FA 4H13D 4R4MA 1S1CX 1KQGB 1K04A 1HJ0A 2QSIA 3IAOA 2WSCJ 2WSFJ 1R6OC 1OMIA 2P10A 3LW5J 1PV3A 1VF5B 4TT3H 3G9RA 2MKVA 2IDBA 5L8RJ 2V7QJ 2FYNC 3H25A 2WPVB 3SFDC 2D2CD 3G1BA 3Q2YA 2BEZF 1AJYA 4OGQD 4PV1B 1U57A 1FDIA 3ABVC 1WMKA 3GF7A 3Q5PA 1RQVA 3B71A 4Y28J 1VF5C 5M1BA 2JO1A 4YXDC 4XFJA 3AEDC 3AEAC 2G3AA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBU C;  1MG9 A;  1DD4 A;  3GQ0 A;  2W9R A;  1R6O C;  1RQU A;  3GQ1 A;  1MBX C;  1DD3 A;  3O2B A;  3G3P A;  1CTF A;  3O2H A;  1R6Q C;  3G1B A;  4YJX A;  2WA9 A;  3O1F B;  4YJM A;  1RQS A;  3G19 A;  3O2O A;  1MBV B;  1RQV A;  2WA8 A;  4YKA A;  3GW1 A;  3O1F A;  1LZW A;  3DNJ A; 
#chains in the Genus database with same CATH topology
 1L0L K;  1Y47 A;  3CC4 W;  5GTH E;  3FXE A;  2M3E A;  3H1I G;  1DH3 A;  2JWA A;  3TDK A;  3H1I D;  5KKZ C;  5CCG C;  2YO2 A;  3LW5 H;  3CME P;  4YJM A;  4C46 A;  3G4S P;  2QA4 W;  3JC2 2;  2A45 I;  1JB0 J;  2QE7 H;  3CMA W;  3JSV C;  2V4H A;  1NJI Q;  2ZT9 C;  1JUN A;  3HE5 B;  3AE6 C;  3G71 P;  4WFN W;  1M1K X;  1NKN A;  1VF5 D;  3CI9 A;  1NGM B;  5CMZ A;  2O01 H;  1EXI A;  2WT7 B;  2ZVO B;  5CBO A;  3BRV B;  3B5N D;  3L74 G;  3SWK A;  1M56 D;  1RQU A;  2B88 A;  3KZI E;  1YI2 W;  1SS1 A;  1R5S A;  3Q1M A;  3CCU P;  1A02 F;  1QVG V;  2O01 J;  4N3Y B;  1SQX E;  3ZFZ A;  3CCL P;  5HL7 W;  5KLV D;  3II6 A;  1EZV D;  1S1C X;  1GU4 A;  3CWB D;  5AVS B;  4CPG A;  1R6O C;  1PV3 A;  3H1H E;  2MKV A;  2PP6 A;  2Y9Y A;  2NPS D;  4DZO A;  2XNX A;  3CME W;  1LTB C;  4RES B;  1SQX K;  1WMK A;  2KB7 P;  1VQL W;  2FYU E;  2WPS A;  3WU2 E;  3L73 G;  1LTJ A;  1KV4 A;  1DD4 A;  1SQB K;  4AYC A;  1EDK A;  2WMM A;  2OTL P;  1AV1 A;  3AE7 C;  1LTJ C;  4HB1 A;  1IO4 A;  4H0L B;  4MN4 C;  3JCU E;  3S4R A;  1HGZ A;  1MG9 A;  3H1L G;  4ZNC A;  1VQ8 P;  3AE1 C;  3SSU A;  5APT A;  1MV8 A;  2WPQ A;  3O2B A;  2O01 N;  3RL0 B;  3CCE P;  3EWK A;  1P84 D;  3M0A A;  1VQL P;  3OW2 V;  3EQ2 A;  3RL0 g;  4ASV A;  2Q6Q A;  5CJ0 A;  1NTZ K;  3HD7 C;  3OJA B;  1OIP A;  4IOI H;  4W7Z A;  1N73 C;  1PL5 A;  4H0L D;  1U7M A;  2E43 A;  2QG4 A;  2K88 A;  3HD7 A;  3L36 A;  3ZG5 A;  3CC4 P;  5H2F H;  1N7S D;  1OVV A;  1MWR A;  1ZLL A;  4JBZ A;  3GG2 A;  5DJT B;  4CPK A;  3H25 A;  2D2C D;  2OTL W;  3CCR P;  1URQ D;  1VQO W;  1BSN A;  3RK3 D;  3H32 A;  1MWS A;  2GUV A;  2IPP A;  2A45 H;  2HG5 D;  4WY4 B;  3V2N A;  5DM7 W;  3Q3D A;  2LR2 A;  1PPJ D;  1U7J A;  2Y0E A;  3QH9 A;  1HH0 A;  1DX7 A;  2BCC G;  3DLL W;  1BE3 D;  2FXO A;  3GHG B;  5KLV J;  4IOC W;  1SQX D;  4WF9 W;  2E74 D;  1FOS F;  2IBZ D;  2WSS H;  1YQ4 C;  3HE4 A;  2HOD A;  2OTK E;  2P7J A;  3ITK A;  2W8Z A;  3SWY A;  1T2K C;  4UB6 E;  2SPZ A;  2M3B A;  1ZME C;  3CCL W;  1IFM A;  4I1L A;  1NHL A;  3G19 A;  3GLM A;  4PV1 C;  2E76 B;  3U1A A;  3CLQ A;  1KIL B;  3FX0 A;  1FJP A;  4PV1 D;  1FBM A;  3CF5 W;  5KAI H;  1VQO P;  3JCU H;  1UII A;  3D6Y A;  3AEE C;  3O2O A;  1W2E A;  3VP8 A;  1M1J B;  1E79 H;  3L72 D;  3U59 A;  1SQP G;  1YYC A;  1HJB A;  2A06 G;  3LW5 J;  1SQQ G;  1VF5 B;  1NTZ D;  2KIK A;  4ZKU A;  1VQP W;  5L8R J;  3GHG C;  2C9L Y;  1SQQ D;  1NTZ G;  2BEZ F;  1GL2 B;  2C0X A;  1U57 A;  3CPW O;  2I8D A;  1FC2 C;  4XFJ A;  3MUD C;  2KS1 B;  2Z4E A;  1YJW W;  2YMY A;  1VQ8 W;  4YXW H;  4B86 A;  5KLI B;  3AE8 C;  1YHQ W;  3HUS C;  5KJ7 D;  3G4S W;  4IFF A;  1NTK G;  1KYO I;  1SFC B;  1UIX A;  3AEB C;  4KJM A;  1J1D C;  4GOF A;  3CCS W;  4KHX A;  3WU2 H;  3CXH D;  4Z1M H;  1D7M A;  2FYU G;  2BAS A;  2OYH C;  1SQB G;  4GT1 A;  3L72 E;  2N9Y B;  4H0L C;  1HF9 A;  1LP1 A;  5GAE a;  1LWU B;  2Q5U A;  1R8E A;  1LJ2 A;  4RKU J;  3DNJ A;  2Z5I A;  1JY2 O;  3RL0 C;  1DIP A;  2KSJ A;  5GTH H;  2FY8 A;  1KMI Z;  4DKI A;  4U7J A;  1S2E A;  2J58 A;  4TLF A;  5KAF E;  1IFD A;  4UB8 E;  2XV5 A;  5BU5 A;  2ZJR W;  4BWN A;  1JO5 A;  4EIJ A;  5APU A;  2B87 B;  1LWU A;  4PD4 E;  3W7S A;  4BL3 A;  2WQY C;  4WY4 D;  2P67 A;  5APQ A;  1FZG A;  3CWB G;  3CL3 D;  3RK2 C;  2IBZ E;  4OGQ D;  5JVH W;  4NPF X;  2W6B A;  1GL2 D;  3OAK A;  1EDI A;  3H1K D;  1Q86 X;  5AW9 B;  1A02 J;  1L0L D;  3VMZ A;  1T6A A;  1LT1 A;  1NU1 K;  1Q82 Q;  5CCH D;  3A0H H;  1ZV8 A;  1N7S A;  3RK3 E;  2E42 A;  3PIO W;  4D6T G;  4OGQ B;  1XTC C;  2RH0 A;  3MP7 B;  4PD4 H;  3IF4 A;  3CXC V;  3R4Y A;  3EFF K;  2MJZ A;  1N2D C;  4W80 A;  3HUS B;  3HRN A;  2D2C B;  3H1L D;  2HPC A;  3KDP B;  1BCC G;  3L75 D;  1FAV A;  3C1L A;  2FFD A;  3WUT A;  4D6T J;  4ZKP A;  3L75 G;  1JTH A;  3VMX A;  2BCC E;  1CSB A;  1OVU A;  1H0T A;  2R5D A;  1FZC C;  4JYB A;  4LGD E;  3MIW A;  2IZ0 A;  1VQ9 W;  1P84 E;  1QGK B;  1JMB A;  3VP9 A;  4YTP C;  1KIL E;  5AVU B;  2OYO A;  4GKG A;  3BCC E;  2M8R A;  4PD4 D;  5AW7 B;  2PGD A;  1RF0 C;  1DEB A;  1LTI C;  1KN7 A;  1HGV A;  1M1J C;  3VOP A;  3N4X A;  4PV1 B;  2KNC B;  3ABV C;  1KYO H;  4BL2 A;  1BSH A;  1SP4 A;  1MWT A;  2AEM A;  4U3F E;  5CA3 A;  4PJ0 E;  4N78 D;  1VDF A;  3RK2 B;  2WSC H;  4K35 A;  3UIA A;  1VQK P;  2WA9 A;  3O6Q A;  1P84 H;  2W90 A;  5CHX A;  3CCV P;  2YMK A;  4CJN A;  2BEQ D;  1BE3 G;  5DJU B;  1JJ2 V;  1SQB J;  5GAH a;  1QL2 A;  5GTI H;  3PH0 A;  1RY3 A;  2JEE A;  4H44 D;  4BRY B;  4JPZ B;  3TSI A;  3MUD A;  2Q3E A;  1NTK E;  4HJG H;  2JP3 A;  4YPC A;  3GQ0 A;  1EC5 A;  1M90 X;  5AW1 B;  2Z5H A;  3BAT A;  1M90 Q;  1EZV G;  3D71 A;  2M0B A;  3V6I A;  1K04 A;  3L72 G;  3H1H G;  3HD7 B;  4AUW A;  1DEE G;  3NFQ A;  3P8C E;  4A7P A;  1VQK W;  3Q2Y A;  3H1J G;  1YI2 P;  5B66 H;  4LLH A;  2WWW A;  2XZR A;  1H8A A;  2ZYG A;  1YTZ I;  1X79 B;  4PD4 I;  2W9R A;  1MFT A;  1PFI A;  3L70 D;  3OA7 A;  2K37 A;  2WSF H;  3CCS P;  4YJX A;  1BCC E;  1URQ C;  1IK7 A;  2FBW C;  4IL6 H;  1LTS C;  3P8C D;  4IFM A;  1QEX A;  3I55 W;  4RO0 A;  1KFN A;  2GA1 A;  1VQ9 P;  1G1J A;  3TYY A;  2IX7 C;  3W7W A;  2QVA A;  3RBX A;  1LT9 A;  3GF3 A;  2J5U A;  2V7Q H;  5CBN A;  1MBU C;  3C9I A;  2ZVN B;  1ZRT E;  3VN0 A;  3D3I A;  5B5E H;  2IYO A;  3HE5 A;  2IFN A;  1JCD A;  3RBZ A;  3M9Q A;  3AE5 C;  4W7Y A;  3C8V A;  1N7S C;  4N78 E;  3FGA D;  1SQQ K;  1KD1 Q;  5BU8 B;  5AVR B;  1RF1 B;  1SQV K;  2QSI A;  1KQS O;  3IFM A;  4XE5 B;  2FYU J;  1RHZ B;  1X8Y A;  1Q7Y Q;  3VMY A;  1Q7Y X;  1EDJ A;  1GTW A;  3H1H J;  1P84 I;  3MZW B;  3B5N A;  1JY2 P;  1GK6 A;  1J2J B;  4UB6 H;  1QVF O;  2YIU C;  1FDM A;  1BDC A;  1SQX J;  1IFJ A;  2H89 C;  2QJK C;  2K9Y A;  3CCM W;  2FYN B;  3V2Q A;  5KKZ B;  3S9O A;  3CCR W;  2H7H A;  3P32 A;  4WWI A;  3VTP C;  3TK1 A;  1SQQ J;  3KZI H;  1BGY E;  2N1T A;  1CTF A;  1L4A D;  3AEG C;  4L76 A;  2WIT A;  1JOC A;  3O1F B;  4WCE W;  4NPD A;  1ZR4 A;  1JNM A;  1M7L A;  1GL2 C;  4H13 B;  3U1C A;  3LIE A;  1L0N D;  2OQQ A;  3SWF A;  4HYT B;  1L0N G;  3HTK A;  3B5N C;  1NOH A;  1SFC D;  1FZC B;  3O2H A;  1SQP E;  3L73 J;  4K3A A;  1LTA C;  3FWL A;  1NU1 D;  3E1I A;  3T97 B;  1JY2 N;  1SQP D;  3GW1 A;  3CWB E;  3KYQ A;  3GW6 A;  3O1F A;  4H13 D;  4R4M A;  5TIS H;  1NTK K;  1PP9 D;  2A06 D;  2QM8 A;  4EYY Q;  4TT3 H;  3O6Q B;  1USD A;  3ZDM A;  5B66 E;  1VQ6 W;  2R3S A;  3M9B A;  1K8A X;  1AJY A;  4WFA W;  3W7U A;  3CCM P;  2YO3 A;  1K8A Q;  5EFW B;  1G2C B;  3A0B E;  5KAF H;  3CX5 E;  5M1B A;  4BRY A;  3CX5 H;  3AED C;  1FZE A;  2K9J A;  3AE4 C;  3T97 A;  1RE3 C;  2E76 D;  3I55 P;  1ZR2 A;  3IN6 A;  3B4S A;  2AXT H;  1Y9B A;  4R4L A;  3CCV W;  1LT9 C;  2KZI A;  2KLU A;  3AEC C;  1M1J A;  3E1R A;  4XA4 A;  3CC7 W;  4RJT A;  1KOR A;  1S72 W;  2ZT9 D;  2CPS A;  2YKO A;  3NTN A;  2KOG A;  3J7Z Z;  1IZN B;  3LID A;  1OW8 A;  3M0D C;  2FYU D;  1TU3 F;  3G3Z A;  5CCG D;  1VQ5 W;  1M1K Q;  2GM4 A;  3CC2 P;  3V4Q A;  1YJN P;  3AE3 C;  1NU1 E;  2OAR A;  1SQB E;  2ZFC A;  3Q5S A;  2QA4 P;  1KB9 E;  2LXC B;  1YTZ T;  4L73 A;  3D6Z A;  2JDI H;  4L74 A;  4GDO A;  1GU5 A;  2VRS A;  2WSE H;  1RH5 B;  1NO4 A;  1H0T B;  5CJ4 A;  2I1K A;  2OYI B;  2YNY A;  2R5B A;  1AQ5 A;  3H1I J;  3L71 J;  4C7R A;  5KLI C;  1L4A A;  1EXJ A;  2QIW A;  2N1T D;  2OTJ P;  2POH A;  4IOA W;  4DCK A;  1CI6 B;  3Q5R A;  1JY3 O;  1JM0 A;  3L35 A;  2HLO A;  1LT9 B;  4H13 C;  1KFM A;  2LXB A;  1VQ5 P;  2O1J A;  4EOT A;  1BXY A;  3M0D A;  1GW4 A;  1J1E C;  2WSF J;  3CPW V;  2HOD B;  5AVW B;  2P10 A;  4NPE A;  1VQN W;  1MUU A;  1IFP A;  4DT0 A;  3H1H D;  3H1L J;  2QEX W;  2WT7 A;  2CK3 H;  2FKW B;  2XND H;  1FZA A;  1ZW0 A;  2E5Y A;  1PZQ A;  1CI6 A;  1VQ7 W;  3TGU E;  3H1J D;  2JO1 A;  3A2A A;  4C7N B;  3H1K G;  1Q86 Q;  2NZ2 A;  4HH2 A;  4OWF A;  1YIT W;  2KYV A;  3L71 E;  3CC2 W;  2QM7 A;  1BGY G;  3GQ1 A;  1QVF V;  3PRJ A;  2BCC J;  1VQM P;  1J1E B;  5AW5 B;  1AVO A;  4OGQ C;  1GL2 A;  2YIU B;  1S3J A;  3RK2 D;  1KIL A;  3PIP W;  1SQP K;  3AE9 C;  1NU1 J;  3AEF C;  5M19 A;  3L70 E;  1NTZ E;  2JR8 A;  1KB9 D;  1S5L H;  2J59 M;  1NH4 A;  3BRT B;  1R6Q C;  5JVG W;  1NVO A;  2QJP C;  1WRG A;  1MWU A;  1MFZ A;  2H8P D;  1ZRT D;  3H6P A;  2UWJ E;  4C7N A;  3MGN A;  1IC2 A;  1VQN P;  3W67 A;  2RMZ A;  3VYI A;  2ZXE B;  1OVR A;  1RF1 A;  1LTG C;  4N6J A;  2QJK B;  1AA0 A;  4L75 A;  1HWT C;  2Y0D A;  2ZJQ W;  3CX5 D;  3G6E W;  3CX5 I;  1KC8 Q;  1R5L A;  3A0B H;  3G9R A;  1EZV I;  2IDB A;  1SFC A;  3O8Z A;  2QRX A;  1AFO A;  1K73 Q;  1X22 A;  1K73 X;  2KUB A;  3OW2 O;  5AW3 B;  3HUS A;  2FXM A;  2Q9I A;  5KJ7 C;  1SQP J;  3L73 E;  2WTY A;  1LZW A;  5TIS E;  1H89 A;  1EQ7 A;  1PPJ G;  3HE4 B;  3TNU B;  1AVY A;  3V4W A;  1RE3 A;  1RE4 A;  1YJ9 P;  3I56 W;  2IBZ G;  2L5G B;  2QJY B;  1NAF A;  2WA8 A;  1FZB A;  1SQX G;  2KSE A;  1K9M Q;  3L37 A;  1Q81 X;  3M06 A;  1Q81 Q;  3MD0 A;  3L4F A;  4BXL A;  2R44 A;  2KI7 B;  1L2P A;  5M1A A;  5H2F E;  3L70 J;  5CCH A;  2O3J A;  1J1D B;  2DW3 A;  5AVV B;  1BE3 J;  1JY3 N;  2ZT9 B;  1FZF A;  1KYO E;  3A3Y B;  1KYO D;  2OYH B;  3KHU A;  2A06 E;  1MKM A;  1HTL C;  1NU1 G;  1YIT P;  1KQG B;  3NXS A;  3L74 J;  1YIJ W;  1PP9 G;  2HR3 A;  1NTM K;  2N1T C;  2FYU K;  2WPV B;  1GW3 A;  3CMA P;  2O1K A;  2AEJ A;  3WUU A;  1KZU B;  3BAS A;  4WY4 A;  3CCQ P;  3I56 P;  1YJ9 W;  1S5L E;  3H1L E;  3GF7 A;  1CZQ A;  3Q5P A;  3G71 W;  4Y28 J;  1NWQ A;  2WZ7 A;  1OW6 A;  1VQ6 P;  3L70 G;  4WVZ A;  2C9N Y;  1VQP P;  2JWD A;  3RK3 B;  1KQF B;  5KTB A;  2JJL A;  1NTM D;  2ZYA A;  3PJS K;  1ZP0 C;  1NTM G;  1IJD B;  2Y9Z A;  2NPS B;  2WVR A;  5TJH A;  1FDO A;  2E5T A;  2OYH A;  1YJN W;  4LC1 A;  3CCJ W;  1ZXG A;  1YHQ P;  1GK4 A;  5APX A;  3FWN A;  2OYI C;  3KXD A;  1L0L E;  3H1K E;  4AQR D;  1SQB D;  3BCC D;  1JY3 P;  1L0N E;  1S72 P;  3E7K A;  2XDJ A;  5KLV E;  2E76 C;  1PIX A;  2FXP A;  2CPB A;  1BCC J;  1N86 A;  4HKZ H;  4JYC A;  2E75 C;  2OTJ W;  3PTZ A;  3G6E P;  5GW7 A;  3L74 D;  2P2U A;  3HD7 D;  2KXP B;  3W7X A;  4GOD A;  3B5N B;  3M91 A;  1M57 D;  2M5A A;  3K5B A;  1USE A;  1VL2 A;  3PHL A;  5APW A;  2IFM A;  5AVT B;  3CD6 W;  1QLE D;  3GHG A;  1URQ B;  2RN0 A;  1N73 B;  2HYN A;  1WT6 A;  2V7Q J;  2KS1 A;  1Q2N A;  5M18 A;  3G1B A;  4OVN F;  4IL6 E;  5E79 E;  4Y99 C;  2ZYD A;  1FDI A;  1N7S B;  3W7T A;  1BDD A;  3F89 A;  3B71 A;  1KQL A;  3CXH E;  4ZMD A;  3CXH H;  2ZJS E;  1URQ A;  5GAD a;  3L73 D;  3CWB J;  3W68 A;  5AVQ B;  1L4A C;  5AVY B;  1Q82 X;  1FE6 A;  2B89 A;  1HUC A;  1L0L G;  4D6T D;  1N7L A;  1CW5 A;  3CD6 P;  3AE2 C;  3TNU A;  4I7Z B;  2W27 A;  2W6J H;  1VPC A;  3HTK B;  1Z56 A;  4EI2 A;  3F5H A;  3A7O A;  1FZC A;  2Q3I A;  5AVX B;  5AW8 B;  1T8Z A;  3MTU E;  1QVG O;  4WB4 A;  4WY4 C;  2IYP A;  3H32 B;  5CCH C;  2FFD C;  1SVF A;  5APY A;  3SFE C;  1BCC D;  3TGU D;  2IBZ I;  2E75 B;  3FXD A;  1QL1 A;  3NMD A;  1L0N J;  3TGU G;  3GMA A;  2Q1K A;  1BGY J;  3ZG0 A;  1SQQ E;  3H1K J;  1L0L J;  1S9K E;  2E75 D;  1FJK A;  2C0W A;  2NRG A;  1LTJ B;  1LTT C;  1XTG B;  4U3F J;  2WSE J;  5AW6 B;  3PP5 A;  1YBK A;  1SQV G;  1T3J A;  2KNC A;  4I2L C;  1SQV D;  2G8Y A;  4I7Z C;  2ZAE B;  2RKL A;  1HJ0 A;  2YKP A;  1AQT A;  4OH8 B;  4IFD K;  2YKQ A;  2I1J A;  5KJ7 A;  5APV A;  3BCC J;  2W83 C;  5AVZ B;  3RL0 D;  1X0T A;  3L71 G;  3RGU A;  1VF5 C;  5KAI E;  3L74 E;  4YXD C;  3V2P A;  3L71 D;  4IL6 X;  2P58 A;  2K3R A;  5B5E E;  3MHV A;  4IO9 W;  4JF7 A;  1MBX C;  2LKM A;  2N9B A;  2OYI A;  1IFI A;  2L91 A;  1VQ7 P;  1NYH A;  4D6T E;  1S9K D;  1BE3 E;  1LNQ A;  1NJI X;  2BCC D;  2HPC B;  3V2R A;  4WFB W;  1S5L X;  1EDL A;  2GUS A;  1PGP A;  1G2C A;  1SFC C;  1K9M X;  3WMM 0;  1PGJ A;  2AXT E;  2KK7 A;  4H44 B;  2FFD B;  1L0N K;  1OXZ A;  4DOJ A;  2WPR A;  2XKM A;  1RF1 C;  4I6M C;  1KTM A;  2A45 G;  1PGO A;  5GTI E;  2QJY C;  5KLV G;  2ZJP W;  3BVH A;  1K05 A;  1S4X A;  3IAO A;  1M8O B;  2B9B A;  1OFC X;  1OWA A;  2NPS A;  3CXH I;  1LGH B;  2PFX A;  1OX3 A;  1FS0 E;  2PAJ A;  1FU1 A;  1T2K D;  3P8M C;  1PPJ E;  3WUV A;  1RQV A;  2HFE D;  1KIL C;  3KPE A;  2Y0C A;  3SFD C;  3AEA C;  2G3A A;  1BGY D;  2R3C A;  1KB9 H;  3L75 E;  3TF5 A;  3H1J J;  3G3P A;  1FOS E;  3CCQ W;  2K1A A;  1W5C E;  2E74 C;  4H44 C;  3CCJ P;  1YQ3 C;  4Y99 B;  5KLV K;  1NTK D;  2PRR A;  1W2B O;  1OW7 A;  3EFG A;  1MZ9 A;  5DM6 W;  1RE4 C;  2QEX P;  1VQ4 P;  1MBV B;  3IR9 A;  3L72 J;  1PGQ A;  1GMJ A;  1GDT A;  1NTK J;  1PP9 E;  5APS A;  2N1T B;  1NKZ B;  5AW4 B;  4JQ0 D;  3BCC G;  1HBW A;  5CCG A;  2W6A A;  1VQM W;  1SLQ A;  1LWU C;  2D2C C;  1NTZ J;  2ITA A;  2AEF A;  1GZL A;  2K9J B;  2YXR B;  3A5T A;  1KQS V;  1NTM E;  1SQV J;  2Q7C A;  1VQ4 W;  4U3F G;  3VMA A;  2E74 B;  4U3F D;  5C39 A;  1N8R Q;  1N8R X;  1KC8 X;  1KD1 X;  2WSC J;  3I5C A;  1OMI A;  3TGU J;  1YJW P;  1LP1 B;  1VQQ A;  3P7K A;  2IZ1 A;  3QWO C;  5K5G B;  3CCU W;  2AXC A;  1T3U A;  1G1I A;  4EDF A;  4DJG A;  2R32 A;  1IK9 A;  1YIJ P;  1KIL D;  3N7N A;  4PJ0 H;  3KQG A;  1SQV E;  1NTM J;  3B8E B;  2ZXX A;  2H43 A;  5GAG a;  4M3L A;  1IFN A;  1Q90 D;  1N73 A;  4GIF A;  2KLV A;  1ZN5 A;  4KT0 J;  1RQS A;  2QJP B;  2NPS C;  3PLN A;  3H1I E;  2JKV A;  1EZV E;  4UB8 H;  1PP9 J;  2H88 C;  2P1J A;  5E79 H;  1QX8 A;  4GOE A;  3S1K A;  4O9B A;  1W2B V;  3H1J E;  5AW2 B;  1L4A B;  3M9H A;  3L75 J;  2M5A B;  1H88 A;  1NAY A;  4ASW A;  1DD3 A;  2FYZ A;  3D70 A;  3CCE W;  4U67 W;  4UY8 Z;  1ZOY C;  4YKA A;  1HVV A;  2KP8 A;  1OZH A;  1Y8A A;  2XU6 A;  3A0H E;  2B87 A;  3V5B A;  1E5W A;  2YXQ B;  1X9V A;  1RF0 A;  1JMM A;  5BVZ A;  2FYN C;  1JCC A;  2OGU A;  1KB9 I;  3R2P A;  1JTH B;  3USS A;  4WBA A;  4QMA A;  1JEK A;  3CC7 P;  5AW0 B;  2KZJ A;  3RK3 C;  1GD2 E; 
#chains in the Genus database with same CATH homology
 2NZ2 A;  2E76 D;  1DD4 A;  3IN6 A;  3AE8 C;  2W9R A;  2YIU C;  3GQ1 A;  1KQF B;  1MBX C;  1Q90 D;  3Q3D A;  1Y9B A;  4R4L A;  3G3P A;  2E74 C;  1ZP0 C;  4H44 C;  3AEC C;  1YQ3 C;  5KKZ C;  1NYH A;  4YJX A;  3AE2 C;  4OGQ C;  2WA9 A;  2H89 C;  3O6Q A;  4I7Z B;  1IK7 A;  1UIX A;  1OW7 A;  2QJK C;  3AE7 C;  1FDO A;  2FBW C;  3AEB C;  4KT0 J;  2K9Y A;  1KOR A;  3RK3 E;  2ZT9 D;  4H0L B;  1RQS A;  4OGQ B;  1MBV B;  3S9O A;  2WA8 A;  1JB0 J;  2YMK A;  1S5L X;  2E74 D;  2BEQ D;  1LZW A;  2ZT9 C;  1OW8 A;  1GMJ A;  3R4Y A;  3AE9 C;  3AEF C;  1MG9 A;  1TU3 F;  3AE6 C;  4Z1M H;  3AE1 C;  1YQ4 C;  4YJM A;  4H44 D;  2D2C B;  3O2B A;  3AE3 C;  3SFE C;  2H88 C;  1CTF A;  3Q5S A;  1VF5 D;  1NGM B;  3AEG C;  1R6Q C;  3EWK A;  4IL6 X;  3O1F B;  2E75 B;  2QJP C;  2E76 C;  4H0L C;  1ZME C;  1PIX A;  3RL0 g;  3D6Z A;  1HF9 A;  3G19 A;  3GLM A;  1EXI A;  3GMA A;  4GDO A;  4PV1 C;  2FXP A;  3GF3 A;  4H13 B;  1R8E A;  4RKU J;  4H44 B;  2D2C C;  2E76 B;  2E75 C;  2J5U A;  3DNJ A;  1MBU C;  1DIP A;  2JP3 A;  3GQ0 A;  1ZRT E;  2OQQ A;  1RQU A;  2E75 D;  5KLI C;  1DD3 A;  1EXJ A;  2QIW A;  1KMI Z;  4U7J A;  3O2H A;  4PV1 D;  3Q1M A;  3AE5 C;  1PL5 A;  1KTM A;  2WSE J;  2O01 J;  3C8V A;  2ZT9 B;  4H0L D;  3Q5R A;  3D70 A;  1VL2 A;  3D6Y A;  2QJY C;  3AEE C;  4YTP C;  2E74 B;  1KIL E;  4H13 C;  3O2O A;  1K05 A;  3FGA D;  1ZOY C;  3D71 A;  4YKA A;  3T97 B;  1MKM A;  2G8Y A;  2WQY C;  4I7Z C;  3AE4 C;  3GW1 A;  3O1F A;  4H13 D;  4R4M A;  1S1C X;  1KQG B;  1K04 A;  1HJ0 A;  2QSI A;  3IAO A;  2WSC J;  2WSF J;  1R6O C;  1OMI A;  2P10 A;  3LW5 J;  1PV3 A;  1VF5 B;  4TT3 H;  3G9R A;  2MKV A;  2IDB A;  5L8R J;  2V7Q J;  2FYN C;  3H25 A;  2WPV B;  3SFD C;  2D2C D;  3G1B A;  3Q2Y A;  2BEZ F;  1AJY A;  4OGQ D;  4PV1 B;  1U57 A;  1FDI A;  3ABV C;  1WMK A;  3GF7 A;  3Q5P A;  1RQV A;  3B71 A;  4Y28 J;  1VF5 C;  5M1B A;  2JO1 A;  4YXD C;  4XFJ A;  3AED C;  3AEA C;  2G3A A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...