1RQUA

Nmr structure of l7 dimer from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L7/L12
publication title From structure and dynamics of protein L7/L12 to molecular switching in ribosome.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
A PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.710 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1rquA01
3.30.1390.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal Protein L30; Chain: A, 1rquA02
2WA9A 3O1FB 3G1BA 3G3PA 1MG9A 2W9RA 1RQSA 3GQ1A 3DNJA 1LZWA 1MBVB 3GW1A 3GQ0A 1CTFA 3G19A 1R6QC 1DD4A 4YJXA 1R6OC 1DD3A 1RQUA 4YJMA 1RQVA 1MBUC 3O2HA 3O1FA 4YKAA 2WA8A 1MBXC 3O2OA 3O2BA
chains in the Genus database with same CATH superfamily
3V4WA 3PIOW 2O3JA 1ZW0A 1KB9I 2BCCJ 1Q7YX 2WWWA 2E74C 4U3FG 3P8MC 2W83C 3M0DA 4CJNA 1GMJA 2K1AA 1RE3A 1ZLLA 1MWRA 3D6ZA 5TISE 1KV4A 3MD0A 1PGQA 3MUDC 1MBXC 2QRXA 3H1LG 3BASA 3CCSP 2GA1A 3G3PA 5B66H 2K9JA 1NJIX 4WFAW 3AEBC 1PP9J 1WRGA 1RQUA 4OGQB 2O01N 1NTMJ 2M3EA 1MBUC 2OYHB 5AVQB 1LTSC 1LWUB 3AEDC 3CCMW 1N7SC 4XFJA 1JTHA 3L72G 2PGDA 2FY8A 1A02J 1PP9E 2W27A 4C7RA 2WSFJ 2V4HA 3W7SA 1PP9D 1Q90D 1YJ9W 1NTME 1NTMD 1GK4A 5CCGD 3AE7C 3WUTA 2I1KA 1AQ5A 3AEAC 2Z5HA 2Q3EA 3CCUW 2K9JB 3GQ0A 3AE1C 1NHLA 1YI2P 1VQ9P 1LTGC 3A0BH 4AYCA 4D6TJ 4H44C 3H1JG 3H25A 2QE7H 5CCGA 4BRYA 1NVOA 2WSEH 3Q5PA 4EI2A 2IPPA 2HLOA 1RF0A 3DLLW 1JTHB 5APUA 3CXCV 1Q2NA 3KQGA 5CJ0A 4TLFA 1HUCA 2W6JH 1DEEG 1FZGA 4ZKUA 4IOAW 5KAFH 3I5CA 4D6TD 4DJGA 2LXCB 1S9KE 2E42A 1VF5B 2QEXP 2P67A 2O1JA 2XZRA 1S9KD 2L91A 3CCQW 1SQBG 1LP1A 2JWDA 4ZKPA 1PIXA 1KMIZ 4UB6E 4WVZA 5AVYB 3RL0g 4W7ZA 1IK7A 4IFFA 3L75E 3L36A 3CCLW 5KAIE 1A02F 2Q9IA 1JEKA 3TGUG 2ZYAA 3A5TA 1LTAC 1IZNB 3TYYA 2C0WA 5AW8B 3W67A 1MKMA 1PFIA 1IFDA 5AW6B 3BCCE 3GHGB 4GOFA 4L75A 2FYZA 2QJYC 3C8VA 1GTWA 1NJIQ 1NU1G 3CL3D 2OTLP 4OVNF 3TNUA 1BE3J 1LP1B 3D70A 3J7ZZ 3B71A 1X8YA 1N73C 4H13D 3PLNA 3PHLA 1N8RX 5EFWB 1QVFV 1NYHA 2VRSA 4LC1A 2QEXW 3VMZA 2J5UA 3TDKA 3CMEW 4U3FJ 2J58A 1PZQA 3WMM0 4WFNW 1KQSV 1OXZA 2KI7B 2MJZA 1HJBA 3Q3DA 2ZJPW 2Y9ZA 1U7MA 1JY2O 3HD7C 3V2NA 3H1HG 2W9RA 1W2BV 1GW3A 2ZT9D 3FWLA 3MP7B 1JY3P 3TK1A 3L70G 1KILB 1M1JC 3II6A 1VQ4P 1ZRTE 2NPSC 1RF1C 1NTKG 1ZRTD 3CX5E 2KIKA 1VQ6P 1BDDA 1KQFB 4I7ZB 3CX5D 5AW9B 4IOCW 4U3FE 3A0HH 4MN4C 2AXTE 3TNUB 4U3FD 3CX5I 1BCCJ 3G71P 1BGYJ 5KJ7D 1LZWA 3H1LE 1L4AC 1NKNA 3L72J 2IYOA 1FZEA 2OTLW 1K04A 2AEMA 1QEXA 1ZR4A 2Q3IA 1H89A 2H88C 5K5GB 1WMKA 1T6AA 4H13B 4W7YA 5KJ7A 1R5SA 3KXDA 1RY3A 1DIPA 1BCCD 5B5EH 1BGYD 1J1EB 3CF5W 1EDJA 4O9BA 2A45H 3L72E 1U57A 3TSIA 1MV8A 3L72D 5BVZA 3W7WA 1CZQA 3AE8C 1MBVB 3RGUA 1EDKA 1VQ4W 2BCCG 3VYIA 4IL6X 3QH9A 3I55W 1VPCA 4WB4A 1ZOYC 2Q5UA 4C7NA 1VQ6W 1N86A 4LGDE 1LTIC 1W2EA 3G1BA 1IK9A 2XU6A 2WQYC 1MWUA 2R44A 5CA3A 1IFJA 4WY4D 4L73A 2ZJQW 3H1JE 5CMZA 4UY8Z 3H1JD 1LT9C 3CCVW 4H0LD 2FYNC 4DCKA 1GL2C 1URQC 2XNDH 3F5HA 4GIFA 5AVXB 1OMIA 5M1BA 5APXA 1SQBJ 3NFQA 1M56D 4AQRD 4WY4A 1YTZT 3P7KA 3L71J 2KZIA 3GG2A 1N8RQ 1JOCA 4PD4D 1RQVA 2POHA 4GT1A 5CJ4A 3OA7A 1KZUB 5APQA 3RK3E 3V6IA 1SQBK 4PD4I 4ZMDA 5BU5A 1Q86Q 3L37A 3RK3D 4Y99B 1SQBE 3TGUJ 3HTKA 5M18A 4C7NB 2BEZF 1R8EA 3RL0C 1SQBD 4YXWH 4EYYQ 3F89A 4UB8E 1IJDB 3L71D 2KXPB 4PJ0E 3V5BA 4PV1B 2NZ2A 2ZXEB 1HGVA 1AQTA 3TGUE 4JYBA 4C46A 4D6TG 2KSEA 3TGUD 2Z4EA 5L8RJ 3KZIE 3SWKA 1QL1A 2E76D 4WY4B 1MWTA 3H1IG 4JBZA 1NU1K 2IDBA 4H0LB 4HB1A 3IN6A 5DJTB 1HJ0A 3B5NC 1NU1E 2A06G 4BXLA 1YITP 1X22A 1X9VA 3HTKB 1JM0A 2FKWB 3UIAA 1PGPA 1LTTC 3L70J 1FDOA 3LIEA 1JMBA 3SFEC 1NTKJ 2E74D 4DT0A 3CC7P 2PRRA 2P58A 1YQ3C 1M7LA 1R6OC 1FC2C 3GW6A 3H1HE 5B66E 3L70E 1Z56A 1QX8A 3L70D 1OX3A 2WPVB 1NTKD 5AW3B 1EXJA 1M90Q 1SQPG 2OTJW 2B89A 3Q5SA 2PAJA 5APSA 1JY3N 3MUDA 3PH0A 1BSNA 1EC5A 3EFFK 2E76B 5APYA 3VP8A 2M0BA 3Q5RA 1N7SD 2WVRA 1MG9A 3NTNA 4A7PA 2ZAEB 2KOGA 2OARA 1S3JA 5GADa 1BE3G 2KZJA 4ASVA 1DEBA 3G6EP 4YXDC 2CK3H 2WPQA 2WSEJ 2CPSA 2G3AA 3OAKA 4WFBW 1GDTA 1PL5A 1N7SA 1SLQA 4RJTA 1AFOA 3JCUE 2E74B 1FZBA 1OVRA 2HYNA 1YJWP 2HPCA 3N7NA 1KFMA 2WMMA 2OYIC 1MWSA 1KYOH 3MTUE 3KYQA 3CC4P 1VQKP 1VQPW 3FX0A 1LTJC 3T97A 2BCCE 3W7TA 1OZHA 1SVFA 2BCCD 2IZ1A 5KAFE 1EDLA 1BCCG 2K3RA 1BGYG 2ITAA 1KC8X 1ZXGA 3EFGA 1VF5D 1HTLC 2Y9YA 2KNCA 1N7SB 2KLUA 1VQOP 2K9YA 4U67W 2OYHC 3D3IA 1J1DB 1NTMK 1ZMEC 1YIJP 3G6EW 3RBZA 2E75C 1H88A 2HPCB 5GTIE 3EQ2A 5CHXA 2OGUA 5H2FE 3T97B 2Y0DA 2YO3A 1KQGB 1YYCA 3M9QA 3RK2D 1R5LA 1QVGO 5M19A 1KB9H 4H44B 4JQ0D 3H6PA 1FJPA 1K9MQ 1SQQG 1QLED 2HR3A 1W5CE 1DH3A 3CC2P 2QSIA 3H1IJ 5AW4B 2JR8A 1S5LE 1SQVJ 3CCSW 2ZJSE 3CC4W 1S1CX 1VQKW 2KNCB 2C9LY 2B87B 2J59M 2YMYA 1OIPA 3ZFZA 3G4SP 4D6TE 3GHGA 5TISH 2YXQB 3H1IE 3CCJP 2QIWA 3USSA 3H1ID 1PGOA 1R6QC 4WBAA 1SQVD 1VQQA 2A06E 1S72P 2ZYDA 1HVVA 1L2PA 4EOTA 2O01H 1KILE 3HD7D 1M1KQ 2A06D 3L71G 1EQ7A 4BL3A 3I56P 1YJNP 1KILD 1Y9BA 3VMYA 1HWTC 1H0TB 1AJYA 5C39A 2R32A 3GW1A 2RH0A 3FXDA 1Q7YQ 2ZVNB 3AEGC 4XA4A 1JY3O 2K88A 3HUSA 4OWFA 1CI6B 2MKVA 4BWNA 4I6MC 5GW7A 1SQPJ 3HD7A 3O2OA 1SQXG 3RK2B 1YI2W 1VQ9W 1KILA 3WU2E 3A2AA 3SFDC 1RF1A 1ZR2A 2ZJRW 5AVRB 4HH2A 2FYUJ 3BVHA 3K5BA 3JSVC 1RF0C 1SQPK 4OH8B 2FFDC 1PGJA 5AVVB 1SQPE 5APWA 1N73B 1SQPD 3G4SW 5B5EE 1FDMA 3G9RA 1M8OB 5DJUB 1CTFA 1L0LJ 2B9BA 2ZXXA 3BATA 5TJHA 1JMMA 1PV3A 5M1AA 3HUSB 1BE3E 1RH5B 2XKMA 2YMKA 2GUVA 3HD7B 1BE3D 1UIXA 4ZNCA 1VQ5P 4NPFX 3I56W 1YJNW 1EDIA 1T2KD 1RF1B 2KS1B 2JO1A 2WPSA 3VMXA 4B86A 2SPZA 3RBXA 1E5WA 2XDJA 1VQ7P 4UB6H 3DNJA 3CMAP 1Y8AA 3L4FA 1VQMP 5KAIH 1FZCC 1L4AB 1GL2D 1URQD 3SSUA 2AEJA 5DM7W 1T3UA 3ITKA 3MIWA 2FXOA 4RESB 3CWBG 2YIUC 1BCCE 1TU3F 1BGYE 1LT9A 1K73X 1FDIA 1GL2A 1URQA 3AE5C 3D71A 2OQQA 1YHQP 2Q1KA 3RL0D 1JB0J 1WT6A 2Q6QA 2QM8A 3VP9A 1SQQJ 1JY2P 4RKUJ 2WITA 1KQLA 3E7KA 1VQ5W 2M5AA 2BASA 4PV1D 4DZOA 2DW3A 1X79B 4KHXA 1CW5A 4IOIH 5AVZB 2JWAA 2ZT9C 3B8EB 4IL6H 2C0XA 2HFED 5AW1B 1SQQK 3IR9A 5AVTB 4YJXA 1USDA 1SQQE 3G71W 1FZFA 4DKIA 4NPEA 3S9OA 1LT9B 1SQQD 4NPDA 1KFNA 3CX5H 1SFCD 1GL2B 1URQB 5GAEa 3B5ND 1E79H 2LR2A 1M57D 2V7QH 4PD4E 2R3SA 1P84E 2YNYA 4YKAA 5GTHE 2JP3A 1SFCA 2IYPA 1P84D 3N4XA 5KKZC 3LW5H 3B5NA 2M5AB 1Q81X 2WT7B 1FJKA 1P84I 2I1JA 2GM4A 3RL0B 1SQXJ 3L71E 1MFZA 2WZ7A 1L0NG 2Y0EA 2YO2A 2FXPA 1FBMA 5KTBA 3E1RA 1JNMA 2M3BA 3PTZA 1SQXK 3GMAA 1SQXE 1CSBA 1QVFO 3C9IA 5CCHC 2WSSH 2W6AA 3M06A 3HE5A 1SQXD 2G8YA 1SQVG 3O2BA 1OVUA 3HRNA 1S2EA 3ZG5A 2WA9A 3AEFC 1VDFA 1SFCB 2AXCA 2BEQD 3B5NB 5E79E 2QJKC 1FU1A 1KQSO 2Y0CA 1G2CA 1DD4A 2NRGA 2N1TC 1W2BO 1LGHB 3MZWB 3GF7A 1K73Q 1K8AX 3U59A 5DM6W 3ZG0A 3V2QA 4DOJA 1OFCX 2D2CC 1U7JA 3W7XA 1NTKK 1KYOD 2QJPC 1NTKE 3HE5B 4KJMA 3AEEC 1LNQA 3RK3C 3L74G 1SP4A 4IFMA 3VOPA 3E1IA 3CWBJ 5BU8B 4GOEA 2OYIA 2N9YB 2E5TA 1G2CB 2P2UA 5KLIB 2R3CA 2A45G 3SWFA 1T8ZA 1LTJA 4UB8H 2R5DA 4WCEW 2FYUG 1EZVD 2WSCH 1KD1X 4PJ0H 4LLHA 3MHVA 1BSHA 3M9HA 1AA0A 2RKLA 1PPJG 5CBNA 3V4QA 3CCMP 2JKVA 2I8DA 3CWBE 2E75D 1YITW 1HH0A 1HGZA 2RN0A 3CWBD 2YKPA 1OVVA 1L0LG 1GU5A 5AW7B 2IZ0A 3L73G 3CCRP 2KYVA 3MGNA 3A0BE 1Q81Q 1YJ9P 2N9BA 2KP8A 1FZAA 3H32A 3CC7W 5APVA 1DD3A 3D6YA 1G1IA 4H44D 1LTBC 3ABVC 1T3JA 2OYIB 3CCUP 2P7JA 2PFXA 4YPCA 3OJAB 1LTJB 3OW2O 2O01J 1YQ4C 5AW0B 3CXHH 4RO0A 3O6QA 2K37A 4HKZH 1JY2N 1HBWA 1USEA 3NMDA 1BXYA 3AECC 3CLQA 2B87A 3AE6C 3IFMA 4OGQC 1RE4C 4WWIA 1IO4A 1XTCC 3ZDMA 3H32B 1LWUC 1QL2A 4TT3H 1MZ9A 2E75B 3L35A 3CCQP 1RQSA 1NO4A 1L0NJ 1FS0E 5AVUB 3Q2YA 1K8AQ 1NKZB 1J1DC 1IFMA 3CCRW 3M0DC 3A3YB 3R4YA 2HG5D 2XNXA 4YJMA 1NTZG 1RE3C 3CCLP 1H0TA 3O6QB 1YJWW 1L0NK 1QGKB 4XE5B 1L0NE 5JVHW 4ASWA 1IFPA 1CI6A 1L0ND 3JCUH 3U1AA 4CPKA 3CI9A 1DX7A 3FGAD 2YKOA 3IF4A 1JCCA 2H7HA 2B88A 2IBZG 2IX7C 1SQVK 1BDCA 1SQVE 1IFNA 1KD1Q 1JJ2V 2FFDA 1VQOW 3CPWO 1N73A 2W6BA 3H1KG 3L75J 1IC2A 1YIJW 1ZV8A 1VF5C 2NPSD 3CMEP 1AV1A 1KN7A 3M0AA 1FE6A 3V2PA 3A0HE 1KORA 2M8RA 3L74J 1LT1A 3VN0A 2P1JA 4HJGH 2IFNA 3KDPB 3BCCJ 5CCGC 1M1JA 2R5BA 3PIPW 4BRYB 2NPSA 3L75D 2KS1A 2QG4A 2QM7A 2RMZA 1FAVA 3CC2W 5GTIH 1Y47A 1OW8A 3G19A 1JO5A 1L4AD 3BRVB 2QJYB 3O1FA 3L74E 1RHZB 5H2FH 4JYCA 3RK2C 2WA8A 2FFDB 3L74D 1S5LX 3GHGC 2WSFH 3W68A 4W80A 2AEFA 5CBOA 3BCCD 1KC8Q 4M3LA 1NWQA 2FYUK 1L4AA 4I2LC 1FZCA 1S5LH 3AE2C 2H43A 3CCJW 1JUNA 2FYUE 3IAOA 3L73J 1OWAA 2FYUD 3PRJA 2A45I 1MUUA 1PPJE 4K3AA 4I1LA 5GAHa 1S72W 1PPJD 4JF7A 1XTGB 2Z5IA 1M1JB 3QWOC 1L0LK 4AUWA 1YBKA 2NPSB 4CPGA 1J2JB 1Q86X 1L0LE 2E5YA 3HUSC 3G3ZA 3L73E 4IL6E 3TF5A 1L0LD 4GKGA 2V7QJ 3L73D 3O1FB 4EIJA 4QMAA 5KLVG 1KILC 3R2PA 1AVYA 4IFDK 3H1LJ 1EZVG 3I55P 2C9NY 2LXBA 3LW5J 3AE4C 4I7ZC 1Q82X 2ZVOB 2JEEA 1FZCB 1VQLP 3C1LA 1NGMB 2OYOA 5AVWB 3LIDA 2Q7CA 2YKQA 2L5GB 2IFMA 2YIUB 3CCVP 3WU2H 2QA4P 3H1LD 1VQNP 3S1KA 4GODA 1FOSE 1AVOA 3GLMA 4H13C 4R4MA 1NTZJ 3NXSA 1J1EC 1X0TA 1MFTA 4N3YB 2KSJA 4Y28J 3A7OA 2WT7A 4YTPC 4L74A 1IFIA 1NTZK 5JVGW 2XV5A 1NTZE 2ZT9B 3H1JJ 2WTYA 1VQ7W 1VQ8P 1NTZD 1T2KC 5CCHD 3HE4A 1OW7A 1M90X 5AW2B 3CMAW 1VQMW 2FYNB 3WUUA 2LKMA 2FXMA 1VQLW 4KT0J 2AXTH 5AW5B 3H1KJ 2ZFCA 5KJ7C 5CCHA 2N1TD 1NH4A 3PP5A 2IBZE 3OW2V 4U7JA 1FOSF 4EDFA 2QA4W 2IBZD 2KB7P 1PP9G 1VQNW 5KKZB 1YHQW 1NTMG 2IBZI 3VTPC 5AVSB 1S4XA 3P32A 2D2CD 3M91A 4HYTB 3H1KE 3O8ZA 2N1TA 3V2RA 1ZN5A 4K35A 2WSCJ 3H1KD 3O2HA 1GZLA 3KPEA 3Q1MA 4Y99C 1H8AA 3HE4B 2QVAA 4IO9W 3M9BA 2O1KA 1JCDA 1GK6A 1G1JA 5HL7W 1VQ8W 4PV1C 4WF9W 4Z1MH 1EXIA 3CCEP 2OTJP 1NU1J 1ZP0C 2H89C 4R4LA 2YXRB 3CD6P 1Q82Q 3BRTB 1QVGV 1GW4A 2QJKB 4WY4C 3KHUA 1D7MA 3PJSK 3SWYA 1K05A 3JC22 5APTA 1GD2E 2N1TB 2E43A 4H0LC 1SFCC 2JJLA 1NOHA 2GUSA 5GAGa 3S4RA 1NU1D 1HF9A 3L75G 3H1HJ 1KTMA 1LJ2A 2D2CB 5KLVJ 3VMAA 1KYOE 4PD4H 3GF3A 3P8CE 2UWJE 2QJPB 1UIIA 1P84H 3AE9C 5GTHH 3CPWV 1SS1A 3P8CD 3CXHE 1KYOI 2JDIH 3B4SA 3RK3B 3CXHD 2HODA 5KLVK 1K9MX 3EWKA 3BCCG 1NAYA 5KLVE 3CXHI 1VQPP 1OW6A 3H1HD 4L76A 4N78E 5KLVD 1EZVE 4N78D 3GQ1A 4JPZB 2W90A 3CCEW 2KK7A 2WPRA 1GU4A 4GDOA 4OGQD 3CD6W 1NAFA 1EZVI 2PP6A 2ZYGA 2KUBA 1N7LA 2E76C 5KLIC 2CPBA 3FWNA 3KZIH 2KLVA 1YTZI 3WUVA 2W8ZA 2P10A 2FBWC 1VL2A 2H8PD 3U1CA 4N6JA 2OYHA 1RE4A 1M1KX 1KB9E 1N2DC 5E79H 4BL2A 1LWUA 3W7UA 3FXEA 1KB9D 2HODB 3AE3C 2OTKE
chains in the Genus database with same CATH topology
2NZ2A 3H25A 4H13D 3O1FB 3Q5PA 3AEEC 1MG9A 1VF5C 2YIUC 3SFDC 3AE8C 4KT0J 2E74C 1NYHA 3AECC 1TU3F 3Q5RA 4YXDC 1MBVB 3AE6C 1HF9A 3LW5J 3T97B 1GMJA 5L8RJ 3AE4C 4OGQC 1KTMA 2J5UA 2E76D 3O2OA 2D2CB 2WSEJ 1KORA 1FDIA 4I7ZC 4IL6X 1KQGB 3AE5C 4U7JA 3D6ZA 2G3AA 3D71A 2OQQA 1PL5A 1MBXC 2FXPA 3GF3A 1ZOYC 4TT3H 4H44B 2E75B 2IDBA 3Q3DA 4H0LB 1NGMB 3G1BA 3IN6A 3G3PA 3AE9C 1HJ0A 2W9RA 1RQSA 2WQYC 2QSIA 2ZT9D 1VF5B 3G9RA 1JB0J 3Q2YA 1ZRTE 2D2CD 2E74B 1S1CX 2V7QJ 3AEBC 3GMAA 1CTFA 1OW8A 3G19A 4RKUJ 3EWKA 3R4YA 1PIXA 2WSCJ 1RQUA 4OGQB 4YJMA 1KQFB 1KMIZ 2E75D 4PV1D 1MBUC 3O2HA 3O1FA 4I7ZB 4H0LD 1OW6A 1FDOA 1PV3A 2FYNC 2G8YA 3SFEC 2WA8A 3O2BA 1OMIA 5M1BA 2WA9A 2YMKA 3AEFC 3AEDC 3Q1MA 3RL0g 3GLMA 1IK7A 4XFJA 1S5LX 4H13C 3GQ1A 4R4MA 2E74D 2BEQD 2ZT9C 1UIXA 2QJKC 2QIWA 1LZWA 4GDOA 4OGQD 1YQ3C 1R6QC 1DD4A 3AE2C 4YJXA 2JO1A 1DD3A 1R6OC 2WSFJ 3D6YA 2E76C 1RQVA 5KLIC 3IAOA 1Q90D 4H44D 4PV1C 4Y28J 3S9OA 4Z1MH 3FGAD 1EXIA 3RK3E 1KILE 3ABVC 3GF7A 4YTPC 1K04A 1ZP0C 1MKMA 1VF5D 3AE7C 2H89C 2H88C 2WPVB 4R4LA 1Y9BA 3DNJA 1WMKA 1AJYA 4H13B 1EXJA 1R8EA 2BEZF 2P10A 2ZT9B 3AEAC 2O01J 2FBWC 2K9YA 1VL2A 1DIPA 1YQ4C 3Q5SA 3GQ0A 3GW1A 2D2CC 2QJYC 3AE1C 3C8VA 3AEGC 1K05A 1ZMEC 3O6QA 4YKAA 2MKVA 1OW7A 2JP3A 2E76B 3AE3C 2E75C 4H44C 2QJPC 3D70A 4H0LC 4PV1B 1U57A 3B71A 5KKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WA9 A;  3O1F B;  3G1B A;  3G3P A;  1MG9 A;  2W9R A;  1RQS A;  3GQ1 A;  3DNJ A;  1LZW A;  1MBV B;  3GW1 A;  3GQ0 A;  1CTF A;  3G19 A;  1R6Q C;  1DD4 A;  4YJX A;  1R6O C;  1DD3 A;  1RQU A;  4YJM A;  1RQV A;  1MBU C;  3O2H A;  3O1F A;  4YKA A;  2WA8 A;  1MBX C;  3O2O A;  3O2B A; 
#chains in the Genus database with same CATH topology
 3V4W A;  3PIO W;  2O3J A;  1ZW0 A;  1KB9 I;  2BCC J;  1Q7Y X;  2WWW A;  2E74 C;  4U3F G;  3P8M C;  2W83 C;  3M0D A;  4CJN A;  1GMJ A;  2K1A A;  1RE3 A;  1ZLL A;  1MWR A;  3D6Z A;  5TIS E;  1KV4 A;  3MD0 A;  1PGQ A;  3MUD C;  1MBX C;  2QRX A;  3H1L G;  3BAS A;  3CCS P;  2GA1 A;  3G3P A;  5B66 H;  2K9J A;  1NJI X;  4WFA W;  3AEB C;  1PP9 J;  1WRG A;  1RQU A;  4OGQ B;  2O01 N;  1NTM J;  2M3E A;  1MBU C;  2OYH B;  5AVQ B;  1LTS C;  1LWU B;  3AED C;  3CCM W;  1N7S C;  4XFJ A;  1JTH A;  3L72 G;  2PGD A;  2FY8 A;  1A02 J;  1PP9 E;  2W27 A;  4C7R A;  2WSF J;  2V4H A;  3W7S A;  1PP9 D;  1Q90 D;  1YJ9 W;  1NTM E;  1NTM D;  1GK4 A;  5CCG D;  3AE7 C;  3WUT A;  2I1K A;  1AQ5 A;  3AEA C;  2Z5H A;  2Q3E A;  3CCU W;  2K9J B;  3GQ0 A;  3AE1 C;  1NHL A;  1YI2 P;  1VQ9 P;  1LTG C;  3A0B H;  4AYC A;  4D6T J;  4H44 C;  3H1J G;  3H25 A;  2QE7 H;  5CCG A;  4BRY A;  1NVO A;  2WSE H;  3Q5P A;  4EI2 A;  2IPP A;  2HLO A;  1RF0 A;  3DLL W;  1JTH B;  5APU A;  3CXC V;  1Q2N A;  3KQG A;  5CJ0 A;  4TLF A;  1HUC A;  2W6J H;  1DEE G;  1FZG A;  4ZKU A;  4IOA W;  5KAF H;  3I5C A;  4D6T D;  4DJG A;  2LXC B;  1S9K E;  2E42 A;  1VF5 B;  2QEX P;  2P67 A;  2O1J A;  2XZR A;  1S9K D;  2L91 A;  3CCQ W;  1SQB G;  1LP1 A;  2JWD A;  4ZKP A;  1PIX A;  1KMI Z;  4UB6 E;  4WVZ A;  5AVY B;  3RL0 g;  4W7Z A;  1IK7 A;  4IFF A;  3L75 E;  3L36 A;  3CCL W;  5KAI E;  1A02 F;  2Q9I A;  1JEK A;  3TGU G;  2ZYA A;  3A5T A;  1LTA C;  1IZN B;  3TYY A;  2C0W A;  5AW8 B;  3W67 A;  1MKM A;  1PFI A;  1IFD A;  5AW6 B;  3BCC E;  3GHG B;  4GOF A;  4L75 A;  2FYZ A;  2QJY C;  3C8V A;  1GTW A;  1NJI Q;  1NU1 G;  3CL3 D;  2OTL P;  4OVN F;  3TNU A;  1BE3 J;  1LP1 B;  3D70 A;  3J7Z Z;  3B71 A;  1X8Y A;  1N73 C;  4H13 D;  3PLN A;  3PHL A;  1N8R X;  5EFW B;  1QVF V;  1NYH A;  2VRS A;  4LC1 A;  2QEX W;  3VMZ A;  2J5U A;  3TDK A;  3CME W;  4U3F J;  2J58 A;  1PZQ A;  3WMM 0;  4WFN W;  1KQS V;  1OXZ A;  2KI7 B;  2MJZ A;  1HJB A;  3Q3D A;  2ZJP W;  2Y9Z A;  1U7M A;  1JY2 O;  3HD7 C;  3V2N A;  3H1H G;  2W9R A;  1W2B V;  1GW3 A;  2ZT9 D;  3FWL A;  3MP7 B;  1JY3 P;  3TK1 A;  3L70 G;  1KIL B;  1M1J C;  3II6 A;  1VQ4 P;  1ZRT E;  2NPS C;  1RF1 C;  1NTK G;  1ZRT D;  3CX5 E;  2KIK A;  1VQ6 P;  1BDD A;  1KQF B;  4I7Z B;  3CX5 D;  5AW9 B;  4IOC W;  4U3F E;  3A0H H;  4MN4 C;  2AXT E;  3TNU B;  4U3F D;  3CX5 I;  1BCC J;  3G71 P;  1BGY J;  5KJ7 D;  1LZW A;  3H1L E;  1L4A C;  1NKN A;  3L72 J;  2IYO A;  1FZE A;  2OTL W;  1K04 A;  2AEM A;  1QEX A;  1ZR4 A;  2Q3I A;  1H89 A;  2H88 C;  5K5G B;  1WMK A;  1T6A A;  4H13 B;  4W7Y A;  5KJ7 A;  1R5S A;  3KXD A;  1RY3 A;  1DIP A;  1BCC D;  5B5E H;  1BGY D;  1J1E B;  3CF5 W;  1EDJ A;  4O9B A;  2A45 H;  3L72 E;  1U57 A;  3TSI A;  1MV8 A;  3L72 D;  5BVZ A;  3W7W A;  1CZQ A;  3AE8 C;  1MBV B;  3RGU A;  1EDK A;  1VQ4 W;  2BCC G;  3VYI A;  4IL6 X;  3QH9 A;  3I55 W;  1VPC A;  4WB4 A;  1ZOY C;  2Q5U A;  4C7N A;  1VQ6 W;  1N86 A;  4LGD E;  1LTI C;  1W2E A;  3G1B A;  1IK9 A;  2XU6 A;  2WQY C;  1MWU A;  2R44 A;  5CA3 A;  1IFJ A;  4WY4 D;  4L73 A;  2ZJQ W;  3H1J E;  5CMZ A;  4UY8 Z;  3H1J D;  1LT9 C;  3CCV W;  4H0L D;  2FYN C;  4DCK A;  1GL2 C;  1URQ C;  2XND H;  3F5H A;  4GIF A;  5AVX B;  1OMI A;  5M1B A;  5APX A;  1SQB J;  3NFQ A;  1M56 D;  4AQR D;  4WY4 A;  1YTZ T;  3P7K A;  3L71 J;  2KZI A;  3GG2 A;  1N8R Q;  1JOC A;  4PD4 D;  1RQV A;  2POH A;  4GT1 A;  5CJ4 A;  3OA7 A;  1KZU B;  5APQ A;  3RK3 E;  3V6I A;  1SQB K;  4PD4 I;  4ZMD A;  5BU5 A;  1Q86 Q;  3L37 A;  3RK3 D;  4Y99 B;  1SQB E;  3TGU J;  3HTK A;  5M18 A;  4C7N B;  2BEZ F;  1R8E A;  3RL0 C;  1SQB D;  4YXW H;  4EYY Q;  3F89 A;  4UB8 E;  1IJD B;  3L71 D;  2KXP B;  4PJ0 E;  3V5B A;  4PV1 B;  2NZ2 A;  2ZXE B;  1HGV A;  1AQT A;  3TGU E;  4JYB A;  4C46 A;  4D6T G;  2KSE A;  3TGU D;  2Z4E A;  5L8R J;  3KZI E;  3SWK A;  1QL1 A;  2E76 D;  4WY4 B;  1MWT A;  3H1I G;  4JBZ A;  1NU1 K;  2IDB A;  4H0L B;  4HB1 A;  3IN6 A;  5DJT B;  1HJ0 A;  3B5N C;  1NU1 E;  2A06 G;  4BXL A;  1YIT P;  1X22 A;  1X9V A;  3HTK B;  1JM0 A;  2FKW B;  3UIA A;  1PGP A;  1LTT C;  3L70 J;  1FDO A;  3LIE A;  1JMB A;  3SFE C;  1NTK J;  2E74 D;  4DT0 A;  3CC7 P;  2PRR A;  2P58 A;  1YQ3 C;  1M7L A;  1R6O C;  1FC2 C;  3GW6 A;  3H1H E;  5B66 E;  3L70 E;  1Z56 A;  1QX8 A;  3L70 D;  1OX3 A;  2WPV B;  1NTK D;  5AW3 B;  1EXJ A;  1M90 Q;  1SQP G;  2OTJ W;  2B89 A;  3Q5S A;  2PAJ A;  5APS A;  1JY3 N;  3MUD A;  3PH0 A;  1BSN A;  1EC5 A;  3EFF K;  2E76 B;  5APY A;  3VP8 A;  2M0B A;  3Q5R A;  1N7S D;  2WVR A;  1MG9 A;  3NTN A;  4A7P A;  2ZAE B;  2KOG A;  2OAR A;  1S3J A;  5GAD a;  1BE3 G;  2KZJ A;  4ASV A;  1DEB A;  3G6E P;  4YXD C;  2CK3 H;  2WPQ A;  2WSE J;  2CPS A;  2G3A A;  3OAK A;  4WFB W;  1GDT A;  1PL5 A;  1N7S A;  1SLQ A;  4RJT A;  1AFO A;  3JCU E;  2E74 B;  1FZB A;  1OVR A;  2HYN A;  1YJW P;  2HPC A;  3N7N A;  1KFM A;  2WMM A;  2OYI C;  1MWS A;  1KYO H;  3MTU E;  3KYQ A;  3CC4 P;  1VQK P;  1VQP W;  3FX0 A;  1LTJ C;  3T97 A;  2BCC E;  3W7T A;  1OZH A;  1SVF A;  2BCC D;  2IZ1 A;  5KAF E;  1EDL A;  1BCC G;  2K3R A;  1BGY G;  2ITA A;  1KC8 X;  1ZXG A;  3EFG A;  1VF5 D;  1HTL C;  2Y9Y A;  2KNC A;  1N7S B;  2KLU A;  1VQO P;  2K9Y A;  4U67 W;  2OYH C;  3D3I A;  1J1D B;  1NTM K;  1ZME C;  1YIJ P;  3G6E W;  3RBZ A;  2E75 C;  1H88 A;  2HPC B;  5GTI E;  3EQ2 A;  5CHX A;  2OGU A;  5H2F E;  3T97 B;  2Y0D A;  2YO3 A;  1KQG B;  1YYC A;  3M9Q A;  3RK2 D;  1R5L A;  1QVG O;  5M19 A;  1KB9 H;  4H44 B;  4JQ0 D;  3H6P A;  1FJP A;  1K9M Q;  1SQQ G;  1QLE D;  2HR3 A;  1W5C E;  1DH3 A;  3CC2 P;  2QSI A;  3H1I J;  5AW4 B;  2JR8 A;  1S5L E;  1SQV J;  3CCS W;  2ZJS E;  3CC4 W;  1S1C X;  1VQK W;  2KNC B;  2C9L Y;  2B87 B;  2J59 M;  2YMY A;  1OIP A;  3ZFZ A;  3G4S P;  4D6T E;  3GHG A;  5TIS H;  2YXQ B;  3H1I E;  3CCJ P;  2QIW A;  3USS A;  3H1I D;  1PGO A;  1R6Q C;  4WBA A;  1SQV D;  1VQQ A;  2A06 E;  1S72 P;  2ZYD A;  1HVV A;  1L2P A;  4EOT A;  2O01 H;  1KIL E;  3HD7 D;  1M1K Q;  2A06 D;  3L71 G;  1EQ7 A;  4BL3 A;  3I56 P;  1YJN P;  1KIL D;  1Y9B A;  3VMY A;  1HWT C;  1H0T B;  1AJY A;  5C39 A;  2R32 A;  3GW1 A;  2RH0 A;  3FXD A;  1Q7Y Q;  2ZVN B;  3AEG C;  4XA4 A;  1JY3 O;  2K88 A;  3HUS A;  4OWF A;  1CI6 B;  2MKV A;  4BWN A;  4I6M C;  5GW7 A;  1SQP J;  3HD7 A;  3O2O A;  1SQX G;  3RK2 B;  1YI2 W;  1VQ9 W;  1KIL A;  3WU2 E;  3A2A A;  3SFD C;  1RF1 A;  1ZR2 A;  2ZJR W;  5AVR B;  4HH2 A;  2FYU J;  3BVH A;  3K5B A;  3JSV C;  1RF0 C;  1SQP K;  4OH8 B;  2FFD C;  1PGJ A;  5AVV B;  1SQP E;  5APW A;  1N73 B;  1SQP D;  3G4S W;  5B5E E;  1FDM A;  3G9R A;  1M8O B;  5DJU B;  1CTF A;  1L0L J;  2B9B A;  2ZXX A;  3BAT A;  5TJH A;  1JMM A;  1PV3 A;  5M1A A;  3HUS B;  1BE3 E;  1RH5 B;  2XKM A;  2YMK A;  2GUV A;  3HD7 B;  1BE3 D;  1UIX A;  4ZNC A;  1VQ5 P;  4NPF X;  3I56 W;  1YJN W;  1EDI A;  1T2K D;  1RF1 B;  2KS1 B;  2JO1 A;  2WPS A;  3VMX A;  4B86 A;  2SPZ A;  3RBX A;  1E5W A;  2XDJ A;  1VQ7 P;  4UB6 H;  3DNJ A;  3CMA P;  1Y8A A;  3L4F A;  1VQM P;  5KAI H;  1FZC C;  1L4A B;  1GL2 D;  1URQ D;  3SSU A;  2AEJ A;  5DM7 W;  1T3U A;  3ITK A;  3MIW A;  2FXO A;  4RES B;  3CWB G;  2YIU C;  1BCC E;  1TU3 F;  1BGY E;  1LT9 A;  1K73 X;  1FDI A;  1GL2 A;  1URQ A;  3AE5 C;  3D71 A;  2OQQ A;  1YHQ P;  2Q1K A;  3RL0 D;  1JB0 J;  1WT6 A;  2Q6Q A;  2QM8 A;  3VP9 A;  1SQQ J;  1JY2 P;  4RKU J;  2WIT A;  1KQL A;  3E7K A;  1VQ5 W;  2M5A A;  2BAS A;  4PV1 D;  4DZO A;  2DW3 A;  1X79 B;  4KHX A;  1CW5 A;  4IOI H;  5AVZ B;  2JWA A;  2ZT9 C;  3B8E B;  4IL6 H;  2C0X A;  2HFE D;  5AW1 B;  1SQQ K;  3IR9 A;  5AVT B;  4YJX A;  1USD A;  1SQQ E;  3G71 W;  1FZF A;  4DKI A;  4NPE A;  3S9O A;  1LT9 B;  1SQQ D;  4NPD A;  1KFN A;  3CX5 H;  1SFC D;  1GL2 B;  1URQ B;  5GAE a;  3B5N D;  1E79 H;  2LR2 A;  1M57 D;  2V7Q H;  4PD4 E;  2R3S A;  1P84 E;  2YNY A;  4YKA A;  5GTH E;  2JP3 A;  1SFC A;  2IYP A;  1P84 D;  3N4X A;  5KKZ C;  3LW5 H;  3B5N A;  2M5A B;  1Q81 X;  2WT7 B;  1FJK A;  1P84 I;  2I1J A;  2GM4 A;  3RL0 B;  1SQX J;  3L71 E;  1MFZ A;  2WZ7 A;  1L0N G;  2Y0E A;  2YO2 A;  2FXP A;  1FBM A;  5KTB A;  3E1R A;  1JNM A;  2M3B A;  3PTZ A;  1SQX K;  3GMA A;  1SQX E;  1CSB A;  1QVF O;  3C9I A;  5CCH C;  2WSS H;  2W6A A;  3M06 A;  3HE5 A;  1SQX D;  2G8Y A;  1SQV G;  3O2B A;  1OVU A;  3HRN A;  1S2E A;  3ZG5 A;  2WA9 A;  3AEF C;  1VDF A;  1SFC B;  2AXC A;  2BEQ D;  3B5N B;  5E79 E;  2QJK C;  1FU1 A;  1KQS O;  2Y0C A;  1G2C A;  1DD4 A;  2NRG A;  2N1T C;  1W2B O;  1LGH B;  3MZW B;  3GF7 A;  1K73 Q;  1K8A X;  3U59 A;  5DM6 W;  3ZG0 A;  3V2Q A;  4DOJ A;  1OFC X;  2D2C C;  1U7J A;  3W7X A;  1NTK K;  1KYO D;  2QJP C;  1NTK E;  3HE5 B;  4KJM A;  3AEE C;  1LNQ A;  3RK3 C;  3L74 G;  1SP4 A;  4IFM A;  3VOP A;  3E1I A;  3CWB J;  5BU8 B;  4GOE A;  2OYI A;  2N9Y B;  2E5T A;  1G2C B;  2P2U A;  5KLI B;  2R3C A;  2A45 G;  3SWF A;  1T8Z A;  1LTJ A;  4UB8 H;  2R5D A;  4WCE W;  2FYU G;  1EZV D;  2WSC H;  1KD1 X;  4PJ0 H;  4LLH A;  3MHV A;  1BSH A;  3M9H A;  1AA0 A;  2RKL A;  1PPJ G;  5CBN A;  3V4Q A;  3CCM P;  2JKV A;  2I8D A;  3CWB E;  2E75 D;  1YIT W;  1HH0 A;  1HGZ A;  2RN0 A;  3CWB D;  2YKP A;  1OVV A;  1L0L G;  1GU5 A;  5AW7 B;  2IZ0 A;  3L73 G;  3CCR P;  2KYV A;  3MGN A;  3A0B E;  1Q81 Q;  1YJ9 P;  2N9B A;  2KP8 A;  1FZA A;  3H32 A;  3CC7 W;  5APV A;  1DD3 A;  3D6Y A;  1G1I A;  4H44 D;  1LTB C;  3ABV C;  1T3J A;  2OYI B;  3CCU P;  2P7J A;  2PFX A;  4YPC A;  3OJA B;  1LTJ B;  3OW2 O;  2O01 J;  1YQ4 C;  5AW0 B;  3CXH H;  4RO0 A;  3O6Q A;  2K37 A;  4HKZ H;  1JY2 N;  1HBW A;  1USE A;  3NMD A;  1BXY A;  3AEC C;  3CLQ A;  2B87 A;  3AE6 C;  3IFM A;  4OGQ C;  1RE4 C;  4WWI A;  1IO4 A;  1XTC C;  3ZDM A;  3H32 B;  1LWU C;  1QL2 A;  4TT3 H;  1MZ9 A;  2E75 B;  3L35 A;  3CCQ P;  1RQS A;  1NO4 A;  1L0N J;  1FS0 E;  5AVU B;  3Q2Y A;  1K8A Q;  1NKZ B;  1J1D C;  1IFM A;  3CCR W;  3M0D C;  3A3Y B;  3R4Y A;  2HG5 D;  2XNX A;  4YJM A;  1NTZ G;  1RE3 C;  3CCL P;  1H0T A;  3O6Q B;  1YJW W;  1L0N K;  1QGK B;  4XE5 B;  1L0N E;  5JVH W;  4ASW A;  1IFP A;  1CI6 A;  1L0N D;  3JCU H;  3U1A A;  4CPK A;  3CI9 A;  1DX7 A;  3FGA D;  2YKO A;  3IF4 A;  1JCC A;  2H7H A;  2B88 A;  2IBZ G;  2IX7 C;  1SQV K;  1BDC A;  1SQV E;  1IFN A;  1KD1 Q;  1JJ2 V;  2FFD A;  1VQO W;  3CPW O;  1N73 A;  2W6B A;  3H1K G;  3L75 J;  1IC2 A;  1YIJ W;  1ZV8 A;  1VF5 C;  2NPS D;  3CME P;  1AV1 A;  1KN7 A;  3M0A A;  1FE6 A;  3V2P A;  3A0H E;  1KOR A;  2M8R A;  3L74 J;  1LT1 A;  3VN0 A;  2P1J A;  4HJG H;  2IFN A;  3KDP B;  3BCC J;  5CCG C;  1M1J A;  2R5B A;  3PIP W;  4BRY B;  2NPS A;  3L75 D;  2KS1 A;  2QG4 A;  2QM7 A;  2RMZ A;  1FAV A;  3CC2 W;  5GTI H;  1Y47 A;  1OW8 A;  3G19 A;  1JO5 A;  1L4A D;  3BRV B;  2QJY B;  3O1F A;  3L74 E;  1RHZ B;  5H2F H;  4JYC A;  3RK2 C;  2WA8 A;  2FFD B;  3L74 D;  1S5L X;  3GHG C;  2WSF H;  3W68 A;  4W80 A;  2AEF A;  5CBO A;  3BCC D;  1KC8 Q;  4M3L A;  1NWQ A;  2FYU K;  1L4A A;  4I2L C;  1FZC A;  1S5L H;  3AE2 C;  2H43 A;  3CCJ W;  1JUN A;  2FYU E;  3IAO A;  3L73 J;  1OWA A;  2FYU D;  3PRJ A;  2A45 I;  1MUU A;  1PPJ E;  4K3A A;  4I1L A;  5GAH a;  1S72 W;  1PPJ D;  4JF7 A;  1XTG B;  2Z5I A;  1M1J B;  3QWO C;  1L0L K;  4AUW A;  1YBK A;  2NPS B;  4CPG A;  1J2J B;  1Q86 X;  1L0L E;  2E5Y A;  3HUS C;  3G3Z A;  3L73 E;  4IL6 E;  3TF5 A;  1L0L D;  4GKG A;  2V7Q J;  3L73 D;  3O1F B;  4EIJ A;  4QMA A;  5KLV G;  1KIL C;  3R2P A;  1AVY A;  4IFD K;  3H1L J;  1EZV G;  3I55 P;  2C9N Y;  2LXB A;  3LW5 J;  3AE4 C;  4I7Z C;  1Q82 X;  2ZVO B;  2JEE A;  1FZC B;  1VQL P;  3C1L A;  1NGM B;  2OYO A;  5AVW B;  3LID A;  2Q7C A;  2YKQ A;  2L5G B;  2IFM A;  2YIU B;  3CCV P;  3WU2 H;  2QA4 P;  3H1L D;  1VQN P;  3S1K A;  4GOD A;  1FOS E;  1AVO A;  3GLM A;  4H13 C;  4R4M A;  1NTZ J;  3NXS A;  1J1E C;  1X0T A;  1MFT A;  4N3Y B;  2KSJ A;  4Y28 J;  3A7O A;  2WT7 A;  4YTP C;  4L74 A;  1IFI A;  1NTZ K;  5JVG W;  2XV5 A;  1NTZ E;  2ZT9 B;  3H1J J;  2WTY A;  1VQ7 W;  1VQ8 P;  1NTZ D;  1T2K C;  5CCH D;  3HE4 A;  1OW7 A;  1M90 X;  5AW2 B;  3CMA W;  1VQM W;  2FYN B;  3WUU A;  2LKM A;  2FXM A;  1VQL W;  4KT0 J;  2AXT H;  5AW5 B;  3H1K J;  2ZFC A;  5KJ7 C;  5CCH A;  2N1T D;  1NH4 A;  3PP5 A;  2IBZ E;  3OW2 V;  4U7J A;  1FOS F;  4EDF A;  2QA4 W;  2IBZ D;  2KB7 P;  1PP9 G;  1VQN W;  5KKZ B;  1YHQ W;  1NTM G;  2IBZ I;  3VTP C;  5AVS B;  1S4X A;  3P32 A;  2D2C D;  3M91 A;  4HYT B;  3H1K E;  3O8Z A;  2N1T A;  3V2R A;  1ZN5 A;  4K35 A;  2WSC J;  3H1K D;  3O2H A;  1GZL A;  3KPE A;  3Q1M A;  4Y99 C;  1H8A A;  3HE4 B;  2QVA A;  4IO9 W;  3M9B A;  2O1K A;  1JCD A;  1GK6 A;  1G1J A;  5HL7 W;  1VQ8 W;  4PV1 C;  4WF9 W;  4Z1M H;  1EXI A;  3CCE P;  2OTJ P;  1NU1 J;  1ZP0 C;  2H89 C;  4R4L A;  2YXR B;  3CD6 P;  1Q82 Q;  3BRT B;  1QVG V;  1GW4 A;  2QJK B;  4WY4 C;  3KHU A;  1D7M A;  3PJS K;  3SWY A;  1K05 A;  3JC2 2;  5APT A;  1GD2 E;  2N1T B;  2E43 A;  4H0L C;  1SFC C;  2JJL A;  1NOH A;  2GUS A;  5GAG a;  3S4R A;  1NU1 D;  1HF9 A;  3L75 G;  3H1H J;  1KTM A;  1LJ2 A;  2D2C B;  5KLV J;  3VMA A;  1KYO E;  4PD4 H;  3GF3 A;  3P8C E;  2UWJ E;  2QJP B;  1UII A;  1P84 H;  3AE9 C;  5GTH H;  3CPW V;  1SS1 A;  3P8C D;  3CXH E;  1KYO I;  2JDI H;  3B4S A;  3RK3 B;  3CXH D;  2HOD A;  5KLV K;  1K9M X;  3EWK A;  3BCC G;  1NAY A;  5KLV E;  3CXH I;  1VQP P;  1OW6 A;  3H1H D;  4L76 A;  4N78 E;  5KLV D;  1EZV E;  4N78 D;  3GQ1 A;  4JPZ B;  2W90 A;  3CCE W;  2KK7 A;  2WPR A;  1GU4 A;  4GDO A;  4OGQ D;  3CD6 W;  1NAF A;  1EZV I;  2PP6 A;  2ZYG A;  2KUB A;  1N7L A;  2E76 C;  5KLI C;  2CPB A;  3FWN A;  3KZI H;  2KLV A;  1YTZ I;  3WUV A;  2W8Z A;  2P10 A;  2FBW C;  1VL2 A;  2H8P D;  3U1C A;  4N6J A;  2OYH A;  1RE4 A;  1M1K X;  1KB9 E;  1N2D C;  5E79 H;  4BL2 A;  1LWU A;  3W7U A;  3FXE A;  1KB9 D;  2HOD B;  3AE3 C;  2OTK E; 
#chains in the Genus database with same CATH homology
 2NZ2 A;  3H25 A;  4H13 D;  3O1F B;  3Q5P A;  3AEE C;  1MG9 A;  1VF5 C;  2YIU C;  3SFD C;  3AE8 C;  4KT0 J;  2E74 C;  1NYH A;  3AEC C;  1TU3 F;  3Q5R A;  4YXD C;  1MBV B;  3AE6 C;  1HF9 A;  3LW5 J;  3T97 B;  1GMJ A;  5L8R J;  3AE4 C;  4OGQ C;  1KTM A;  2J5U A;  2E76 D;  3O2O A;  2D2C B;  2WSE J;  1KOR A;  1FDI A;  4I7Z C;  4IL6 X;  1KQG B;  3AE5 C;  4U7J A;  3D6Z A;  2G3A A;  3D71 A;  2OQQ A;  1PL5 A;  1MBX C;  2FXP A;  3GF3 A;  1ZOY C;  4TT3 H;  4H44 B;  2E75 B;  2IDB A;  3Q3D A;  4H0L B;  1NGM B;  3G1B A;  3IN6 A;  3G3P A;  3AE9 C;  1HJ0 A;  2W9R A;  1RQS A;  2WQY C;  2QSI A;  2ZT9 D;  1VF5 B;  3G9R A;  1JB0 J;  3Q2Y A;  1ZRT E;  2D2C D;  2E74 B;  1S1C X;  2V7Q J;  3AEB C;  3GMA A;  1CTF A;  1OW8 A;  3G19 A;  4RKU J;  3EWK A;  3R4Y A;  1PIX A;  2WSC J;  1RQU A;  4OGQ B;  4YJM A;  1KQF B;  1KMI Z;  2E75 D;  4PV1 D;  1MBU C;  3O2H A;  3O1F A;  4I7Z B;  4H0L D;  1OW6 A;  1FDO A;  1PV3 A;  2FYN C;  2G8Y A;  3SFE C;  2WA8 A;  3O2B A;  1OMI A;  5M1B A;  2WA9 A;  2YMK A;  3AEF C;  3AED C;  3Q1M A;  3RL0 g;  3GLM A;  1IK7 A;  4XFJ A;  1S5L X;  4H13 C;  3GQ1 A;  4R4M A;  2E74 D;  2BEQ D;  2ZT9 C;  1UIX A;  2QJK C;  2QIW A;  1LZW A;  4GDO A;  4OGQ D;  1YQ3 C;  1R6Q C;  1DD4 A;  3AE2 C;  4YJX A;  2JO1 A;  1DD3 A;  1R6O C;  2WSF J;  3D6Y A;  2E76 C;  1RQV A;  5KLI C;  3IAO A;  1Q90 D;  4H44 D;  4PV1 C;  4Y28 J;  3S9O A;  4Z1M H;  3FGA D;  1EXI A;  3RK3 E;  1KIL E;  3ABV C;  3GF7 A;  4YTP C;  1K04 A;  1ZP0 C;  1MKM A;  1VF5 D;  3AE7 C;  2H89 C;  2H88 C;  2WPV B;  4R4L A;  1Y9B A;  3DNJ A;  1WMK A;  1AJY A;  4H13 B;  1EXJ A;  1R8E A;  2BEZ F;  2P10 A;  2ZT9 B;  3AEA C;  2O01 J;  2FBW C;  2K9Y A;  1VL2 A;  1DIP A;  1YQ4 C;  3Q5S A;  3GQ0 A;  3GW1 A;  2D2C C;  2QJY C;  3AE1 C;  3C8V A;  3AEG C;  1K05 A;  1ZME C;  3O6Q A;  4YKA A;  2MKV A;  1OW7 A;  2JP3 A;  2E76 B;  3AE3 C;  2E75 C;  4H44 C;  2QJP C;  3D70 A;  4H0L C;  4PV1 B;  1U57 A;  3B71 A;  5KKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...