The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
55
|
structure length |
55
|
Chain Sequence |
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb |
| molecule keywords |
23S ribosomal RNA
|
| molecule tags |
Ribosome/ribosome inhibitor
|
| total genus |
13
|
| structure length |
55
|
| sequence length |
55
|
| ec nomenclature | |
| pdb deposition date | 2013-01-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| W | PF00327 | Ribosomal_L30 | Ribosomal protein L30p/L7e |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ribosomal Protein L30; Chain: A, | Ribosomal protein L30, ferredoxin-like fold domain |
#chains in the Genus database with same CATH superfamily 3I56 W; 3CCR W; 1VQL W; 1QVG V; 1N8R X; 1Q7Y X; 3CCV W; 1S72 W; 2QEX W; 1YJ9 W; 5HL7 W; 3CCE W; 3G4S W; 5GAG a; 3J7Z Z; 2QA4 W; 1VQ7 W; 3PIP W; 1K9M X; 5JVH W; 4WCE W; 2OTJ W; 1YJN W; 3CCQ W; 3CD6 W; 5DM6 W; 5JVG W; 3OW2 V; 1YIT W; 3CCM W; 3CCU W; 1KD1 X; 4IOC W; 1M90 X; 1VQM W; 1YHQ W; 3CCS W; 4WFA W; 3CCL W; 3DLL W; 3I55 W; 1NJI X; 3CC7 W; 1VQO W; 3CCJ W; 1VQ8 W; 3CF5 W; 4UY8 Z; 1JJ2 V; 1KQS V; 1W2B V; 3CMA W; 4WFB W; 1VQK W; 1VQ6 W; 1BXY A; 1VQ5 W; 3G71 W; 1Q82 X; 3CC4 W; 1M1K X; 1VQ4 W; 1K73 X; 5GAD a; 5DM7 W; 3CXC V; 5GAH a; 2OTL W; 1VQN W; 1YI2 W; 1Q81 X; 3PIO W; 1Q86 X; 1VQ9 W; 1K8A X; 4WFN W; 4U67 W; 3CME W; 1YIJ W; 3CC2 W; 1QVF V; 3CPW V; 3G6E W; 1KC8 X; 2ZJQ W; 1VQP W; 4WF9 W; 2ZJR W; 2ZJP W; 4IOA W; 5GAE a; 1YJW W; 4IO9 W; #chains in the Genus database with same CATH topology 3I56 W; 3CCR W; 1VQL W; 1QVG V; 1DD3 A; 1N8R X; 1Q7Y X; 3CCV W; 1MBX C; 1S72 W; 3ZFZ A; 2QEX W; 1MWS A; 1YJ9 W; 5HL7 W; 1MG9 A; 3DNJ A; 3CCE W; 1CTF A; 3W7U A; 1MWR A; 3G4S W; 5GAG a; 3J7Z Z; 2QA4 W; 1VQ7 W; 1RQV A; 3PIP W; 1K9M X; 5JVH W; 3G19 A; 4WCE W; 3O2B A; 2WA9 A; 2OTJ W; 1YJN W; 3CCQ W; 3CD6 W; 1MWU A; 5DM6 W; 4BL3 A; 5JVG W; 3W7W A; 3OW2 V; 1YIT W; 3CCM W; 3G3P A; 3CCU W; 1KD1 X; 1VQQ A; 3G1B A; 5M1A A; 4IOC W; 1M90 X; 1VQM W; 5M18 A; 1RQS A; 3O1F B; 1YHQ W; 3CCS W; 3O2O A; 1MWT A; 4WFA W; 3CCL W; 2WA8 A; 3DLL W; 3I55 W; 4BL2 A; 1NJI X; 3CC7 W; 1VQO W; 3CCJ W; 3ZG5 A; 3GW1 A; 1VQ8 W; 3CF5 W; 4UY8 Z; 1JJ2 V; 1R6Q C; 4YJX A; 3W7S A; 1KQS V; 1W2B V; 3CMA W; 4WFB W; 1VQK W; 1VQ6 W; 1BXY A; 1VQ5 W; 3G71 W; 1Q82 X; 5CA3 A; 4CPK A; 3CC4 W; 3GQ0 A; 1M1K X; 5M19 A; 4CJN A; 1VQ4 W; 1K73 X; 2W9R A; 5GAD a; 4YKA A; 5DM7 W; 3CXC V; 3O2H A; 5GAH a; 2OTL W; 1VQN W; 1YI2 W; 1Q81 X; 3PIO W; 1Q86 X; 1VQ9 W; 4YJM A; 1MBV B; 1RQU A; 3GQ1 A; 5GW7 A; 1LZW A; 1K8A X; 4WFN W; 1R6O C; 4U67 W; 3CME W; 1YIJ W; 3O1F A; 3ZG0 A; 3D3I A; 3CC2 W; 1QVF V; 3CPW V; 3W7X A; 3G6E W; 1KC8 X; 1DD4 A; 4DKI A; 2ZJQ W; 1VQP W; 4WF9 W; 2ZJR W; 2ZJP W; 4IOA W; 5GAE a; 3W7T A; 1YJW W; 1MBU C; 4IO9 W; #chains in the Genus database with same CATH homology 3I56 W; 3CCR W; 1VQL W; 1QVG V; 1N8R X; 1Q7Y X; 3CCV W; 1S72 W; 2QEX W; 1YJ9 W; 5HL7 W; 3CCE W; 3G4S W; 5GAG a; 3J7Z Z; 2QA4 W; 1VQ7 W; 3PIP W; 1K9M X; 5JVH W; 4WCE W; 2OTJ W; 1YJN W; 3CCQ W; 3CD6 W; 5DM6 W; 5JVG W; 3OW2 V; 1YIT W; 3CCM W; 3CCU W; 1KD1 X; 4IOC W; 1M90 X; 1VQM W; 1YHQ W; 3CCS W; 4WFA W; 3CCL W; 3DLL W; 3I55 W; 1NJI X; 3CC7 W; 1VQO W; 3CCJ W; 1VQ8 W; 3CF5 W; 4UY8 Z; 1JJ2 V; 1KQS V; 1W2B V; 3CMA W; 4WFB W; 1VQK W; 1VQ6 W; 1BXY A; 1VQ5 W; 3G71 W; 1Q82 X; 3CC4 W; 1M1K X; 1VQ4 W; 1K73 X; 5GAD a; 5DM7 W; 3CXC V; 5GAH a; 2OTL W; 1VQN W; 1YI2 W; 1Q81 X; 3PIO W; 1Q86 X; 1VQ9 W; 1K8A X; 4WFN W; 4U67 W; 3CME W; 1YIJ W; 3CC2 W; 1QVF V; 3CPW V; 3G6E W; 1KC8 X; 2ZJQ W; 1VQP W; 4WF9 W; 2ZJR W; 2ZJP W; 4IOA W; 5GAE a; 1YJW W; 4IO9 W;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...