The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
LERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSEDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis of an N-Degron Adaptor with More Stringent Specificity.
pubmed doi rcsb |
molecule tags |
Protein binding
|
source organism |
Agrobacterium tumefaciens (strain c58 / atcc 33970)
|
molecule keywords |
ATP-dependent Clp protease adapter protein ClpS 2
|
total genus |
22
|
structure length |
85
|
sequence length |
85
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2015-03-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02617 | ClpS | ATP-dependent Clp protease adaptor protein ClpS |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Ribosomal Protein L30; Chain: A, | Ribosomal Protein L30; Chain: A, |
#chains in the Genus database with same CATH superfamily 2W9R A; 3GQ1 A; 3O2H A; 3DNJ A; 3O2B A; 3G19 A; 1MG9 A; 3O1F A; 3O2O A; 3GQ0 A; 4YJM A; 1MBU C; 2WA9 A; 4YKA A; 3GW1 A; 1RQV A; 1DD4 A; 3O1F B; 1LZW A; 1RQU A; 1MBV B; 3G3P A; 1DD3 A; 1MBX C; 1CTF A; 1RQS A; 3G1B A; 2WA8 A; 1R6O C; 4YJX A; 1R6Q C; #chains in the Genus database with same CATH topology 3O2H A; 3O2B A; 3I56 W; 3G19 A; 4IOA W; 3CCS W; 3CCU W; 3CCQ W; 3O1F A; 4BL2 A; 4CJN A; 2OTJ W; 1VQ9 W; 5DM7 W; 4CPK A; 4YJM A; 2WA9 A; 4YKA A; 4DKI A; 1S72 W; 2ZJR W; 3CCR W; 1K8A X; 1LZW A; 2ZJP W; 4BL3 A; 1W2B V; 1K73 X; 4UY8 Z; 5JVH W; 1QVF V; 1MBX C; 4U67 W; 2QA4 W; 4IO9 W; 3CMA W; 3I55 W; 5CA3 A; 1VQN W; 2W9R A; 1BXY A; 1M90 X; 1JJ2 V; 1Q7Y X; 3ZG5 A; 4WF9 W; 1MWR A; 1VQQ A; 5M18 A; 3W7X A; 3ZG0 A; 1N8R X; 1VQM W; 1Q82 X; 3O2O A; 1MWU A; 5GAD a; 3GW1 A; 3CPW V; 5JVG W; 1RQV A; 3W7U A; 3W7T A; 3G6E W; 3O1F B; 1VQK W; 1MBV B; 3CCJ W; 4WFN W; 1VQ4 W; 1NJI X; 1KQS V; 5GAE a; 1VQ7 W; 1YJ9 W; 2WA8 A; 1MG9 A; 3CXC V; 3GQ1 A; 3CCV W; 3OW2 V; 3G4S W; 3CCM W; 1Q81 X; 3DLL W; 1KC8 X; 3CC4 W; 1YIJ W; 3CCE W; 5M1A A; 3GQ0 A; 3PIO W; 1VQP W; 3CCL W; 3W7S A; 5GAH a; 1RQU A; 3D3I A; 1YJW W; 3G3P A; 1YJN W; 4IOC W; 1YHQ W; 1VQO W; 1YI2 W; 2OTL W; 1QVG V; 1CTF A; 3PIP W; 5DM6 W; 1Q86 X; 1K9M X; 3G1B A; 3ZFZ A; 3CC2 W; 1M1K X; 4YJX A; 1R6Q C; 5M19 A; 3DNJ A; 4WCE W; 1KD1 X; 5HL7 W; 1MWT A; 2ZJQ W; 4WFB W; 5GW7 A; 3CME W; 1MWS A; 3CF5 W; 1YIT W; 1VQ6 W; 1MBU C; 3G71 W; 1DD4 A; 3CC7 W; 1VQL W; 4WFA W; 5GAG a; 2QEX W; 3W7W A; 1DD3 A; 1VQ5 W; 1VQ8 W; 3CD6 W; 1RQS A; 3J7Z Z; 1R6O C; #chains in the Genus database with same CATH homology 2W9R A; 3GQ1 A; 3O2H A; 3DNJ A; 3O2B A; 3G19 A; 1MG9 A; 3O1F A; 3O2O A; 3GQ0 A; 4YJM A; 1MBU C; 2WA9 A; 4YKA A; 3GW1 A; 1RQV A; 1DD4 A; 3O1F B; 1LZW A; 1RQU A; 1MBV B; 3G3P A; 1DD3 A; 1MBX C; 1CTF A; 1RQS A; 3G1B A; 2WA8 A; 1R6O C; 4YJX A; 1R6Q C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...