4IOCW

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00327 Ribosomal_L30 Ribosomal protein L30p/L7e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1390.20 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal protein L30, ferredoxin-like fold domain 4iocW00
5GADa 1YJ9W 1K9MX 2QA4W 3G6EW 1VQ8W 1K73X 1YJNW 3G71W 5JVHW 2ZJPW 3J7ZZ 5HL7W 3OW2V 4UY8Z 1W2BV 4U67W 1N8RX 1VQ6W 3CF5W 5DM7W 3CCSW 4WFNW 4WFAW 2OTLW 2OTJW 4WFBW 3PIOW 4WF9W 5GAEa 1Q86X 1KD1X 1NJIX 4IO9W 1M1KX 4IOCW 1Q7YX 1Q81X 3CXCV 1YJWW 1KQSV 3PIPW 5DM6W 1BXYA 4WCEW 3CCMW 3DLLW 1QVGV 3I56W 5JVGW 3CCUW 3CC7W 1VQPW 1S72W 3CCQW 1YHQW 3CCVW 2ZJRW 1VQ7W 1VQ9W 3CCRW 3CMAW 5GAHa 1Q82X 1KC8X 3CCJW 1YI2W 1YIJW 3CCLW 1VQMW 3CPWV 1VQ4W 3CMEW 1M90X 3I55W 4IOAW 2QEXW 3CC4W 1K8AX 1VQOW 3CCEW 2ZJQW 3G4SW 1VQ5W 1VQNW 1QVFV 1YITW 5GAGa 1JJ2V 3CD6W 1VQLW 1VQKW 3CC2W
chains in the Genus database with same CATH superfamily
5GADa 1YJ9W 1K9MX 1CTFA 1RQVA 2QA4W 3G6EW 3W7UA 1VQ8W 5M19A 1K73X 1YJNW 3G71W 3O1FB 5JVHW 4YKAA 1MBUC 2ZJPW 3J7ZZ 1DD4A 5HL7W 3G3PA 3OW2V 4UY8Z 3W7WA 2WA8A 3GQ1A 1W2BV 4U67W 1N8RX 1VQ6W 1MWTA 3CF5W 5DM7W 3CCSW 4WFNW 4WFAW 2OTLW 2WA9A 2OTJW 4WFBW 3PIOW 4WF9W 3O1FA 5GAEa 1Q86X 3W7TA 3O2BA 1DD3A 1KD1X 1MWSA 1NJIX 1R6QC 5GW7A 4IO9W 5CA3A 1M1KX 1R6OC 4BL3A 4IOCW 1Q7YX 1LZWA 3D3IA 3W7XA 1Q81X 3CXCV 1YJWW 1RQUA 3DNJA 1KQSV 3PIPW 3G19A 5DM6W 1BXYA 4WCEW 3CCMW 3DLLW 1MBXC 1QVGV 3I56W 1MBVB 5JVGW 4CPKA 3CCUW 3CC7W 1VQPW 1MWRA 1S72W 3GQ0A 3CCQW 5M1AA 1YHQW 3CCVW 2ZJRW 1VQ7W 2W9RA 1MWUA 1VQ9W 3ZG5A 4BL2A 3O2HA 3CCRW 3W7SA 3CMAW 3G1BA 5GAHa 1Q82X 1KC8X 3CCJW 1YI2W 1YIJW 3CCLW 1VQQA 1MG9A 3ZFZA 1VQMW 3GW1A 3CPWV 1VQ4W 1RQSA 3CMEW 1M90X 3I55W 4IOAW 2QEXW 3O2OA 3CC4W 1K8AX 1VQOW 3CCEW 4DKIA 4YJXA 2ZJQW 3G4SW 5M18A 1VQ5W 1VQNW 1QVFV 1YITW 5GAGa 1JJ2V 3CD6W 4CJNA 4YJMA 1VQLW 3ZG0A 1VQKW 3CC2W
chains in the Genus database with same CATH topology
5GADa 1YJ9W 1K9MX 2QA4W 3G6EW 1VQ8W 1K73X 1YJNW 3G71W 5JVHW 2ZJPW 3J7ZZ 5HL7W 3OW2V 4UY8Z 1W2BV 4U67W 1N8RX 1VQ6W 3CF5W 5DM7W 3CCSW 4WFNW 4WFAW 2OTLW 2OTJW 4WFBW 3PIOW 4WF9W 5GAEa 1Q86X 1KD1X 1NJIX 4IO9W 1M1KX 4IOCW 1Q7YX 1Q81X 3CXCV 1YJWW 1KQSV 3PIPW 5DM6W 1BXYA 4WCEW 3CCMW 3DLLW 1QVGV 3I56W 5JVGW 3CCUW 3CC7W 1VQPW 1S72W 3CCQW 1YHQW 3CCVW 2ZJRW 1VQ7W 1VQ9W 3CCRW 3CMAW 5GAHa 1Q82X 1KC8X 3CCJW 1YI2W 1YIJW 3CCLW 1VQMW 3CPWV 1VQ4W 3CMEW 1M90X 3I55W 4IOAW 2QEXW 3CC4W 1K8AX 1VQOW 3CCEW 2ZJQW 3G4SW 1VQ5W 1VQNW 1QVFV 1YITW 5GAGa 1JJ2V 3CD6W 1VQLW 1VQKW 3CC2W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD a;  1YJ9 W;  1K9M X;  2QA4 W;  3G6E W;  1VQ8 W;  1K73 X;  1YJN W;  3G71 W;  5JVH W;  2ZJP W;  3J7Z Z;  5HL7 W;  3OW2 V;  4UY8 Z;  1W2B V;  4U67 W;  1N8R X;  1VQ6 W;  3CF5 W;  5DM7 W;  3CCS W;  4WFN W;  4WFA W;  2OTL W;  2OTJ W;  4WFB W;  3PIO W;  4WF9 W;  5GAE a;  1Q86 X;  1KD1 X;  1NJI X;  4IO9 W;  1M1K X;  4IOC W;  1Q7Y X;  1Q81 X;  3CXC V;  1YJW W;  1KQS V;  3PIP W;  5DM6 W;  1BXY A;  4WCE W;  3CCM W;  3DLL W;  1QVG V;  3I56 W;  5JVG W;  3CCU W;  3CC7 W;  1VQP W;  1S72 W;  3CCQ W;  1YHQ W;  3CCV W;  2ZJR W;  1VQ7 W;  1VQ9 W;  3CCR W;  3CMA W;  5GAH a;  1Q82 X;  1KC8 X;  3CCJ W;  1YI2 W;  1YIJ W;  3CCL W;  1VQM W;  3CPW V;  1VQ4 W;  3CME W;  1M90 X;  3I55 W;  4IOA W;  2QEX W;  3CC4 W;  1K8A X;  1VQO W;  3CCE W;  2ZJQ W;  3G4S W;  1VQ5 W;  1VQN W;  1QVF V;  1YIT W;  5GAG a;  1JJ2 V;  3CD6 W;  1VQL W;  1VQK W;  3CC2 W; 
#chains in the Genus database with same CATH topology
 5GAD a;  1YJ9 W;  1K9M X;  1CTF A;  1RQV A;  2QA4 W;  3G6E W;  3W7U A;  1VQ8 W;  5M19 A;  1K73 X;  1YJN W;  3G71 W;  3O1F B;  5JVH W;  4YKA A;  1MBU C;  2ZJP W;  3J7Z Z;  1DD4 A;  5HL7 W;  3G3P A;  3OW2 V;  4UY8 Z;  3W7W A;  2WA8 A;  3GQ1 A;  1W2B V;  4U67 W;  1N8R X;  1VQ6 W;  1MWT A;  3CF5 W;  5DM7 W;  3CCS W;  4WFN W;  4WFA W;  2OTL W;  2WA9 A;  2OTJ W;  4WFB W;  3PIO W;  4WF9 W;  3O1F A;  5GAE a;  1Q86 X;  3W7T A;  3O2B A;  1DD3 A;  1KD1 X;  1MWS A;  1NJI X;  1R6Q C;  5GW7 A;  4IO9 W;  5CA3 A;  1M1K X;  1R6O C;  4BL3 A;  4IOC W;  1Q7Y X;  1LZW A;  3D3I A;  3W7X A;  1Q81 X;  3CXC V;  1YJW W;  1RQU A;  3DNJ A;  1KQS V;  3PIP W;  3G19 A;  5DM6 W;  1BXY A;  4WCE W;  3CCM W;  3DLL W;  1MBX C;  1QVG V;  3I56 W;  1MBV B;  5JVG W;  4CPK A;  3CCU W;  3CC7 W;  1VQP W;  1MWR A;  1S72 W;  3GQ0 A;  3CCQ W;  5M1A A;  1YHQ W;  3CCV W;  2ZJR W;  1VQ7 W;  2W9R A;  1MWU A;  1VQ9 W;  3ZG5 A;  4BL2 A;  3O2H A;  3CCR W;  3W7S A;  3CMA W;  3G1B A;  5GAH a;  1Q82 X;  1KC8 X;  3CCJ W;  1YI2 W;  1YIJ W;  3CCL W;  1VQQ A;  1MG9 A;  3ZFZ A;  1VQM W;  3GW1 A;  3CPW V;  1VQ4 W;  1RQS A;  3CME W;  1M90 X;  3I55 W;  4IOA W;  2QEX W;  3O2O A;  3CC4 W;  1K8A X;  1VQO W;  3CCE W;  4DKI A;  4YJX A;  2ZJQ W;  3G4S W;  5M18 A;  1VQ5 W;  1VQN W;  1QVF V;  1YIT W;  5GAG a;  1JJ2 V;  3CD6 W;  4CJN A;  4YJM A;  1VQL W;  3ZG0 A;  1VQK W;  3CC2 W; 
#chains in the Genus database with same CATH homology
 5GAD a;  1YJ9 W;  1K9M X;  2QA4 W;  3G6E W;  1VQ8 W;  1K73 X;  1YJN W;  3G71 W;  5JVH W;  2ZJP W;  3J7Z Z;  5HL7 W;  3OW2 V;  4UY8 Z;  1W2B V;  4U67 W;  1N8R X;  1VQ6 W;  3CF5 W;  5DM7 W;  3CCS W;  4WFN W;  4WFA W;  2OTL W;  2OTJ W;  4WFB W;  3PIO W;  4WF9 W;  5GAE a;  1Q86 X;  1KD1 X;  1NJI X;  4IO9 W;  1M1K X;  4IOC W;  1Q7Y X;  1Q81 X;  3CXC V;  1YJW W;  1KQS V;  3PIP W;  5DM6 W;  1BXY A;  4WCE W;  3CCM W;  3DLL W;  1QVG V;  3I56 W;  5JVG W;  3CCU W;  3CC7 W;  1VQP W;  1S72 W;  3CCQ W;  1YHQ W;  3CCV W;  2ZJR W;  1VQ7 W;  1VQ9 W;  3CCR W;  3CMA W;  5GAH a;  1Q82 X;  1KC8 X;  3CCJ W;  1YI2 W;  1YIJ W;  3CCL W;  1VQM W;  3CPW V;  1VQ4 W;  3CME W;  1M90 X;  3I55 W;  4IOA W;  2QEX W;  3CC4 W;  1K8A X;  1VQO W;  3CCE W;  2ZJQ W;  3G4S W;  1VQ5 W;  1VQN W;  1QVF V;  1YIT W;  5GAG a;  1JJ2 V;  3CD6 W;  1VQL W;  1VQK W;  3CC2 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...