1CEAA

The structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN
publication title Crystal structures of the recombinant kringle 1 domain of human plasminogen in complexes with the ligands epsilon-aminocaproic acid and trans-4-(aminomethyl)cyclohexane-1-carboxylic Acid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease
total genus 15
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1995-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1ceaA00
1NK1A 3KIVA 5CT3A 2I9BA 2KJ4A 4BV5A 4BVVA 4BVWA 4A5TS 5CS5A 2I9AA 5CS1A 3BT1A 5CSQA 2QJ4A 1CEBA 1PKRA 2QJ2A 4BVDA 2HPPP 4CIKA 1KDUA 2FEBA 3U73A 3BT2A 3NXPA 4BV7A 1KRNA 1A0HA 1PK4A 1BHTA 1URKA 5CS3A 1KI0A 5CP9A 2HPQP 1TPKA 5CT1A 2FD6A 2PK4A 1GP9A 1GMNA 2SPTA 4O03A 1HPKA 4HZHA 2PF2A 1B2IA 1HPJA 2K51A 4IUAA 3LAQA 3E6PL 5COEA 2L0SA 2PF1A 1NL2A 5CS9A 2K4RA 2KNFA 5CT2A 3K65A 1PMLA 2DOHX 4NZQA 1JFNA 2DOIA 3HN4A 1I71A 1I5KA 4KIVA 1NL1A 4DURA 4D3CA 1PMKA 5HPGA 3SP8A 1PK2A 3MKPA 4BVCA 1KIVA 1CEAA 1GMOA
chains in the Genus database with same CATH superfamily
1NK1A 3KIVA 5CT3A 2I9BA 2KJ4A 4BV5A 4BVVA 4BVWA 4A5TS 5CS5A 2I9AA 5CS1A 3BT1A 5CSQA 2QJ4A 1CEBA 1PKRA 2QJ2A 4BVDA 2HPPP 4CIKA 1KDUA 2FEBA 3U73A 3BT2A 3NXPA 4BV7A 1KRNA 1A0HA 1PK4A 1BHTA 1URKA 5CS3A 1KI0A 5CP9A 2HPQP 1TPKA 5CT1A 2FD6A 2PK4A 1GP9A 1GMNA 2SPTA 4O03A 1HPKA 4HZHA 2PF2A 1B2IA 1HPJA 2K51A 4IUAA 3LAQA 3E6PL 5COEA 2L0SA 2PF1A 1NL2A 5CS9A 2K4RA 2KNFA 5CT2A 3K65A 1PMLA 2DOHX 4NZQA 1JFNA 2DOIA 3HN4A 1I71A 1I5KA 4KIVA 1NL1A 4DURA 4D3CA 1PMKA 5HPGA 3SP8A 1PK2A 3MKPA 4BVCA 1KIVA 1CEAA 1GMOA
chains in the Genus database with same CATH topology
1NK1A 3KIVA 5CT3A 2I9BA 2KJ4A 4BV5A 4BVVA 4BVWA 4A5TS 5CS5A 2I9AA 5CS1A 3BT1A 5CSQA 2QJ4A 1CEBA 1PKRA 2QJ2A 4BVDA 2HPPP 4CIKA 1KDUA 2FEBA 3U73A 3BT2A 3NXPA 4BV7A 1KRNA 1A0HA 1PK4A 1BHTA 1URKA 5CS3A 1KI0A 5CP9A 2HPQP 1TPKA 5CT1A 2FD6A 2PK4A 1GP9A 1GMNA 2SPTA 4O03A 1HPKA 4HZHA 2PF2A 1B2IA 1HPJA 2K51A 4IUAA 3LAQA 3E6PL 5COEA 2L0SA 2PF1A 1NL2A 5CS9A 2K4RA 2KNFA 5CT2A 3K65A 1PMLA 2DOHX 4NZQA 1JFNA 2DOIA 3HN4A 1I71A 1I5KA 4KIVA 1NL1A 4DURA 4D3CA 1PMKA 5HPGA 3SP8A 1PK2A 3MKPA 4BVCA 1KIVA 1CEAA 1GMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK1 A;  3KIV A;  5CT3 A;  2I9B A;  2KJ4 A;  4BV5 A;  4BVV A;  4BVW A;  4A5T S;  5CS5 A;  2I9A A;  5CS1 A;  3BT1 A;  5CSQ A;  2QJ4 A;  1CEB A;  1PKR A;  2QJ2 A;  4BVD A;  2HPP P;  4CIK A;  1KDU A;  2FEB A;  3U73 A;  3BT2 A;  3NXP A;  4BV7 A;  1KRN A;  1A0H A;  1PK4 A;  1BHT A;  1URK A;  5CS3 A;  1KI0 A;  5CP9 A;  2HPQ P;  1TPK A;  5CT1 A;  2FD6 A;  2PK4 A;  1GP9 A;  1GMN A;  2SPT A;  4O03 A;  1HPK A;  4HZH A;  2PF2 A;  1B2I A;  1HPJ A;  2K51 A;  4IUA A;  3LAQ A;  3E6P L;  5COE A;  2L0S A;  2PF1 A;  1NL2 A;  5CS9 A;  2K4R A;  2KNF A;  5CT2 A;  3K65 A;  1PML A;  2DOH X;  4NZQ A;  1JFN A;  2DOI A;  3HN4 A;  1I71 A;  1I5K A;  4KIV A;  1NL1 A;  4DUR A;  4D3C A;  1PMK A;  5HPG A;  3SP8 A;  1PK2 A;  3MKP A;  4BVC A;  1KIV A;  1CEA A;  1GMO A; 
#chains in the Genus database with same CATH topology
 1NK1 A;  3KIV A;  5CT3 A;  2I9B A;  2KJ4 A;  4BV5 A;  4BVV A;  4BVW A;  4A5T S;  5CS5 A;  2I9A A;  5CS1 A;  3BT1 A;  5CSQ A;  2QJ4 A;  1CEB A;  1PKR A;  2QJ2 A;  4BVD A;  2HPP P;  4CIK A;  1KDU A;  2FEB A;  3U73 A;  3BT2 A;  3NXP A;  4BV7 A;  1KRN A;  1A0H A;  1PK4 A;  1BHT A;  1URK A;  5CS3 A;  1KI0 A;  5CP9 A;  2HPQ P;  1TPK A;  5CT1 A;  2FD6 A;  2PK4 A;  1GP9 A;  1GMN A;  2SPT A;  4O03 A;  1HPK A;  4HZH A;  2PF2 A;  1B2I A;  1HPJ A;  2K51 A;  4IUA A;  3LAQ A;  3E6P L;  5COE A;  2L0S A;  2PF1 A;  1NL2 A;  5CS9 A;  2K4R A;  2KNF A;  5CT2 A;  3K65 A;  1PML A;  2DOH X;  4NZQ A;  1JFN A;  2DOI A;  3HN4 A;  1I71 A;  1I5K A;  4KIV A;  1NL1 A;  4DUR A;  4D3C A;  1PMK A;  5HPG A;  3SP8 A;  1PK2 A;  3MKP A;  4BVC A;  1KIV A;  1CEA A;  1GMO A; 
#chains in the Genus database with same CATH homology
 1NK1 A;  3KIV A;  5CT3 A;  2I9B A;  2KJ4 A;  4BV5 A;  4BVV A;  4BVW A;  4A5T S;  5CS5 A;  2I9A A;  5CS1 A;  3BT1 A;  5CSQ A;  2QJ4 A;  1CEB A;  1PKR A;  2QJ2 A;  4BVD A;  2HPP P;  4CIK A;  1KDU A;  2FEB A;  3U73 A;  3BT2 A;  3NXP A;  4BV7 A;  1KRN A;  1A0H A;  1PK4 A;  1BHT A;  1URK A;  5CS3 A;  1KI0 A;  5CP9 A;  2HPQ P;  1TPK A;  5CT1 A;  2FD6 A;  2PK4 A;  1GP9 A;  1GMN A;  2SPT A;  4O03 A;  1HPK A;  4HZH A;  2PF2 A;  1B2I A;  1HPJ A;  2K51 A;  4IUA A;  3LAQ A;  3E6P L;  5COE A;  2L0S A;  2PF1 A;  1NL2 A;  5CS9 A;  2K4R A;  2KNF A;  5CT2 A;  3K65 A;  1PML A;  2DOH X;  4NZQ A;  1JFN A;  2DOI A;  3HN4 A;  1I71 A;  1I5K A;  4KIV A;  1NL1 A;  4DUR A;  4D3C A;  1PMK A;  5HPG A;  3SP8 A;  1PK2 A;  3MKP A;  4BVC A;  1KIV A;  1CEA A;  1GMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...