3MKPA

Crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
RNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGEGESYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Engineering a fragment of Hepatocyte Growth Factor/Scatter Factor for tissue and organ regeneration
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 3mkpA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3mkpA01
3SP8A 1I5KA 3SRJA 2FEBA 4BV5A 1KIVA 1PKRA 1KRNA 1KDUA 2I9AA 4CIKA 3HMSA 4R1CA 3BT2A 3K65A 2LL3A 4NZQA 2HPQP 4KIVA 4DURA 4D3CA 2Q8AA 4UAOA 5CS3A 2Q8BA 4BV7A 4R1AA 2X2ZA 2K51A 1HKYA 3SRIA 4IUAA 1CEBA 1KI0A 2K13X 4BVCA 4UV6A 5CS1A 4Z0FA 2QJ2A 5CSQA 5I25A 4APLA 3KIVA 1W81A 2PK4A 4Z0EA 1PK2A 2J8JA 5EODA 4R19A 5CS9A 1GP9A 2FD6A 2KJ4A 3MKPA 2L0SA 1NK1A 2KNFA 1Z40A 3HN4A 2LL4M 1HPJA 1YXEA 3HMTA 3E6PL 2DOHX 2HPPP 4BVDA 2YILA 2K4RA 2Z8WA 1CEAA 1W8KA 1I8NA 2YIOA 5CT2A 1I71A 3NXPA 1HPKA 4A5TS 3LAQA 1B2IA 4Z09A 4APMA 4HZHA 5HPGA 5CT3A 2SPTA 1BHTA 1NL1A 1PMKA 2I9BA 2PF2A 2YIPA 5CS5A 3BT1A 1NL2A 2QJ4A 4O03A 2Z8VA 2J8LA 1TPKA 4Z0DA 1GMNA 2DOIA 4R1BA 1A0HA 3U73A 2PF1A 2F83A 5COEA 3ZLEA 4BVWA 5EOKA 1PK4A 1GMOA 2HGFA 3ZWZA 5CP9A 2Y8RA 1URKA 3HMRA 1PMLA 4BVVA 5CT1A 1JFNA
chains in the Genus database with same CATH superfamily
3SP8A 1I5KA 3SRJA 2FEBA 4BV5A 1KIVA 1PKRA 1KRNA 1KDUA 2I9AA 4YIZA 4CIKA 3HMSA 4R1CA 3BT2A 3K65A 2LL3A 4NZQA 2HPQP 4KIVA 4DURA 4D3CA 2Q8AA 4UAOA 5CS3A 2Q8BA 4BV7A 4R1AA 2X2ZA 2K51A 1HKYA 3SRIA 4IUAA 1CEBA 1KI0A 2K13X 4BVCA 4UV6A 5CS1A 4Z0FA 2QJ2A 5CSQA 5I25A 4APLA 3KIVA 1W81A 2PK4A 4Z0EA 1PK2A 2J8JA 5EODA 4R19A 5CS9A 1GP9A 2FD6A 2KJ4A 3MKPA 2L0SA 1NK1A 2KNFA 1Z40A 3HN4A 2LL4M 1HPJA 1YXEA 4YIVA 3HMTA 3E6PL 2DOHX 2HPPP 4BVDA 2YILA 2K4RA 2Z8WA 1CEAA 1W8KA 1I8NA 2YIOA 5CT2A 1I71A 3NXPA 1HPKA 4A5TS 3LAQA 1B2IA 4Z09A 4APMA 4HZHA 5HPGA 5CT3A 2SPTA 1BHTA 1NL1A 1PMKA 2I9BA 2PF2A 2YIPA 5CS5A 3BT1A 1NL2A 2QJ4A 4O03A 2Z8VA 2J8LA 1TPKA 4Z0DA 1GMNA 2DOIA 4R1BA 1A0HA 3U73A 2PF1A 2F83A 2KL5A 5COEA 3ZLEA 4BVWA 5EOKA 1PK4A 1GMOA 2HGFA 3ZWZA 5CP9A 2Y8RA 1URKA 3HMRA 1PMLA 4BVVA 5CT1A 1JFNA
chains in the Genus database with same CATH topology
3SP8A 1I5KA 3SRJA 2FEBA 4BV5A 1KIVA 1PKRA 1KRNA 1KDUA 2I9AA 4YIZA 4CIKA 3HMSA 4R1CA 3BT2A 3K65A 2LL3A 4NZQA 2HPQP 4KIVA 4DURA 4D3CA 2Q8AA 4UAOA 5CS3A 2Q8BA 4BV7A 4R1AA 2X2ZA 2K51A 1HKYA 3SRIA 4IUAA 1CEBA 1KI0A 2K13X 4BVCA 4UV6A 5CS1A 4Z0FA 2QJ2A 5CSQA 5I25A 4APLA 3KIVA 1W81A 2PK4A 4Z0EA 1PK2A 2J8JA 5EODA 4R19A 5CS9A 1GP9A 2FD6A 2KJ4A 3MKPA 2L0SA 1NK1A 2KNFA 1Z40A 3HN4A 2LL4M 1HPJA 1YXEA 4YIVA 3HMTA 3E6PL 2DOHX 2HPPP 4BVDA 2YILA 2K4RA 2Z8WA 1CEAA 1W8KA 1I8NA 2YIOA 5CT2A 1I71A 3NXPA 1HPKA 4A5TS 3LAQA 1B2IA 4Z09A 4APMA 4HZHA 5HPGA 5CT3A 2SPTA 1BHTA 1NL1A 1PMKA 2I9BA 2PF2A 2YIPA 5CS5A 3BT1A 1NL2A 2QJ4A 4O03A 2Z8VA 2J8LA 1TPKA 4Z0DA 1GMNA 2DOIA 4R1BA 1A0HA 3U73A 2PF1A 2F83A 2KL5A 5COEA 3ZLEA 4BVWA 5EOKA 1PK4A 1GMOA 2HGFA 3ZWZA 5CP9A 2Y8RA 1URKA 3HMRA 1PMLA 4BVVA 5CT1A 1JFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SP8 A;  1I5K A;  3SRJ A;  2FEB A;  4BV5 A;  1KIV A;  1PKR A;  1KRN A;  1KDU A;  2I9A A;  4CIK A;  3HMS A;  4R1C A;  3BT2 A;  3K65 A;  2LL3 A;  4NZQ A;  2HPQ P;  4KIV A;  4DUR A;  4D3C A;  2Q8A A;  4UAO A;  5CS3 A;  2Q8B A;  4BV7 A;  4R1A A;  2X2Z A;  2K51 A;  1HKY A;  3SRI A;  4IUA A;  1CEB A;  1KI0 A;  2K13 X;  4BVC A;  4UV6 A;  5CS1 A;  4Z0F A;  2QJ2 A;  5CSQ A;  5I25 A;  4APL A;  3KIV A;  1W81 A;  2PK4 A;  4Z0E A;  1PK2 A;  2J8J A;  5EOD A;  4R19 A;  5CS9 A;  1GP9 A;  2FD6 A;  2KJ4 A;  3MKP A;  2L0S A;  1NK1 A;  2KNF A;  1Z40 A;  3HN4 A;  2LL4 M;  1HPJ A;  1YXE A;  3HMT A;  3E6P L;  2DOH X;  2HPP P;  4BVD A;  2YIL A;  2K4R A;  2Z8W A;  1CEA A;  1W8K A;  1I8N A;  2YIO A;  5CT2 A;  1I71 A;  3NXP A;  1HPK A;  4A5T S;  3LAQ A;  1B2I A;  4Z09 A;  4APM A;  4HZH A;  5HPG A;  5CT3 A;  2SPT A;  1BHT A;  1NL1 A;  1PMK A;  2I9B A;  2PF2 A;  2YIP A;  5CS5 A;  3BT1 A;  1NL2 A;  2QJ4 A;  4O03 A;  2Z8V A;  2J8L A;  1TPK A;  4Z0D A;  1GMN A;  2DOI A;  4R1B A;  1A0H A;  3U73 A;  2PF1 A;  2F83 A;  5COE A;  3ZLE A;  4BVW A;  5EOK A;  1PK4 A;  1GMO A;  2HGF A;  3ZWZ A;  5CP9 A;  2Y8R A;  1URK A;  3HMR A;  1PML A;  4BVV A;  5CT1 A;  1JFN A; 
#chains in the Genus database with same CATH topology
 3SP8 A;  1I5K A;  3SRJ A;  2FEB A;  4BV5 A;  1KIV A;  1PKR A;  1KRN A;  1KDU A;  2I9A A;  4YIZ A;  4CIK A;  3HMS A;  4R1C A;  3BT2 A;  3K65 A;  2LL3 A;  4NZQ A;  2HPQ P;  4KIV A;  4DUR A;  4D3C A;  2Q8A A;  4UAO A;  5CS3 A;  2Q8B A;  4BV7 A;  4R1A A;  2X2Z A;  2K51 A;  1HKY A;  3SRI A;  4IUA A;  1CEB A;  1KI0 A;  2K13 X;  4BVC A;  4UV6 A;  5CS1 A;  4Z0F A;  2QJ2 A;  5CSQ A;  5I25 A;  4APL A;  3KIV A;  1W81 A;  2PK4 A;  4Z0E A;  1PK2 A;  2J8J A;  5EOD A;  4R19 A;  5CS9 A;  1GP9 A;  2FD6 A;  2KJ4 A;  3MKP A;  2L0S A;  1NK1 A;  2KNF A;  1Z40 A;  3HN4 A;  2LL4 M;  1HPJ A;  1YXE A;  4YIV A;  3HMT A;  3E6P L;  2DOH X;  2HPP P;  4BVD A;  2YIL A;  2K4R A;  2Z8W A;  1CEA A;  1W8K A;  1I8N A;  2YIO A;  5CT2 A;  1I71 A;  3NXP A;  1HPK A;  4A5T S;  3LAQ A;  1B2I A;  4Z09 A;  4APM A;  4HZH A;  5HPG A;  5CT3 A;  2SPT A;  1BHT A;  1NL1 A;  1PMK A;  2I9B A;  2PF2 A;  2YIP A;  5CS5 A;  3BT1 A;  1NL2 A;  2QJ4 A;  4O03 A;  2Z8V A;  2J8L A;  1TPK A;  4Z0D A;  1GMN A;  2DOI A;  4R1B A;  1A0H A;  3U73 A;  2PF1 A;  2F83 A;  2KL5 A;  5COE A;  3ZLE A;  4BVW A;  5EOK A;  1PK4 A;  1GMO A;  2HGF A;  3ZWZ A;  5CP9 A;  2Y8R A;  1URK A;  3HMR A;  1PML A;  4BVV A;  5CT1 A;  1JFN A; 
#chains in the Genus database with same CATH homology
 3SP8 A;  1I5K A;  3SRJ A;  2FEB A;  4BV5 A;  1KIV A;  1PKR A;  1KRN A;  1KDU A;  2I9A A;  4YIZ A;  4CIK A;  3HMS A;  4R1C A;  3BT2 A;  3K65 A;  2LL3 A;  4NZQ A;  2HPQ P;  4KIV A;  4DUR A;  4D3C A;  2Q8A A;  4UAO A;  5CS3 A;  2Q8B A;  4BV7 A;  4R1A A;  2X2Z A;  2K51 A;  1HKY A;  3SRI A;  4IUA A;  1CEB A;  1KI0 A;  2K13 X;  4BVC A;  4UV6 A;  5CS1 A;  4Z0F A;  2QJ2 A;  5CSQ A;  5I25 A;  4APL A;  3KIV A;  1W81 A;  2PK4 A;  4Z0E A;  1PK2 A;  2J8J A;  5EOD A;  4R19 A;  5CS9 A;  1GP9 A;  2FD6 A;  2KJ4 A;  3MKP A;  2L0S A;  1NK1 A;  2KNF A;  1Z40 A;  3HN4 A;  2LL4 M;  1HPJ A;  1YXE A;  4YIV A;  3HMT A;  3E6P L;  2DOH X;  2HPP P;  4BVD A;  2YIL A;  2K4R A;  2Z8W A;  1CEA A;  1W8K A;  1I8N A;  2YIO A;  5CT2 A;  1I71 A;  3NXP A;  1HPK A;  4A5T S;  3LAQ A;  1B2I A;  4Z09 A;  4APM A;  4HZH A;  5HPG A;  5CT3 A;  2SPT A;  1BHT A;  1NL1 A;  1PMK A;  2I9B A;  2PF2 A;  2YIP A;  5CS5 A;  3BT1 A;  1NL2 A;  2QJ4 A;  4O03 A;  2Z8V A;  2J8L A;  1TPK A;  4Z0D A;  1GMN A;  2DOI A;  4R1B A;  1A0H A;  3U73 A;  2PF1 A;  2F83 A;  2KL5 A;  5COE A;  3ZLE A;  4BVW A;  5EOK A;  1PK4 A;  1GMO A;  2HGF A;  3ZWZ A;  5CP9 A;  2Y8R A;  1URK A;  3HMR A;  1PML A;  4BVV A;  5CT1 A;  1JFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...