2FD6A

Structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human urokinase plasminogen activator in complex with its receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 25
structure length 122
sequence length 122
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2fd6A01
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2fd6A02
1DIYA 2FLBL 3V64C 1NZIA 5IKQA 2VVCK 3GCXE 2VVVL 2Q1JB 1G2LB 4RRXA 1PK2A 4G1MB 2WYJB 3ZYGA 3IITB 1UZPA 1GMOA 3SOBB 1MQ5L 1A3PA 1KDUA 4X8SL 4O1ZA 2UWLB 5IKVA 4BVDA 3M37L 4ZXXL 3M36L 2P26A 5CS5A 1ATAA 1LPZA 3LN1A 2WPLE 2J2UB 1NL1A 1GP9A 3LTFB 4D3CA 2MHPA 2W2ME 1G1SA 1HCGB 4BV5A 2J38B 2FLGA 3SOVA 1I0UA 5CKQA 3KCGL 3K9XA 3LAQA 2ADXA 2VWOL 2SPTA 1APQA 2J34B 1TLEA 2RHPA 4YT6L 5L2ZL 2Y5FL 1IP0A 1ATDA 2VWNL 5K0HB 2W2QE 1PKRA 1IJQA 4XLWA 2P95L 4CSYA 4ZAEB 5L2YL 1I5KA 1IQHL 2W2PE 1CCVA 4XBMA 1V3XB 1ATBA 2MGPA 1U8CB 1CVWL 3SOQA 3ENSA 5COXA 4Y7BB 1SZBA 2BO2A 2MGRA 1KLIL 1N7DA 2BQ6A 2Y5HL 2DOHX 1UZKA 2I9BA 4BVCA 4BVWA 4TGFA 3Q7DA 4Z0KB 1IOXA 2FZZL 2Y81B 4JZFL 3N8XA 2XBXL 4CUFA 2PK4A 3KIVA 1JBUL 1WHEA 4RRYA 1UZQA 1APOA 1K37A 1NFUB 1G1TA 4NG9L 5CISA 3U7UG 5CSQA 2J4IB 1FAKL 4M11A 5CS1A 2YGOA 4BTTA 1QFKL 4AQTA 1IQEL 1TOZA 3POYA 1KI0A 4BVVA 1P0SL 1N1IA 3N8VA 4BTUA 1IGXA 3CS7L 3KQDL 2Y82B 5CS3A 1PMKA 3SP8A 3HO3A 1KSNB 3CENL 3TK6B 1KIGL 3NXPA 1YUGA 3NT1A 5JB9E 1LMJA 1J9CL 4IUAA 3N8ZA 4ISIL 2BOUA 2JKHL 2WG4B 3IJEB 4LORA 3U73A 1ATEA 3FFGL 1HPJA 5COEA 4FM5A 1CEAA 1IQFL 5F19A 4MMYB 1EPIA 5CT2A 1CVUA 1IQGL 2Y5GL 3KQEL 1JV2B 1IQML 2PR3B 4PH9A 5JB8E 4NA9L 2WFXB 4A7IA 3HO4A 1PRHA 4M10A 3FCSB 1NK1A 1KLOA 1YUFA 1IQKL 2KL7A 1DDXA 1XKAL 4X8UL 4MMZB 3R05A 1BHTA 2PF1A 2VJ3A 1IQIL 3LN0A 5CKMA 1PK4A 4BDXA 1XKBA 2VH0B 1RFNB 3BPSE 4D0FA 1PMLA 4JZEL 1HT8A 1EGFA 2F9BL 1K36A 3K65A 2J94B 3EGFA 3F6UL 2M74A 1PTHA 3CFWA 2H9EL 2P3FL 1Z6EL 3HS5A 1IVOC 2FEBA 1Z6CA 1F0RB 2WPIE 2EI6B 2Y80B 1P9JA 4YT7L 2K51A 1B2IA 1XFEA 1DX5I 2P3UA 1F7EA 2I9AA 2WPHE 5JBCE 1URKA 2W2NE 4Y71B 2K4RA 1W7XL 3V65B 2QJ4A 2UWPB 1XDTR 1CX2A 2D1JB 2BQWA 2W86A 1FF7A 4X8TL 4D90A 1IGZA 5IKTA 1EBVA 4OTJA 4O03A 3CA7A 1ZAQA 3N8WB 2Y7XB 1EPJA 1WHFA 2L0SA 1HREA 5HPGA 3LTGD 2VWMK 3TBDA 1EMOA 2BMGA 2P16L 4BXSA 3BT2A 2DOIA 4Y6DB 3TZIA 4Y79B 4NGAL 1LQDA 2XC5L 2HPPP 1IQJL 1EMNA 4Y76B 3QH0A 4OTYA 1EPHA 3GISX 2J95B 5IKRA 3N8WA 1L3YA 1CEJA 1CQEA 2FLRL 3N8YA 5JBAE 3HS6A 5CT1A 3NJPC 3C9AC 5KIRA 1TPGA 2YGPA 4ZXYL 2WG3C 2VWLL 3P5BL 1YGCL 2QJ2A 1OB1C 1DVAL 2WPJE 1KIVA 1GK5A 1IQNL 1FE2A 4CUDA 4RRZA 1NL2A 1M1XB 4E1GA 2VVUL 1AUTL 3ZYJB 1CEBA 4BXWA 1TPKA 1C5MF 1X7AL 3MQEA 2P28B 1GMNA 5CT3A 2B7DL 2KJ4A 1HT5A 3ASIA 1CCFA 1WU1B 3DEMA 2VH6B 2K2SB 5KN5C 2WPME 2XBWL 3NTGA 2KB9A 2OYUP 4Z0LA 1KRNA 1YO8A 2KNFA 1L5GB 4CUEA 6COXA 2W3KB 5JW1A 1HZ8A 1NFXB 2P93L 2W2OE 2TGFA 3PGHA 5FDQA 2BQ7A 2GD4A 1NT0A 1O5DL 1PGEA 1A0HA 1FJSL 3MKPA 2P3FN 3TH3L 1MQ6L 1FAXL 3MDLA 1F0SB 2K2TA 1NPEB 1G1RA 1LPKA 4HZHA 1LPGA 2FD6A 3TK5B 1BF9A 1IQLL 2XC0L 1NQLB 1G2MB 3KL6B 2HPQP 2DDUA 3F1SB 4DURA 1EAIC 4Z6AL 5CKNA 2RNLA 5E8DA 4O02B 3KK6A 2OYEP 2W3IB 4YZUB 3OLUA 4ZHAB 2BZ6L 1FSBA 3SW2A 3OLTA 2W26B 4LMFA 5L30L 1I71A 5I46L 1MOXC 2G00L 3Q3KB 4MMXB 3QMOA 2XBYL 4COXA 1ADXA 2AYLA 1YUKB 2XC4L 1FFMA 2KV4A 1EQHA 4BTIA 1F7MA 3KQBL 1UZJA 3HPTA 3QCWA 3FBYA 4Y7AB 2WFTA 3LC5B 3KRKA 2XBVL 4D0EA 3ZYIB 2NPRA 3TGFA 3HN4A 1JL9A 4BV7A 1HRFA 4NZQA 3NTBA 3N8YB 2P3TA 2RA0L 2P94L 4C16A 5JVZA 2CJIB 1EPGA 3KQCL 4A5TS 1PXXA 1KLJL 1HX2A 2EI8B 1HPKA 1B9WA 2BOXA 4RS0A 5JBBE 1G1QA 2Y38A 4ISHL 4KIVA 2PHBB 1HJ7A 4JYVL 1DQBA 4BDWA 1HAEA 3LIWB 3HS7A 2Y7ZB 2PF2A 4CIKA 1JFNA 3RR3A 4JYUL 1HAFA 4RUTA 1Q4GA 4XL1A 1W8BL 5CS9A 1U67A 1COUA 4ZH8B 1NFYB 1PFXL 4X8VL 5CP9A 2BOHA 4RRWA 2BOKL 2UWOB 5EGMB 3ELAL 2PUQL 1EZQB 3HO5A 5JVYA 2WYGB 3GCWE 1NFWB 3E6PL 4JZDL 5F1AA 2WPKE 1EQGA 3H5CB 2EI7B 3BT1A 1IOEL 3LC3B
chains in the Genus database with same CATH superfamily
1DIYA 2FLBL 3V64C 1NZIA 4GU3A 5IKQA 2VVCK 3GCXE 2VVVL 2Q1JB 1G2LB 4RRXA 1PK2A 4G1MB 2WYJB 3ZYGA 3IITB 1UZPA 1GMOA 3SOBB 1MQ5L 1A3PA 1KDUA 4X8SL 4O1ZA 2UWLB 5IKVA 4BVDA 3M37L 4ZXXL 3M36L 2P26A 5CS5A 1ATAA 1LPZA 2JJLA 3LN1A 2WPLE 2J2UB 1NL1A 1GP9A 3LTFB 4D3CA 2MHPA 2W2ME 1G1SA 1HCGB 4BV5A 2J38B 2FLGA 3SOVA 1I0UA 5CKQA 3KCGL 3K9XA 3LAQA 1KKEA 2ADXA 2VWOL 2SPTA 1APQA 2J34B 1TLEA 2RHPA 4YT6L 5L2ZL 2Y5FL 1IP0A 1ATDA 2VWNL 5K0HB 2W2QE 1PKRA 1IJQA 4XLWA 2P95L 4CSYA 4ZAEB 5L2YL 1I5KA 1IQHL 2W2PE 1CCVA 4XBMA 1V3XB 1ATBA 2MGPA 1U8CB 1CVWL 3SOQA 3ENSA 5COXA 4Y7BB 1SZBA 2BO2A 2MGRA 1KLIL 1N7DA 2BQ6A 2Y5HL 2DOHX 1UZKA 2I9BA 4BVCA 4BVWA 4TGFA 3Q7DA 4Z0KB 1IOXA 2FZZL 2Y81B 4JZFL 3N8XA 2XBXL 4CUFA 2PK4A 3KIVA 1JBUL 1WHEA 4RRYA 1UZQA 1APOA 1K37A 1NFUB 1G1TA 4NG9L 5CISA 3U7UG 5CSQA 2J4IB 1FAKL 4M11A 5CS1A 2YGOA 4BTTA 1QFKL 4AQTA 3POYA 1IQEL 1TOZA 1KI0A 4BVVA 1P0SL 1N1IA 3N8VA 4BTUA 1IGXA 3CS7L 2H9EC 3KQDL 2Y82B 5CS3A 1PMKA 3SP8A 3HO3A 1KSNB 3CENL 3TK6B 1KIGL 3NXPA 1YUGA 3NT1A 5JB9E 1LMJA 1J9CL 4IUAA 3N8ZA 4ISIL 2BOUA 2JKHL 2WG4B 3IJEB 4LORA 3U73A 2BT8A 1ATEA 3FFGL 1HPJA 5COEA 4FM5A 1CEAA 1IQFL 5F19A 4MMYB 1EPIA 5CT2A 1CVUA 1IQGL 2Y5GL 3KQEL 1JV2B 1IQML 2PR3B 4PH9A 5JB8E 4NA9L 2WFXB 4A7IA 3HO4A 1PRHA 4M10A 3FCSB 1NK1A 1KLOA 1YUFA 1IQKL 2KL7A 1DDXA 1XKAL 4X8UL 4MMZB 3R05A 1BHTA 2PF1A 2KNIA 2VJ3A 1IQIL 3LN0A 5CKMA 1PK4A 4BDXA 1XKBA 2VH0B 1RFNB 3BPSE 4D0FA 1PMLA 4JZEL 1HT8A 1EGFA 2F9BL 1K36A 3K65A 2J94B 3EGFA 3F6UL 2M74A 1PTHA 3CFWA 2H9EL 2P3FL 1Z6EL 3HS5A 1IVOC 2FEBA 1Z6CA 1F0RB 2WPIE 2EI6B 2Y80B 1P9JA 4YT7L 2K51A 1B2IA 1XFEA 1DX5I 2P3UA 1F7EA 2I9AA 2WPHE 5JBCE 1URKA 2W2NE 4Y71B 2K4RA 1W7XL 3V65B 2QJ4A 2UWPB 1XDTR 1CX2A 2D1JB 2BQWA 2W86A 1FF7A 4X8TL 4D90A 1IGZA 5IKTA 1EBVA 4OTJA 4O03A 3CA7A 1ZAQA 3N8WB 2Y7XB 1EPJA 1WHFA 2L0SA 1HREA 5HPGA 3LTGD 2VWMK 3TBDA 1EMOA 2BMGA 2P16L 4BXSA 3BT2A 2DOIA 4Y6DB 3TZIA 4Y79B 4NGAL 1LQDA 2XC5L 2HPPP 1IQJL 3S6XA 1EMNA 4Y76B 3QH0A 4OTYA 1EPHA 3GISX 2J95B 5IKRA 3N8WA 1L3YA 1CEJA 1CQEA 2FLRL 3N8YA 5JBAE 3HS6A 5CT1A 3NJPC 3C9AC 5KIRA 1TPGA 2YGPA 4ZXYL 4GU4A 2WZPP 2WG3C 2VWLL 3P5BL 1YGCL 2QJ2A 1OB1C 1DVAL 2WPJE 1KIVA 1GK5A 1IQNL 1FE2A 1V1HA 4CUDA 4RRZA 1NL2A 1M1XB 4E1GA 2VVUL 1AUTL 3ZYJB 1CEBA 4BXWA 1TPKA 1C5MF 1X7AL 3MQEA 1V1IA 2P28B 1GMNA 5CT3A 2B7DL 2KJ4A 1HT5A 3ASIA 1CCFA 1WU1B 3DEMA 2VH6B 2K2SB 5KN5C 2WPME 2XBWL 3NTGA 2KB9A 2OYUP 4Z0LA 1KRNA 2HORA 1YO8A 2KNFA 1L5GB 4CUEA 6COXA 2W3KB 5JW1A 1HZ8A 1NFXB 2P93L 2W2OE 2TGFA 3PGHA 5FDQA 2BQ7A 2GD4A 1NT0A 1O5DL 1PGEA 1A0HA 1FJSL 3MKPA 2P3FN 1LMMA 3TH3L 1MQ6L 1FAXL 3MDLA 1F0SB 2K2TA 1NPEB 1G1RA 1LPKA 4HZHA 1LPGA 2FD6A 3TK5B 1BF9A 1IQLL 2XC0L 1NQLB 1G2MB 3KL6B 2HPQP 2DDUA 3F1SB 4DURA 1EAIC 1QIUA 4Z6AL 5CKNA 2RNLA 5E8DA 4O02B 3KK6A 2OYEP 2W3IB 4YZUB 3OLUA 4ZHAB 2BZ6L 1FSBA 3SW2A 3OLTA 2W26B 4LMFA 5L30L 1I71A 5I46L 1MOXC 2G00L 3Q3KB 4MMXB 3QMOA 2XBYL 4COXA 1ADXA 2AYLA 1YUKB 2XC4L 1FFMA 2KV4A 1EQHA 4BTIA 2BT7A 1F7MA 3KQBL 1UZJA 3HPTA 3QCWA 3FBYA 4Y7AB 2WFTA 3LC5B 3KRKA 2XBVL 4D0EA 3ZYIB 2NPRA 3TGFA 3HN4A 1JL9A 4BV7A 1HRFA 4NZQA 3NTBA 3N8YB 2P3TA 2RA0L 2P94L 4C16A 5JVZA 2CJIB 1EPGA 3KQCL 4A5TS 1PXXA 1KLJL 1HX2A 2EI8B 1HPKA 1B9WA 2BOXA 2HOXA 4RS0A 5JBBE 1G1QA 4A94C 2Y38A 1LK9A 4ISHL 4KIVA 2PHBB 2YGQA 1HJ7A 4JYVL 1DQBA 4BDWA 1HAEA 3LIWB 3HS7A 2Y7ZB 2PF2A 4CIKA 1JFNA 3RR3A 4JYUL 1HAFA 4RUTA 1Q4GA 4XL1A 2BSFA 1W8BL 5CS9A 1U67A 1COUA 4ZH8B 1NFYB 1PFXL 4X8VL 5CP9A 2BOHA 4RRWA 2BOKL 2UWOB 5EGMB 3ELAL 2PUQL 1EZQB 3HO5A 5JVYA 2WYGB 3GCWE 1NFWB 3E6PL 4JZDL 5F1AA 2WPKE 2VRSA 1EQGA 3H5CB 2EI7B 3BT1A 1IOEL 3LC3B
chains in the Genus database with same CATH topology
1DIYA 2FLBL 3V64C 1NZIA 5IKQA 2VVCK 3GCXE 2VVVL 2Q1JB 1G2LB 4RRXA 1PK2A 4G1MB 2WYJB 3ZYGA 3IITB 1UZPA 1GMOA 3SOBB 1MQ5L 1A3PA 1KDUA 4X8SL 4O1ZA 2UWLB 5IKVA 4BVDA 3M37L 4ZXXL 3M36L 2P26A 5CS5A 1ATAA 1LPZA 3LN1A 2WPLE 2J2UB 1NL1A 1GP9A 3LTFB 4D3CA 2MHPA 2W2ME 1G1SA 1HCGB 4BV5A 2J38B 2FLGA 3SOVA 1I0UA 5CKQA 3KCGL 3K9XA 3LAQA 2ADXA 2VWOL 2SPTA 1APQA 2J34B 1TLEA 2RHPA 4YT6L 5L2ZL 2Y5FL 1IP0A 1ATDA 2VWNL 5K0HB 2W2QE 1PKRA 1IJQA 4XLWA 2P95L 4CSYA 4ZAEB 5L2YL 1I5KA 1IQHL 2W2PE 1CCVA 4XBMA 1V3XB 1ATBA 2MGPA 1U8CB 1CVWL 3SOQA 3ENSA 5COXA 4Y7BB 1SZBA 2BO2A 2MGRA 1KLIL 1N7DA 2BQ6A 2Y5HL 2DOHX 1UZKA 2I9BA 4BVCA 4BVWA 4TGFA 3Q7DA 4Z0KB 1IOXA 2FZZL 2Y81B 4JZFL 3N8XA 2XBXL 4CUFA 2PK4A 3KIVA 1JBUL 1WHEA 4RRYA 1UZQA 1APOA 1K37A 1NFUB 1G1TA 4NG9L 5CISA 3U7UG 5CSQA 2J4IB 1FAKL 4M11A 5CS1A 2YGOA 4BTTA 1QFKL 4AQTA 1IQEL 1TOZA 3POYA 1KI0A 4BVVA 1P0SL 1N1IA 3N8VA 4BTUA 1IGXA 3CS7L 2H9EC 3KQDL 2Y82B 5CS3A 1PMKA 3SP8A 3HO3A 1KSNB 3CENL 3TK6B 1KIGL 3NXPA 1YUGA 3NT1A 5JB9E 1LMJA 1J9CL 4IUAA 3N8ZA 4ISIL 2BOUA 2JKHL 2WG4B 3IJEB 4LORA 3U73A 1ATEA 3FFGL 1HPJA 5COEA 4FM5A 1CEAA 1IQFL 5F19A 4MMYB 1EPIA 5CT2A 1CVUA 1IQGL 2Y5GL 3KQEL 1JV2B 1IQML 2PR3B 4PH9A 5JB8E 4NA9L 2WFXB 4A7IA 3HO4A 1PRHA 4M10A 3FCSB 1NK1A 1KLOA 1YUFA 1IQKL 2KL7A 1DDXA 1XKAL 4X8UL 4MMZB 3R05A 1BHTA 2PF1A 2KNIA 2VJ3A 1IQIL 3LN0A 5CKMA 1PK4A 4BDXA 1XKBA 2VH0B 1RFNB 3BPSE 4D0FA 1PMLA 4JZEL 1HT8A 1EGFA 2F9BL 1K36A 3K65A 2J94B 3EGFA 3F6UL 2M74A 1PTHA 3CFWA 2H9EL 2P3FL 1Z6EL 3HS5A 1IVOC 2FEBA 1Z6CA 1F0RB 2WPIE 2EI6B 2Y80B 1P9JA 4YT7L 2K51A 1B2IA 1XFEA 1DX5I 2P3UA 1F7EA 2I9AA 2WPHE 5JBCE 1URKA 2W2NE 4Y71B 2K4RA 1W7XL 3V65B 2QJ4A 2UWPB 1XDTR 1CX2A 2D1JB 2BQWA 2W86A 1FF7A 4X8TL 4D90A 1IGZA 5IKTA 1EBVA 4OTJA 4O03A 3CA7A 1ZAQA 3N8WB 2Y7XB 1EPJA 1WHFA 2L0SA 1HREA 5HPGA 3LTGD 2VWMK 3TBDA 1EMOA 2BMGA 2P16L 4BXSA 3BT2A 2DOIA 4Y6DB 3TZIA 4Y79B 4NGAL 1LQDA 2XC5L 2HPPP 1IQJL 3S6XA 1EMNA 4Y76B 3QH0A 4OTYA 1EPHA 3GISX 2J95B 5IKRA 3N8WA 1L3YA 1CEJA 1CQEA 2FLRL 3N8YA 5JBAE 3HS6A 5CT1A 3NJPC 3C9AC 5KIRA 1TPGA 2YGPA 4ZXYL 2WZPP 2WG3C 2VWLL 3P5BL 1YGCL 2QJ2A 1OB1C 1DVAL 2WPJE 1KIVA 1GK5A 1IQNL 1FE2A 4CUDA 4RRZA 1NL2A 1M1XB 4E1GA 2VVUL 1AUTL 3ZYJB 1CEBA 4BXWA 1TPKA 1C5MF 1X7AL 3MQEA 2P28B 1GMNA 5CT3A 2B7DL 2KJ4A 1HT5A 3ASIA 1CCFA 1WU1B 3DEMA 2VH6B 2K2SB 5KN5C 2WPME 2XBWL 3NTGA 2KB9A 2OYUP 4Z0LA 1KRNA 1YO8A 2KNFA 1L5GB 4CUEA 6COXA 2W3KB 5JW1A 1HZ8A 1NFXB 2P93L 2W2OE 2TGFA 3PGHA 5FDQA 2BQ7A 2GD4A 1NT0A 1O5DL 1PGEA 1A0HA 1FJSL 3MKPA 2P3FN 1LMMA 3TH3L 1MQ6L 1FAXL 3MDLA 1F0SB 2K2TA 1NPEB 1G1RA 1LPKA 4HZHA 1LPGA 2FD6A 3TK5B 1BF9A 1IQLL 2XC0L 1NQLB 1G2MB 3KL6B 2HPQP 2DDUA 3F1SB 4DURA 1EAIC 4Z6AL 5CKNA 2RNLA 5E8DA 4O02B 3KK6A 2OYEP 2W3IB 4YZUB 3OLUA 4ZHAB 2BZ6L 1FSBA 3SW2A 3OLTA 2W26B 4LMFA 5L30L 1I71A 5I46L 1MOXC 2G00L 3Q3KB 4MMXB 3QMOA 2XBYL 4COXA 1ADXA 2AYLA 1YUKB 2XC4L 1FFMA 2KV4A 1EQHA 4BTIA 1F7MA 3KQBL 1UZJA 3HPTA 3QCWA 3FBYA 4Y7AB 2WFTA 3LC5B 3KRKA 2XBVL 4D0EA 3ZYIB 2NPRA 3TGFA 3HN4A 1JL9A 4BV7A 1HRFA 4NZQA 3NTBA 3N8YB 2P3TA 2RA0L 2P94L 4C16A 5JVZA 2CJIB 1EPGA 3KQCL 4A5TS 1PXXA 1KLJL 1HX2A 2EI8B 1HPKA 1B9WA 2BOXA 4RS0A 5JBBE 1G1QA 4A94C 2Y38A 4ISHL 4KIVA 2PHBB 2YGQA 1HJ7A 4JYVL 1DQBA 4BDWA 1HAEA 3LIWB 3HS7A 2Y7ZB 2PF2A 4CIKA 1JFNA 3RR3A 4JYUL 1HAFA 4RUTA 1Q4GA 4XL1A 1W8BL 5CS9A 1U67A 1COUA 4ZH8B 1NFYB 1PFXL 4X8VL 5CP9A 2BOHA 4RRWA 2BOKL 2UWOB 5EGMB 3ELAL 2PUQL 1EZQB 3HO5A 5JVYA 2WYGB 3GCWE 1NFWB 3E6PL 4JZDL 5F1AA 2WPKE 1EQGA 3H5CB 2EI7B 3BT1A 1IOEL 3LC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DIY A;  2FLB L;  3V64 C;  1NZI A;  5IKQ A;  2VVC K;  3GCX E;  2VVV L;  2Q1J B;  1G2L B;  4RRX A;  1PK2 A;  4G1M B;  2WYJ B;  3ZYG A;  3IIT B;  1UZP A;  1GMO A;  3SOB B;  1MQ5 L;  1A3P A;  1KDU A;  4X8S L;  4O1Z A;  2UWL B;  5IKV A;  4BVD A;  3M37 L;  4ZXX L;  3M36 L;  2P26 A;  5CS5 A;  1ATA A;  1LPZ A;  3LN1 A;  2WPL E;  2J2U B;  1NL1 A;  1GP9 A;  3LTF B;  4D3C A;  2MHP A;  2W2M E;  1G1S A;  1HCG B;  4BV5 A;  2J38 B;  2FLG A;  3SOV A;  1I0U A;  5CKQ A;  3KCG L;  3K9X A;  3LAQ A;  2ADX A;  2VWO L;  2SPT A;  1APQ A;  2J34 B;  1TLE A;  2RHP A;  4YT6 L;  5L2Z L;  2Y5F L;  1IP0 A;  1ATD A;  2VWN L;  5K0H B;  2W2Q E;  1PKR A;  1IJQ A;  4XLW A;  2P95 L;  4CSY A;  4ZAE B;  5L2Y L;  1I5K A;  1IQH L;  2W2P E;  1CCV A;  4XBM A;  1V3X B;  1ATB A;  2MGP A;  1U8C B;  1CVW L;  3SOQ A;  3ENS A;  5COX A;  4Y7B B;  1SZB A;  2BO2 A;  2MGR A;  1KLI L;  1N7D A;  2BQ6 A;  2Y5H L;  2DOH X;  1UZK A;  2I9B A;  4BVC A;  4BVW A;  4TGF A;  3Q7D A;  4Z0K B;  1IOX A;  2FZZ L;  2Y81 B;  4JZF L;  3N8X A;  2XBX L;  4CUF A;  2PK4 A;  3KIV A;  1JBU L;  1WHE A;  4RRY A;  1UZQ A;  1APO A;  1K37 A;  1NFU B;  1G1T A;  4NG9 L;  5CIS A;  3U7U G;  5CSQ A;  2J4I B;  1FAK L;  4M11 A;  5CS1 A;  2YGO A;  4BTT A;  1QFK L;  4AQT A;  1IQE L;  1TOZ A;  3POY A;  1KI0 A;  4BVV A;  1P0S L;  1N1I A;  3N8V A;  4BTU A;  1IGX A;  3CS7 L;  3KQD L;  2Y82 B;  5CS3 A;  1PMK A;  3SP8 A;  3HO3 A;  1KSN B;  3CEN L;  3TK6 B;  1KIG L;  3NXP A;  1YUG A;  3NT1 A;  5JB9 E;  1LMJ A;  1J9C L;  4IUA A;  3N8Z A;  4ISI L;  2BOU A;  2JKH L;  2WG4 B;  3IJE B;  4LOR A;  3U73 A;  1ATE A;  3FFG L;  1HPJ A;  5COE A;  4FM5 A;  1CEA A;  1IQF L;  5F19 A;  4MMY B;  1EPI A;  5CT2 A;  1CVU A;  1IQG L;  2Y5G L;  3KQE L;  1JV2 B;  1IQM L;  2PR3 B;  4PH9 A;  5JB8 E;  4NA9 L;  2WFX B;  4A7I A;  3HO4 A;  1PRH A;  4M10 A;  3FCS B;  1NK1 A;  1KLO A;  1YUF A;  1IQK L;  2KL7 A;  1DDX A;  1XKA L;  4X8U L;  4MMZ B;  3R05 A;  1BHT A;  2PF1 A;  2VJ3 A;  1IQI L;  3LN0 A;  5CKM A;  1PK4 A;  4BDX A;  1XKB A;  2VH0 B;  1RFN B;  3BPS E;  4D0F A;  1PML A;  4JZE L;  1HT8 A;  1EGF A;  2F9B L;  1K36 A;  3K65 A;  2J94 B;  3EGF A;  3F6U L;  2M74 A;  1PTH A;  3CFW A;  2H9E L;  2P3F L;  1Z6E L;  3HS5 A;  1IVO C;  2FEB A;  1Z6C A;  1F0R B;  2WPI E;  2EI6 B;  2Y80 B;  1P9J A;  4YT7 L;  2K51 A;  1B2I A;  1XFE A;  1DX5 I;  2P3U A;  1F7E A;  2I9A A;  2WPH E;  5JBC E;  1URK A;  2W2N E;  4Y71 B;  2K4R A;  1W7X L;  3V65 B;  2QJ4 A;  2UWP B;  1XDT R;  1CX2 A;  2D1J B;  2BQW A;  2W86 A;  1FF7 A;  4X8T L;  4D90 A;  1IGZ A;  5IKT A;  1EBV A;  4OTJ A;  4O03 A;  3CA7 A;  1ZAQ A;  3N8W B;  2Y7X B;  1EPJ A;  1WHF A;  2L0S A;  1HRE A;  5HPG A;  3LTG D;  2VWM K;  3TBD A;  1EMO A;  2BMG A;  2P16 L;  4BXS A;  3BT2 A;  2DOI A;  4Y6D B;  3TZI A;  4Y79 B;  4NGA L;  1LQD A;  2XC5 L;  2HPP P;  1IQJ L;  1EMN A;  4Y76 B;  3QH0 A;  4OTY A;  1EPH A;  3GIS X;  2J95 B;  5IKR A;  3N8W A;  1L3Y A;  1CEJ A;  1CQE A;  2FLR L;  3N8Y A;  5JBA E;  3HS6 A;  5CT1 A;  3NJP C;  3C9A C;  5KIR A;  1TPG A;  2YGP A;  4ZXY L;  2WG3 C;  2VWL L;  3P5B L;  1YGC L;  2QJ2 A;  1OB1 C;  1DVA L;  2WPJ E;  1KIV A;  1GK5 A;  1IQN L;  1FE2 A;  4CUD A;  4RRZ A;  1NL2 A;  1M1X B;  4E1G A;  2VVU L;  1AUT L;  3ZYJ B;  1CEB A;  4BXW A;  1TPK A;  1C5M F;  1X7A L;  3MQE A;  2P28 B;  1GMN A;  5CT3 A;  2B7D L;  2KJ4 A;  1HT5 A;  3ASI A;  1CCF A;  1WU1 B;  3DEM A;  2VH6 B;  2K2S B;  5KN5 C;  2WPM E;  2XBW L;  3NTG A;  2KB9 A;  2OYU P;  4Z0L A;  1KRN A;  1YO8 A;  2KNF A;  1L5G B;  4CUE A;  6COX A;  2W3K B;  5JW1 A;  1HZ8 A;  1NFX B;  2P93 L;  2W2O E;  2TGF A;  3PGH A;  5FDQ A;  2BQ7 A;  2GD4 A;  1NT0 A;  1O5D L;  1PGE A;  1A0H A;  1FJS L;  3MKP A;  2P3F N;  3TH3 L;  1MQ6 L;  1FAX L;  3MDL A;  1F0S B;  2K2T A;  1NPE B;  1G1R A;  1LPK A;  4HZH A;  1LPG A;  2FD6 A;  3TK5 B;  1BF9 A;  1IQL L;  2XC0 L;  1NQL B;  1G2M B;  3KL6 B;  2HPQ P;  2DDU A;  3F1S B;  4DUR A;  1EAI C;  4Z6A L;  5CKN A;  2RNL A;  5E8D A;  4O02 B;  3KK6 A;  2OYE P;  2W3I B;  4YZU B;  3OLU A;  4ZHA B;  2BZ6 L;  1FSB A;  3SW2 A;  3OLT A;  2W26 B;  4LMF A;  5L30 L;  1I71 A;  5I46 L;  1MOX C;  2G00 L;  3Q3K B;  4MMX B;  3QMO A;  2XBY L;  4COX A;  1ADX A;  2AYL A;  1YUK B;  2XC4 L;  1FFM A;  2KV4 A;  1EQH A;  4BTI A;  1F7M A;  3KQB L;  1UZJ A;  3HPT A;  3QCW A;  3FBY A;  4Y7A B;  2WFT A;  3LC5 B;  3KRK A;  2XBV L;  4D0E A;  3ZYI B;  2NPR A;  3TGF A;  3HN4 A;  1JL9 A;  4BV7 A;  1HRF A;  4NZQ A;  3NTB A;  3N8Y B;  2P3T A;  2RA0 L;  2P94 L;  4C16 A;  5JVZ A;  2CJI B;  1EPG A;  3KQC L;  4A5T S;  1PXX A;  1KLJ L;  1HX2 A;  2EI8 B;  1HPK A;  1B9W A;  2BOX A;  4RS0 A;  5JBB E;  1G1Q A;  2Y38 A;  4ISH L;  4KIV A;  2PHB B;  1HJ7 A;  4JYV L;  1DQB A;  4BDW A;  1HAE A;  3LIW B;  3HS7 A;  2Y7Z B;  2PF2 A;  4CIK A;  1JFN A;  3RR3 A;  4JYU L;  1HAF A;  4RUT A;  1Q4G A;  4XL1 A;  1W8B L;  5CS9 A;  1U67 A;  1COU A;  4ZH8 B;  1NFY B;  1PFX L;  4X8V L;  5CP9 A;  2BOH A;  4RRW A;  2BOK L;  2UWO B;  5EGM B;  3ELA L;  2PUQ L;  1EZQ B;  3HO5 A;  5JVY A;  2WYG B;  3GCW E;  1NFW B;  3E6P L;  4JZD L;  5F1A A;  2WPK E;  1EQG A;  3H5C B;  2EI7 B;  3BT1 A;  1IOE L;  3LC3 B; 
#chains in the Genus database with same CATH topology
 1DIY A;  2FLB L;  3V64 C;  1NZI A;  4GU3 A;  5IKQ A;  2VVC K;  3GCX E;  2VVV L;  2Q1J B;  1G2L B;  4RRX A;  1PK2 A;  4G1M B;  2WYJ B;  3ZYG A;  3IIT B;  1UZP A;  1GMO A;  3SOB B;  1MQ5 L;  1A3P A;  1KDU A;  4X8S L;  4O1Z A;  2UWL B;  5IKV A;  4BVD A;  3M37 L;  4ZXX L;  3M36 L;  2P26 A;  5CS5 A;  1ATA A;  1LPZ A;  2JJL A;  3LN1 A;  2WPL E;  2J2U B;  1NL1 A;  1GP9 A;  3LTF B;  4D3C A;  2MHP A;  2W2M E;  1G1S A;  1HCG B;  4BV5 A;  2J38 B;  2FLG A;  3SOV A;  1I0U A;  5CKQ A;  3KCG L;  3K9X A;  3LAQ A;  1KKE A;  2ADX A;  2VWO L;  2SPT A;  1APQ A;  2J34 B;  1TLE A;  2RHP A;  4YT6 L;  5L2Z L;  2Y5F L;  1IP0 A;  1ATD A;  2VWN L;  5K0H B;  2W2Q E;  1PKR A;  1IJQ A;  4XLW A;  2P95 L;  4CSY A;  4ZAE B;  5L2Y L;  1I5K A;  1IQH L;  2W2P E;  1CCV A;  4XBM A;  1V3X B;  1ATB A;  2MGP A;  1U8C B;  1CVW L;  3SOQ A;  3ENS A;  5COX A;  4Y7B B;  1SZB A;  2BO2 A;  2MGR A;  1KLI L;  1N7D A;  2BQ6 A;  2Y5H L;  2DOH X;  1UZK A;  2I9B A;  4BVC A;  4BVW A;  4TGF A;  3Q7D A;  4Z0K B;  1IOX A;  2FZZ L;  2Y81 B;  4JZF L;  3N8X A;  2XBX L;  4CUF A;  2PK4 A;  3KIV A;  1JBU L;  1WHE A;  4RRY A;  1UZQ A;  1APO A;  1K37 A;  1NFU B;  1G1T A;  4NG9 L;  5CIS A;  3U7U G;  5CSQ A;  2J4I B;  1FAK L;  4M11 A;  5CS1 A;  2YGO A;  4BTT A;  1QFK L;  4AQT A;  3POY A;  1IQE L;  1TOZ A;  1KI0 A;  4BVV A;  1P0S L;  1N1I A;  3N8V A;  4BTU A;  1IGX A;  3CS7 L;  2H9E C;  3KQD L;  2Y82 B;  5CS3 A;  1PMK A;  3SP8 A;  3HO3 A;  1KSN B;  3CEN L;  3TK6 B;  1KIG L;  3NXP A;  1YUG A;  3NT1 A;  5JB9 E;  1LMJ A;  1J9C L;  4IUA A;  3N8Z A;  4ISI L;  2BOU A;  2JKH L;  2WG4 B;  3IJE B;  4LOR A;  3U73 A;  2BT8 A;  1ATE A;  3FFG L;  1HPJ A;  5COE A;  4FM5 A;  1CEA A;  1IQF L;  5F19 A;  4MMY B;  1EPI A;  5CT2 A;  1CVU A;  1IQG L;  2Y5G L;  3KQE L;  1JV2 B;  1IQM L;  2PR3 B;  4PH9 A;  5JB8 E;  4NA9 L;  2WFX B;  4A7I A;  3HO4 A;  1PRH A;  4M10 A;  3FCS B;  1NK1 A;  1KLO A;  1YUF A;  1IQK L;  2KL7 A;  1DDX A;  1XKA L;  4X8U L;  4MMZ B;  3R05 A;  1BHT A;  2PF1 A;  2KNI A;  2VJ3 A;  1IQI L;  3LN0 A;  5CKM A;  1PK4 A;  4BDX A;  1XKB A;  2VH0 B;  1RFN B;  3BPS E;  4D0F A;  1PML A;  4JZE L;  1HT8 A;  1EGF A;  2F9B L;  1K36 A;  3K65 A;  2J94 B;  3EGF A;  3F6U L;  2M74 A;  1PTH A;  3CFW A;  2H9E L;  2P3F L;  1Z6E L;  3HS5 A;  1IVO C;  2FEB A;  1Z6C A;  1F0R B;  2WPI E;  2EI6 B;  2Y80 B;  1P9J A;  4YT7 L;  2K51 A;  1B2I A;  1XFE A;  1DX5 I;  2P3U A;  1F7E A;  2I9A A;  2WPH E;  5JBC E;  1URK A;  2W2N E;  4Y71 B;  2K4R A;  1W7X L;  3V65 B;  2QJ4 A;  2UWP B;  1XDT R;  1CX2 A;  2D1J B;  2BQW A;  2W86 A;  1FF7 A;  4X8T L;  4D90 A;  1IGZ A;  5IKT A;  1EBV A;  4OTJ A;  4O03 A;  3CA7 A;  1ZAQ A;  3N8W B;  2Y7X B;  1EPJ A;  1WHF A;  2L0S A;  1HRE A;  5HPG A;  3LTG D;  2VWM K;  3TBD A;  1EMO A;  2BMG A;  2P16 L;  4BXS A;  3BT2 A;  2DOI A;  4Y6D B;  3TZI A;  4Y79 B;  4NGA L;  1LQD A;  2XC5 L;  2HPP P;  1IQJ L;  3S6X A;  1EMN A;  4Y76 B;  3QH0 A;  4OTY A;  1EPH A;  3GIS X;  2J95 B;  5IKR A;  3N8W A;  1L3Y A;  1CEJ A;  1CQE A;  2FLR L;  3N8Y A;  5JBA E;  3HS6 A;  5CT1 A;  3NJP C;  3C9A C;  5KIR A;  1TPG A;  2YGP A;  4ZXY L;  4GU4 A;  2WZP P;  2WG3 C;  2VWL L;  3P5B L;  1YGC L;  2QJ2 A;  1OB1 C;  1DVA L;  2WPJ E;  1KIV A;  1GK5 A;  1IQN L;  1FE2 A;  1V1H A;  4CUD A;  4RRZ A;  1NL2 A;  1M1X B;  4E1G A;  2VVU L;  1AUT L;  3ZYJ B;  1CEB A;  4BXW A;  1TPK A;  1C5M F;  1X7A L;  3MQE A;  1V1I A;  2P28 B;  1GMN A;  5CT3 A;  2B7D L;  2KJ4 A;  1HT5 A;  3ASI A;  1CCF A;  1WU1 B;  3DEM A;  2VH6 B;  2K2S B;  5KN5 C;  2WPM E;  2XBW L;  3NTG A;  2KB9 A;  2OYU P;  4Z0L A;  1KRN A;  2HOR A;  1YO8 A;  2KNF A;  1L5G B;  4CUE A;  6COX A;  2W3K B;  5JW1 A;  1HZ8 A;  1NFX B;  2P93 L;  2W2O E;  2TGF A;  3PGH A;  5FDQ A;  2BQ7 A;  2GD4 A;  1NT0 A;  1O5D L;  1PGE A;  1A0H A;  1FJS L;  3MKP A;  2P3F N;  1LMM A;  3TH3 L;  1MQ6 L;  1FAX L;  3MDL A;  1F0S B;  2K2T A;  1NPE B;  1G1R A;  1LPK A;  4HZH A;  1LPG A;  2FD6 A;  3TK5 B;  1BF9 A;  1IQL L;  2XC0 L;  1NQL B;  1G2M B;  3KL6 B;  2HPQ P;  2DDU A;  3F1S B;  4DUR A;  1EAI C;  1QIU A;  4Z6A L;  5CKN A;  2RNL A;  5E8D A;  4O02 B;  3KK6 A;  2OYE P;  2W3I B;  4YZU B;  3OLU A;  4ZHA B;  2BZ6 L;  1FSB A;  3SW2 A;  3OLT A;  2W26 B;  4LMF A;  5L30 L;  1I71 A;  5I46 L;  1MOX C;  2G00 L;  3Q3K B;  4MMX B;  3QMO A;  2XBY L;  4COX A;  1ADX A;  2AYL A;  1YUK B;  2XC4 L;  1FFM A;  2KV4 A;  1EQH A;  4BTI A;  2BT7 A;  1F7M A;  3KQB L;  1UZJ A;  3HPT A;  3QCW A;  3FBY A;  4Y7A B;  2WFT A;  3LC5 B;  3KRK A;  2XBV L;  4D0E A;  3ZYI B;  2NPR A;  3TGF A;  3HN4 A;  1JL9 A;  4BV7 A;  1HRF A;  4NZQ A;  3NTB A;  3N8Y B;  2P3T A;  2RA0 L;  2P94 L;  4C16 A;  5JVZ A;  2CJI B;  1EPG A;  3KQC L;  4A5T S;  1PXX A;  1KLJ L;  1HX2 A;  2EI8 B;  1HPK A;  1B9W A;  2BOX A;  2HOX A;  4RS0 A;  5JBB E;  1G1Q A;  4A94 C;  2Y38 A;  1LK9 A;  4ISH L;  4KIV A;  2PHB B;  2YGQ A;  1HJ7 A;  4JYV L;  1DQB A;  4BDW A;  1HAE A;  3LIW B;  3HS7 A;  2Y7Z B;  2PF2 A;  4CIK A;  1JFN A;  3RR3 A;  4JYU L;  1HAF A;  4RUT A;  1Q4G A;  4XL1 A;  2BSF A;  1W8B L;  5CS9 A;  1U67 A;  1COU A;  4ZH8 B;  1NFY B;  1PFX L;  4X8V L;  5CP9 A;  2BOH A;  4RRW A;  2BOK L;  2UWO B;  5EGM B;  3ELA L;  2PUQ L;  1EZQ B;  3HO5 A;  5JVY A;  2WYG B;  3GCW E;  1NFW B;  3E6P L;  4JZD L;  5F1A A;  2WPK E;  2VRS A;  1EQG A;  3H5C B;  2EI7 B;  3BT1 A;  1IOE L;  3LC3 B; 
#chains in the Genus database with same CATH homology
 1DIY A;  2FLB L;  3V64 C;  1NZI A;  5IKQ A;  2VVC K;  3GCX E;  2VVV L;  2Q1J B;  1G2L B;  4RRX A;  1PK2 A;  4G1M B;  2WYJ B;  3ZYG A;  3IIT B;  1UZP A;  1GMO A;  3SOB B;  1MQ5 L;  1A3P A;  1KDU A;  4X8S L;  4O1Z A;  2UWL B;  5IKV A;  4BVD A;  3M37 L;  4ZXX L;  3M36 L;  2P26 A;  5CS5 A;  1ATA A;  1LPZ A;  3LN1 A;  2WPL E;  2J2U B;  1NL1 A;  1GP9 A;  3LTF B;  4D3C A;  2MHP A;  2W2M E;  1G1S A;  1HCG B;  4BV5 A;  2J38 B;  2FLG A;  3SOV A;  1I0U A;  5CKQ A;  3KCG L;  3K9X A;  3LAQ A;  2ADX A;  2VWO L;  2SPT A;  1APQ A;  2J34 B;  1TLE A;  2RHP A;  4YT6 L;  5L2Z L;  2Y5F L;  1IP0 A;  1ATD A;  2VWN L;  5K0H B;  2W2Q E;  1PKR A;  1IJQ A;  4XLW A;  2P95 L;  4CSY A;  4ZAE B;  5L2Y L;  1I5K A;  1IQH L;  2W2P E;  1CCV A;  4XBM A;  1V3X B;  1ATB A;  2MGP A;  1U8C B;  1CVW L;  3SOQ A;  3ENS A;  5COX A;  4Y7B B;  1SZB A;  2BO2 A;  2MGR A;  1KLI L;  1N7D A;  2BQ6 A;  2Y5H L;  2DOH X;  1UZK A;  2I9B A;  4BVC A;  4BVW A;  4TGF A;  3Q7D A;  4Z0K B;  1IOX A;  2FZZ L;  2Y81 B;  4JZF L;  3N8X A;  2XBX L;  4CUF A;  2PK4 A;  3KIV A;  1JBU L;  1WHE A;  4RRY A;  1UZQ A;  1APO A;  1K37 A;  1NFU B;  1G1T A;  4NG9 L;  5CIS A;  3U7U G;  5CSQ A;  2J4I B;  1FAK L;  4M11 A;  5CS1 A;  2YGO A;  4BTT A;  1QFK L;  4AQT A;  1IQE L;  1TOZ A;  3POY A;  1KI0 A;  4BVV A;  1P0S L;  1N1I A;  3N8V A;  4BTU A;  1IGX A;  3CS7 L;  2H9E C;  3KQD L;  2Y82 B;  5CS3 A;  1PMK A;  3SP8 A;  3HO3 A;  1KSN B;  3CEN L;  3TK6 B;  1KIG L;  3NXP A;  1YUG A;  3NT1 A;  5JB9 E;  1LMJ A;  1J9C L;  4IUA A;  3N8Z A;  4ISI L;  2BOU A;  2JKH L;  2WG4 B;  3IJE B;  4LOR A;  3U73 A;  1ATE A;  3FFG L;  1HPJ A;  5COE A;  4FM5 A;  1CEA A;  1IQF L;  5F19 A;  4MMY B;  1EPI A;  5CT2 A;  1CVU A;  1IQG L;  2Y5G L;  3KQE L;  1JV2 B;  1IQM L;  2PR3 B;  4PH9 A;  5JB8 E;  4NA9 L;  2WFX B;  4A7I A;  3HO4 A;  1PRH A;  4M10 A;  3FCS B;  1NK1 A;  1KLO A;  1YUF A;  1IQK L;  2KL7 A;  1DDX A;  1XKA L;  4X8U L;  4MMZ B;  3R05 A;  1BHT A;  2PF1 A;  2KNI A;  2VJ3 A;  1IQI L;  3LN0 A;  5CKM A;  1PK4 A;  4BDX A;  1XKB A;  2VH0 B;  1RFN B;  3BPS E;  4D0F A;  1PML A;  4JZE L;  1HT8 A;  1EGF A;  2F9B L;  1K36 A;  3K65 A;  2J94 B;  3EGF A;  3F6U L;  2M74 A;  1PTH A;  3CFW A;  2H9E L;  2P3F L;  1Z6E L;  3HS5 A;  1IVO C;  2FEB A;  1Z6C A;  1F0R B;  2WPI E;  2EI6 B;  2Y80 B;  1P9J A;  4YT7 L;  2K51 A;  1B2I A;  1XFE A;  1DX5 I;  2P3U A;  1F7E A;  2I9A A;  2WPH E;  5JBC E;  1URK A;  2W2N E;  4Y71 B;  2K4R A;  1W7X L;  3V65 B;  2QJ4 A;  2UWP B;  1XDT R;  1CX2 A;  2D1J B;  2BQW A;  2W86 A;  1FF7 A;  4X8T L;  4D90 A;  1IGZ A;  5IKT A;  1EBV A;  4OTJ A;  4O03 A;  3CA7 A;  1ZAQ A;  3N8W B;  2Y7X B;  1EPJ A;  1WHF A;  2L0S A;  1HRE A;  5HPG A;  3LTG D;  2VWM K;  3TBD A;  1EMO A;  2BMG A;  2P16 L;  4BXS A;  3BT2 A;  2DOI A;  4Y6D B;  3TZI A;  4Y79 B;  4NGA L;  1LQD A;  2XC5 L;  2HPP P;  1IQJ L;  3S6X A;  1EMN A;  4Y76 B;  3QH0 A;  4OTY A;  1EPH A;  3GIS X;  2J95 B;  5IKR A;  3N8W A;  1L3Y A;  1CEJ A;  1CQE A;  2FLR L;  3N8Y A;  5JBA E;  3HS6 A;  5CT1 A;  3NJP C;  3C9A C;  5KIR A;  1TPG A;  2YGP A;  4ZXY L;  2WZP P;  2WG3 C;  2VWL L;  3P5B L;  1YGC L;  2QJ2 A;  1OB1 C;  1DVA L;  2WPJ E;  1KIV A;  1GK5 A;  1IQN L;  1FE2 A;  4CUD A;  4RRZ A;  1NL2 A;  1M1X B;  4E1G A;  2VVU L;  1AUT L;  3ZYJ B;  1CEB A;  4BXW A;  1TPK A;  1C5M F;  1X7A L;  3MQE A;  2P28 B;  1GMN A;  5CT3 A;  2B7D L;  2KJ4 A;  1HT5 A;  3ASI A;  1CCF A;  1WU1 B;  3DEM A;  2VH6 B;  2K2S B;  5KN5 C;  2WPM E;  2XBW L;  3NTG A;  2KB9 A;  2OYU P;  4Z0L A;  1KRN A;  1YO8 A;  2KNF A;  1L5G B;  4CUE A;  6COX A;  2W3K B;  5JW1 A;  1HZ8 A;  1NFX B;  2P93 L;  2W2O E;  2TGF A;  3PGH A;  5FDQ A;  2BQ7 A;  2GD4 A;  1NT0 A;  1O5D L;  1PGE A;  1A0H A;  1FJS L;  3MKP A;  2P3F N;  1LMM A;  3TH3 L;  1MQ6 L;  1FAX L;  3MDL A;  1F0S B;  2K2T A;  1NPE B;  1G1R A;  1LPK A;  4HZH A;  1LPG A;  2FD6 A;  3TK5 B;  1BF9 A;  1IQL L;  2XC0 L;  1NQL B;  1G2M B;  3KL6 B;  2HPQ P;  2DDU A;  3F1S B;  4DUR A;  1EAI C;  4Z6A L;  5CKN A;  2RNL A;  5E8D A;  4O02 B;  3KK6 A;  2OYE P;  2W3I B;  4YZU B;  3OLU A;  4ZHA B;  2BZ6 L;  1FSB A;  3SW2 A;  3OLT A;  2W26 B;  4LMF A;  5L30 L;  1I71 A;  5I46 L;  1MOX C;  2G00 L;  3Q3K B;  4MMX B;  3QMO A;  2XBY L;  4COX A;  1ADX A;  2AYL A;  1YUK B;  2XC4 L;  1FFM A;  2KV4 A;  1EQH A;  4BTI A;  1F7M A;  3KQB L;  1UZJ A;  3HPT A;  3QCW A;  3FBY A;  4Y7A B;  2WFT A;  3LC5 B;  3KRK A;  2XBV L;  4D0E A;  3ZYI B;  2NPR A;  3TGF A;  3HN4 A;  1JL9 A;  4BV7 A;  1HRF A;  4NZQ A;  3NTB A;  3N8Y B;  2P3T A;  2RA0 L;  2P94 L;  4C16 A;  5JVZ A;  2CJI B;  1EPG A;  3KQC L;  4A5T S;  1PXX A;  1KLJ L;  1HX2 A;  2EI8 B;  1HPK A;  1B9W A;  2BOX A;  4RS0 A;  5JBB E;  1G1Q A;  4A94 C;  2Y38 A;  4ISH L;  4KIV A;  2PHB B;  2YGQ A;  1HJ7 A;  4JYV L;  1DQB A;  4BDW A;  1HAE A;  3LIW B;  3HS7 A;  2Y7Z B;  2PF2 A;  4CIK A;  1JFN A;  3RR3 A;  4JYU L;  1HAF A;  4RUT A;  1Q4G A;  4XL1 A;  1W8B L;  5CS9 A;  1U67 A;  1COU A;  4ZH8 B;  1NFY B;  1PFX L;  4X8V L;  5CP9 A;  2BOH A;  4RRW A;  2BOK L;  2UWO B;  5EGM B;  3ELA L;  2PUQ L;  1EZQ B;  3HO5 A;  5JVY A;  2WYG B;  3GCW E;  1NFW B;  3E6P L;  4JZD L;  5F1A A;  2WPK E;  1EQG A;  3H5C B;  2EI7 B;  3BT1 A;  1IOE L;  3LC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...