1CEBA

The structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4-aminomethylcyclohexane-1-carboxylic acid)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
ECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN
publication title Crystal structures of the recombinant kringle 1 domain of human plasminogen in complexes with the ligands epsilon-aminocaproic acid and trans-4-(aminomethyl)cyclohexane-1-carboxylic Acid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease
total genus 16
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1995-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1cebA00
4BV5A 1GMNA 4BVCA 2DOIA 3LAQA 2DOHX 3U73A 1KRNA 4NZQA 4A5TS 1B2IA 2KJ4A 2PF1A 3E6PL 2QJ2A 2PK4A 2I9BA 4O03A 4HZHA 4IUAA 2HPQP 1KI0A 4DURA 3BT1A 3KIVA 2SPTA 3MKPA 2I9AA 5CSQA 1PKRA 2PF2A 1NK1A 1GP9A 1URKA 1CEAA 1JFNA 4KIVA 4BVWA 5CP9A 5HPGA 1HPKA 2FEBA 5CS9A 1CEBA 1GMOA 5CS5A 3SP8A 4CIKA 1TPKA 1I5KA 1NL1A 1BHTA 1A0HA 2HPPP 1HPJA 5COEA 1PK2A 3HN4A 5CS1A 1PMKA 3NXPA 5CT1A 3K65A 1KDUA 2QJ4A 1NL2A 4BV7A 5CT2A 2L0SA 4BVDA 1PK4A 4BVVA 1PMLA 1I71A 5CT3A 5CS3A 2FD6A 2K4RA 4D3CA 3BT2A 2K51A 2KNFA 1KIVA
chains in the Genus database with same CATH superfamily
4BV5A 1GMNA 4BVCA 2DOIA 3LAQA 2DOHX 3U73A 1KRNA 4NZQA 4A5TS 1B2IA 2KJ4A 2PF1A 3E6PL 2QJ2A 2PK4A 2I9BA 4O03A 4HZHA 4IUAA 2HPQP 1KI0A 4DURA 3BT1A 3KIVA 2SPTA 3MKPA 2I9AA 5CSQA 1PKRA 2PF2A 1NK1A 1GP9A 1URKA 1CEAA 1JFNA 4KIVA 4BVWA 5CP9A 5HPGA 1HPKA 2FEBA 5CS9A 1CEBA 1GMOA 5CS5A 3SP8A 4CIKA 1TPKA 1I5KA 1NL1A 1BHTA 1A0HA 2HPPP 1HPJA 5COEA 1PK2A 3HN4A 5CS1A 1PMKA 3NXPA 5CT1A 3K65A 1KDUA 2QJ4A 1NL2A 4BV7A 5CT2A 2L0SA 4BVDA 1PK4A 4BVVA 1PMLA 1I71A 5CT3A 5CS3A 2FD6A 2K4RA 4D3CA 3BT2A 2K51A 2KNFA 1KIVA
chains in the Genus database with same CATH topology
4BV5A 1GMNA 4BVCA 2DOIA 3LAQA 2DOHX 3U73A 1KRNA 4NZQA 4A5TS 1B2IA 2KJ4A 2PF1A 3E6PL 2QJ2A 2PK4A 2I9BA 4O03A 4HZHA 4IUAA 2HPQP 1KI0A 4DURA 3BT1A 3KIVA 2SPTA 3MKPA 2I9AA 5CSQA 1PKRA 2PF2A 1NK1A 1GP9A 1URKA 1CEAA 1JFNA 4KIVA 4BVWA 5CP9A 5HPGA 1HPKA 2FEBA 5CS9A 1CEBA 1GMOA 5CS5A 3SP8A 4CIKA 1TPKA 1I5KA 1NL1A 1BHTA 1A0HA 2HPPP 1HPJA 5COEA 1PK2A 3HN4A 5CS1A 1PMKA 3NXPA 5CT1A 3K65A 1KDUA 2QJ4A 1NL2A 4BV7A 5CT2A 2L0SA 4BVDA 1PK4A 4BVVA 1PMLA 1I71A 5CT3A 5CS3A 2FD6A 2K4RA 4D3CA 3BT2A 2K51A 2KNFA 1KIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BV5 A;  1GMN A;  4BVC A;  2DOI A;  3LAQ A;  2DOH X;  3U73 A;  1KRN A;  4NZQ A;  4A5T S;  1B2I A;  2KJ4 A;  2PF1 A;  3E6P L;  2QJ2 A;  2PK4 A;  2I9B A;  4O03 A;  4HZH A;  4IUA A;  2HPQ P;  1KI0 A;  4DUR A;  3BT1 A;  3KIV A;  2SPT A;  3MKP A;  2I9A A;  5CSQ A;  1PKR A;  2PF2 A;  1NK1 A;  1GP9 A;  1URK A;  1CEA A;  1JFN A;  4KIV A;  4BVW A;  5CP9 A;  5HPG A;  1HPK A;  2FEB A;  5CS9 A;  1CEB A;  1GMO A;  5CS5 A;  3SP8 A;  4CIK A;  1TPK A;  1I5K A;  1NL1 A;  1BHT A;  1A0H A;  2HPP P;  1HPJ A;  5COE A;  1PK2 A;  3HN4 A;  5CS1 A;  1PMK A;  3NXP A;  5CT1 A;  3K65 A;  1KDU A;  2QJ4 A;  1NL2 A;  4BV7 A;  5CT2 A;  2L0S A;  4BVD A;  1PK4 A;  4BVV A;  1PML A;  1I71 A;  5CT3 A;  5CS3 A;  2FD6 A;  2K4R A;  4D3C A;  3BT2 A;  2K51 A;  2KNF A;  1KIV A; 
#chains in the Genus database with same CATH topology
 4BV5 A;  1GMN A;  4BVC A;  2DOI A;  3LAQ A;  2DOH X;  3U73 A;  1KRN A;  4NZQ A;  4A5T S;  1B2I A;  2KJ4 A;  2PF1 A;  3E6P L;  2QJ2 A;  2PK4 A;  2I9B A;  4O03 A;  4HZH A;  4IUA A;  2HPQ P;  1KI0 A;  4DUR A;  3BT1 A;  3KIV A;  2SPT A;  3MKP A;  2I9A A;  5CSQ A;  1PKR A;  2PF2 A;  1NK1 A;  1GP9 A;  1URK A;  1CEA A;  1JFN A;  4KIV A;  4BVW A;  5CP9 A;  5HPG A;  1HPK A;  2FEB A;  5CS9 A;  1CEB A;  1GMO A;  5CS5 A;  3SP8 A;  4CIK A;  1TPK A;  1I5K A;  1NL1 A;  1BHT A;  1A0H A;  2HPP P;  1HPJ A;  5COE A;  1PK2 A;  3HN4 A;  5CS1 A;  1PMK A;  3NXP A;  5CT1 A;  3K65 A;  1KDU A;  2QJ4 A;  1NL2 A;  4BV7 A;  5CT2 A;  2L0S A;  4BVD A;  1PK4 A;  4BVV A;  1PML A;  1I71 A;  5CT3 A;  5CS3 A;  2FD6 A;  2K4R A;  4D3C A;  3BT2 A;  2K51 A;  2KNF A;  1KIV A; 
#chains in the Genus database with same CATH homology
 4BV5 A;  1GMN A;  4BVC A;  2DOI A;  3LAQ A;  2DOH X;  3U73 A;  1KRN A;  4NZQ A;  4A5T S;  1B2I A;  2KJ4 A;  2PF1 A;  3E6P L;  2QJ2 A;  2PK4 A;  2I9B A;  4O03 A;  4HZH A;  4IUA A;  2HPQ P;  1KI0 A;  4DUR A;  3BT1 A;  3KIV A;  2SPT A;  3MKP A;  2I9A A;  5CSQ A;  1PKR A;  2PF2 A;  1NK1 A;  1GP9 A;  1URK A;  1CEA A;  1JFN A;  4KIV A;  4BVW A;  5CP9 A;  5HPG A;  1HPK A;  2FEB A;  5CS9 A;  1CEB A;  1GMO A;  5CS5 A;  3SP8 A;  4CIK A;  1TPK A;  1I5K A;  1NL1 A;  1BHT A;  1A0H A;  2HPP P;  1HPJ A;  5COE A;  1PK2 A;  3HN4 A;  5CS1 A;  1PMK A;  3NXP A;  5CT1 A;  3K65 A;  1KDU A;  2QJ4 A;  1NL2 A;  4BV7 A;  5CT2 A;  2L0S A;  4BVD A;  1PK4 A;  4BVV A;  1PML A;  1I71 A;  5CT3 A;  5CS3 A;  2FD6 A;  2K4R A;  4D3C A;  3BT2 A;  2K51 A;  2KNF A;  1KIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...