5CS3A

The structure of the nk1 fragment of hgf/sf complexed with (h)epps
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 33
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cs3A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cs3A01
4IUAA 2QJ4A 4APMA 4KIVA 4BV7A 1YXEA 2PF1A 1I71A 5HPGA 2I9AA 4R1CA 1HPKA 4BVVA 3BT2A 1HPJA 2J8LA 2Z8WA 4R1AA 5COEA 4Z09A 1HKYA 1URKA 2J8JA 3BT1A 4CIKA 1PMLA 5CSQA 1NK1A 4DURA 1A0HA 4R19A 2KJ4A 3SP8A 1KIVA 4NZQA 4R1BA 2KNFA 2HGFA 1W81A 1W8KA 1B2IA 1GMOA 3NXPA 2FEBA 1I8NA 2LL4M 1PKRA 2QJ2A 2F83A 3HMSA 5EOKA 1KDUA 2Z8VA 5CT1A 2PK4A 3LAQA 5CS5A 1JFNA 3E6PL 5CT3A 2DOHX 2K13X 3SRIA 4APLA 5CP9A 2HPPP 4BVWA 4A5TS 3HMRA 2K51A 2YIOA 4UV6A 1KRNA 3HMTA 5CS3A 2I9BA 5CT2A 4HZHA 1TPKA 2X2ZA 3SRJA 1GP9A 4Z0EA 2FD6A 1I5KA 3HN4A 4Z0FA 2YILA 1KI0A 3MKPA 1PK4A 4O03A 1BHTA 1GMNA 2Q8BA 1PK2A 4BV5A 1PMKA 5CS9A 2Y8RA 3KIVA 1CEBA 1NL2A 2PF2A 3K65A 1Z40A 2DOIA 4D3CA 4Z0DA 2L0SA 3U73A 2K4RA 3ZLEA 1NL1A 5I25A 2HPQP 1CEAA 4UAOA 2LL3A 2YIPA 5CS1A 2Q8AA 5EODA 2SPTA 4BVCA 3ZWZA 4BVDA
chains in the Genus database with same CATH superfamily
4IUAA 2QJ4A 4APMA 4KIVA 4BV7A 1YXEA 2PF1A 1I71A 5HPGA 2I9AA 4R1CA 1HPKA 4BVVA 3BT2A 1HPJA 2J8LA 2Z8WA 4R1AA 5COEA 4Z09A 1HKYA 1URKA 2J8JA 3BT1A 4CIKA 1PMLA 5CSQA 1NK1A 4DURA 1A0HA 4R19A 4YIVA 2KJ4A 3SP8A 1KIVA 4YIZA 4NZQA 4R1BA 2KNFA 2HGFA 1W81A 1W8KA 1B2IA 1GMOA 3NXPA 2FEBA 1I8NA 2LL4M 1PKRA 2QJ2A 2F83A 3HMSA 5EOKA 1KDUA 2Z8VA 5CT1A 2PK4A 3LAQA 5CS5A 1JFNA 3E6PL 5CT3A 2DOHX 2K13X 3SRIA 4APLA 5CP9A 2HPPP 4BVWA 4A5TS 3HMRA 2K51A 2YIOA 4UV6A 1KRNA 3HMTA 5CS3A 2I9BA 5CT2A 4HZHA 1TPKA 2X2ZA 3SRJA 1GP9A 4Z0EA 2FD6A 1I5KA 3HN4A 4Z0FA 2YILA 1KI0A 3MKPA 1PK4A 4O03A 1BHTA 1GMNA 2Q8BA 1PK2A 4BV5A 1PMKA 5CS9A 2Y8RA 3KIVA 1CEBA 1NL2A 2PF2A 3K65A 1Z40A 2DOIA 4D3CA 4Z0DA 2L0SA 3U73A 2K4RA 3ZLEA 1NL1A 5I25A 2HPQP 1CEAA 4UAOA 2LL3A 2YIPA 2KL5A 5CS1A 2Q8AA 5EODA 2SPTA 4BVCA 3ZWZA 4BVDA
chains in the Genus database with same CATH topology
4IUAA 2QJ4A 4APMA 4KIVA 4BV7A 1YXEA 2PF1A 1I71A 5HPGA 2I9AA 4R1CA 1HPKA 4BVVA 3BT2A 1HPJA 2J8LA 2Z8WA 4R1AA 5COEA 4Z09A 1HKYA 1URKA 2J8JA 3BT1A 4CIKA 1PMLA 5CSQA 1NK1A 4DURA 1A0HA 4R19A 4YIVA 2KJ4A 3SP8A 1KIVA 4YIZA 4NZQA 4R1BA 2KNFA 2HGFA 1W81A 1W8KA 1B2IA 1GMOA 3NXPA 2FEBA 1I8NA 2LL4M 1PKRA 2QJ2A 2F83A 3HMSA 5EOKA 1KDUA 2Z8VA 5CT1A 2PK4A 3LAQA 5CS5A 1JFNA 3E6PL 5CT3A 2DOHX 2K13X 3SRIA 4APLA 5CP9A 2HPPP 4BVWA 4A5TS 3HMRA 2K51A 2YIOA 4UV6A 1KRNA 3HMTA 5CS3A 2I9BA 5CT2A 4HZHA 1TPKA 2X2ZA 3SRJA 1GP9A 4Z0EA 2FD6A 1I5KA 3HN4A 4Z0FA 2YILA 1KI0A 3MKPA 1PK4A 4O03A 1BHTA 1GMNA 2Q8BA 1PK2A 4BV5A 1PMKA 5CS9A 2Y8RA 3KIVA 1CEBA 1NL2A 2PF2A 3K65A 1Z40A 2DOIA 4D3CA 4Z0DA 2L0SA 3U73A 2K4RA 3ZLEA 1NL1A 5I25A 2HPQP 1CEAA 4UAOA 2LL3A 2YIPA 2KL5A 5CS1A 2Q8AA 5EODA 2SPTA 4BVCA 3ZWZA 4BVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUA A;  2QJ4 A;  4APM A;  4KIV A;  4BV7 A;  1YXE A;  2PF1 A;  1I71 A;  5HPG A;  2I9A A;  4R1C A;  1HPK A;  4BVV A;  3BT2 A;  1HPJ A;  2J8L A;  2Z8W A;  4R1A A;  5COE A;  4Z09 A;  1HKY A;  1URK A;  2J8J A;  3BT1 A;  4CIK A;  1PML A;  5CSQ A;  1NK1 A;  4DUR A;  1A0H A;  4R19 A;  2KJ4 A;  3SP8 A;  1KIV A;  4NZQ A;  4R1B A;  2KNF A;  2HGF A;  1W81 A;  1W8K A;  1B2I A;  1GMO A;  3NXP A;  2FEB A;  1I8N A;  2LL4 M;  1PKR A;  2QJ2 A;  2F83 A;  3HMS A;  5EOK A;  1KDU A;  2Z8V A;  5CT1 A;  2PK4 A;  3LAQ A;  5CS5 A;  1JFN A;  3E6P L;  5CT3 A;  2DOH X;  2K13 X;  3SRI A;  4APL A;  5CP9 A;  2HPP P;  4BVW A;  4A5T S;  3HMR A;  2K51 A;  2YIO A;  4UV6 A;  1KRN A;  3HMT A;  5CS3 A;  2I9B A;  5CT2 A;  4HZH A;  1TPK A;  2X2Z A;  3SRJ A;  1GP9 A;  4Z0E A;  2FD6 A;  1I5K A;  3HN4 A;  4Z0F A;  2YIL A;  1KI0 A;  3MKP A;  1PK4 A;  4O03 A;  1BHT A;  1GMN A;  2Q8B A;  1PK2 A;  4BV5 A;  1PMK A;  5CS9 A;  2Y8R A;  3KIV A;  1CEB A;  1NL2 A;  2PF2 A;  3K65 A;  1Z40 A;  2DOI A;  4D3C A;  4Z0D A;  2L0S A;  3U73 A;  2K4R A;  3ZLE A;  1NL1 A;  5I25 A;  2HPQ P;  1CEA A;  4UAO A;  2LL3 A;  2YIP A;  5CS1 A;  2Q8A A;  5EOD A;  2SPT A;  4BVC A;  3ZWZ A;  4BVD A; 
#chains in the Genus database with same CATH topology
 4IUA A;  2QJ4 A;  4APM A;  4KIV A;  4BV7 A;  1YXE A;  2PF1 A;  1I71 A;  5HPG A;  2I9A A;  4R1C A;  1HPK A;  4BVV A;  3BT2 A;  1HPJ A;  2J8L A;  2Z8W A;  4R1A A;  5COE A;  4Z09 A;  1HKY A;  1URK A;  2J8J A;  3BT1 A;  4CIK A;  1PML A;  5CSQ A;  1NK1 A;  4DUR A;  1A0H A;  4R19 A;  4YIV A;  2KJ4 A;  3SP8 A;  1KIV A;  4YIZ A;  4NZQ A;  4R1B A;  2KNF A;  2HGF A;  1W81 A;  1W8K A;  1B2I A;  1GMO A;  3NXP A;  2FEB A;  1I8N A;  2LL4 M;  1PKR A;  2QJ2 A;  2F83 A;  3HMS A;  5EOK A;  1KDU A;  2Z8V A;  5CT1 A;  2PK4 A;  3LAQ A;  5CS5 A;  1JFN A;  3E6P L;  5CT3 A;  2DOH X;  2K13 X;  3SRI A;  4APL A;  5CP9 A;  2HPP P;  4BVW A;  4A5T S;  3HMR A;  2K51 A;  2YIO A;  4UV6 A;  1KRN A;  3HMT A;  5CS3 A;  2I9B A;  5CT2 A;  4HZH A;  1TPK A;  2X2Z A;  3SRJ A;  1GP9 A;  4Z0E A;  2FD6 A;  1I5K A;  3HN4 A;  4Z0F A;  2YIL A;  1KI0 A;  3MKP A;  1PK4 A;  4O03 A;  1BHT A;  1GMN A;  2Q8B A;  1PK2 A;  4BV5 A;  1PMK A;  5CS9 A;  2Y8R A;  3KIV A;  1CEB A;  1NL2 A;  2PF2 A;  3K65 A;  1Z40 A;  2DOI A;  4D3C A;  4Z0D A;  2L0S A;  3U73 A;  2K4R A;  3ZLE A;  1NL1 A;  5I25 A;  2HPQ P;  1CEA A;  4UAO A;  2LL3 A;  2YIP A;  2KL5 A;  5CS1 A;  2Q8A A;  5EOD A;  2SPT A;  4BVC A;  3ZWZ A;  4BVD A; 
#chains in the Genus database with same CATH homology
 4IUA A;  2QJ4 A;  4APM A;  4KIV A;  4BV7 A;  1YXE A;  2PF1 A;  1I71 A;  5HPG A;  2I9A A;  4R1C A;  1HPK A;  4BVV A;  3BT2 A;  1HPJ A;  2J8L A;  2Z8W A;  4R1A A;  5COE A;  4Z09 A;  1HKY A;  1URK A;  2J8J A;  3BT1 A;  4CIK A;  1PML A;  5CSQ A;  1NK1 A;  4DUR A;  1A0H A;  4R19 A;  4YIV A;  2KJ4 A;  3SP8 A;  1KIV A;  4YIZ A;  4NZQ A;  4R1B A;  2KNF A;  2HGF A;  1W81 A;  1W8K A;  1B2I A;  1GMO A;  3NXP A;  2FEB A;  1I8N A;  2LL4 M;  1PKR A;  2QJ2 A;  2F83 A;  3HMS A;  5EOK A;  1KDU A;  2Z8V A;  5CT1 A;  2PK4 A;  3LAQ A;  5CS5 A;  1JFN A;  3E6P L;  5CT3 A;  2DOH X;  2K13 X;  3SRI A;  4APL A;  5CP9 A;  2HPP P;  4BVW A;  4A5T S;  3HMR A;  2K51 A;  2YIO A;  4UV6 A;  1KRN A;  3HMT A;  5CS3 A;  2I9B A;  5CT2 A;  4HZH A;  1TPK A;  2X2Z A;  3SRJ A;  1GP9 A;  4Z0E A;  2FD6 A;  1I5K A;  3HN4 A;  4Z0F A;  2YIL A;  1KI0 A;  3MKP A;  1PK4 A;  4O03 A;  1BHT A;  1GMN A;  2Q8B A;  1PK2 A;  4BV5 A;  1PMK A;  5CS9 A;  2Y8R A;  3KIV A;  1CEB A;  1NL2 A;  2PF2 A;  3K65 A;  1Z40 A;  2DOI A;  4D3C A;  4Z0D A;  2L0S A;  3U73 A;  2K4R A;  3ZLE A;  1NL1 A;  5I25 A;  2HPQ P;  1CEA A;  4UAO A;  2LL3 A;  2YIP A;  2KL5 A;  5CS1 A;  2Q8A A;  5EOD A;  2SPT A;  4BVC A;  3ZWZ A;  4BVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...