1GMOA

Crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR
publication title Crystal Structures of Nk1-Heparin Complexes Reveal the Basis for Nk1 Activity and Enable Engineering of Potent Agonists of the met Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 37
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1gmoA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1gmoA01
5EODA 5COEA 1NL1A 2I9AA 2J8JA 2Z8VA 3SRJA 1W8KA 4KIVA 4NZQA 3HMSA 1PKRA 5CS1A 4BVVA 2Q8BA 1JFNA 2YIOA 4R1BA 1YXEA 1Z40A 4O03A 4D3CA 5CT3A 4UAOA 1W81A 1A0HA 5EOKA 5CS5A 3ZWZA 2PF1A 4CIKA 4DURA 2K51A 1KI0A 4UV6A 2FEBA 4Z0DA 2HGFA 5CS9A 1GP9A 3MKPA 4BV5A 2HPQP 2FD6A 2PF2A 4Z0FA 3HN4A 4BVCA 1TPKA 2L0SA 2KNFA 3LAQA 2YILA 4Z0EA 1B2IA 4R19A 2DOHX 3K65A 1BHTA 2YIPA 1KRNA 4BVDA 4IUAA 4HZHA 5CT1A 2K13X 3U73A 3HMTA 2QJ2A 3ZLEA 5CT2A 2K4RA 1PK4A 2SPTA 5HPGA 2LL4M 2LL3A 1NK1A 2KJ4A 1GMOA 3SP8A 2Z8WA 3SRIA 2J8LA 1I8NA 2Q8AA 1KIVA 2Y8RA 2QJ4A 3KIVA 1NL2A 4R1CA 4APLA 1PMLA 1URKA 2X2ZA 2F83A 1HPKA 2I9BA 1CEAA 5CSQA 4Z09A 5CS3A 1PMKA 4R1AA 3BT2A 1I5KA 1HKYA 1HPJA 1I71A 1KDUA 2PK4A 2DOIA 3E6PL 5I25A 3BT1A 1GMNA 4A5TS 1PK2A 3HMRA 5CP9A 3NXPA 2HPPP 4BVWA 4APMA 4BV7A 1CEBA
chains in the Genus database with same CATH superfamily
5EODA 5COEA 1NL1A 2I9AA 2J8JA 2Z8VA 3SRJA 1W8KA 4KIVA 4NZQA 3HMSA 1PKRA 5CS1A 4BVVA 2Q8BA 1JFNA 2YIOA 4R1BA 1YXEA 1Z40A 4O03A 4D3CA 5CT3A 4UAOA 1W81A 1A0HA 5EOKA 5CS5A 3ZWZA 2PF1A 4CIKA 4DURA 2K51A 1KI0A 4UV6A 2FEBA 4Z0DA 2HGFA 5CS9A 1GP9A 3MKPA 4BV5A 4YIZA 2HPQP 2FD6A 2PF2A 4Z0FA 3HN4A 4BVCA 1TPKA 2L0SA 2KNFA 3LAQA 2YILA 4Z0EA 1B2IA 4R19A 2DOHX 3K65A 1BHTA 2YIPA 1KRNA 4BVDA 4IUAA 4HZHA 5CT1A 2K13X 3U73A 3HMTA 2QJ2A 3ZLEA 5CT2A 2K4RA 1PK4A 2SPTA 5HPGA 2LL4M 2LL3A 1NK1A 2KJ4A 1GMOA 3SP8A 2Z8WA 3SRIA 2J8LA 1I8NA 2Q8AA 1KIVA 2Y8RA 2QJ4A 3KIVA 1NL2A 4R1CA 4APLA 1PMLA 1URKA 4YIVA 2X2ZA 2F83A 1HPKA 2I9BA 1CEAA 5CSQA 4Z09A 5CS3A 1PMKA 4R1AA 3BT2A 1I5KA 1HKYA 1HPJA 1I71A 1KDUA 2PK4A 2DOIA 3E6PL 5I25A 3BT1A 1GMNA 4A5TS 1PK2A 3HMRA 5CP9A 3NXPA 2HPPP 4BVWA 2KL5A 4APMA 4BV7A 1CEBA
chains in the Genus database with same CATH topology
5EODA 5COEA 1NL1A 2I9AA 2J8JA 2Z8VA 3SRJA 1W8KA 4KIVA 4NZQA 3HMSA 1PKRA 5CS1A 4BVVA 2Q8BA 1JFNA 2YIOA 4R1BA 1YXEA 1Z40A 4O03A 4D3CA 5CT3A 4UAOA 1W81A 1A0HA 5EOKA 5CS5A 3ZWZA 2PF1A 4CIKA 4DURA 2K51A 1KI0A 4UV6A 2FEBA 4Z0DA 2HGFA 5CS9A 1GP9A 3MKPA 4BV5A 4YIZA 2HPQP 2FD6A 2PF2A 4Z0FA 3HN4A 4BVCA 1TPKA 2L0SA 2KNFA 3LAQA 2YILA 4Z0EA 1B2IA 4R19A 2DOHX 3K65A 1BHTA 2YIPA 1KRNA 4BVDA 4IUAA 4HZHA 5CT1A 2K13X 3U73A 3HMTA 2QJ2A 3ZLEA 5CT2A 2K4RA 1PK4A 2SPTA 5HPGA 2LL4M 2LL3A 1NK1A 2KJ4A 1GMOA 3SP8A 2Z8WA 3SRIA 2J8LA 1I8NA 2Q8AA 1KIVA 2Y8RA 2QJ4A 3KIVA 1NL2A 4R1CA 4APLA 1PMLA 1URKA 4YIVA 2X2ZA 2F83A 1HPKA 2I9BA 1CEAA 5CSQA 4Z09A 5CS3A 1PMKA 4R1AA 3BT2A 1I5KA 1HKYA 1HPJA 1I71A 1KDUA 2PK4A 2DOIA 3E6PL 5I25A 3BT1A 1GMNA 4A5TS 1PK2A 3HMRA 5CP9A 3NXPA 2HPPP 4BVWA 2KL5A 4APMA 4BV7A 1CEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOD A;  5COE A;  1NL1 A;  2I9A A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  4KIV A;  4NZQ A;  3HMS A;  1PKR A;  5CS1 A;  4BVV A;  2Q8B A;  1JFN A;  2YIO A;  4R1B A;  1YXE A;  1Z40 A;  4O03 A;  4D3C A;  5CT3 A;  4UAO A;  1W81 A;  1A0H A;  5EOK A;  5CS5 A;  3ZWZ A;  2PF1 A;  4CIK A;  4DUR A;  2K51 A;  1KI0 A;  4UV6 A;  2FEB A;  4Z0D A;  2HGF A;  5CS9 A;  1GP9 A;  3MKP A;  4BV5 A;  2HPQ P;  2FD6 A;  2PF2 A;  4Z0F A;  3HN4 A;  4BVC A;  1TPK A;  2L0S A;  2KNF A;  3LAQ A;  2YIL A;  4Z0E A;  1B2I A;  4R19 A;  2DOH X;  3K65 A;  1BHT A;  2YIP A;  1KRN A;  4BVD A;  4IUA A;  4HZH A;  5CT1 A;  2K13 X;  3U73 A;  3HMT A;  2QJ2 A;  3ZLE A;  5CT2 A;  2K4R A;  1PK4 A;  2SPT A;  5HPG A;  2LL4 M;  2LL3 A;  1NK1 A;  2KJ4 A;  1GMO A;  3SP8 A;  2Z8W A;  3SRI A;  2J8L A;  1I8N A;  2Q8A A;  1KIV A;  2Y8R A;  2QJ4 A;  3KIV A;  1NL2 A;  4R1C A;  4APL A;  1PML A;  1URK A;  2X2Z A;  2F83 A;  1HPK A;  2I9B A;  1CEA A;  5CSQ A;  4Z09 A;  5CS3 A;  1PMK A;  4R1A A;  3BT2 A;  1I5K A;  1HKY A;  1HPJ A;  1I71 A;  1KDU A;  2PK4 A;  2DOI A;  3E6P L;  5I25 A;  3BT1 A;  1GMN A;  4A5T S;  1PK2 A;  3HMR A;  5CP9 A;  3NXP A;  2HPP P;  4BVW A;  4APM A;  4BV7 A;  1CEB A; 
#chains in the Genus database with same CATH topology
 5EOD A;  5COE A;  1NL1 A;  2I9A A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  4KIV A;  4NZQ A;  3HMS A;  1PKR A;  5CS1 A;  4BVV A;  2Q8B A;  1JFN A;  2YIO A;  4R1B A;  1YXE A;  1Z40 A;  4O03 A;  4D3C A;  5CT3 A;  4UAO A;  1W81 A;  1A0H A;  5EOK A;  5CS5 A;  3ZWZ A;  2PF1 A;  4CIK A;  4DUR A;  2K51 A;  1KI0 A;  4UV6 A;  2FEB A;  4Z0D A;  2HGF A;  5CS9 A;  1GP9 A;  3MKP A;  4BV5 A;  4YIZ A;  2HPQ P;  2FD6 A;  2PF2 A;  4Z0F A;  3HN4 A;  4BVC A;  1TPK A;  2L0S A;  2KNF A;  3LAQ A;  2YIL A;  4Z0E A;  1B2I A;  4R19 A;  2DOH X;  3K65 A;  1BHT A;  2YIP A;  1KRN A;  4BVD A;  4IUA A;  4HZH A;  5CT1 A;  2K13 X;  3U73 A;  3HMT A;  2QJ2 A;  3ZLE A;  5CT2 A;  2K4R A;  1PK4 A;  2SPT A;  5HPG A;  2LL4 M;  2LL3 A;  1NK1 A;  2KJ4 A;  1GMO A;  3SP8 A;  2Z8W A;  3SRI A;  2J8L A;  1I8N A;  2Q8A A;  1KIV A;  2Y8R A;  2QJ4 A;  3KIV A;  1NL2 A;  4R1C A;  4APL A;  1PML A;  1URK A;  4YIV A;  2X2Z A;  2F83 A;  1HPK A;  2I9B A;  1CEA A;  5CSQ A;  4Z09 A;  5CS3 A;  1PMK A;  4R1A A;  3BT2 A;  1I5K A;  1HKY A;  1HPJ A;  1I71 A;  1KDU A;  2PK4 A;  2DOI A;  3E6P L;  5I25 A;  3BT1 A;  1GMN A;  4A5T S;  1PK2 A;  3HMR A;  5CP9 A;  3NXP A;  2HPP P;  4BVW A;  2KL5 A;  4APM A;  4BV7 A;  1CEB A; 
#chains in the Genus database with same CATH homology
 5EOD A;  5COE A;  1NL1 A;  2I9A A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  4KIV A;  4NZQ A;  3HMS A;  1PKR A;  5CS1 A;  4BVV A;  2Q8B A;  1JFN A;  2YIO A;  4R1B A;  1YXE A;  1Z40 A;  4O03 A;  4D3C A;  5CT3 A;  4UAO A;  1W81 A;  1A0H A;  5EOK A;  5CS5 A;  3ZWZ A;  2PF1 A;  4CIK A;  4DUR A;  2K51 A;  1KI0 A;  4UV6 A;  2FEB A;  4Z0D A;  2HGF A;  5CS9 A;  1GP9 A;  3MKP A;  4BV5 A;  4YIZ A;  2HPQ P;  2FD6 A;  2PF2 A;  4Z0F A;  3HN4 A;  4BVC A;  1TPK A;  2L0S A;  2KNF A;  3LAQ A;  2YIL A;  4Z0E A;  1B2I A;  4R19 A;  2DOH X;  3K65 A;  1BHT A;  2YIP A;  1KRN A;  4BVD A;  4IUA A;  4HZH A;  5CT1 A;  2K13 X;  3U73 A;  3HMT A;  2QJ2 A;  3ZLE A;  5CT2 A;  2K4R A;  1PK4 A;  2SPT A;  5HPG A;  2LL4 M;  2LL3 A;  1NK1 A;  2KJ4 A;  1GMO A;  3SP8 A;  2Z8W A;  3SRI A;  2J8L A;  1I8N A;  2Q8A A;  1KIV A;  2Y8R A;  2QJ4 A;  3KIV A;  1NL2 A;  4R1C A;  4APL A;  1PML A;  1URK A;  4YIV A;  2X2Z A;  2F83 A;  1HPK A;  2I9B A;  1CEA A;  5CSQ A;  4Z09 A;  5CS3 A;  1PMK A;  4R1A A;  3BT2 A;  1I5K A;  1HKY A;  1HPJ A;  1I71 A;  1KDU A;  2PK4 A;  2DOI A;  3E6P L;  5I25 A;  3BT1 A;  1GMN A;  4A5T S;  1PK2 A;  3HMR A;  5CP9 A;  3NXP A;  2HPP P;  4BVW A;  2KL5 A;  4APM A;  4BV7 A;  1CEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...