1GMOA

Crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR
publication title Crystal Structures of Nk1-Heparin Complexes Reveal the Basis for Nk1 Activity and Enable Engineering of Potent Agonists of the met Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 37
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1gmoA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1gmoA01
4HZHA 3KIVA 2K13X 2QJ2A 1I8NA 1PK2A 5CT1A 2K51A 5CP9A 2YILA 1I71A 2YIPA 1YXEA 1W8KA 1KI0A 4APMA 3BT2A 2Z8VA 2PF2A 5CS3A 1HPKA 2DOIA 3K65A 2PF1A 3BT1A 1PMLA 1GMNA 3SRIA 1TPKA 2QJ4A 2Y8RA 3HMTA 2X2ZA 2K4RA 4KIVA 1PMKA 1W81A 2F83A 3MKPA 4D3CA 4APLA 1HPJA 1NK1A 3HMSA 2HPPP 4Z09A 4R19A 4CIKA 2HPQP 2I9AA 2PK4A 1HKYA 1A0HA 2KJ4A 1Z40A 1PKRA 3HN4A 5CS1A 3HMRA 1CEBA 1NL2A 2FEBA 4Z0DA 2DOHX 3LAQA 5CS9A 1B2IA 2FD6A 5CT2A 2HGFA 2LL4M 3E6PL 1URKA 1PK4A 2SPTA 1NL1A 3NXPA 4R1CA 4BV7A 5CS5A 5COEA 2Q8BA 4UAOA 4BV5A 4UV6A 1GMOA 2LL3A 3SP8A 1BHTA 4BVCA 5CT3A 2KNFA 1KIVA 4O03A 1GP9A 3SRJA 3ZLEA 4BVWA 1I5KA 5HPGA 4IUAA 5EOKA 4NZQA 1KDUA 1KRNA 4A5TS 2Q8AA 2L0SA 2Z8WA 4R1AA 1CEAA 2J8LA 4BVDA 4Z0FA 5I25A 5CSQA 4DURA 4R1BA 2J8JA 2I9BA 3U73A 2YIOA 1JFNA 3ZWZA 5EODA 4Z0EA 4BVVA
chains in the Genus database with same CATH superfamily
4HZHA 3KIVA 2K13X 2QJ2A 1I8NA 1PK2A 5CT1A 2K51A 5CP9A 2YILA 1I71A 2YIPA 1YXEA 1W8KA 1KI0A 4APMA 3BT2A 2Z8VA 2PF2A 5CS3A 1HPKA 2DOIA 3K65A 2PF1A 3BT1A 1PMLA 1GMNA 3SRIA 4YIVA 1TPKA 2QJ4A 2Y8RA 3HMTA 2X2ZA 2K4RA 4KIVA 1PMKA 2KL5A 1W81A 2F83A 3MKPA 4D3CA 4APLA 1HPJA 1NK1A 3HMSA 4YIZA 2HPPP 4Z09A 4R19A 4CIKA 2HPQP 2I9AA 2PK4A 1HKYA 1A0HA 2KJ4A 1Z40A 1PKRA 3HN4A 5CS1A 3HMRA 1CEBA 1NL2A 2FEBA 4Z0DA 2DOHX 3LAQA 5CS9A 1B2IA 2FD6A 5CT2A 2HGFA 2LL4M 3E6PL 1URKA 1PK4A 2SPTA 1NL1A 3NXPA 4R1CA 4BV7A 5CS5A 5COEA 2Q8BA 4UAOA 4BV5A 4UV6A 1GMOA 2LL3A 3SP8A 1BHTA 4BVCA 5CT3A 2KNFA 1KIVA 4O03A 1GP9A 3SRJA 3ZLEA 4BVWA 1I5KA 5HPGA 4IUAA 5EOKA 4NZQA 1KDUA 1KRNA 4A5TS 2Q8AA 2L0SA 2Z8WA 4R1AA 1CEAA 2J8LA 4BVDA 4Z0FA 5I25A 5CSQA 4DURA 4R1BA 2J8JA 2I9BA 3U73A 2YIOA 1JFNA 3ZWZA 5EODA 4Z0EA 4BVVA
chains in the Genus database with same CATH topology
4HZHA 3KIVA 2K13X 2QJ2A 1I8NA 1PK2A 5CT1A 2K51A 5CP9A 2YILA 1I71A 2YIPA 1YXEA 1W8KA 1KI0A 4APMA 3BT2A 2Z8VA 2PF2A 5CS3A 1HPKA 2DOIA 3K65A 2PF1A 3BT1A 1PMLA 1GMNA 3SRIA 4YIVA 1TPKA 2QJ4A 2Y8RA 3HMTA 2X2ZA 2K4RA 4KIVA 1PMKA 2KL5A 1W81A 2F83A 3MKPA 4D3CA 4APLA 1HPJA 1NK1A 3HMSA 4YIZA 2HPPP 4Z09A 4R19A 4CIKA 2HPQP 2I9AA 2PK4A 1HKYA 1A0HA 2KJ4A 1Z40A 1PKRA 3HN4A 5CS1A 3HMRA 1CEBA 1NL2A 2FEBA 4Z0DA 2DOHX 3LAQA 5CS9A 1B2IA 2FD6A 5CT2A 2HGFA 2LL4M 3E6PL 1URKA 1PK4A 2SPTA 1NL1A 3NXPA 4R1CA 4BV7A 5CS5A 5COEA 2Q8BA 4UAOA 4BV5A 4UV6A 1GMOA 2LL3A 3SP8A 1BHTA 4BVCA 5CT3A 2KNFA 1KIVA 4O03A 1GP9A 3SRJA 3ZLEA 4BVWA 1I5KA 5HPGA 4IUAA 5EOKA 4NZQA 1KDUA 1KRNA 4A5TS 2Q8AA 2L0SA 2Z8WA 4R1AA 1CEAA 2J8LA 4BVDA 4Z0FA 5I25A 5CSQA 4DURA 4R1BA 2J8JA 2I9BA 3U73A 2YIOA 1JFNA 3ZWZA 5EODA 4Z0EA 4BVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZH A;  3KIV A;  2K13 X;  2QJ2 A;  1I8N A;  1PK2 A;  5CT1 A;  2K51 A;  5CP9 A;  2YIL A;  1I71 A;  2YIP A;  1YXE A;  1W8K A;  1KI0 A;  4APM A;  3BT2 A;  2Z8V A;  2PF2 A;  5CS3 A;  1HPK A;  2DOI A;  3K65 A;  2PF1 A;  3BT1 A;  1PML A;  1GMN A;  3SRI A;  1TPK A;  2QJ4 A;  2Y8R A;  3HMT A;  2X2Z A;  2K4R A;  4KIV A;  1PMK A;  1W81 A;  2F83 A;  3MKP A;  4D3C A;  4APL A;  1HPJ A;  1NK1 A;  3HMS A;  2HPP P;  4Z09 A;  4R19 A;  4CIK A;  2HPQ P;  2I9A A;  2PK4 A;  1HKY A;  1A0H A;  2KJ4 A;  1Z40 A;  1PKR A;  3HN4 A;  5CS1 A;  3HMR A;  1CEB A;  1NL2 A;  2FEB A;  4Z0D A;  2DOH X;  3LAQ A;  5CS9 A;  1B2I A;  2FD6 A;  5CT2 A;  2HGF A;  2LL4 M;  3E6P L;  1URK A;  1PK4 A;  2SPT A;  1NL1 A;  3NXP A;  4R1C A;  4BV7 A;  5CS5 A;  5COE A;  2Q8B A;  4UAO A;  4BV5 A;  4UV6 A;  1GMO A;  2LL3 A;  3SP8 A;  1BHT A;  4BVC A;  5CT3 A;  2KNF A;  1KIV A;  4O03 A;  1GP9 A;  3SRJ A;  3ZLE A;  4BVW A;  1I5K A;  5HPG A;  4IUA A;  5EOK A;  4NZQ A;  1KDU A;  1KRN A;  4A5T S;  2Q8A A;  2L0S A;  2Z8W A;  4R1A A;  1CEA A;  2J8L A;  4BVD A;  4Z0F A;  5I25 A;  5CSQ A;  4DUR A;  4R1B A;  2J8J A;  2I9B A;  3U73 A;  2YIO A;  1JFN A;  3ZWZ A;  5EOD A;  4Z0E A;  4BVV A; 
#chains in the Genus database with same CATH topology
 4HZH A;  3KIV A;  2K13 X;  2QJ2 A;  1I8N A;  1PK2 A;  5CT1 A;  2K51 A;  5CP9 A;  2YIL A;  1I71 A;  2YIP A;  1YXE A;  1W8K A;  1KI0 A;  4APM A;  3BT2 A;  2Z8V A;  2PF2 A;  5CS3 A;  1HPK A;  2DOI A;  3K65 A;  2PF1 A;  3BT1 A;  1PML A;  1GMN A;  3SRI A;  4YIV A;  1TPK A;  2QJ4 A;  2Y8R A;  3HMT A;  2X2Z A;  2K4R A;  4KIV A;  1PMK A;  2KL5 A;  1W81 A;  2F83 A;  3MKP A;  4D3C A;  4APL A;  1HPJ A;  1NK1 A;  3HMS A;  4YIZ A;  2HPP P;  4Z09 A;  4R19 A;  4CIK A;  2HPQ P;  2I9A A;  2PK4 A;  1HKY A;  1A0H A;  2KJ4 A;  1Z40 A;  1PKR A;  3HN4 A;  5CS1 A;  3HMR A;  1CEB A;  1NL2 A;  2FEB A;  4Z0D A;  2DOH X;  3LAQ A;  5CS9 A;  1B2I A;  2FD6 A;  5CT2 A;  2HGF A;  2LL4 M;  3E6P L;  1URK A;  1PK4 A;  2SPT A;  1NL1 A;  3NXP A;  4R1C A;  4BV7 A;  5CS5 A;  5COE A;  2Q8B A;  4UAO A;  4BV5 A;  4UV6 A;  1GMO A;  2LL3 A;  3SP8 A;  1BHT A;  4BVC A;  5CT3 A;  2KNF A;  1KIV A;  4O03 A;  1GP9 A;  3SRJ A;  3ZLE A;  4BVW A;  1I5K A;  5HPG A;  4IUA A;  5EOK A;  4NZQ A;  1KDU A;  1KRN A;  4A5T S;  2Q8A A;  2L0S A;  2Z8W A;  4R1A A;  1CEA A;  2J8L A;  4BVD A;  4Z0F A;  5I25 A;  5CSQ A;  4DUR A;  4R1B A;  2J8J A;  2I9B A;  3U73 A;  2YIO A;  1JFN A;  3ZWZ A;  5EOD A;  4Z0E A;  4BVV A; 
#chains in the Genus database with same CATH homology
 4HZH A;  3KIV A;  2K13 X;  2QJ2 A;  1I8N A;  1PK2 A;  5CT1 A;  2K51 A;  5CP9 A;  2YIL A;  1I71 A;  2YIP A;  1YXE A;  1W8K A;  1KI0 A;  4APM A;  3BT2 A;  2Z8V A;  2PF2 A;  5CS3 A;  1HPK A;  2DOI A;  3K65 A;  2PF1 A;  3BT1 A;  1PML A;  1GMN A;  3SRI A;  4YIV A;  1TPK A;  2QJ4 A;  2Y8R A;  3HMT A;  2X2Z A;  2K4R A;  4KIV A;  1PMK A;  2KL5 A;  1W81 A;  2F83 A;  3MKP A;  4D3C A;  4APL A;  1HPJ A;  1NK1 A;  3HMS A;  4YIZ A;  2HPP P;  4Z09 A;  4R19 A;  4CIK A;  2HPQ P;  2I9A A;  2PK4 A;  1HKY A;  1A0H A;  2KJ4 A;  1Z40 A;  1PKR A;  3HN4 A;  5CS1 A;  3HMR A;  1CEB A;  1NL2 A;  2FEB A;  4Z0D A;  2DOH X;  3LAQ A;  5CS9 A;  1B2I A;  2FD6 A;  5CT2 A;  2HGF A;  2LL4 M;  3E6P L;  1URK A;  1PK4 A;  2SPT A;  1NL1 A;  3NXP A;  4R1C A;  4BV7 A;  5CS5 A;  5COE A;  2Q8B A;  4UAO A;  4BV5 A;  4UV6 A;  1GMO A;  2LL3 A;  3SP8 A;  1BHT A;  4BVC A;  5CT3 A;  2KNF A;  1KIV A;  4O03 A;  1GP9 A;  3SRJ A;  3ZLE A;  4BVW A;  1I5K A;  5HPG A;  4IUA A;  5EOK A;  4NZQ A;  1KDU A;  1KRN A;  4A5T S;  2Q8A A;  2L0S A;  2Z8W A;  4R1A A;  1CEA A;  2J8L A;  4BVD A;  4Z0F A;  5I25 A;  5CSQ A;  4DUR A;  4R1B A;  2J8J A;  2I9B A;  3U73 A;  2YIO A;  1JFN A;  3ZWZ A;  5EOD A;  4Z0E A;  4BVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...