4DURA

The x-ray crystal structure of full-length type ii human plasminogen
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
789
structure length
756
Chain Sequence
LDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plasminogen
publication title The X-ray crystal structure of full-length human plasminogen
pubmed doi rcsb
molecule tags Hydrolase
total genus 197
structure length 756
sequence length 789
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4durA01
2NU1E 5F8XA 1FV9A 1P01A 3BEFB 2GTBA 3TIUA 3OYPA 4I8LA 5L30H 1SLVB 2CF8H 3TLOA 3WY8A 2TGDA 3QX5H 1F0SA 2B8OH 4ABFA 1O2YA 2HVXA 2BZAA 1E38B 1DY9A 2Z8WA 2V3OH 4K1SA 3HPTB 2TGPZ 1MBMA 2HNTC 2XCFA 2BX4A 1FNIA 3NWUA 1EATA 2KNFA 3NPSA 3KQEA 5HGGA 1KDUA 2FOAA 2FEQH 4ABJA 4NSVA 2ESTE 1XMNB 3K6ZA 1G9IE 3RMNH 2EEKA 2V35A 1FY8E 2FYRA 1JWTA 4Y79A 3GYMA 5EOKA 1SGDE 4ZKNU 3TITA 2HNTE 1BTHH 3O8CA 3U8OH 2TRMA 1ELGA 3UR6A 1OWHA 4KTCA 2GV6A 1GMDG 2DOIA 5CS3A 2XNIA 1OWKA 1FQ3A 2H6MA 3K6YA 2H9EH 5TCCA 2ZDLA 4B2CA 4D9RA 3DD2H 2LL3A 2ZTXA 1G3DA 3UIRA 1RTKA 3MU8A 5FPSA 1QBNA 1TX8A 4KP0A 2LNCA 4X0WU 2CHAC 3LGTA 3QTOH 1B5GH 5JYIA 3H7TA 3TGKE 1T32A 1RFNA 3BTEE 3ZZ3A 4R1CA 2XCNA 4DGJA 1TFXA 4Y71A 1QJ1B 1KLIH 4WMFA 2I9BA 4GCHG 4F49A 2KAIA 3QUMP 1CGIE 3MNCA 2ZFQH 1SSXA 4WXIA 3RC6A 4IBLH 4I8JA 1PPHE 1FN6A 2NWNA 1QFKH 3SNEA 1EZSC 4BANB 2ZHQH 4FUFA 1VITG 1H1BA 1JBUH 1L4DA 2BDHA 1PJPA 1GJ6A 2F9NA 1GBMA 1UJ1A 2ZGBH 5H4IB 1EASA 1IQJA 2BM2A 1HRTH 1EAUA 3E3TA 4ZHMU 1OYQA 3TVJB 1BRUP 3UR9A 4AYVB 1HYLA 3LC5A 4E7RG 5DJ7A 4UAOA 1MKWH 2ZU3A 5E0HA 1QGFA 2QJ4A 1KIVA 1AZZA 4WMDA 5DP6A 1DUEA 1GWAA 4GAWA 1RD3B 2BMGB 5FCRA 2CHAB 1DLKB 2WPHS 1SFQB 1KLTA 1QRZA 2FI4E 2PUXB 1V2VT 1ZRBA 6ESTA 3ZZDA 2OBOA 1P3CA 1P8VC 3FVFB 4JK6A 4NA7A 1H8DH 3RLWH 1FPHH 2PGQB 1GBDA 3GDVA 1Y3WA 5AVDA 1A4WH 4CRGA 2BOHB 2VWOA 3TK5A 2Y5GA 2UWPA 2PWXA 1XUKA 4TY6A 4BV7A 3EA9A 2BDBA 2G55A 1DSTA 1N8OC 2HALA 1FZZA 2FS8A 3BG8A 3LGUA 1DICA 1NRPH 1W3CA 4NG9H 3K65A 1LHEH 3TU7H 1O5DH 2YNAA 4FVDA 4UDWH 1E35B 2GX4A 1BZXE 4OS1A 1HCGA 1C1UH 1GJ7B 1WTGH 3ZYDA 2WPIS 2WPLS 4K3JA 3STIA 4X2YA 3SQHE 3RXLA 4DY7B 4FUDA 1FONA 2C4FH 1ZOMA 3B23B 1O3LA 2C93B 2Y7XA 3PMBB 1P9UA 1O3KA 1SOZA 1IQHA 1DUAA 3BTFE 3FP8E 3O8DA 4ZH8A 1HLTH 2FI5E 2FOHA 3EA7A 3VGCC 4DOQA 1XUJA 2FLBH 1WOFA 1T8LA 4CREA 2Y81A 4X1SU 1C2LA 3HATH 2OLGA 1EKBB 1CHGA 2J94A 3BF6H 3M36A 2PHBA 3T2NA 3GYLB 1A0JA 2XYAA 4BVDA 2Q6DA 2STBE 1SC8U 1TNKA 1P9SA 2ZGJA 4U32A 1IQEA 1LHFH 2NU0E 3PM3A 3PMHB 1V2QT 1WQVH 2A5KA 1CEAA 1DANH 4MPVA 3HGNA 4B2BA 2HLCA 1N8OB 3FP7E 1GHAG 1C5YB 1CGJE 4Y8YA 1OKXA 4H6TA 2HNTF 1GI0A 1AKSB 4K1TA 8LPRA 1NPMA 2Y5FA 1MU6B 1GHZA 1XXFA 1WBGB 4R1BA 1AZ8A 4AFZA 5CP9A 1AFEH 1GBAA 1ZSLA 3H7OA 3PO1C 1XUIA 3RXMA 2G4TA 3MYWA 3UNRA 4AGKA 1YBWA 3UTUH 3TH2H 2UUFB 2OBQA 4O9VA 1SBWA 4FVBA 1GDUA 4DCDA 1TRNA 1O33A 2XWBI 3M7QA 5GCHG 4ISIH 1DOJA 3IWMA 1HIAA 2ZGCA 1QTFA 4UEHH 3MO6A 3VGCB 5FX6A 3IITA 3BTQE 1VGCC 1NN6A 2ILNA 4KGAA 4AORA 1LPGB 1ORFA 2W7SA 3KCGH 1TGNA 1ELVA 1P57B 2IJOB 1SGPE 3S0NA 3LIWA 3PMAB 3AAUA 1C1OA 3A87A 2JH6D 2QAAA 1FLEE 5DP9A 1K22H 5F8TA 1UTOA 2ANKH 2VWMA 5K0HA 5CT2A 1O34A 7GCHF 1CO7E 3A86A 2B7DH 2FPZA 3AVZA 4JCNA 1HKYA 2A7JA 3GISB 3BSQA 1NU9A 1MTUA 2K13X 4NIYA 2K4RA 1PPCE 3VB6A 5ESBA 1GVZA 2WINI 2R0KA 2WPKS 4MDSA 3OSYA 1ZPCA 1SHHB 4I8HA 1GHXH 4MPUA 3PO1B 2FZZA 3OY6U 4K8BA 2ZDVH 3SUGA 2AEIH 1Y3VA 1GCDA 1CEBA 1AB9C 3LC3A 3RUOA 2P3FH 2EC9H 5CSQA 1QQ4A 1LCYA 5JPMH 4J1YA 4I31A 3K2UA 1TONA 1MZDA 1TIOA 3HGPA 1GHVH 1BMNH 4Y8XA 1LHDH 1QRXA 2ZTZA 1J8AA 1JXPA 3UUZA 5LH8A 4BV5A 1VGCB 2YIOA 2FODA 1PPBH 3LT3A 2G00A 1G3CA 1TRYA 3M5LA 2BD3A 1DS2E 1MZAA 1MTNC 1V2LT 2FI3E 4K69A 1AKSA 2UUYA 4UV6A 3U69H 1TBRH 4B74A 2XC0A 2PKSC 5C1XA 2V3HH 1GI6A 1FAXA 1BTXA 2PF1A 4AFQA 1DWBH 6GCHG 1UTQA 1O2TA 1Y5UT 2O8UA 1V2UT 3S9BA 4AB8A 1P2MA 2BD7A 1XKAC 2AYWA 4D8NA 1O2LA 2QGRA 2ZFFH 1TNGA 4PROA 2H2ZA 2L0SA 3LGVA 1D3QB 2VINA 4TPYA 1LDTT 1K1OA 1W8BH 4A7IB 1ELFA 1SQTA 3VXEH 1WCZA 2PGBB 1AUTC 4X6NA 1AN1E 3F9FA 1D6RA 1BUIA 1Z71A 1ID5H 3A7VA 3UQVA 4X2VA 4MLFB 3TK9A 2Y82A 2Z3CA 3V0XA 1MQ6A 2RA0A 4WXVA 1THPB 3EAJA 2EI7A 1A2CH 2BQ7B 3I78A 2OTVA 1TQ0B 2RA3A 2A4QA 4BVCA 1K1NA 2ZNKH 2HPPP 2GZ9A 1V3XA 3NCLA 3M7TA 1WUNH 4ZKOU 1GHYH 4YESB 1SG8B 2J8JA 4AFUA 1YCPK 4O3UA 1KRNA 1GJ9B 1S6HA 2PKSB 3PMJA 3MH7A 3BT1A 1D4PB 3ELAH 1YPHE 1LHGH 4I33A 3SW2B 2ZEBA 1B2IA 3RXHA 3P8OA 3Q76A 2TGAA 2SNWA 4DG4A 2Y80A 1RGQA 2PW8H 4KTUA 4FUCA 2P94A 1C1NA 5FBEA 2WPJS 2J8LA 2FX6A 1V2ST 1GGDC 1AHTH 2PTCE 1IOEA 3T62A 2XBWA 3ZV9A 4U30A 1KTTB 4XDEA 1IQGA 3LH1A 1AE5A 4JZIA 1HAOH 1SGEE 1GBKA 1GMHF 3L6PA 4OS6A 1AO5A 1C2EA 1HXEH 1ZMNA 5DKMA 2OQ5A 3NK8A 4Y0ZE 1DWEH 1QL8A 3GY3A 4NWLA 1E36B 2V6NA 1MKXK 4JYUH 1SQOA 4R19A 1PKRA 1BTZA 2BY6X 2J95A 3NKKA 4BAMB 4X1PU 2RDLA 1D3DB 2F83A 3DFLA 5C5OA 3A7WA 3ZZ6A 1RS0A 3MU5A 2ZCHP 2BD5A 5GWZA 4VGCB 1D3TB 1KTSB 1GI9B 1AIXH 3GCTF 1O2KA 2SGEE 2VVVA 4X8VH 4CH2B 2QCYA 4ZUHA 4UFEH 1GMOA 3A8DA 1HAPH 3FP6E 1KSNA 2BQWB 1K2I1 2VNTA 3L33A 1UK4A 1C2MA 5CHAC 5HMAA 1WQSA 1UVTH 5A8ZA 1XXDA 4AOQA 5ABWA 2THFB 3TNTA 1A0HA 4AG2A 3F9EA 1V2PT 2FP7B 1C5TA 2FD6A 3E8LA 3RM2H 3BN9A 2W3KA 1W13U 5DPAA 4ZHAA 4MPXA 1Z8IB 1DDJA 2BB4A 2BXTH 1O3MA 3MNSA 4ZXXH 2HPPH 1SGFG 2QN5T 2ZDKA 1T8OA 4LZ4B 1FMGA 2C8YB 2ZU1A 1SGRE 1AQ7A 1GL1A 1QA0A 1QL9A 2K51A 2FS9A 4INKA 2O8WA 2C8XB 3RXBA 4ZROA 5JBBS 1F2SE 1I8NA 3ATLA 5EW2H 3UNQA 1C5ZB 1O3FA 3ZVDA 2G8TA 2GD4B 4HI3A 4UFDH 4E05H 3SQEE 3VXFH 1GCTB 3GY5A 3GICB 2B9LA 1ETRH 3DFJA 3GDUA 1C5LH 4Q2KA 2FTLE 1BHXB 2ZU2A 1L0ZA 1Z40A 1JIMA 1AI8H 2ZGXH 5AFZH 1OWJA 3FAOA 3LONA 1GG6C 2AMPA 1ABJH 1F5KU 3MNBA 4ISNA 3V3MA 1CSOE 2ZFPH 3QZQA 4TY7A 5CHAB 1A46H 2DE9A 1YF4A 3F6UH 1SB1H 4NIWA 4ZAEA 4O3TA 4CRAA 1SR5C 2STAE 3A83A 1LVYA 4ABIA 3LOXA 2TPIZ 5DP4A 3LGIA 2OC8A 4CRBA 3A8BA 3UWIA 1E0FD 3SJ8A 5FAHA 3LJOA 4Y0YE 4Y6DA 1XM1A 3SJ9A 4YOJA 5T3HA 2VIPA 3SZNA 1HPJA 3TK6A 2UUKB 2P95A 1YP9A 1O5AB 1HGTH 3QGNB 2G5NA 1E34B 2VVUA 2W5EA 2XTTB 3PYHA 1PPFE 1ESTA 1UVSH 4INLA 5CS5A 1O31A 3P92A 3LGWA 1S0QA 3URCA 1A3EH 1ELAA 1QY6A 5ESTE 1DVAH 3ZZ9A 3FANA 2JH0D 1P10A 1CU1A 2P8OC 1YCPH 3U1IB 4H6SB 2FOMB 1A5GH 3S69A 3HK3B 2BD8A 4CRDA 4BAOB 5HPGA 1IHTH 1GG6B 3ZWZA 1L1NA 2AGGX 2BDIA 2BY9X 2Y7ZA 4ABGA 3NXPA 1JFNA 4ASHA 2Q6GA 1AU8A 1M9UA 4WVPE 1MBQA 4F4OC 1XUGA 3BV9B 3M61U 3UNSA 2A5IA 4FU8A 1CHOF 3SNDA 3SV2H 5E0GA 1K1MA 1CGHA 4APLA 1MAYA 1PPEE 1TMUH 2AS9A 2FOBA 3K65B 5CMXH 5FCKA 1J14A 1THSH 1VCWA 1D9IA 4DW2U 1K1PA 1P2QA 1UTMA 1W0YH 1UMAH 3HKIB 4D7FA 5AHGH 1FAKH 4K8YA 4Q7YA 3TGJE 4NIXA 1C5XB 1CA0C 1RTLA 4OS5A 1BRBE 5FXLA 2R2MB 4I8GA 1MKXH 1PPGE 1OX1A 2GZ7A 3T5FH 4FUEA 4Q7ZA 2Z9GA 1O2UA 1KXDA 4OS7A 3K9XB 2B5TB 3VB7A 5GDSH 5PTPA 3A80A 3E90B 2AIQA 2ZHWH 1UCYE 1UCYH 2P8OB 4D3CA 1W14U 2A31A 1JOUB 2Z8VA 2A0QB 4OS4A 2P59A 3SU3A 2GDDA 3RXUA 4YOIA 3RXJA 5A0BA 1ZTKA 2FWWA 5HM2A 1GJ8B 1GI5A 1CVWH 5F03A 1ZTJA 2QC2A 2ZPRA 1ZHRA 1HAIH 4CHAC 2O9QA 3AASA 1GI4A 1A5IA 2XBVA 3A8CA 4X2XA 1BA8B 1YKTA 2ZFSA 3PWCA 2TIOA 3QZRA 1BHXF 4LK4A 3AW0A 1O2PA 4BNRA 8KME2 1YLCA 2GKVE 3SHAH 2RG3A 3SNBA 4WY3A 1P06A 3M3SA 3DUXH 1S0RA 1TPPA 3ZYEA 1O3HA 2BDGA 1NM6A 1Z1IA 1CA0B 2BLVA 1D3PB 5SGAE 4IW4E 4GUXA 3BTWE 3SU4A 1SLXB 1HPGA 1TQ7B 2F9VA 5GJ4B 3S9AA 4Y7AA 2K1QA 2C90B 1EAIA 3TJVA 1OP2A 3RXTA 4AN7A 3M3VA 3MH5A 1UVOA 1TNLA 1FN8A 8GCHG 1HIAB 2R9PA 1O5EH 2BDCA 3CS7A 1C2HA 4MQAA 1LKBA 1NRQH 1QB1A 4MNYA 1ARCA 1AWHB 1Y3YA 3HKJB 2BD2A 3PLKA 1AY6H 2IPHA 3H5CB 1IQMA 5A09A 2F9UA 4K2YA 1TB6H 2A45B 1C5QA 1ELDE 3NZIA 4X2WA 4XBDA 5EQRA 1EJNA 2H5DA 1GMHG 3A8AA 4CR9A 1V2JT 3SJKA 4CHAB 3JZ1B 1EX3A 4CIKA 3RP2A 5CE1A 1AFQC 3UPEA 4CRCA 2PKAB 1VR1H 1O2WA 1W81A 1FXYA 1O2ZA 4NZQA 2BLWA 2D26C 1BOQA 3RXPA 3M35A 1C5VA 4GLYA 3ZVFA 1O2MA 2CMYA 3KF2A 1O2XA 3SGAE 1UVUH 1EAWA 3Q77A 3RXIA 1EPTA 2HRVA 4CH8B 4RKJB 1W7GH 1FY5A 1TGCA 3RXVA 4IN1A 2Z7FE 3BTGE 1EB2A 4O97A 1UHBB 2A4GA 3PTNA 4D7GA 1YLDA 1OWDA 7LPRA 2YIPA 3VB4A 2CF9H 3LDXH 3UREA 3S7HB 1GPZA 1ELBA 1YXEA 2YILA 3GDSA 1QBVH 1W7XH 1P2NA 1O3EA 3Q3KA 4X8SH 2GCHF 5FPTA 1YC0A 2BXUH 1GMCG 2ZZUH 2AMDA 1PYTD 1AGJA 2W7UA 2ZC9H 1O5GH 1ZMLA 1FJSA 1BTPA 2I9AA 2ZF0H 4BTUB 1ESBA 2QV1A 1TE0A 3O8BA 5JBTA 2Q8BA 1Z6JH 1AFQB 2VIWA 5L2YH 1YCPM 4JZEH 4X8TH 1G3EA 5DG6A 1OYTH 3U1JB 1BBRE 1BBRH 2J4IA 1MQ5A 1UK3A 1ZSKA 3ATWA 5B6OA 1GI8B 4NCYA 4CBNA 1HJ8A 1Z8RA 4DVAU 1MCTA 5FBIA 1V2MT 1TPAE 5L2ZH 2OCVB 4MG3A 1WAYB 1O3IA 1W11U 3U73A 1BJUA 2AIPA 4FUGA 5JBAS 1CT2E 3ATMA 1GDQA 1IQFA 1O3NA 3RC5A 1W12U 1O5CB 2F9OA 2Z94A 1XVMA 1GI3A 1Q2WA 1CQQA 1EQ9A 5C1YA 4X8UH 4X1QU 2VIDA 4DT7B 3LKWA 3ZVBA 3SOSA 4E06H 1EJMA 1E37B 3RDZA 4R1AA 2A32A 4AB9A 1K1JA 1DFPA 3BG4C 5I46H 1QJ7B 1C1WH 1HNEE 1TMTH 3CENA 4CRFA 5A0CA 1BRCE 1PQ5A 4Y8ZA 2ZHEH 5DK1A 2PKAA 4ISHH 2FEBA 3W95A 1V2KT 2ZPSA 3A81A 1A1RA 3TJUA 3RXAA 1FPCH 1FY1A 3EE0B 1Q3XA 1C2JA 1T7CA 4WH6A 1S82A 1SVPA 3PLBA 1EP6A 2PR3A 3SI3H 4Y10E 3SI4H 3UQOA 3M7UA 4KKDA 2WPMS 3SRIA 3RXCA 1TOMH 1ANEA 5A2MH 1UHBA 1VJAU 3MO9A 3EA8A 4X1RU 4MTBA 2PTNA 3BEIB 4NA8A 1NFYA 1OPHB 2ODPA 2ZDAH 4OGYA 4APMA 1C2FA 1Y3XA 3R3GB 1ZGIA 3BTKE 2ZQ1A 1IQIA 4DIHH 2C8WB 1QB9A 1W8KA 1OXGA 4JZDH 2NU2E 1O38A 2QXIA 1O3PB 5ETXA 1TGBA 4Z09A 4BVVA 2YOLA 3SHCH 1GMDF 5EW1H 1B0FA 3SP8A 3RU4E 2WV5A 3G01A 1O2JA 3BG4B 1MTWA 3TJNA 1EOLA 1CT4E 2PK4A 1NRNH 3SUFA 1J17T 3VB3A 1C2IA 3R0FA 4M7GA 5F6MA 2ZECA 1O0DH 3V13A 1C1VH 1HUTH 2FO9A 4HTCH 3GCNA 1TBZH 2FXRA 3RMOH 3LAQA 1NU7B 2QA9E 2Z3EA 2ZA5A 1XVOA 1SGIB 3HMTA 1W0ZU 1VJ9U 2VH0A 4ISOA 4OGXA 1ZHMA 1Q31A 3GY7A 3RU4D 3SU5A 4NIVA 4RN6A 2AMQA 1SHYA 3MU0A 1HB0B 1QHRB 3ZZCA 1AB9B 1ANBA 1TNHA 3SV7A 1ZTLA 3EGKH 4GCHF 1EB1H 2BVSH 2O8TA 2SGQE 1A0HB 1DXPA 2UWOA 1DE7H 1EJAA 2CGAA 4NZLA 1HJAC 3S7KB 1U6QA 1PQAA 3A7ZA 1ZYOA 1YPHC 3P8GA 4H42U 2HGTH 5C2ZA 3M37A 4WMEA 3MMGA 1TGSZ 1C2GA 4CR5A 1GJAB 1TWXB 3OX7U 1MTNB 1RXPA 2ANMH 5EGMA 4IMZA 1O3GA 2VIOA 4GHQA 3QN7A 1S84A 2BOKA 4Z0FA 1YGCH 2A7HA 3OU0A 2TBSA 4JK5A 5EQQA 3BEUA 2CV3A 2ZG0H 2BZ6H 1CT0E 1DPOA 3KEEA 3GOVB 2FYQA 1TMBH 3PTBA 1G3BA 1ZJDA 2XC5A 3HMRA 2XC4A 1QCPA 4HFPB 2A5AA 3M5OA 2F9PA 1Y5BT 5E0JA 2QXHA 2GGVB 4JYTA 1O2NA 2XBYA 1SFIA 1MD8A 5TCAA 3A88A 2AH4X 2ALPA 1TRMA 1K21H 1HJAB 4NGAH 2FESH 3BTTE 4QT8C 1Z8JB 1K28D 3UWJH 1IQNA 1C9PA 4BXSA 4DJZB 1TPOA 4YM9A 1A3BH 1ARBA 1TYNA 1QNJA 5E2OA 1ZZZA 1MAXA 2BDAA 1P11E 1DM4B 2PF2A 2PFEA 4UONA 1YPEH 4MVNA 1TGTA 1V2TT 5FHTA 4FUJA 5JDUB 2BYAX 3SV6A 3SO3A 1C5SA 2ULLA 1SPJA 2GDEH 2XBXA 1GI2A 1UCYK 1GJCB 2DUCA 1GBBA 2IOTA 1O39A 1PK2A 2DE8A 1GHBF 2V0BA 4NA9H 1GI1A 3SBKA 1MMJN 1QR3E 1TBQH 3HK6B 1T4UH 4OS2A 1TX6A 1ELEE 4FU7A 5DGJA 2SNVA 2FIRH 1RRKA 1O2RA 1GGDB 3MTYA 1O32A 4UFGH 4KIVA 1KYNA 3SRJA 2F91A 3ZZ4A 1NS3A 1O2QA 1SOTA 2O8MA 2OP9A 5T6GA 1BJVA 3P70B 1ANCA 4Z0EA 2P93A 3A89A 1HAGE 2A4RA 5CS9A 1I5KA 2Z3DA 3LJJA 2W26A 2EI6A 3LU9B 1FIZA 1PK4A 1RJXB 2D8WA 2SGDE 1PQ7A 1P12E 3ATIA 3HN4A 1GHAF 4Q80A 1S81A 5EXNA 2WYGA 1NFXA 2F9BH 1BMAA 2FOFA 8ESTE 2OUAA 1BTWA 1QIXB 1TOCB 2W3IA 2Z9KA 4AYYB 2GCHG 4FXGH 5CT3A 2VIVA 1BT7A 1F0RA 1TALA 3HMSA 3OTJE 4AZ2B 5A8XA 1A0LA 9ESTA 2ZTYA 4TPIZ 3F9HA 4Y11E 2VJ1A 3T25A 1TNIA 1ZPBA 3GY6A 5DP3A 4AGJA 5FX5A 1WV7H 1P09A 4X6MA 1ZPZA 1TA6A 2EA3A 5GCHF 3DT0H 3I29A 2EI8A 2ZDNA 1LVMA 3L3TA 1Z6EA 4TWYA 2P3UB 1O3BA 2Z6BD 3ZVGA 2H5CA 4X6PA 1A7SA 7ESTE 4RSPA 2ZFTA 1DX5M 1JMOH 1O2VA 2VU8E 4XOJA 3ITIA 1HFDA 3MU1A 5JB9S 1UO6A 3QO6A 2AERH 3U8RH 2PSYA 1BQYA 1BTUA 1YYY1 3U98H 2FOGA 1O3CA 3LGYA 1ELCA 1UTKA 1GVLA 1DLEA 2Y5HA 2Z9IA 4I7YH 3E16B 1WU1A 1BMLA 1H9IE 3MWIU 1Y59T 2SPTA 1NROH 1OOKB 1GBEA 2AFQB 2A2XH 4J2YB 5C1UA 4Y76A 7GCHG 1ZHPA 4A1XA 1EZUC 2A1DB 3SGBE 2QXGA 5HM9A 3E1XB 2JH5D 1YPJH 3RLYH 1H4WA 1IHSH 1EPTC 1ZGVA 3ZVCA 3D65E 4IUAA 4IC5A 1Z7KA 3F9GA 5GIBA 1AMHA 1HDTH 3RXRA 2A7CA 3UY9A 4UE7H 3KIVA 4WWYA 1A61H 3M3TA 1C1RA 1GL0E 1GDNA 2SGPE 3BTDE 4Y7BA 2XXLA 4SGBE 4ZKRU 3VPKA 3A82A 3ESTA 1SL3A 2OINA 2OD3B 2C3SA 1T8NA 2C8ZB 1H8IH 3FZZA 1MTSA 2VWLA 3PLPA 2D1JA 1BTYA 3ZZ8A 4ZHLU 3RXDA 2H1UA 1BBRK 5IDKA 4GSOA 5JB8S 1EXFA 4JMYA 1CA8B 1HXFH 2BVRH 5EG4A 1PMKA 1SQAA 2QYIA 3A85A 1SLUB 1TA2A 1P03A 2X2ZA 1DXWA 1GBLA 1S5SA 1WSSH 4Q7XA 1UK2A 1O2OA 4MPWA 6GCHF 1K1LA 4FUBA 1GBJA 1KY9A 3MOCA 1B0EA 3V7TA 3ZZBA 5C20A 9LPRA 1O5BB 3BT2A 1Y3UA 3BTHE 1LQDB 1SGTA 1EPTB 4U2WA 1XUHA 5EU8A 4X1NU 1O2HA 4XSKU 2R3UA 1UVPA 1KXAA 3RM0H 3ATKA 3SNAA 1NZQH 2A4OA 2ZI2H 1YPLH 3S9CA 1SGQE 3QLPH 1C5PA 1P2KA 1ACBE 2G52A 1BHTA 3MI4A 4IS5A 3ZLEA 1EAXA 3VFEA 1P3EA 1NT1A 3GY8A 3D62A 2UUJB 3Q3XA 1SLWB 3RXFA 1FIWA 1C1PA 1QJ6B 2GCTC 5LPRA 3RMMH 1NL1A 4ESTE 1F5RA 2ZP0H 1B7XB 4K1EA 1HAVB 1F7ZA 3OY5U 3EQ0H 1KXFA 4YTAA 1C5OH 4KELA 3SJIA 2FDAA 1F0UA 4YZUA 3A7XA 1OS8A 2F3CE 5C3NA 4MNWA 1VZQH 3P95A 1TPSA 2J2UA 4B75A 1C1SA 3E6PH 1LKAA 4A1TA 1C1QA 1L1JA 1NFUA 1KXCA 4CBOA 4MNXA 3MO3A 3P6ZB 1AUJA 4UD9H 2GVFA 3UOPA 2ZPQA 1HAZB 3AAVA 2Y8RA 1O2SA 5C5NA 3RC4A 4AG1A 4DURA 5I25A 1QBOA 3GY4A 2R0LA 1AD8H 3SNCA 1F5LA 1MCVA 4R0IA 1DITH 2CJIA 2BX3A 2ANYA 3QK1A 1V2NT 1G2MA 1KXBA 1NC6A 2Q6FA 4BXWA 1GBIA 2FOEA 4ABBA 3I77A 2ZCLP 3T29A 2DOHX 1MD7A 4YT6H 5JBCS 2FLRH 1C2DA 3RXEA 1QB6A 3RXQA 1I71A 1L2EA 2ZIQH 2ZFRH 2JETC 4FUIA 3KL6A 1T4VH 4U01A 5AFYH 2GCTB 4BOHA 1PYTC 2QXJA 3TGIE 2LPRA 3F1SB 1VCPA 3E91A 3SORA 3TPIZ 1HAHH 1W2KH 1C5NH 1SGFA 2PUQH 3ZVAA 1O3OA 2GT7A 3B8JA 3BTME 1SGCA 3KQDA 1VITH 1A5HA 2UWLA 1N6YA 1EOJA 2XRCA 2ZWLH 3KIDU 3QGJA 1PPZA 2BLOA 1VCQA 3GCTG 2WV4A 5EPNA 1CBWC 1LVBA 1QURH 1GHBG 1O30A 3VEQB 1O37A 1JRSA 1C5WB 3KQCA 5J4SA 1YPKH 1RIWC 1ZLRA 2FOCA 1ETTH 1P04A 1L1GA 1GMNA 5CS1A 1TNJA 2G51A 3U9AH 1SGNE 5HXFA 4ZXYH 1HJ9A 1DSUA 1V2RT 1TABE 1V2OT 2Q1JA 4TYDA 4Z0KA 1V2WT 5L6NH 4HGCA 4XBCA 1HAVA 2BDYA 2VIQA 3VB5A 4MNVA 1C4Y2 3ZVEA 1C1MA 3B9FH 5A8YA 2JETB 1P2JA 2O8LA 4ABAA 3P8FA 1EZXC 3DA9B 3E6PL 1INCA 2FTMA 2XW9A 2QF0A 4NWKA 1ELTA 3GCOA 2R2WU 2RCEA 1NRRH 4TWWA 4YLQH 2QIQA 3C1KA 3MHWU 4YO9A 1GJ5H 1L4ZA 1KLJH 4ZMAH 1D6WA 3LPRA 4FUHA 3KHVA 2H9TH 1GJBB 2PLXA 3KQBA 1TX7A 4B2AA 2BTCE 3SU6A 2BQ6B 5C67A 3PV4A 1PFXC 2KJ4A 1BMMH 1CBWB 1THRH 1KDQB 4LZ1H 2GMTC 1O2GH 3GCHC 3SU1A 1EZQA 1QRWA 2GP9B 1RIWB 1ZR0A 5GPIB 4A1VA 1NK1A 3KN2A 1O35A 4WJG2 5DP7A 2ZHDA 1HAYB 1H9HE 5T6DA 1AWFH 5LPFA 1UTJA 2HOBA 3SJOA 3AW1A 4A92A 1HAXB 2AGEX 2QJ2A 3V12A 3URDA 2WUCA 1O5FH 5EQSA 4B73A 1DWCH 1CE5A 4LOYH 2BY7X 3O8RA 4D76A 4E7NA 3E0PB 3RU4T 2G4UA 4ZKSU 1TAWA 1KIGH 1IQKA 3TH3H 3T27A 1UTNA 1F92A 1TLDA 3M5MA 4JZFH 2HPQP 1NY22 1MUEB 2Z9JA 3IG6B 3DHKH 5IYTA 2HGFA 1C1TA 3ZZ5A 1ETSH 1W10U 3PROA 1O36A 1J9CH 1NRSH 1V6DA 3BIVH 3D49H 1BIOA 2JKHA 2WUBA 2OC0A 2HWLB 3A84A 3N7OA 4FU9A 2FX4A 2TGTA 3PB1E 5LGOA 1LPZB 3M5NA 5F8ZA 1Z8GA 3C27B 1PMLA 2GMTB 1XKBC 3GCHB 2SFAA 2WYJA 4AFSA 3ODFA 1P2IA 1AVWA 3QDZB 1P0SH 1ZSJA 3Q00A 4XFQA 5T6FA 3RXOA 4JYVH 1LPKB 1FI8A 3MNXA 3ODDA 2IN2A 1LHCH 3SGQE 3SUEA 2LL4M 1P05A 1FY4A 1MH0A 2CN0H 5K7RA 3MU4A 1IQLA 7KMEH 5G4BA 1C4V2 5BPEA 3TJOA 3FFGA 2VWNA 4RKOB 4BAKB 1BRAA 1CHOG 1GBHA 3SU0A 2ODYB 1G2LA 4H4FA 5DO4H 1YPMH 2QF3A 2ZU4A 4NFEA 5J4QA 5DP8A 4GPGA 4YLUA 1GVKB 1S6FA 1HPKA 3LH3A 3KGPA 1BDAA 2J9NA 3JZ2B 4IMQA 1GJDB 1WYKA 3RXSA 4IN2A 4XE4A 2AGIX 4K60A 3ZV8A 4Z6AH 4KTSA 3W94A 5BRRE 1Y8TA 1KDQA 2NU4E 4Z0DA 2GZ8A 2OXSA 4A6LA 1HV7A 1LQEA 4ABDA 2D2DA 1VITF 3GY2A 2Q8AA 1ZRKA 2BY8X 1UTPA 3SN8A 6LPRA 2BY5X 2I6SA 1O3AA 4IGDA 1ESAA 1GHWH 1QQUA 4ISLA 2Z9LA 1IAUA 3A7TA 2ZU5A 3SUDA 1KXEA 1C9TA 4AX9H 1MU8B 1MTVA 2ZKSA 4WF8A 2GT8A 1GI7B 1OP0A 2ZDMA 1QA7A 4SGAE 2VH6A 4THNH 3RXGA 5EXMA 4YOGA 2HPQH 1T8MA 2J92A 2Y6TA 4X6OA 4K5ZA 1GP9A 1LMWB 2ZO3H 1J15A 1NESE 1LO6A 3NUMA 4VGCC 1G32B 1YPGH 3KNXA 2SGAA 2VGCC 2M5TA 4GVUA 3D23A 2BD4A 1ZJKA 2XWAA 1XUFA 1S83A 2BD9A 8GCHF 1NTPA 1J16A 1NO9H 4WH8A 2CXVA 2OC1A 1G36A 1ABIH 2BLQA 5COEA 3FZDA 3ZZAA 1C2KA 2VVCA 4UFFH 1WTHD 4D9QA 4BAHB 2H9HA 4XBBA 1OWIA 1X7AC 2ZCKP 2OQUA 1GJ4H 4B71A 1G30B 1GBFA 5E2PA 1S85A 1FUJA 1QL7A 4HZHA 4B76A 4IC6A 4INHA 2J38A 1GBTA 1C4U2 1C5UA 2ODQA 5EXLA 4A5TS 3T28A 1AVXA 4I32A 1LVOA 5GXPA 4I8KA 1O3DA 1NFWA 1Y5AT 3P17H 5FPYA 1GCTC 1P2OA 2OC7A 3RXKA 1OWEA 1BITA 3RMLH 2VB0A 3SV9A 5HYOA 2VGCB 1RTFB 3SV8A 3ENSB 1ZMJA 1KI0A 1C5RA 2SGFE 4YT7H 3E0NB 2ANWA 3F68H 6CHAC 1SI5H 1GBCA 2R3YA 3MKPA 3MH6A 1DWDH 1EUFA 4R8TB 2ALVA 5AF9H 2ZQ2A 5LPEA 1NL2A 4BVWA 3A7YA 1EP5A 4NFFA 1P02A 4B1TA 4BTIB 3PWBA 1PQ8A 4BTTB 5DP5A 1K1IA 2BHGA 4DIIH 3T26A 1F0TA 1FY3A 3ZZ7A 4GHTA 1GMCF 1G37A 1YM0A 2B0FA 1MKWK 1Z1JA 4NSYA 4BAQB 3U8TH 2J34A 1T31A 2PV9B 1N6XA 1HBTH 3CS0A 1XX9A 3CP7A 3MFJA 1BB0B 1H9LB 2G81E 2ZGHA 2P16A 3QWCH 1K9OE 5EODA 1TPKA 1O2IA 2ZHFH 1FDPA 3SU2A 2FM2A 4ABEA 1O3JA 5EPYA 1JRTA 1UTLM 2PSXA 3MH4A 4O03A 1BCUH 4LXBH 2G5VA 5TJXA 1OSSA 1SGYE 3EDXB 3TH4H 1SMFE 1URKA 2P3TB 3EYDA 3QTVH 3UOUA 4JZ1A 2ASUB 3Q3YA 2NU3E 1ANDA 2BVXH 2FMJA 2QY0B 3UFAA 3TNSA 1DT2A 1AVGH 2A2QH 3P8NA 5CT1A 2YNBA 1JIRA 4ABHA 3STJA 6CHAB 1C5MD 1LTOA 2KAIB 5A0AE 2GV7A 1N1LA 2I6QA 3BIUH 5E8EH 1OP8A 1DY8A 1AE8H
chains in the Genus database with same CATH superfamily
2NU1E 5F8XA 1FV9A 1P01A 3BEFB 2GTBA 3TIUA 3OYPA 4I8LA 5L30H 1SLVB 2CF8H 3TLOA 3WY8A 3H09A 2TGDA 3QX5H 1F0SA 2B8OH 4ABFA 1O2YA 2HVXA 2BZAA 1E38B 1OHHD 1DY9A 2Z8WA 2V3OH 4K1SA 3HPTB 2TGPZ 1MBMA 2HNTC 2XCFA 2BX4A 1FNIA 3NWUA 1EATA 2KNFA 3NPSA 3KQEA 5HGGA 1KDUA 2W6JD 2FOAA 2FEQH 4ABJA 4NSVA 2ESTE 1XMNB 3K6ZA 1G9IE 3RMNH 2EEKA 2V35A 1FY8E 2FYRA 1JWTA 3W1EA 4Y79A 3GYMA 5EOKA 1SGDE 4ZKNU 3TITA 2HNTE 3F2HA 1BTHH 3O8CA 3U8OH 2TRMA 1YWUA 1ELGA 3PRBA 3UR6A 1OWHA 4KTCA 2GV6A 1GMDG 2DOIA 5CS3A 2XNIA 1OWKA 1FQ3A 2H6MA 3K6YA 2H9EH 5TCCA 2ZDLA 4B2CA 4D9RA 3DD2H 2LL3A 2ZTXA 1G3DA 3UIRA 1RTKA 3MU8A 5FPSA 1QBNA 1TX8A 4KP0A 2LNCA 4X0WU 4XD7D 2CHAC 3LGTA 3QTOH 1B5GH 5JYIA 3H7TA 3TGKE 1T32A 1RFNA 3BTEE 3ZZ3A 4R1CA 2XCNA 4DGJA 1TFXA 4Y71A 1QJ1B 1KLIH 4WMFA 2I9BA 4GCHG 4F49A 2KAIA 3QUMP 1CGIE 3MNCA 2ZFQH 1SSXA 4WXIA 3RC6A 4IBLH 4I8JA 1PPHE 1FN6A 2NWNA 1QFKH 3SNEA 1W0JD 1EZSC 4BANB 2ZHQH 4FUFA 1VITG 1H1BA 5C17A 1JBUH 1L4DA 2BDHA 1PJPA 1GJ6A 2F9NA 1GBMA 1UJ1A 3N7DA 2ZGBH 5H4IB 1EASA 1IQJA 2BM2A 1HRTH 1EAUA 3E3TA 2XOKD 4ZHMU 1OYQA 3TVJB 1BRUP 3UR9A 4AYVB 1HYLA 3LC5A 4E7RG 5DJ7A 4UAOA 1MKWH 2ZU3A 5E0HA 1QGFA 2QJ4A 1KIVA 1AZZA 2J97A 4WMDA 5DP6A 1DUEA 1GWAA 4GAWA 1RD3B 2BMGB 5FCRA 2CHAB 2KCPA 1DLKB 2WPHS 1SFQB 1KLTA 1QRZA 2FI4E 2PUXB 1V2VT 1ZRBA 6ESTA 3ZZDA 2OBOA 1P3CA 1P8VC 3FVFB 4JK6A 4I86A 1H8DH 4NA7A 3RLWH 1FPHH 2PGQB 1GBDA 3GDVA 1Y3WA 5AVDA 1A4WH 4CRGA 2BOHB 2VWOA 3TK5A 2Y5GA 2UWPA 2PWXA 1XUKA 4TY6A 4BV7A 2AHME 3EA9A 2BDBA 2G55A 5EIYA 1DSTA 1N8OC 2HALA 1FZZA 2FS8A 3BG8A 3LGUA 1DICA 1NRPH 1W3CA 4NG9H 3K65A 1LHEH 3TU7H 1O5DH 2YNAA 4FVDA 4UDWH 1E35B 2GX4A 1BZXE 4OS1A 3KYGA 1HCGA 1C1UH 1GJ7B 1WTGH 3ZYDA 2WPIS 2WPLS 4K3JA 3STIA 4X2YA 3SQHE 3RXLA 4DY7B 4FUDA 1FONA 2C4FH 1ZOMA 3B23B 1O3LA 2C93B 2Y7XA 3PMBB 1P9UA 1SOZA 1O3KA 1QZ8A 1IQHA 1DUAA 3U28C 3BTFE 3FP8E 3O8DA 4ZH8A 1HLTH 2FI5E 2FOHA 3EA7A 3OEED 3VGCC 4DOQA 1XUJA 2FLBH 1WOFA 2OK5A 1T8LA 4CREA 2Y81A 1K0HA 4X1SU 1C2LA 3HATH 2OLGA 1EKBB 1CHGA 2J94A 3BF6H 3M36A 4TT3D 2PHBA 3T2NA 3GYLB 1A0JA 2F43B 2XYAA 4BVDA 2Q6DA 2STBE 1SC8U 1TNKA 1P9SA 2ZGJA 4U32A 1IQEA 1LHFH 2NU0E 3PM3A 3PMHB 1V2QT 1WQVH 2A5KA 1CEAA 1DANH 4MPVA 3HGNA 4B2BA 2HLCA 1N8OB 3FP7E 1GHAG 1C5YB 1CGJE 4Y8YA 1OKXA 4H6TA 2HNTF 1GI0A 1AKSB 4K1TA 8LPRA 1NPMA 2Y5FA 2L74A 1MU6B 1GHZA 1XXFA 1WBGB 4R1BA 1AZ8A 4AFZA 5EJ1A 5CP9A 1AFEH 1GBAA 1ZSLA 3H7OA 3SYJA 3PO1C 1XUIA 3RXMA 2G4TA 3MYWA 3UNRA 4FETA 4AGKA 1YBWA 3UTUH 3TH2H 2UUFB 2OBQA 4O9VA 1SBWA 4FVBA 1GDUA 4RT1A 4DCDA 1TRNA 1O33A 2XWBI 3M7QA 5GCHG 4ISIH 5B6LA 1DOJA 3IWMA 1HIAA 2ZGCA 1QTFA 4UEHH 3MO6A 3VGCB 5FX6A 3IITA 3BTQE 1VGCC 1NN6A 2ILNA 4KGAA 4AORA 3EE7A 1LPGB 1ORFA 2W7SA 3KCGH 1TGNA 1ELVA 1P57B 2EY4C 2IJOB 5C94A 1SGPE 3S0NA 3LIWA 3PMAB 3AAUA 1C1OA 3A87A 2JH6D 2QAAA 1FLEE 2WPDD 5DP9A 1K22H 5F8TA 2PP6A 3GS9A 1UTOA 2ANKH 2VWMA 5K0HA 5CT2A 1O34A 7GCHF 1CO7E 3A86A 2B7DH 2FPZA 3AVZA 4JCNA 1HKYA 2A7JA 3GISB 3BSQA 1NU9A 1MTUA 2K13X 4NIYA 2K4RA 3N99A 1PPCE 3VB6A 5ESBA 1GVZA 2WINI 2R0KA 2WPKS 4MDSA 3OSYA 1ZPCA 1SHHB 4I8HA 1GHXH 4MPUA 3PO1B 2FZZA 3OY6U 4K8BA 2ZDVH 3SUGA 2AEIH 1Y3VA 1GCDA 1CEBA 1AB9C 3LC3A 3RUOA 2P3FH 2EC9H 5CSQA 1QQ4A 1LCYA 5JPMH 4J1YA 4I31A 3K2UA 1TONA 1MZDA 1TIOA 3HGPA 1GHVH 1WDIA 1BMNH 4Y8XA 1LHDH 1QRXA 2ZTZA 1J8AA 1JXPA 3UUZA 5LH8A 4BV5A 1VGCB 2YIOA 2FODA 1PPBH 3LT3A 2G00A 1G3CA 1TRYA 3M5LA 2BD3A 1DS2E 2YMSC 1MZAA 1MTNC 1V2LT 2FI3E 4K69A 1AKSA 2UUYA 4UV6A 2KM0A 1TBRH 3U69H 4B74A 2XC0A 2PKSC 5C1XA 2V3HH 1GI6A 1FAXA 1BTXA 2PF1A 4AFQA 2LELA 1DWBH 6GCHG 1UTQA 1O2TA 1Y5UT 2O8UA 1V2UT 3S9BA 4AB8A 1P2MA 2BD7A 1XKAC 2AYWA 4D8NA 1O2LA 2QGRA 2ZFFH 1TNGA 4PROA 2H2ZA 5C0UA 2L0SA 3LGVA 1D3QB 2VINA 4TPYA 1LDTT 1K1OA 1W8BH 4A7IB 1ELFA 1SQTA 4RT0A 3VXEH 1WCZA 2PGBB 1AUTC 4X6NA 1AN1E 3F9FA 1D6RA 1BUIA 1BMFD 1Z71A 1ID5H 3F3BA 3A7VA 3UQVA 4X2VA 4MLFB 3TK9A 2Y82A 2Z3CA 3V0XA 1MQ6A 2RA0A 4WXVA 1THPB 3EAJA 2EI7A 1A2CH 2BQ7B 3I78A 2OTVA 1TQ0B 2RA3A 2A4QA 4BVCA 1K1NA 2ZNKH 2HPPP 2YMSB 2KCYA 2GZ9A 1V3XA 3NCLA 3VG8A 3M7TA 1WUNH 4ZKOU 1GHYH 4YESB 1SG8B 2J8JA 4AFUA 1YCPK 4O3UA 1KRNA 1GJ9B 1S6HA 2PKSB 3PMJA 2JDID 3MH7A 3BT1A 1D4PB 3ELAH 1YPHE 1LHGH 4I33A 3SW2B 2ZEBA 1B2IA 3RXHA 3P8OA 3Q76A 2TGAA 2SNWA 4DG4A 2Y80A 3PV5A 1RGQA 2PW8H 4KTUA 4FUCA 2P94A 1C1NA 5FBEA 2WPJS 2J8LA 2FX6A 1V2ST 1GGDC 5DN6D 1AHTH 4F55A 2PTCE 1IOEA 3T62A 2XBWA 3ZV9A 4U30A 1KTTB 1EFRD 4XDEA 1IQGA 3LH1A 1AE5A 4JZIA 1HAOH 1SGEE 1GBKA 1GMHF 3L6PA 4OS6A 1AO5A 1C2EA 1HXEH 1ZMNA 5DKMA 2OQ5A 3NK8A 4Y0ZE 1DWEH 1QL8A 3GY3A 3NRLA 1E36B 4NWLA 2V6NA 1MKXK 4JYUH 1SQOA 4R19A 1PKRA 4XRNA 1BTZA 2BY6X 2J95A 4F48B 3NKKA 4BAMB 4X1PU 2RDLA 1D3DB 2F83A 3DFLA 5C5OA 3A7WA 3ZZ6A 1RS0A 2M2AA 2ZCHP 2BD5A 3MU5A 5GWZA 2WHXA 1D3TB 4VGCB 1KTSB 1GI9B 2LP6A 3OAAD 1AIXH 3GCTF 1O2KA 2SGEE 2VVVA 3DSGA 4X8VH 4CH2B 2QCYA 4ZUHA 4UFEH 1GMOA 3A8DA 1HAPH 3FP6E 1KSNA 2BQWB 1K2I1 2VNTA 3L33A 1UK4A 1C2MA 5CHAC 5HMAA 1WQSA 1UVTH 5A8ZA 1XXDA 4AOQA 5ABWA 2THFB 3TNTA 1A0HA 4AG2A 3F9EA 1V2PT 2FP7B 1C5TA 2FD6A 3E8LA 3RM2H 3BN9A 2W3KA 1W13U 5DPAA 4ZHAA 4MPXA 1Z8IB 1DDJA 2BB4A 2BXTH 1O3MA 3MNSA 4ZXXH 2HPPH 1SGFG 1E1RD 2QN5T 1T8OA 2ZDKA 4LZ4B 1FMGA 2C8YB 2ZU1A 1SGRE 1AQ7A 1GL1A 1QA0A 1QL9A 2K51A 2FS9A 4INKA 2O8WA 2C8XB 3RXBA 4ZROA 5JBBS 1F2SE 1I8NA 3ATLA 5HKKD 5EW2H 3UNQA 1C5ZB 1O3FA 3ZVDA 2G8TA 2GD4B 4HI3A 4UFDH 4E05H 3SQEE 3VXFH 1GCTB 1WXRA 3GY5A 3GICB 2B9LA 1E1QD 1ETRH 3DFJA 3GDUA 1C5LH 4Q2KA 2FTLE 1BHXB 2ZU2A 1L0ZA 1Z40A 1JIMA 1AI8H 2CK3D 4AC9A 2ZGXH 2VBCA 5AFZH 1OWJA 3FAOA 3LONA 1GG6C 2AMPA 1ABJH 1F5KU 3MNBA 4ISNA 3V3MA 1CSOE 2ZFPH 3QZQA 4TY7A 5CHAB 1A46H 2DE9A 1YF4A 3F6UH 1SB1H 4NIWA 4ZAEA 4O3TA 4CRAA 1SR5C 2STAE 3A83A 1LVYA 4ABIA 3LOXA 3F2GA 2TPIZ 3N7EA 5DP4A 3LGIA 2OC8A 4CRBA 3A8BA 3UWIA 1E0FD 3SJ8A 5FAHA 3LJOA 4Y0YE 4Y6DA 1XM1A 2QE7D 3SJ9A 4YOJA 5T3HA 2VIPA 1FX0B 3SZNA 1HPJA 3TK6A 2UUKB 2P95A 1YP9A 1O5AB 1HGTH 3QGNB 2G5NA 1E34B 2VVUA 2W5EA 2XTTB 3PYHA 1PPFE 1ESTA 1UVSH 4INLA 2HVYB 5CS5A 1O31A 3P92A 3LGWA 1S0QA 3URCA 1A3EH 1ELAA 1QY6A 5ESTE 1DVAH 3ZZ9A 3FANA 2JH0D 2WSSD 1P10A 1CU1A 2P8OC 1YCPH 3U1IB 4H6SB 3F0OA 2FOMB 1A5GH 3S69A 3HK3B 2BD8A 4CRDA 4BAOB 5HPGA 1IHTH 1GG6B 2KX4A 3ZWZA 1L1NA 2AGGX 2BDIA 2BY9X 2Y7ZA 4ABGA 3NXPA 1JFNA 4ASHA 2Q6GA 5IK2D 1AU8A 1M9UA 4WVPE 3WWBA 1MBQA 4F4OC 1XUGA 3BV9B 3M61U 1E79D 3UNSA 2A5IA 4FU8A 1CHOF 3SNDA 3SV2H 5E0GA 1K1MA 1CGHA 4APLA 1MAYA 1PPEE 1TMUH 2AS9A 2FOBA 3K65B 5CMXH 5FCKA 1J14A 1THSH 1VCWA 1D9IA 4DW2U 1K1PA 1P2QA 1UTMA 1W0YH 1UMAH 3HKIB 4D7FA 2KFWA 5AHGH 1FAKH 4K8YA 4Q7YA 3TGJE 4NIXA 1C5XB 1CA0C 1RTLA 4OS5A 1BRBE 5FXLA 2R2MB 4I8GA 1MKXH 1PPGE 1OX1A 2GZ7A 3T5FH 4FUEA 4Q7ZA 4TSFD 2Z9GA 1O2UA 1KXDA 4OS7A 4YXWD 3K9XB 2B5TB 3VB7A 5GDSH 5PTPA 1SQRA 3A80A 3E90B 2AIQA 2ZHWH 1UCYE 1UCYH 2P8OB 4D3CA 1W14U 2A31A 2IJD1 1JOUB 2Z8VA 2A0QB 4OS4A 2P59A 3SU3A 2GDDA 3RXUA 4YOIA 3RXJA 5A0BA 1ZTKA 2FWWA 5HM2A 1GJ8B 1GI5A 1CVWH 5F03A 1ZTJA 2QC2A 2ZPRA 1ZHRA 1HAIH 4CHAC 2O9QA 3AASA 3AK5A 1GI4A 1A5IA 1SKYE 2XBVA 3A8CA 4X2XA 1BA8B 1YKTA 2ZFSA 3PWCA 2TIOA 3QZRA 1BHXF 4LK4A 3AW0A 5HIYA 2QF5A 1O2PA 4BNRA 8KME2 1YLCA 2GKVE 3SHAH 2RG3A 2K0QA 3SNBA 4WY3A 1P06A 3M3SA 3DUXH 1S0RA 1TPPA 3ZYEA 1O3HA 2BDGA 1NM6A 1Z1IA 1CA0B 2BLVA 1D3PB 5SGAE 4IW4E 4GUXA 3BTWE 3SU4A 4ACBA 1SLXB 1HPGA 1TQ7B 2F9VA 4OM9A 5GJ4B 3S9AA 4Y7AA 2K1QA 2C90B 1EAIA 3TJVA 1OP2A 3RXTA 4AN7A 3M3VA 3MH5A 1UVOA 1TNLA 1FN8A 8GCHG 2JJ1D 1HIAB 2R9PA 1O5EH 2BDCA 3CS7A 1C2HA 4MQAA 1LKBA 1NRQH 1QB1A 4MNYA 1ARCA 1AWHB 1Y3YA 3HKJB 2BD2A 3PLKA 1AY6H 2IPHA 3H5CB 1IQMA 5A09A 2F9UA 4K2YA 1TB6H 2A45B 1C5QA 1ELDE 3NZIA 4X2WA 4XBDA 5EQRA 1EJNA 2H5DA 1GMHG 3A8AA 4CR9A 1V2JT 3SJKA 4CHAB 3JZ1B 1EX3A 4CIKA 3RP2A 2V7QD 5CE1A 1AFQC 3UPEA 4CRCA 2PKAB 1VR1H 1O2WA 1W81A 1FXYA 1O2ZA 4NZQA 2BLWA 2D26C 1BOQA 3RXPA 3M35A 1C5VA 4GLYA 3ZVFA 1O2MA 2F4LA 2CMYA 3KF2A 1O2XA 3SGAE 1UVUH 1EAWA 3Q77A 3RXIA 1EPTA 2HRVA 4CH8B 4RKJB 1W7GH 1FY5A 1TGCA 3RXVA 4IN1A 2Z7FE 3BTGE 1EB2A 4O97A 1UHBB 2A4GA 3PTNA 4D7GA 1YLDA 1OWDA 7LPRA 2YIPA 3VB4A 2CF9H 3LDXH 3UREA 3S7HB 1GPZA 1ELBA 1YXEA 2YILA 3GDSA 1QBVH 1W7XH 4B6EA 1P2NA 1O3EA 3Q3KA 2JIZD 4X8SH 4Q4LA 2GCHF 5FPTA 1YC0A 2BXUH 1GMCG 2ZZUH 2AMDA 1PYTD 1AGJA 2W7UA 2ZC9H 1O5GH 1ZMLA 1FJSA 1BTPA 2I9AA 2ZF0H 4BTUB 1ESBA 2QV1A 1TE0A 3O8BA 5JBTA 2Q8BA 1Z6JH 1AFQB 2VIWA 5L2YH 1YCPM 4JZEH 4X8TH 1G3EA 5DG6A 1OYTH 3U1JB 1BBRE 1BBRH 2J4IA 1MQ5A 1UK3A 1ZSKA 3ATWA 5B6OA 1GI8B 4NCYA 4CBNA 1HJ8A 4DT4A 1Z8RA 4DVAU 1MCTA 5FBIA 1V2MT 1TPAE 5L2ZH 2OCVB 4MG3A 1WAYB 2RDEA 1O3IA 1W11U 3U73A 1BJUA 2AIPA 4FUGA 5JBAS 1CT2E 3ATMA 1GDQA 1IQFA 1O3NA 3RC5A 1W12U 1O5CB 2F9OA 2Z94A 1XVMA 1GI3A 1Q2WA 1CQQA 1EQ9A 5C1YA 4X8UH 4X1QU 2VIDA 3MQKC 4DT7B 3LKWA 3ZVBA 3SOSA 4E06H 1EJMA 1E37B 3RDZA 4R1AA 2A32A 4AB9A 1K1JA 1DFPA 3BG4C 5I46H 1QJ7B 1C1WH 1HNEE 1TMTH 3CENA 4CRFA 5A0CA 1BRCE 1PQ5A 4Y8ZA 2ZHEH 5DK1A 2PKAA 4ISHH 2FEBA 3W95A 1V2KT 2ZPSA 3A81A 1A1RA 3TJUA 3RXAA 1FPCH 1FY1A 3EE0B 1Q3XA 1C2JA 1T7CA 4WH6A 1S82A 1SVPA 3PLBA 1EP6A 2PR3A 3SI3H 4Y10E 4YIVA 1COWD 4ACAA 4HG6A 3SI4H 3UQOA 3M7UA 4KKDA 2WPMS 3SRIA 3RXCA 1TOMH 1ANEA 5A2MH 3OE7D 1UHBA 1VJAU 3MO9A 3EA8A 4X1RU 4MTBA 2PTNA 3BEIB 4NA8A 1NFYA 1OPHB 2ODPA 2ZDAH 4OGYA 4APMA 1C2FA 1Y3XA 3R3GB 4YIZA 1ZGIA 3BTKE 2ZQ1A 1IQIA 4DIHH 1NBME 2C8WB 1QB9A 1W8KA 1OXGA 4JZDH 2NU2E 1O38A 2HLDD 2QXIA 5KECA 1O3PB 5ETXA 1TGBA 4Z09A 4BVVA 2YOLA 3SHCH 1GMDF 5EW1H 1B0FA 3SP8A 3RU4E 2WV5A 3G01A 1O2JA 3BG4B 1MTWA 3TJNA 1EOLA 1CT4E 2PK4A 1NRNH 3SUFA 1J17T 3VB3A 1C2IA 3R0FA 4M7GA 5F6MA 2ZECA 4ZCNA 1O0DH 3V13A 1C1VH 1HUTH 2FO9A 4HTCH 3GCNA 1TBZH 2FXRA 3RMOH 3LAQA 1NU7B 2QA9E 2Z3EA 2ZA5A 1XVOA 1SGIB 3HMTA 1W0ZU 1VJ9U 2VH0A 3DCLA 4ISOA 4OGXA 1ZHMA 1Q31A 3GY7A 3RU4D 3SU5A 4NIVA 4RN6A 2AMQA 1SHYA 3MU0A 1HB0B 1QHRB 3ZZCA 1AB9B 1ANBA 1TNHA 3SV7A 1ZTLA 3EGKH 2RFKC 4GCHF 1EB1H 2BVSH 2O8TA 2SGQE 1A0HB 1DXPA 2UWOA 1DE7H 1EJAA 2CGAA 4NZLA 1HJAC 3S7KB 1U6QA 1PQAA 3A7ZA 2J98B 1ZYOA 1YPHC 3P8GA 4H42U 2HGTH 3WW7A 5C2ZA 3M37A 4WMEA 3MMGA 1TGSZ 1C2GA 4CR5A 1GJAB 3FO8D 1TWXB 3OX7U 1MTNB 1RXPA 2ANMH 5EGMA 4IMZA 1O3GA 2VIOA 4GHQA 3QN7A 1S84A 2BOKA 3SZEA 4Z0FA 1YGCH 2A7HA 3OU0A 2TBSA 4JK5A 5EQQA 3BEUA 2CV3A 2ZG0H 2BZ6H 1CT0E 1DPOA 3KEEA 3GOVB 2FYQA 1TMBH 3PTBA 1G3BA 1ZJDA 2XC5A 3HMRA 2XC4A 1QCPA 4HFPB 2A5AA 4M9FA 3M5OA 2F9PA 1Y5BT 5E0JA 2QXHA 2GGVB 4JYTA 1O2NA 2XBYA 1SFIA 1MD8A 5TCAA 3A88A 2AH4X 2ALPA 1TRMA 1K21H 1HJAB 4NGAH 2FESH 3BTTE 4QT8C 1Z8JB 1K28D 3UWJH 1IQNA 1C9PA 4BXSA 4DJZB 1TPOA 4YM9A 1A3BH 1YLNA 3DSOA 1ARBA 1TYNA 1QNJA 5E2OA 1ZZZA 1MAXA 2BDAA 1P11E 1DM4B 2PF2A 2PFEA 4UONA 1YPEH 4MVNA 1TGTA 1V2TT 5FHTA 3ZIAD 4FUJA 5JDUB 2BYAX 3SV6A 3SO3A 1C5SA 2ULLA 1SPJA 2GDEH 2XBXA 1GI2A 1UCYK 1GJCB 2DUCA 1GBBA 2IOTA 1O39A 1PK2A 2DE8A 1GHBF 2V0BA 4NA9H 1GI1A 3SBKA 1MMJN 1QR3E 1TBQH 3HK6B 1T4UH 5C0TA 4OS2A 1TX6A 1ELEE 4FU7A 5DGJA 2SNVA 2FIRH 1RRKA 1O2RA 1GGDB 3MTYA 1O32A 4UFGH 4KIVA 1KYNA 2J98A 3SRJA 2F91A 3ZZ4A 1NS3A 1O2QA 1SOTA 2O8MA 2OP9A 5GNDA 5T6GA 1BJVA 3P70B 1ANCA 4Z0EA 2P93A 3A89A 1HAGE 2A4RA 5CS9A 1I5KA 2Z3DA 3LJJA 2W26A 2EI6A 3LU9B 1FIZA 1PK4A 1RJXB 2D8WA 2SGDE 1PQ7A 1P12E 3ATIA 3HN4A 1GHAF 4Q80A 1S81A 5EXNA 2WYGA 1NFXA 2F9BH 1BMAA 2FOFA 8ESTE 2OUAA 1BTWA 1QIXB 1TOCB 2W3IA 2Z9KA 4AYYB 2GCHG 4FXGH 5CT3A 2VIVA 1BT7A 1F0RA 1TALA 5FL7D 3HMSA 3OTJE 2KCAA 4AZ2B 5A8XA 1A0LA 9ESTA 2ZTYA 4TPIZ 3F9HA 4Y11E 2VJ1A 3T25A 1TNIA 5HIZA 1ZPBA 3GY6A 5DP3A 4AGJA 5FX5A 1WV7H 1P09A 4X6MA 1ZPZA 1TA6A 2EA3A 5GCHF 3DT0H 3I29A 2EI8A 2ZDNA 1LVMA 3L3TA 1Z6EA 4TWYA 2P3UB 1O3BA 2Z6BD 3ZVGA 2H5CA 4X6PA 1A7SA 7ESTE 3PV2A 2ZFTA 4RSPA 5EJLA 1DX5M 1JMOH 1O2VA 2VU8E 4XOJA 3ITIA 1HFDA 3MU1A 5JB9S 1UO6A 3QO6A 2AERH 3U8RH 2PSYA 1BQYA 1BTUA 1YYY1 3U98H 2FOGA 1O3CA 3LGYA 1ELCA 3WWFA 1UTKA 1GVLA 1DLEA 2Y5HA 2Z9IA 4I7YH 3E16B 1WU1A 1BMLA 1H9IE 3MWIU 1Y59T 2SPTA 1NROH 1OOKB 1GBEA 2AFQB 2A2XH 4J2YB 5C1UA 4Y76A 7GCHG 1ZHPA 4A1XA 1EZUC 2A1DB 3SGBE 2QXGA 5HM9A 3E1XB 2JH5D 2K8IA 1YPJH 3RLYH 1H4WA 1IHSH 1EPTC 1ZGVA 3ZVCA 3D65E 4IUAA 4IC5A 1Z7KA 3F9GA 5GIBA 1AMHA 1HDTH 3RXRA 2A7CA 3UY9A 4UE7H 3KIVA 4WWYA 1A61H 3M3TA 1C1RA 1GL0E 1GDNA 2SGPE 3BTDE 4Y7BA 2XXLA 4SGBE 4ZKRU 3VPKA 3A82A 3ESTA 1SL3A 4P02A 2OINA 2OD3B 2C3SA 1T8NA 2C8ZB 1H8IH 3FZZA 1MTSA 2VWLA 3PLPA 2D1JA 1BTYA 3ZZ8A 4ZHLU 3RXDA 2H1UA 1BBRK 5IDKA 4GSOA 5JB8S 1EXFA 4JMYA 1CA8B 1HXFH 2BVRH 5EG4A 1PMKA 1SQAA 2QYIA 3A85A 1SLUB 1TA2A 1P03A 2X2ZA 2XNDD 1DXWA 1GBLA 1S5SA 1WSSH 3FOAA 4Q7XA 1UK2A 1O2OA 4MPWA 6GCHF 1K1LA 4FUBA 1GBJA 1KY9A 3MOCA 5T1VA 1B0EA 3V7TA 3ZZBA 5C20A 9LPRA 1O5BB 3BT2A 1Y3UA 3BTHE 1LQDB 1SGTA 1EPTB 4U2WA 1XUHA 5EU8A 4X1NU 1O2HA 4XSKU 2R3UA 1UVPA 1KXAA 3RM0H 3ATKA 3OFND 3SNAA 1NZQH 2A4OA 2ZI2H 1YPLH 3S9CA 1SGQE 3QLPH 1C5PA 1P2KA 1ACBE 2G52A 1BHTA 3MI4A 4IS5A 3ZLEA 1EAXA 3VFEA 1P3EA 1NT1A 3GY8A 3D62A 2UUJB 3Q3XA 1SLWB 3RXFA 1FIWA 1C1PA 1QJ6B 2GCTC 5LPRA 3RMMH 1NL1A 4ESTE 1F5RA 2ZP0H 1B7XB 4K1EA 1HAVB 1F7ZA 3OY5U 3EQ0H 1KXFA 4YTAA 1C5OH 4KELA 3SJIA 2FDAA 1F0UA 4YZUA 3A7XA 3PRDA 1OS8A 2F3CE 2KR7A 4MNWA 5C3NA 1VZQH 3P95A 1TPSA 2J2UA 4B75A 1C1SA 3UB0A 3E6PH 1LKAA 4A1TA 1C1QA 1L1JA 1NFUA 1KXCA 5CDFE 4CBOA 4MNXA 3MO3A 3P6ZB 1AUJA 4UD9H 2GVFA 3UOPA 2ZPQA 1HAZB 3AAVA 2Y8RA 1O2SA 5C5NA 3RC4A 4AG1A 4DURA 5I25A 1QBOA 3GY4A 2R0LA 1AD8H 3SNCA 1F5LA 1MCVA 4R0IA 1DITH 2CJIA 2BX3A 2ANYA 3QK1A 1V2NT 1G2MA 1KXBA 1NC6A 2Q6FA 4BXWA 1GBIA 2FOEA 4ABBA 3I77A 2ZCLP 3T29A 2DOHX 1MD7A 4YT6H 5JBCS 2FLRH 1C2DA 3RXEA 1QB6A 3RXQA 1I71A 1L2EA 2ZIQH 2ZFRH 2JETC 4FUIA 3KL6A 1T4VH 4U01A 5AFYH 2GCTB 4BOHA 1PYTC 2QXJA 3TGIE 2LPRA 3F1SB 1VCPA 3E91A 3SORA 3TPIZ 1HAHH 2WV9A 1W2KH 1C5NH 1SGFA 2PUQH 3ZVAA 5CHBA 1O3OA 2GT7A 3B8JA 3BTME 5KEDA 1SGCA 3KQDA 1VITH 1A5HA 2UWLA 1N6YA 1EOJA 2XRCA 2ZWLH 3KIDU 3QGJA 2KCOA 1PPZA 2BLOA 1VCQA 3GCTG 2WV4A 5EPNA 1CBWC 1LVBA 1QURH 1GHBG 1O30A 3VEQB 1O37A 1JRSA 1C5WB 3KQCA 5J4SA 1YPKH 1RIWC 1ZLRA 2FOCA 4FOUC 4Z1MD 1ETTH 1P04A 1L1GA 1GMNA 5CS1A 1TNJA 2G51A 3U9AH 1SGNE 5HXFA 4ZXYH 1HJ9A 1DSUA 1V2RT 1TABE 1V2OT 2Q1JA 4TYDA 4Z0KA 3FN8A 1V2WT 5L6NH 4HGCA 4XBCA 1HAVA 2BDYA 2VIQA 3VB5A 3DSPA 4MNVA 1C4Y2 3ZVEA 1C1MA 3B9FH 1MABB 5A8YA 2JETB 1P2JA 2O8LA 4ABAA 3P8FA 1EZXC 3DA9B 3E6PL 1INCA 2FTMA 2XW9A 2QF0A 4NWKA 1ELTA 3GCOA 2R2WU 2RCEA 1NRRH 4TWWA 4YLQH 2QIQA 3C1KA 3MHWU 4YO9A 1GJ5H 1L4ZA 1KLJH 4ZMAH 1D6WA 2V3MA 3LPRA 4FUHA 3KHVA 2H9TH 1GJBB 2PLXA 3KQBA 1TX7A 4B2AA 2BTCE 3SU6A 2BQ6B 5C67A 3PV4A 1PFXC 2KJ4A 1BMMH 1CBWB 1THRH 1KDQB 4LZ1H 2GMTC 1O2GH 3GCHC 3SU1A 1EZQA 1QRWA 2GP9B 1RIWB 3F2FA 1ZR0A 5GPIB 4A1VA 1NK1A 3KN2A 1O35A 4WJG2 5DP7A 2ZHDA 1HAYB 1H9HE 2IPQX 5T6DA 1AWFH 5LPFA 1UTJA 2HOBA 3SJOA 3AW1A 4A92A 1HAXB 2AGEX 2QJ2A 3V12A 3URDA 2WUCA 1O5FH 5EQSA 4B73A 1DWCH 1CE5A 4LOYH 2BY7X 3O8RA 4D76A 4E7NA 3E0PB 3RU4T 2G4UA 4ZKSU 1TAWA 1KIGH 1IQKA 3TH3H 3T27A 1UTNA 1F92A 1TLDA 3M5MA 4JZFH 2HPQP 1NY22 1MUEB 2Z9JA 3IG6B 3DHKH 3OEHD 5IYTA 2HGFA 1C1TA 3ZZ5A 1ETSH 1W10U 3PROA 1O36A 1J9CH 1NRSH 1S6LA 1V6DA 3BIVH 3D49H 1BIOA 2JKHA 2WUBA 2OC0A 2HWLB 3A84A 3N7OA 4FU9A 2FX4A 2TGTA 3F0PA 3PB1E 1LPZB 5LGOA 3M5NA 5F8ZA 1Z8GA 3C27B 1PMLA 2GMTB 1XKBC 3GCHB 2SFAA 2WYJA 4AFSA 3KQ5A 3ODFA 1P2IA 1AVWA 3QDZB 1P0SH 1ZSJA 3Q00A 4XFQA 5T6FA 3RXOA 3UAIC 4JYVH 1LPKB 1FI8A 3MNXA 3ODDA 2IN2A 1LHCH 3SGQE 3SUEA 2LL4M 1P05A 1FY4A 1MH0A 2CN0H 5K7RA 3MU4A 1IQLA 7KMEH 5G4BA 1C4V2 5BPEA 3TJOA 3FFGA 2VWNA 4RKOB 4BAKB 1BRAA 1CHOG 1GBHA 3SU0A 2ODYB 1G2LA 2EQNA 3OTPA 1YPMH 4H4FA 2QF3A 2ZU4A 4NFEA 5DO4H 5J4QA 5DP8A 4GPGA 4YLUA 1GVKB 1NBMD 1S6FA 1HPKA 3LH3A 3KGPA 1BDAA 2J9NA 3JZ2B 4IMQA 1GJDB 1WYKA 3RXSA 4IN2A 4XE4A 2AGIX 4K60A 3ZV8A 4Z6AH 4KTSA 3W94A 5BRRE 1Y8TA 1KDQA 2NU4E 4B6FA 4Z0DA 2GZ8A 2OXSA 4A6LA 1UW7A 1HV7A 1LQEA 4ABDA 2D2DA 1VITF 3GY2A 2Q8AA 1ZRKA 2BY8X 1UTPA 3SN8A 6LPRA 2BY5X 2I6SA 1O3AA 4P00A 2W6ID 4IGDA 1ESAA 1GHWH 1QQUA 4ISLA 2Z9LA 1IAUA 3A7TA 2ZU5A 3SUDA 1KXEA 1C9TA 4AX9H 2YMSD 1MU8B 1MTVA 2ZKSA 4WF8A 2GT8A 1GI7B 1OP0A 2ZDMA 1QA7A 4SGAE 2VH6A 4THNH 1KMHB 3RXGA 5EXMA 4YOGA 2HPQH 1T8MA 2J92A 2Y6TA 4X6OA 4K5ZA 1GP9A 1LMWB 2ZO3H 1J15A 2L6OA 1NESE 1LO6A 3NUMA 4VGCC 1G32B 1YPGH 3KNXA 2SGAA 2VGCC 2M5TA 4GVUA 3D23A 2BD4A 1ZJKA 2KZ4A 2XWAA 1XUFA 1S83A 1W0KD 2BD9A 3CNRA 8GCHF 1NTPA 1J16A 1NO9H 4WH8A 2CXVA 2OC1A 1G36A 1ABIH 2BLQA 5COEA 3FZDA 3ZZAA 1C2KA 2VVCA 4UFFH 1WTHD 5F53A 2JJ2D 4D9QA 4BAHB 2H9HA 4XBBA 1OWIA 1X7AC 2ZCKP 2OQUA 1GJ4H 4B71A 1G30B 1GBFA 5E2PA 1S85A 1FUJA 1QL7A 4HZHA 4B76A 4IC6A 4INHA 2J38A 3FKSD 1GBTA 1C4U2 1C5UA 2ODQA 5EXLA 4A5TS 3T28A 1AVXA 4I32A 1LVOA 5GXPA 4I8KA 1O3DA 1NFWA 1Y5AT 3P17H 5FPYA 1GCTC 1P2OA 2OC7A 3RXKA 1OWEA 1BITA 3RMLH 2VB0A 3SV9A 5HYOA 1H8HD 1RTFB 2VGCB 3ENSB 1ZMJA 3SV8A 1C5RA 1KI0A 2SGFE 4YT7H 4Q63A 3E0NB 2ANWA 5EJZA 1YY3A 3F68H 2QF4A 6CHAC 1SI5H 1GBCA 2R3YA 3MKPA 3MH6A 1DWDH 1EUFA 4R8TB 4ASUD 2ALVA 5AF9H 2ZQ2A 5LPEA 1NL2A 4BVWA 3A7YA 1EP5A 4NFFA 2KL5A 1P02A 4B1TA 4BTIB 3PWBA 1PQ8A 4BTTB 5DP5A 1K1IA 2BHGA 4DIIH 3T26A 1F0TA 1FY3A 3ZZ7A 4GHTA 1GMCF 1G37A 1YM0A 2B0FA 1MKWK 1Z1JA 4NSYA 1VKYA 3KYFA 4BAQB 4RI0A 3U8TH 2J34A 1T31A 2PV9B 1N6XA 1HBTH 3CS0A 1XX9A 3CP7A 3MFJA 1BB0B 1H9LB 2G81E 2ZGHA 2P16A 3QWCH 1K9OE 5EODA 1TPKA 1H8ED 1O2IA 2ZHFH 1FDPA 3SU2A 2FM2A 4ABEA 1O3JA 5EPYA 1JRTA 1UTLM 2PSXA 2WZQA 3MH4A 4O03A 1BCUH 4LXBH 2G5VA 5TJXA 1OSSA 1SGYE 3EDXB 3TH4H 1SMFE 1URKA 2J5UA 2P3TB 3EYDA 3QTVH 2GJGA 3UOUA 4JZ1A 2ASUB 3Q3YA 5KGOA 2NU3E 1ANDA 2BVXH 2FMJA 2QY0B 3UFAA 3TNSA 1DT2A 1AVGH 5DSFA 2A2QH 3P8NA 5CT1A 2YNBA 1JIRA 4ABHA 3STJA 6CHAB 1C5MD 1LTOA 2KAIB 5A0AE 2GV7A 1N1LA 2I6QA 3BIUH 5E8EH 1OP8A 1DY8A 1AE8H
chains in the Genus database with same CATH topology
2NU1E 5F8XA 1FV9A 1P01A 3BEFB 2GTBA 3TIUA 3OYPA 4I8LA 5L30H 1SLVB 2CF8H 3TLOA 3WY8A 2TGDA 3QX5H 1F0SA 2B8OH 4ABFA 1O2YA 2HVXA 2BZAA 1E38B 1DY9A 2Z8WA 2V3OH 4K1SA 3HPTB 2TGPZ 1MBMA 2HNTC 2XCFA 2BX4A 1FNIA 3NWUA 1EATA 2KNFA 3NPSA 3KQEA 5HGGA 1KDUA 2FOAA 2FEQH 4ABJA 4NSVA 2ESTE 1XMNB 3K6ZA 1G9IE 3RMNH 2EEKA 2V35A 1FY8E 2FYRA 1JWTA 4Y79A 3GYMA 5EOKA 1SGDE 4ZKNU 3TITA 2HNTE 1BTHH 3O8CA 3U8OH 2TRMA 1ELGA 3UR6A 1OWHA 4KTCA 2GV6A 1GMDG 2DOIA 5CS3A 2XNIA 1OWKA 1FQ3A 2H6MA 3K6YA 2H9EH 5TCCA 2ZDLA 4B2CA 4D9RA 3DD2H 2LL3A 2ZTXA 1G3DA 3UIRA 1RTKA 3MU8A 5FPSA 1QBNA 1TX8A 4KP0A 2LNCA 4X0WU 2CHAC 3LGTA 3QTOH 1B5GH 5JYIA 3H7TA 3TGKE 1T32A 1RFNA 3BTEE 3ZZ3A 4R1CA 2XCNA 4DGJA 1TFXA 4Y71A 1QJ1B 1KLIH 4WMFA 2I9BA 4GCHG 4F49A 2KAIA 3QUMP 1CGIE 3MNCA 2ZFQH 1SSXA 4WXIA 3RC6A 4IBLH 4I8JA 1PPHE 1FN6A 2NWNA 1QFKH 3SNEA 1EZSC 4BANB 2ZHQH 4FUFA 1VITG 1H1BA 1JBUH 1L4DA 2BDHA 1PJPA 1GJ6A 2F9NA 1GBMA 1UJ1A 2ZGBH 5H4IB 1EASA 1IQJA 2BM2A 1HRTH 1EAUA 3E3TA 4ZHMU 1OYQA 3TVJB 1BRUP 3UR9A 4AYVB 1HYLA 3LC5A 4E7RG 5DJ7A 4UAOA 1MKWH 2ZU3A 5E0HA 1QGFA 2QJ4A 1KIVA 1AZZA 4WMDA 5DP6A 1DUEA 1GWAA 4GAWA 1RD3B 2BMGB 5FCRA 2CHAB 1DLKB 2WPHS 1SFQB 1KLTA 1QRZA 2FI4E 2PUXB 1V2VT 1ZRBA 6ESTA 3ZZDA 2OBOA 1P3CA 1P8VC 3FVFB 4JK6A 4NA7A 1H8DH 3RLWH 1FPHH 2PGQB 1GBDA 3GDVA 1Y3WA 5AVDA 1A4WH 4CRGA 2BOHB 2VWOA 3TK5A 2Y5GA 2UWPA 2PWXA 1XUKA 4TY6A 4BV7A 3EA9A 2BDBA 2G55A 1DSTA 1N8OC 2HALA 1FZZA 2FS8A 3BG8A 3LGUA 1DICA 1NRPH 1W3CA 4NG9H 3K65A 1LHEH 3TU7H 1O5DH 2YNAA 4FVDA 4UDWH 1E35B 2GX4A 1BZXE 4OS1A 1HCGA 1C1UH 1GJ7B 1WTGH 3ZYDA 2WPIS 2WPLS 4K3JA 3STIA 4X2YA 3SQHE 3RXLA 4DY7B 4FUDA 1FONA 2C4FH 1ZOMA 3B23B 1O3LA 2C93B 2Y7XA 3PMBB 1P9UA 1O3KA 1SOZA 1IQHA 1DUAA 3BTFE 3FP8E 3O8DA 4ZH8A 1HLTH 2FI5E 2FOHA 3EA7A 3VGCC 4DOQA 1XUJA 2FLBH 1WOFA 1T8LA 4CREA 2Y81A 4X1SU 1C2LA 3HATH 2OLGA 1EKBB 1CHGA 2J94A 3BF6H 3M36A 2PHBA 3T2NA 3GYLB 1A0JA 2XYAA 4BVDA 2Q6DA 2STBE 1SC8U 1TNKA 1P9SA 2ZGJA 4U32A 1IQEA 1LHFH 2NU0E 3PM3A 3PMHB 1V2QT 1WQVH 2A5KA 1CEAA 1DANH 4MPVA 3HGNA 4B2BA 2HLCA 1N8OB 3FP7E 1GHAG 1C5YB 1CGJE 4Y8YA 1OKXA 4H6TA 2HNTF 1GI0A 1AKSB 4K1TA 8LPRA 1NPMA 2Y5FA 1MU6B 1GHZA 1XXFA 1WBGB 4R1BA 1AZ8A 4AFZA 5CP9A 1AFEH 1GBAA 1ZSLA 3H7OA 3PO1C 1XUIA 3RXMA 2G4TA 3MYWA 3UNRA 4AGKA 1YBWA 3UTUH 3TH2H 2UUFB 2OBQA 4O9VA 1SBWA 4FVBA 1GDUA 4DCDA 1TRNA 1O33A 2XWBI 3M7QA 5GCHG 4ISIH 1DOJA 3IWMA 1HIAA 2ZGCA 1QTFA 4UEHH 3MO6A 3VGCB 5FX6A 3IITA 3BTQE 1VGCC 1NN6A 2ILNA 4KGAA 4AORA 1LPGB 1ORFA 2W7SA 3KCGH 1TGNA 1ELVA 1P57B 2IJOB 1SGPE 3S0NA 3LIWA 3PMAB 3AAUA 1C1OA 3A87A 2JH6D 2QAAA 1FLEE 5DP9A 1K22H 5F8TA 1UTOA 2ANKH 2VWMA 5K0HA 5CT2A 1O34A 7GCHF 1CO7E 3A86A 2B7DH 2FPZA 3AVZA 4JCNA 1HKYA 2A7JA 3GISB 3BSQA 1NU9A 1MTUA 2K13X 4NIYA 2K4RA 1PPCE 3VB6A 5ESBA 1GVZA 2WINI 2R0KA 2WPKS 4MDSA 3OSYA 1ZPCA 1SHHB 4I8HA 1GHXH 4MPUA 3PO1B 2FZZA 3OY6U 4K8BA 2ZDVH 3SUGA 2AEIH 1Y3VA 1GCDA 1CEBA 1AB9C 3LC3A 3RUOA 2P3FH 2EC9H 5CSQA 1QQ4A 1LCYA 5JPMH 4J1YA 4I31A 3K2UA 1TONA 1MZDA 1TIOA 3HGPA 1GHVH 1BMNH 4Y8XA 1LHDH 1QRXA 2ZTZA 1J8AA 1JXPA 3UUZA 5LH8A 4BV5A 1VGCB 2YIOA 2FODA 1PPBH 3LT3A 2G00A 1G3CA 1TRYA 3M5LA 2BD3A 1DS2E 1MZAA 1MTNC 1V2LT 2FI3E 4K69A 1AKSA 2UUYA 4UV6A 3U69H 1TBRH 4B74A 2XC0A 2PKSC 5C1XA 2V3HH 1GI6A 1FAXA 1BTXA 2PF1A 4AFQA 1DWBH 6GCHG 1UTQA 1O2TA 1Y5UT 2O8UA 1V2UT 3S9BA 4AB8A 1P2MA 2BD7A 1XKAC 2AYWA 4D8NA 1O2LA 2QGRA 2ZFFH 1TNGA 4PROA 2H2ZA 2L0SA 3LGVA 1D3QB 2VINA 4TPYA 1LDTT 1K1OA 1W8BH 4A7IB 1ELFA 1SQTA 3VXEH 1WCZA 2PGBB 1AUTC 4X6NA 1AN1E 3F9FA 1D6RA 1BUIA 1Z71A 1ID5H 3A7VA 3UQVA 4X2VA 4MLFB 3TK9A 2Y82A 2Z3CA 3V0XA 1MQ6A 2RA0A 4WXVA 1THPB 3EAJA 2EI7A 1A2CH 2BQ7B 3I78A 2OTVA 1TQ0B 2RA3A 2A4QA 4BVCA 1K1NA 2ZNKH 2HPPP 2GZ9A 1V3XA 3NCLA 3M7TA 1WUNH 4ZKOU 1GHYH 4YESB 1SG8B 2J8JA 4AFUA 1YCPK 4O3UA 1KRNA 1GJ9B 1S6HA 2PKSB 3PMJA 3MH7A 3BT1A 1D4PB 3ELAH 1YPHE 1LHGH 4I33A 3SW2B 2ZEBA 1B2IA 3RXHA 3P8OA 3Q76A 2TGAA 2SNWA 4DG4A 2Y80A 1RGQA 2PW8H 4KTUA 4FUCA 2P94A 1C1NA 5FBEA 2WPJS 2J8LA 2FX6A 1V2ST 1GGDC 1AHTH 2PTCE 1IOEA 3T62A 2XBWA 3ZV9A 4U30A 1KTTB 4XDEA 1IQGA 3LH1A 1AE5A 4JZIA 1HAOH 1SGEE 1GBKA 1GMHF 3L6PA 4OS6A 1AO5A 1C2EA 1HXEH 1ZMNA 5DKMA 2OQ5A 3NK8A 4Y0ZE 1DWEH 1QL8A 3GY3A 4NWLA 1E36B 2V6NA 1MKXK 4JYUH 1SQOA 4R19A 1PKRA 1BTZA 2BY6X 2J95A 3NKKA 4BAMB 4X1PU 2RDLA 1D3DB 2F83A 3DFLA 5C5OA 3A7WA 3ZZ6A 1RS0A 3MU5A 2ZCHP 2BD5A 5GWZA 4VGCB 1D3TB 1KTSB 1GI9B 1AIXH 3GCTF 1O2KA 2SGEE 2VVVA 4X8VH 4CH2B 2QCYA 4ZUHA 4UFEH 1GMOA 3A8DA 1HAPH 3FP6E 1KSNA 2BQWB 1K2I1 2VNTA 3L33A 1UK4A 1C2MA 5CHAC 5HMAA 1WQSA 1UVTH 5A8ZA 1XXDA 4AOQA 5ABWA 2THFB 3TNTA 1A0HA 4AG2A 3F9EA 1V2PT 2FP7B 1C5TA 2FD6A 3E8LA 3RM2H 3BN9A 2W3KA 1W13U 5DPAA 4ZHAA 4MPXA 1Z8IB 1DDJA 2BB4A 2BXTH 1O3MA 3MNSA 4ZXXH 2HPPH 1SGFG 2QN5T 2ZDKA 1T8OA 4LZ4B 1FMGA 2C8YB 2ZU1A 1SGRE 1AQ7A 1GL1A 1QA0A 1QL9A 2K51A 2FS9A 4INKA 2O8WA 2C8XB 3RXBA 4ZROA 5JBBS 1F2SE 1I8NA 3ATLA 5EW2H 3UNQA 1C5ZB 1O3FA 3ZVDA 2G8TA 2GD4B 4HI3A 4UFDH 4E05H 3SQEE 3VXFH 1GCTB 3GY5A 3GICB 2B9LA 1ETRH 3DFJA 3GDUA 1C5LH 4Q2KA 2FTLE 1BHXB 2ZU2A 1L0ZA 1Z40A 1JIMA 1AI8H 2ZGXH 5AFZH 1OWJA 3FAOA 3LONA 1GG6C 2AMPA 1ABJH 1F5KU 3MNBA 4ISNA 3V3MA 1CSOE 2ZFPH 3QZQA 4TY7A 5CHAB 1A46H 2DE9A 1YF4A 3F6UH 1SB1H 4NIWA 4ZAEA 4O3TA 4CRAA 1SR5C 2STAE 3A83A 1LVYA 4ABIA 3LOXA 2TPIZ 5DP4A 3LGIA 2OC8A 4CRBA 3A8BA 3UWIA 1E0FD 3SJ8A 5FAHA 3LJOA 4Y0YE 4Y6DA 1XM1A 3SJ9A 4YOJA 5T3HA 2VIPA 3SZNA 1HPJA 3TK6A 2UUKB 2P95A 1YP9A 1O5AB 1HGTH 3QGNB 2G5NA 1E34B 2VVUA 2W5EA 2XTTB 3PYHA 1PPFE 1ESTA 1UVSH 4INLA 5CS5A 1O31A 3P92A 3LGWA 1S0QA 3URCA 1A3EH 1ELAA 1QY6A 5ESTE 1DVAH 3ZZ9A 3FANA 2JH0D 1P10A 1CU1A 2P8OC 1YCPH 3U1IB 4H6SB 2FOMB 1A5GH 3S69A 3HK3B 2BD8A 4CRDA 4BAOB 5HPGA 1IHTH 1GG6B 3ZWZA 1L1NA 2AGGX 2BDIA 2BY9X 2Y7ZA 4ABGA 3NXPA 1JFNA 4ASHA 2Q6GA 1AU8A 1M9UA 4WVPE 1MBQA 4F4OC 1XUGA 3BV9B 3M61U 3UNSA 2A5IA 4FU8A 1CHOF 3SNDA 3SV2H 5E0GA 1K1MA 1CGHA 4APLA 1MAYA 1PPEE 1TMUH 2AS9A 2FOBA 3K65B 5CMXH 5FCKA 1J14A 1THSH 1VCWA 1D9IA 4DW2U 1K1PA 1P2QA 1UTMA 1W0YH 1UMAH 3HKIB 4D7FA 5AHGH 1FAKH 4K8YA 4Q7YA 3TGJE 4NIXA 1C5XB 1CA0C 1RTLA 4OS5A 1BRBE 5FXLA 2R2MB 4I8GA 1MKXH 1PPGE 1OX1A 2GZ7A 3T5FH 4FUEA 4Q7ZA 2Z9GA 1O2UA 1KXDA 4OS7A 3K9XB 2B5TB 3VB7A 5GDSH 5PTPA 3A80A 3E90B 2AIQA 2ZHWH 1UCYE 1UCYH 2P8OB 4D3CA 1W14U 2A31A 1JOUB 2Z8VA 2A0QB 4OS4A 2P59A 3SU3A 2GDDA 3RXUA 4YOIA 3RXJA 5A0BA 1ZTKA 2FWWA 5HM2A 1GJ8B