4DURA

The x-ray crystal structure of full-length type ii human plasminogen
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
789
structure length
756
Chain Sequence
LDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plasminogen
publication title The X-ray crystal structure of full-length human plasminogen
pubmed doi rcsb
molecule tags Hydrolase
total genus 197
structure length 756
sequence length 789
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4durA01
1SGFG 2ZDLA 3RXDA 1PKRA 4U01A 3SU2A 1FY4A 3VB4A 1YPJH 1Q3XA 1OXGA 4TWWA 5LH8A 4APLA 4YLUA 1GJ4H 1T8OA 2XWBI 3URCA 2ZU1A 1P8VC 2AMQA 2HRVA 3KHVA 1XVMA 2J2UA 3ATLA 4KTUA 1SGQE 3MOCA 1O32A 2GX4A 3ZZDA 2B0FA 1OOKB 4IN2A 3GCTF 2VIOA 1HIAA 4LOYH 2A7HA 1S5SA 2QXIA 5GJ4B 1B0FA 3DT0H 3E0PB 4CRFA 4Z0FA 1O2TA 1XMNB 1GI7B 2ZGJA 1KY9A 1FAXA 1YBWA 1HAVB 4UEHH 1ZGIA 4A7IB 4X1RU 1O2IA 2FI5E 1ZGVA 1TE0A 4BAKB 3UY9A 1E36B 1T4UH 2CHAB 4ABFA 2ZU4A 4KTCA 1UVTH 1T32A 3LH1A 3RXPA 1TNLA 2Q1JA 1J17T 3TK5A 2A32A 1O30A 1GMHG 1NU9A 3V12A 3C27B 1OWHA 1GDUA 1UMAH 1QGFA 2HALA 3BEIB 5DKMA 1LDTT 3RLWH 2B7DH 1BBRH 1GBTA 4ZHLU 4MQAA 3LJOA 1VITF 2STBE 1LHDH 2F9PA 4INLA 1L1GA 3F9EA 1GI2A 1GMDF 2FOCA 3M5OA 2WV5A 5FX6A 1DXWA 2I6SA 5JYIA 2FTLE 1YCPM 5I25A 1MTVA 5C1YA 1P9SA 1MCTA 1UHBB 4KKDA 2C3SA 3PMJA 1LVBA 5IDKA 3SZNA 1DE7H 2IJOB 1FY3A 2I9AA 3DFLA 1BCUH 1C2JA 3DUXH 5CS5A 1BHTA 3KIVA 1FIZA 1O5DH 2Z6BD 8KME2 1Z6EA 2AMDA 3NZIA 2L0SA 1C2KA 1CA8B 3ZZ5A 1RS0A 2HLCA 1O3NA 3UNSA 3RXCA 1RFNA 4XSKU 4FUEA 3BTQE 1ZR0A 1UTLM 3P8GA 3RUOA 1OKXA 5FPTA 3SORA 2BMGB 3B23B 1FONA 3JZ1B 3URDA 1PPFE 2GDDA 1HAVA 1C1TA 1FAKH 2OQUA 3UFAA 1C1UH 1K1OA 3GY5A 1UTJA 1O2YA 3PWBA 4LXBH 3SQHE 1L2EA 1VITH 2Y81A 4Y8ZA 1O5FH 2ALVA 1P3CA 2QC2A 5GDSH 1BITA 1KLTA 3IG6B 8LPRA 3DFJA 1G2LA 2YNAA 1TA6A 1OWEA 1THPB 4SGAE 3R3GB 2Y8RA 3RXOA 1TX7A 4X2WA 1YPHE 3ESTA 4GLYA 5A0AE 1IQGA 1K1NA 3SHAH 3TJOA 2GT8A 2BTCE 4X2VA 4ISHH 2A2XH 3F9HA 1V2MT 4OS6A 2SGPE 4Y7BA 2PF2A 2LL3A 4AFQA 3GCTG 3PWCA 1P09A 1MZAA 1V2KT 4KTSA 3E8LA 1G3CA 3IITA 5AVDA 1UHBA 3Q77A 3ZVAA 4DVAU 1BIOA 3TK6A 2BXUH 2CMYA 4U32A 3W95A 2NU1E 2A45B 4B76A 5EU8A 1C5PA 6GCHF 3F9GA 4GUXA 1D6RA 1ESAA 4YZUA 1UK2A 2G81E 1ZHMA 1T7CA 1BTHH 1YPHC 1EASA 2BDYA 1PQ7A 1GI8B 3ZZ8A 3D23A 4NFEA 3RC5A 3E16B 1CBWB 1YPMH 5FHTA 2OBOA 2AERH 3ATMA 3A7YA 1CO7E 2XXLA 1ELFA 2XC0A 1D3DB 3O8RA 3RXSA 1VITG 2OINA 2BDHA 1MU8B 1GI0A 4O03A 5GCHF 1WOFA 1GMDG 1NY22 1EZUC 1KLJH 1KDQB 1IHTH 1SMFE 1J15A 2BY6X 1S6HA 3OY6U 1UVSH 4UE7H 3KCGH 1XUGA 2V3HH 4INKA 1AE8H 1BHXB 1TBQH 2JKHA 2UWPA 3SI4H 2C8ZB 3FFGA 1GI5A 4INHA 1SVPA 2FIRH 1KIVA 2Z8VA 3S9BA 4AX9H 4NIWA 2GZ7A 1DM4B 3PO1B 4ABIA 1QA0A 3LGUA 1P2IA 2Z9GA 2D2DA 2FMJA 3ZYDA 1INCA 1KXDA 1ELTA 2WPKS 3P92A 1P03A 4XBDA 3TH4H 3BV9B 1WYKA 3PLBA 3BT2A 4WMFA 3U8RH 1X7AC 1EUFA 2ZECA 1SGIB 1DDJA 1SC8U 2B9LA 2AGIX 3A7ZA 1UCYE 3VGCB 1ZPBA 2SNWA 2RCEA 2FPZA 1GCDA 2ASUB 2ZG0H 3HATH 1P2JA 1EKBB 3AW1A 1E37B 3STIA 5GPIB 1C5SA 4JYTA 1C5RA 1O2WA 2D8WA 3M3VA 3TJNA 2ANMH 1AUTC 4THNH 2GCHF 3A89A 3SGAE 5JB9S 1KDQA 1Y3UA 1XUKA 3A8DA 1DT2A 1Q31A 3TK9A 3KQCA 1TRNA 1GBEA 1GBCA 1PK2A 1C2IA 2SPTA 1I8NA 2A4GA 1GJ5H 2P8OB 3FP8E 1FLEE 3T25A 1A3BH 3I77A 1WV7H 5FCRA 4YTAA 3U9AH 1DUAA 1K9OE 3QGJA 1V2PT 4FUDA 2RA3A 1QRWA 4KP0A 1FDPA 3E3TA 3TVJB 5FPYA 3LOXA 2ZI2H 1O37A 1ID5H 2EI8A 4MNXA 4O3TA 3EA8A 1FV9A 2K13X 3RLYH 1KXAA 1GBMA 1P2MA 3H7TA 1M9UA 1LMWB 1P02A 4FUCA 3RM2H 5CS9A 1ACBE 2ZF0H 4OS4A 4TYDA 1NRPH 2VWMA 2VH6A 4OGYA 2AGEX 3EDXB 2ZIQH 1OX1A 3LGYA 3L33A 1MQ5A 4NCYA 3UUZA 4AG1A 3LT3A 3PLPA 1P9UA 3M36A 1GWAA 3U69H 1LVOA 3O8BA 4DT7B 3MNSA 1G9IE 2OP9A 1C5XB 1TQ7B 1VZQH 3RXFA 2VWLA 3ATKA 1EPTC 2SGFE 2FOHA 1C2HA 2J95A 3F1SB 4IBLH 5AFYH 2PWXA 3U8OH 1VCWA 3CS7A 5T6DA 2XC4A 4BVVA 2A7CA 4WY3A 1HPKA 3MI4A 1MZDA 4BVDA 3QO6A 5LPFA 3SJ9A 1AI8H 1GDQA 4D8NA 3ODFA 1ELGA 1EOJA 3U8TH 3TNTA 1GG6B 1S84A 5T6GA 1QJ1B 5K7RA 1O2UA 4YOIA 4UV6A 3MKPA 2ZTZA 1TB6H 1UO6A 5EPYA 3RU4D 1BA8B 2BLQA 4IC6A 1NU7B 1LVYA 1HXFH 4UFFH 3RXJA 1UVUH 1DY9A 3SU4A 1V2JT 3GCHB 1XUJA 3AW0A 4CRBA 2AEIH 2CF8H 1A1RA 1AFQB 1MTNB 4B71A 3H5CB 2GZ8A 1YKTA 1ZSJA 1HAGE 2LPRA 3S69A 2C8YB 2R2MB 1C1NA 3E91A 1H8DH 4Y6DA 4ISIH 3OYPA 2BD3A 2YIOA 4XDEA 3ZVFA 1SGYE 1SL3A 2FDAA 1GMCF 3EYDA 4FVDA 1E0FD 2VVUA 1K28D 3BEFB 5F8TA 1O5BB 2FM2A 4HZHA 3MHWU 1GVKB 3P6ZB 2FLBH 3GDSA 2OC8A 4TWYA 3ZYEA 1NFXA 3MMGA 3SN8A 3RXMA 4AFSA 1XX9A 3Q3XA 2QY0B 1H1BA 1XKBC 5C5NA 4RKOB 5JBAS 2ODYB 1ABJH 3MU5A 4B1TA 4CBNA 1J9CH 1SGPE 4YLQH 5DP7A 1GHWH 5EXNA 5TCAA 1KDUA 1P05A 1NO9H 3K2UA 3LJJA 4MTBA 2M5TA 4ZUHA 2BVRH 1UTNA 2A2QH 4E7RG 1HKYA 2HNTF 2I6QA 1F7ZA 4Z0KA 3V13A 1ETRH 4X6NA 1E35B 1O3KA 3P8NA 4JZIA 3DD2H 3BTGE 1FY1A 1O33A 2J92A 1A3EH 3S0NA 1Y5BT 1NFWA 1TABE 3MYWA 4Q7YA 6ESTA 3LC5A 2JETC 1ETSH 3RM0H 1TPSA 1GJ8B 2BZAA 3FANA 2UUYA 1BTYA 2CN0H 3QK1A 1GI1A 1PYTD 2WPHS 4KELA 3KL6A 4JZEH 2PW8H 1SG8B 1C2EA 1VCPA 4WXVA 1TPOA 5HM2A 1NRQH 5J4SA 1VGCB 4NWLA 1Y3WA 2BD8A 2AH4X 1TOCB 1G37A 1GJ7B 4DURA 1YC0A 1NL1A 3M5NA 1NESE 2Q8BA 1AE5A 1O2XA 6LPRA 1TGCA 1G3EA 3SUEA 4Y10E 2AIPA 5EG4A 4DOQA 1QIXB 1ETTH 3TGIE 1WCZA 2H1UA 3PM3A 1QL7A 3M7TA 1N8OB 1SGNE 4JZFH 1C5NH 5A2MH 1GHAG 2QA9E 1QTFA 4BTUB 2W3KA 2Y5GA 3C1KA 3Q00A 1TNGA 1AB9C 1P3EA 1AKSA 2G5NA 2K1QA 3P17H 2FEBA 1W13U 1QNJA 1MCVA 1BB0B 1AVGH 2Z9LA 1V6DA 2ZTYA 1TGBA 8GCHF 3MH4A 4M7GA 2NU4E 4K3JA 4MNWA 3M35A 1E34B 5CHAB 4JYUH 1FZZA 1GMCG 1YPLH 2A4RA 5A8YA 5C3NA 2XWAA 2QAAA 2ZQ1A 3SUFA 4VGCB 1P0SH 3SP8A 2QF0A 3S7HB 2GV6A 1PPBH 4X8TH 4D7FA 1W0YH 1O3BA 1O2JA 2Y7XA 1G2MA 2ANKH 2ZFPH 1S81A 4B74A 1PMKA 1MBMA 1TYNA 4CH8B 2VIPA 1IQHA 3BTEE 1OP0A 3ELAH 4AGJA 4DW2U 4GSOA 2BLWA 2NU3E 1TALA 4ZHMU 4R1BA 1C5TA 1SFQB 4MNVA 2R9PA 3UWIA 5T6FA 3A8CA 1IQLA 3HKIB 3DA9B 2XCNA 3MNCA 3UWJH 8ESTE 4X2XA 1EP5A 1FPCH 1TFXA 1T8NA 5A09A 1PJPA 3SBKA 1J14A 1SLXB 2UWLA 2XTTB 3RXTA 1UCYK 2PSXA 4K1SA 1TMUH 4JZ1A 1P11E 4WVPE 1O3PB 3LU9B 2P16A 4LZ4B 1S6FA 2CHAC 1SQOA 3PB1E 3VFEA 1IQIA 2PV9B 3QZRA 1AZZA 1SLVB 3RXGA 4BTTB 4R8TB 2F9VA 4NFFA 4DIHH 2PTNA 2FESH 1EB2A 1J8AA 4QT8C 4ZKSU 1ZTJA 4I8HA 3BTKE 2FS8A 1TNHA 3FVFB 1A5IA 3ATWA 1FN6A 1O35A 1TPPA 2G55A 9ESTA 3QLPH 1AQ7A 1ELDE 1NFYA 3MO6A 4AFUA 1G3BA 4NG9H 3T62A 1F5RA 1NT1A 4O3UA 3M7QA 3TIUA 1MKXH 5FX5A 1Y5AT 1CGJE 1AO5A 2PHBA 1KRNA 1J16A 2UUJB 4H6SB 1EAUA 2ZDMA 1HRTH 5ESBA 1GVZA 1B5GH 4CRAA 1S83A 1CGIE 1GCTB 2R0KA 3ZVBA 2QXHA 1HAYB 1BRCE 1OWDA 1ARBA 1O3EA 4TPIZ 1H4WA 1NZQH 1K1MA 2VB0A 4BOHA 7ESTE 4Z0DA 1SBWA 1N1LA 4Y71A 1TPKA 1CVWH 4GAWA 4TY6A 1XUFA 1HPJA 1JRSA 1LQDB 1PQAA 1KTTB 2SGQE 3TITA 4B2BA 3VXEH 2F9UA 4A1TA 8GCHG 1K1LA 3SU1A 5DGJA 4IS5A 5L6NH 1S82A 4TPYA 2FTMA 1IQKA 4BAOB 3SGQE 3MH5A 1ELCA 4IGDA 1FNIA 1O31A 3KQBA 3GCNA 1SGRE 4X0WU 3A7TA 3SO3A 1WU1A 1HB0B 3TU7H 3EE0B 1C1WH 1GBHA 3VEQB 1AUJA 2ILNA 4ZKRU 4X8VH 1KXBA 1UJ1A 2ZA5A 1BBRE 1O5GH 1F0UA 2LL4M 3PMAB 1H9IE 1AIXH 3GY8A 4H42U 3SNAA 3O8DA 5CP9A 2ZFTA 3MFJA 2BVXH 4MPVA 3PROA 1ZTKA 4AGKA 5JBTA 4IW4E 3RU4E 2XBWA 2VNTA 1O2SA 3FAOA 2V6NA 2ZO3H 1P2OA 2KJ4A 4RKJB 4Y79A 3ZZAA 5DK1A 1Y8TA 2Z9JA 1UTKA 4GVUA 3BF6H 2WINI 3SQEE 1KXEA 1DLEA 1QFKH 1EAIA 2R0LA 1AZ8A 2A5IA 2GZ9A 3QTOH 1ANCA 1QURH 4X2YA 4UONA 2FOMB 3RXEA 1O2VA 2EI6A 2WPJS 2D1JA 1U6QA 1IQMA 3KQEA 1DWCH 3OY5U 1O3GA 1NM6A 1P10A 3SV9A 1ZZZA 2PKSC 3NK8A 2A1DB 2Z9KA 2DOIA 3A80A 4DY7B 1YCPK 3ZZ4A 1MKWH 1HBTH 5DP9A 2OQ5A 1UVPA 3MO3A 1BTPA 2BY7X 1FI8A 3KNXA 1O3CA 3QWCH 3VPKA 3LC3A 3SNDA 3MH7A 4X1QU 1V2TT 2WUCA 2Z8WA 5EGMA 2ZEBA 1O5CB 3K6YA 4AYVB 1GBDA 4U30A 3HMTA 1UTPA 1CE5A 1O3MA 2BX4A 5HGGA 3EAJA 4DIIH 1EJMA 5EQSA 3RC4A 3SHCH 2PR3A 4NWKA 1YLCA 4GCHF 3SU5A 3CENA 2SGEE 5IYTA 2BDCA 1V2NT 3FP7E 3HMRA 2P94A 1HJ8A 4I8KA 3SUGA 1RRKA 1QBVH 2CJIA 4RSPA 4Y0YE 1AU8A 3NCLA 3VGCC 5EXLA 1QB9A 4UFEH 3Q3YA 1TWXB 1TIOA 3QN7A 4FXGH 4ZXXH 1A0HB 1OP8A 4JZDH 2I9BA 2H9TH 1BZXE 1HPGA 4X1NU 1SGCA 3SRIA 4Y8XA 2G4TA 4ZKNU 3T28A 4D3CA 3SNBA 1HJAB 5HXFA 1C4U2 1O2RA 1OS8A 1URKA 1O2OA 5HMAA 6CHAB 1C5QA 1FQ3A 2VGCC 2C90B 5I46H 1VJAU 2H9HA 1SOZA 4HFPB 4B2CA 1MQ6A 2BD9A 1MTSA 2GCTC 2ODPA 4X8SH 5CE1A 3HGNA 1HXEH 1O2LA 2P8OC 3LGTA 1NL2A 1QB1A 1DX5M 4D7GA 1YF4A 1GHZA 2YIPA 1PYTC 1C9PA 3GISB 5DO4H 3ZZ6A 4BAHB 2B8OH 3TJVA 4XOJA 1SQAA 1WTGH 5ESTE 1YM0A 3SGBE 4ZROA 3L6PA 1AMHA 1B0EA 2Y5HA 1I71A 1LKBA 1ZHPA 3GY6A 3LPRA 4BAQB 1THRH 2P95A 4IMQA 4ABHA 2QYIA 3ZVEA 2AMPA 1GGDB 1GL1A 1TLDA 2BB4A 1Z71A 4R1CA 4AB9A 3A85A 5DP3A 1S0QA 3EA7A 1FN8A 1YPGH 3ENSB 5DG6A 3LGIA 2D26C 4Z6AH 5JB8S 1A0HA 2CV3A 1NRSH 1O38A 2UUFB 2ZDVH 4I8LA 1BRBE 5L30H 3BIUH 4MPWA 1OYQA 1ZMLA 3H7OA 1TA2A 4XBCA 2ZNKH 1P57B 4JYVH 1Z8GA 3VB5A 1P2NA 4XFQA 1W3CA 4OS7A 1IQFA 2BY9X 2WPMS 2ZCHP 1F0TA 2FOFA 3T5FH 3BG8A 1QL9A 3EA9A 2BQ7B 1C2LA 4CIKA 1B7XB 3NPSA 2Y82A 3GYLB 4GCHG 1GG6C 3RXLA 1O2QA 3MU4A 1HAZB 2GMTC 4K1EA 1FUJA 1UTQA 1C5OH 3DHKH 3RXIA 2A5AA 3M5MA 2QXGA 4BV7A 1ZSLA 3RXQA 1BTZA 1IQNA 2H6MA 1LQEA 4YM9A 3M37A 4OGXA 2ZGCA 3GCHC 2JH6D 4OS5A 2ZFQH 1AFQC 2LNCA 3UREA 1GMNA 1T8LA 3OSYA 1YLDA 1LKAA 5ETXA 5EW1H 4K2YA 4CRDA 5GXPA 5HM9A 1TONA 1KI0A 4YOJA 1MBQA 4YESB 4YOGA 1BJVA 2AGGX 3ZVCA 1CEAA 1O3HA 1RTFB 1DPOA 2BY8X 1LVMA 3TJUA 3D62A 1RIWB 1LO6A 1JIRA 2ZCKP 1V2LT 3RXKA 1H9HE 1CSOE 2BD2A 3BTTE 1V2WT 2AIQA 1GVLA 1V2RT 2Z3DA 2IOTA 1JBUH 2XNIA 4X6OA 3E90B 5L2ZH 1JOUB 1FPHH 1OWJA 1VJ9U 3I29A 2C8WB 5B6OA 1K21H 7GCHF 1GHAF 1GBIA 1BDAA 4UDWH 1MD8A 1DWDH 2STAE 2BVSH 1SHHB 3WY8A 2ZU3A 3GDVA 3SV8A 2GGVB 3SW2B 3BG4C 4SGBE 1C5YB 1P2QA 1O2HA 3P95A 5AFZH 2QIQA 1K1PA 4WXIA 4E7NA 1C5LH 1BQYA 1ESBA 1PQ5A 2VVCA 5DP5A 1YCPH 2BZ6H 4UAOA 2QXJA 3N7OA 1K22H 3STJA 1W11U 4K69A 1EJAA 1NTPA 1ZRBA 1GHYH 2ZKSA 2P3TB 5EPNA 2ZZUH 2G52A 1EATA 5F8ZA 5F6MA 1CA0B 1AHTH 3SNEA 5FXLA 1ESTA 1SLWB 4FUHA 1BBRK 2JH0D 2HOBA 3NXPA 1QCPA 2QN5T 3MU0A 1O2GH 1A5GH 3B8JA 1QHRB 4WMDA 1DSUA 2Q6DA 1VGCC 2PUQH 1IAUA 2HGTH 1YPEH 3T29A 5C5OA 2EI7A 3VB6A 2BD4A 3F9FA 1XM1A 2ESTE 3RXHA 3Q3KA 1GHVH 4LZ1H 1F92A 5E2OA 1W12U 1GBKA 5FCKA 3GCOA 2ZC9H 1ANBA 4I8GA 4J2YB 4FUGA 3EQ0H 1NFUA 1C1OA 1HFDA 3ZLEA 1C2DA 1EB1H 1V2ST 1QBNA 4NSVA 3SV7A 1F5KU 4YT7H 1XKAC 1L0ZA 1THSH 4IN1A 1C5MD 3A7XA 4APMA 5C1UA 2FX4A 2DUCA 4PROA 1QRZA 2B5TB 4D9RA 1CT2E 5BRRE 3PTNA 4BANB 3UR9A 3P70B 7LPRA 1LCYA 1NRNH 1S85A 2UWOA 2YNBA 3RXAA 1DWBH 3MU8A 4MPUA 2XW9A 4B75A 1BMAA 3UR6A 4CH2B 2FXRA 1ZYOA 2Z7FE 5A8XA 1Z40A 1D6WA 2ZGXH 5CS1A 3K9XB 1HJ9A 1Z6JH 4Z0EA 4WH8A 1O2MA 2ODQA 2TGTA 2GVFA 3UQOA 1ZOMA 2XCFA 1ZRKA 3PV4A 5LPRA 2F83A 3SU6A 2FX6A 1IOEA 4VGCC 1KTSB 3FZZA 4NIYA 3SU0A 5SGAE 1HLTH 7GCHG 1O3IA 1GBJA 5C67A 2ZHEH 4ESTE 1A5HA 2ANWA 1HDTH 2KAIB 2FOAA 2HWLB 4ISLA 2WV4A 2YOLA 2THFB 1HUTH 4KGAA 2UUKB 1W7GH 5TJXA 1GP9A 2OC1A 1VR1H 2QF3A 2ZTXA 2SNVA 2CXVA 4FU8A 1MTWA 2JETB 3UQVA 2CF9H 3HK6B 2O8LA 4X8UH 4AOQA 3A88A 1O3JA 4XBBA 2H5DA 3KN2A 4AN7A 1QJ7B 1C1PA 2GDEH 3HGPA 1Y3VA 3IWMA 2AYWA 1O5EH 2Z3EA 4ZMAH 2ZHWH 3LGWA 4LK4A 2QGRA 1AVWA 1D3QB 3D49H 3A87A 1E38B 2H2ZA 3ZVDA 1RD3B 4Y0ZE 4CHAB 1O3OA 2PF1A 3KIDU 1AWFH 3UPEA 4K8BA 1Q2WA 2C4FH 2A5KA 1SLUB 3LIWA 2BDBA 3QUMP 5JBBS 2BHGA 1P06A 1ZSKA 1ZPCA 2JH5D 5E0JA 3SJKA 2ZHQH 1P04A 1W81A 1UTOA 2OD3B 5C20A 2NWNA 1Y3YA 2H5CA 3LONA 5AHGH 5CT3A 4FUBA 4AFZA 3CP7A 1W0ZU 2XBYA 4NA8A 1C1SA 1W7XH 1PMLA 5FBIA 2ZPRA 5FAHA 2ZFSA 1AB9B 1AN1E 3GOVB 1EAXA 1GCTC 3GDUA 2KAIA 5F8XA 1SB1H 2G4UA 1RJXB 2TRMA 1DVAH 1C2FA 1HAXB 1QL8A 1O3LA 3PMBB 1GJBB 5CT2A 5H4IB 4R1AA 2OBQA 1BTXA 4Q80A 2ZHDA 1Z8IB 2W3IA 2H9EH 4BVCA 1IHSH 1OSSA 3MWIU 1C9TA 1O3AA 1T31A 2FYRA 2VWOA 2BM2A 1DOJA 2VIQA 3D65E 1NRRH 1G36A 2K4RA 4JCNA 1JIMA 2Y7ZA 3GY7A 2FP7B 3E1XB 3LH3A 2ZPSA 3VXFH 3ZWZA 2VIVA 2SGAA 3RXVA 4Y76A 1V2VT 1C5UA 1F0SA 1UK3A 1RTKA 2O8WA 4I32A 1JRTA 1HYLA 2BD5A 1RGQA 3OU0A 2IN2A 4AORA 2PFEA 1ZJKA 1Y3XA 2FOGA 2WYJA 3TH3H 1TX6A 2ZCLP 4U2WA 3RXRA 5A0BA 1BHXF 1V2UT 4FUJA 1GJ6A 5C1XA 3UTUH 4Q7XA 5DP4A 4ABAA 3GYMA 1KYNA 2P93A 2P3FH 3A8BA 4ZKOU 1Z7KA 1F0RA 1D3PB 1GBFA 1O34A 2WUBA 4ABGA 1O3DA 1V2OT 2FS9A 5FBEA 2A7JA 5TCCA 3EGKH 4I8JA 1YGCH 1TRMA 4Y11E 1RXPA 4WH6A 1ELVA 1WUNH 1L4DA 1L4ZA 3HK3B 2R3YA 1DICA 1DFPA 3ZVGA 3S9AA 4E06H 3MO9A 2XYAA 1QA7A 2ZQ2A 1QB6A 1Y59T 5G4BA 1GDNA 2OC0A 2A0QB 2G5VA 3TGKE 1MU6B 4OS2A 2R3UA 3A84A 2F91A 2VH0A 4WJG2 1ZMJA 1L1JA 2ZDAH 1GI4A 1LTOA 2BQ6B 3B9FH 2DE8A 1PFXC 1WQSA 2PUXB 4BTIB 3M61U 1BOQA 3ATIA 9LPRA 2BDGA 2DOHX 1PPHE 4NGAH 1FY8E 2PGBB 4GHQA 4AYYB 2J8LA 5J4QA 2F9BH 2XRCA 1TBZH 1V2QT 1MTUA 4I33A 1V3XA 1SGFA 2R2WU 3E0NB 1Z1JA 1GBBA 1TQ0B 5ABWA 1CBWC 2FD6A 4XE4A 2PGQB 4A1VA 2OXSA 3LAQA 1MMJN 1C2MA 1O2KA 4CRGA 2Z9IA 4D9QA 3FZDA 5E0HA 2G00A 1O3FA 1LHCH 3FP6E 4ZXYH 1JWTA 3S7KB 4H4FA 2BY5X 3ZV9A 2TPIZ 1TRYA 1EZXC 1GJ9B 1K2I1 1ORFA 1S0RA 1SOTA 2BDIA 1TMTH 4MNYA 4I7YH 2ZGHA 5DP8A 2TBSA 5CS3A 4JK6A 1YXEA 1TNIA 1KLIH 2VIDA 5DP6A 3RC6A 1HJAC 1P12E 4A6LA 5EODA 5COEA 3PO1C 1BMMH 4DGJA 1CQQA 3V7TA 1H9LB 6CHAC 4ASHA 1P01A 1F5LA 1XUIA 2ANYA 4F4OC 2BDAA 4UFDH 2PTCE 4YO9A 4K8YA 1EXFA 2HPQP 4NSYA 1HAIH 4HI3A 3SJOA 5LGOA 2VJ1A 1Z1IA 2O8MA 1UVOA 2BD7A 1QJ6B 1EZSC 3I78A 1HV7A 1BMNH 1Z8JB 2QV1A 3SV2H 1G3DA 2X2ZA 5HYOA 1LPKB 1DWEH 1UTMA 3U98H 2J9NA 1KIGH 1TGSZ 2W7SA 2PLXA 4NZQA 3HPTB 5DJ7A 7KMEH 4WF8A 5GWZA 4MLFB 2SGDE 3LGVA 2ZU5A 1AWHB 3HN4A 2PKSB 1ZPZA 4IUAA 2HPQH 3U73A 5E0GA 3SI3H 1GPZA 3QTVH 4ZH8A 1C2GA 5EW2H 1W2KH 1WSSH 3A81A 2OTVA 1GGDC 5A8ZA 4K5ZA 1CT0E 1WTHD 4BXSA 2A31A 1SSXA 3U1JB 1W8KA 1QR3E 1CHOF 1MD7A 1W10U 3A82A 3UIRA 1EZQA 4X1PU 3HMSA 1UCYH 1C5WB 3ZZ3A 2EC9H 4A92A 1G30B 3PMHB 4HTCH 3E6PL 4BXWA 1AFEH 2ZWLH 1IQJA 4H6TA 1Y5UT 3RMMH 2RG3A 1CHGA 4YT6H 4Z09A 3TH2H 1A2CH 3BIVH 2ZFFH 1O2ZA 3MU1A 1GHBF 1GJAB 2F9OA 1WBGB 1XUHA 3SUDA 1TNKA 4K1TA 1BRAA 3RMNH 3T2NA 1TNJA 1NPMA 4UFGH 4Y7AA 3QDZB 3QGNB 5L2YH 3K65B 4NA9H 1VCQA 1NROH 2P59A 1C5VA 4BVWA 3MNBA 2FODA 3ITIA 2NU2E 1OWIA 5BPEA 1IQEA 3V3MA 2J8JA 3MNXA 2AS9A 1XXDA 4X1SU 1QQUA 4O97A 2TGPZ 3CS0A 1ZLRA 1QRXA 4DG4A 2ZU2A 4NZLA 3RP2A 2NU0E 3K6ZA 2XBVA 3SOSA 1AVXA 1LHFH 1RTLA 2BOHB 2BLOA 2SFAA 1SFIA 1TAWA 1DS2E 2Z3CA 1OYTH 3MTYA 2VGCB 2OC7A 1TBRH 3OTJE 1GL0E 2GP9B 1AD8H 2V35A 1T8MA 2PKAB 2GCTB 3RMLH 1DUEA 3ZZ7A 4Q7ZA 3Q76A 1DY8A 1GJDB 4FUIA 3W94A 2FZZA 3UOPA 4TY7A 1G32B 6GCHG 3SNCA 5T3HA 3BN9A 1EX3A 1RIWC 1DXPA 1N6XA 3BSQA 1GJCB 2CGAA 1PK4A 4I31A 3GY3A 1N6YA 1YP9A 1C1VH 3QX5H 4MDSA 2VU8E 2WPIS 1LPGB 3GICB 3R0FA 5CSQA 1H8IH 4ABBA 1P2KA 3QZQA 5GCHG 4AG2A 1CT4E 1O0DH 2O8TA 1O2NA 3K65A 2ZDNA 4J1YA 1MTNC 3SV6A 1A0LA 3L3TA 5EQQA 2F3CE 1FY5A 2FO9A 4HGCA 1JMOH 3F68H 4FUFA 1DSTA 1GBLA 3RMOH 1BTUA 4UD9H 1EP6A 1MUEB 3P8OA 5E8EH 1GI9B 3M5LA 1A7SA 1CHOG 2KNFA 3BTDE 5DPAA 1DITH 3KEEA 3VB7A 1HNEE 1TMBH 2Q6FA 1A46H 4JK5A 3ZZBA 1W8BH 3A8AA 1Z8RA 1C5ZB 3RU4T 4CREA 1CA0C 3BEUA 3RXUA 2J34A 2RA0A 3A86A 4GHTA 1OPHB 2FYQA 4GPGA 2G51A 5K0HA 1OP2A 1ZJDA 3ODDA 1ZMNA 5AF9H 2PKAA 1UK4A 4K60A 5GIBA 1F2SE 1GHBG 2Q6GA 3AAUA 1PPEE 1LHGH 1JXPA 2O9QA 1O2PA 2DE9A 1A61H 2FOBA 1NK1A 2VWNA 2ULLA 4ABEA 1XXFA 2Y6TA 1MKXK 1W14U 2GMTB 1ELEE 3LKWA 4WWYA 1EAWA 1A4WH 1MH0A 2HGFA 2ZGBH 4X6PA 1DLKB 4Y8YA 4AB8A 2RDLA 5CT1A 1CU1A 1ARCA 3A7WA 1CEBA 1D9IA 4AZ2B 3GY2A 1HGTH 1EPTB 2A4QA 5HPGA 2YILA 2G8TA 1PPCE 1TGTA 2GCHG 1OWKA 2GT7A 4CR9A 1BUIA 3SJ8A 1SGDE 1ELAA 1I5KA 3BTFE 3TPIZ 3KF2A 1FXYA 1KXCA 1L1NA 4ABDA 1HAPH 2FEQH 2GV7A 3VB3A 1O5AB 2FI4E 4IC5A 2W26A 3T27A 3SRJA 5CMXH 2VIWA 1HAHH 2XBXA 1FIWA 4ABJA 1ELBA 4FU9A 3U1IB 2OLGA 4NIXA 3S9CA 1LPZB 2Z94A 1SHYA 2FI3E 4O9VA 4IMZA 1KSNA 3F6UH 2BQWB 3UNQA 1N8OC 3A83A 3M3SA 1DANH 1MAXA 2IPHA 1C4Y2 1AKSB 3G01A 1ANDA 3BG4B 2FOEA 4B2AA 1GI3A 4OS1A 1JFNA 1C1MA 3HKJB 4WMEA 2WPLS 2ALPA 5C2ZA 1NS3A 3JZ2B 1ABIH 1SI5H 3ZZ9A 3LDXH 3M7UA 4NA7A 4BV5A 1ZHRA 3BTHE 3MH6A 1O36A 2A4OA 3E6PH 1D3TB 2OUAA 2WYGA 4D76A 5CHAC 2Q8AA 2FLRH 1EPTA 2C93B 2EA3A 1GI6A 1T4VH 2ZP0H 5JPMH 4ZAEA 4DCDA 3NWUA 2EEKA 1YYY1 2QCYA 3O8CA 2W7UA 1HAOH 1TOMH 2ZPQA 4MPXA 3AAVA 2HPPP 1TGNA 2C8XB 2VVVA 2BOKA 3BTWE 5JDUB 1SQTA 2PSYA 4FVBA 4CR5A 4CHAC 1NN6A 1SR5C 4MVNA 1PPGE 1WAYB 2GKVE 2XC5A 1BRUP 2BLVA 4NIVA 5EOKA 3V0XA 1ANEA 1NC6A 1HCGA 3TNSA 5JBCS 2J4IA 3SU3A 2ZFRH 4BAMB 1FJSA 1EOLA 1SGTA 1PQ8A 4MG3A 1XVOA 1C1QA 1PPZA 1MKWK 3PYHA 1GMOA 4FU7A 1GHXH 1QBOA 5A0CA 2HPPH 1LHEH 3M3TA 3A7VA 2K51A 3AASA 2FWWA 5E2PA 2O8UA 5EXMA 3TLOA 1CGHA 2HNTE 4X6MA 1GMHF 1AGJA 2BXTH 1FMGA 2QJ2A 3GY4A 2HVXA 1B2IA 1MAYA 1EQ9A 3NUMA 3RDZA 1BTWA 4CBOA 2J38A 3T26A 2P3UB 2ZHFH 5PTPA 4R0IA 1O39A 1SGEE 1KXFA 2V0BA 4A5TS 4A1XA 5LPEA 2F9NA 2ZDKA 1K1IA 3OX7U 3P8FA 3KQDA 3UOUA 4DJZB 2J94A 1HIAB 1K1JA 3BTME 1BT7A 4ISNA 1C4V2 4Q2KA 2Y80A 3RXBA 1TX8A 4BNRA 2GTBA 2TIOA 3PTBA 2AFQB 2TGDA 4B73A 1D4PB 2PK4A 3AVZA 4CRCA 5F03A 1GBAA 1C1RA 4E05H 2GD4B 1BJUA 3PLKA 2HNTC 3ZZCA 1ZTLA 5FPSA 1BMLA 4ZHAA 1EJNA 3SJIA 4F49A 4JMYA 4RN6A 3TGJE 1QQ4A 5EQRA 1QY6A 2V3OH 2VINA 2W5EA 2TGAA 1SPJA 3UNRA 2OCVB 3KGPA 1A0JA 1AY6H 4ISOA 3ZV8A 2Y5FA 1TPAE 4KIVA 2QJ4A 2BYAX 1YPKH 4R19A 3BT1A 1WQVH 3NKKA 2BX3A
chains in the Genus database with same CATH superfamily
1SGFG 2ZDLA 3RXDA 1PKRA 4U01A 3SU2A 1FY4A 3VB4A 1YPJH 2RFKC 1Q3XA 1OXGA 2KZ4A 4TWWA 5LH8A 4APLA 4YLUA 2WHXA 1GJ4H 1T8OA 2XWBI 3URCA 2ZU1A 1P8VC 2AMQA 2HRVA 3KHVA 1XVMA 2J2UA 3ATLA 4KTUA 1SGQE 3MOCA 1O32A 2GX4A 3ZZDA 2B0FA 1OOKB 4IN2A 3GCTF 2VIOA 1HIAA 4LOYH 1YWUA 1S5SA 2A7HA 2QXIA 1B0FA 5GJ4B 2JDID 3DT0H 3E0PB 4CRFA 4Z0FA 1O2TA 1XMNB 1GI7B 2ZGJA 1KY9A 1FAXA 1YBWA 1HAVB 5CHBA 4UEHH 1ZGIA 4A7IB 4X1RU 1O2IA 2FI5E 1ZGVA 1TE0A 4BAKB 3UY9A 1E36B 1T4UH 2CHAB 4ABFA 2ZU4A 4KTCA 1UVTH 1T32A 3LH1A 3RXPA 1TNLA 2Q1JA 1J17T 3TK5A 2A32A 1O30A 1GMHG 1NU9A 3V12A 3C27B 1OWHA 1GDUA 1UMAH 1QGFA 2HALA 3BEIB 5DKMA 1LDTT 3RLWH 2B7DH 1BBRH 1GBTA 4ZHLU 4MQAA 3LJOA 1VITF 2STBE 1LHDH 2F9PA 4INLA 1L1GA 3F9EA 1GI2A 1GMDF 2FOCA 3M5OA 2WV5A 5FX6A 1DXWA 2I6SA 5JYIA 2FTLE 4TSFD 1YCPM 5I25A 1S6LA 1MTVA 5C1YA 1P9SA 1MCTA 1UHBB 4KKDA 2C3SA 3PMJA 1LVBA 5C17A 5IDKA 3SZNA 1DE7H 2IJOB 1FY3A 2I9AA 3DFLA 1BCUH 1C2JA 3DUXH 4ACBA 5CS5A 1BHTA 3KIVA 1FIZA 5T1VA 4AC9A 1O5DH 2Z6BD 8KME2 1Z6EA 2AMDA 3NZIA 2L0SA 1C2KA 1CA8B 3ZZ5A 1RS0A 2HLCA 1O3NA 3UNSA 3RXCA 1RFNA 4XSKU 4FUEA 3FO8D 3BTQE 1ZR0A 1UTLM 3P8GA 3RUOA 3MQKC 1OKXA 5FPTA 3SORA 5KECA 2BMGB 3B23B 1FONA 3JZ1B 3URDA 1PPFE 2GDDA 1HAVA 1C1TA 1FAKH 2OQUA 3UFAA 1C1UH 1K1OA 3GY5A 1UTJA 1O2YA 3PWBA 4LXBH 3SQHE 4OM9A 1L2EA 1VITH 2Y81A 4Y8ZA 1O5FH 2ALVA 1P3CA 2QC2A 5GDSH 1BITA 1KLTA 3IG6B 8LPRA 3DFJA 1G2LA 2YNAA 1TA6A 1OWEA 1THPB 4SGAE 3R3GB 2Y8RA 3RXOA 1TX7A 4X2WA 1YPHE 3ESTA 4GLYA 5A0AE 1IQGA 1K1NA 5DSFA 3SHAH 3TJOA 2GT8A 2BTCE 4X2VA 4ISHH 2A2XH 3F9HA 1V2MT 4OS6A 2SGPE 4Y7BA 2PF2A 2LL3A 4AFQA 3GCTG 3PWCA 1P09A 1MZAA 1V2KT 4KTSA 3E8LA 1G3CA 3IITA 5AVDA 1UHBA 3Q77A 3ZVAA 4DVAU 1BIOA 3TK6A 2BXUH 4FETA 2CMYA 4U32A 3W95A 2NU1E 2A45B 4B76A 5EU8A 1C5PA 6GCHF 3F9GA 4GUXA 1D6RA 1ESAA 4YZUA 1UK2A 1OHHD 2G81E 1ZHMA 1T7CA 1BTHH 1YPHC 1EASA 2BDYA 1PQ7A 1GI8B 1NBMD 3ZZ8A 3D23A 4NFEA 3GS9A 3RC5A 3E16B 1CBWB 1YPMH 5FHTA 2OBOA 2AERH 3ATMA 3A7YA 2QF4A 1CO7E 2XXLA 1ELFA 2XC0A 1D3DB 3O8RA 3RXSA 1VITG 2OINA 2BDHA 1MU8B 1GI0A 4O03A 5GCHF 1WOFA 1GMDG 1NY22 1EZUC 1KLJH 1KDQB 5EJZA 1IHTH 1SMFE 2GJGA 1J15A 2BY6X 1S6HA 3OY6U 1UVSH 4UE7H 3KCGH 1XUGA 2V3HH 4INKA 1AE8H 1BHXB 1TBQH 2JKHA 2UWPA 3SI4H 2C8ZB 3FFGA 1GI5A 4INHA 1SVPA 2FIRH 1KIVA 2Z8VA 3S9BA 4AX9H 4NIWA 2GZ7A 1DM4B 3PO1B 4ABIA 1QA0A 3KQ5A 1E1QD 3LGUA 1P2IA 2Z9GA 2D2DA 2HVYB 1KMHB 2FMJA 3ZYDA 1INCA 1KXDA 1ELTA 2WPKS 3P92A 1P03A 4XBDA 2J5UA 3TH4H 3BV9B 1WYKA 3PLBA 3BT2A 4WMFA 3U8RH 1X7AC 1EUFA 2ZECA 1SGIB 1DDJA 1SC8U 2B9LA 2AGIX 3A7ZA 1UCYE 3VGCB 1ZPBA 2SNWA 2RCEA 2FPZA 1GCDA 2ASUB 2ZG0H 3HATH 1P2JA 1EKBB 3AW1A 1E37B 3STIA 5GPIB 1C5SA 4JYTA 1C5RA 1O2WA 2D8WA 3M3VA 3TJNA 2ANMH 1AUTC 4THNH 1FX0B 2GCHF 3A89A 3SGAE 5JB9S 1KDQA 1Y3UA 1XUKA 3A8DA 1DT2A 1Q31A 3TK9A 3KQCA 1TRNA 1GBEA 1GBCA 1PK2A 1C2IA 3UAIC 2SPTA 2A4GA 1I8NA 1GJ5H 2P8OB 3FP8E 3UB0A 1FLEE 3T25A 1A3BH 3I77A 1WV7H 5FCRA 4YTAA 3U9AH 1DUAA 1K9OE 3QGJA 1V2PT 4FUDA 2RA3A 1QRWA 4KP0A 1FDPA 3E3TA 3TVJB 5FPYA 3LOXA 2ZI2H 1O37A 1ID5H 2EI8A 4MNXA 4O3TA 3EA8A 1FV9A 2K13X 3RLYH 1KXAA 1GBMA 1P2MA 3H7TA 1M9UA 1LMWB 1P02A 4FUCA 3RM2H 5CS9A 1ACBE 2ZF0H 4OS4A 4TYDA 1NRPH 2VWMA 2VH6A 4OGYA 2AGEX 3EDXB 2ZIQH 1OX1A 3LGYA 3L33A 1MQ5A 2KR7A 4NCYA 3UUZA 2KCOA 4AG1A 3LT3A 3PLPA 1P9UA 3M36A 1GWAA 5HIYA 3U69H 1LVOA 3O8BA 4DT7B 2VBCA 3MNSA 1G9IE 2F4LA 1C5XB 2OP9A 1TQ7B 1VZQH 3RXFA 2VWLA 3ATKA 5C94A 1EPTC 2SGFE 2FOHA 1C2HA 2J95A 3F1SB 4IBLH 5AFYH 2PWXA 3U8OH 1VCWA 3CS7A 5T6DA 2XC4A 4BVVA 2A7CA 4WY3A 1HPKA 4B6EA 3MI4A 1MZDA 4BVDA 3QO6A 2XNDD 5LPFA 3SJ9A 1AI8H 1GDQA 4D8NA 3ODFA 1ELGA 1EOJA 3U8TH 3TNTA 1GG6B 4YIVA 1S84A 5T6GA 1QJ1B 5K7RA 1O2UA 4YOIA 4UV6A 3MKPA 2ZTZA 1TB6H 1UO6A 2YMSB 4ACAA 5EPYA 3RU4D 1BA8B 2BLQA 4IC6A 1NU7B 1LVYA 1HXFH 4UFFH 3RXJA 1UVUH 1DY9A 3SU4A 1V2JT 3GCHB 1XUJA 3AW0A 4CRBA 2AEIH 2CF8H 1A1RA 1AFQB 1MTNB 4B71A 3H5CB 2GZ8A 1YKTA 1ZSJA 1HAGE 2LPRA 3S69A 2C8YB 2R2MB 1C1NA 3E91A 1H8DH 5C0TA 1VKYA 4Y6DA 4ISIH 3OYPA 2BD3A 2YIOA 4XDEA 3ZVFA 1SGYE 1SL3A 2FDAA 1GMCF 3EYDA 4FVDA 1E0FD 2VVUA 1K28D 3BEFB 5F8TA 1O5BB 2FM2A 4HZHA 3MHWU 1GVKB 3P6ZB 2FLBH 3GDSA 2OC8A 4TWYA 3ZYEA 3OFND 1NFXA 3MMGA 3SN8A 3RXMA 4AFSA 1XX9A 3Q3XA 2QY0B 1H1BA 1XKBC 5C5NA 4RKOB 5JBAS 2ODYB 1ABJH 4HG6A 3MU5A 4B1TA 4CBNA 1J9CH 3VG8A 1SGPE 4YLQH 5DP7A 1GHWH 5EXNA 5TCAA 1KDUA 1P05A 1NO9H 3K2UA 3LJJA 4MTBA 2M5TA 4ZUHA 2BVRH 1UTNA 2A2QH 4E7RG 1HKYA 2HNTF 2I6QA 1F7ZA 4Z0KA 3V13A 1ETRH 4X6NA 1E35B 1O3KA 3P8NA 4JZIA 3DD2H 3BTGE 1FY1A 1O33A 2J92A 1A3EH 3S0NA 1Y5BT 1NFWA 1TABE 3MYWA 4Q7YA 2PP6A 5FL7D 3LC5A 6ESTA 2JETC 1ETSH 3RM0H 2LELA 1TPSA 1GJ8B 2BZAA 3FANA 2UUYA 1BTYA 2CN0H 3QK1A 1GI1A 1PYTD 2WPHS 4KELA 3KL6A 4JZEH 2PW8H 1SG8B 5EJLA 1C2EA 1VCPA 4WXVA 1TPOA 5HM2A 1NRQH 5J4SA 1VGCB 4NWLA 1Y3WA 2BD8A 2AH4X 1TOCB 1G37A 1GJ7B 4DURA 1YC0A 1NL1A 3M5NA 1NESE 2Q8BA 1AE5A 1O2XA 6LPRA 1TGCA 2KFWA 1G3EA 3SUEA 4Y10E 2AIPA 5EG4A 4DOQA 1QIXB 1ETTH 3TGIE 1WCZA 2H1UA 3PM3A 1QL7A 3M7TA 1N8OB 1SGNE 4JZFH 1C5NH 1NBME 5A2MH 1GHAG 2QA9E 1QTFA 4BTUB 2W3KA 2Y5GA 3F0OA 3C1KA 3Q00A 1TNGA 1AB9C 1P3EA 1AKSA 2G5NA 2K1QA 3P17H 2FEBA 1W13U 1QNJA 2HLDD 1MCVA 5CDFE 1BB0B 1AVGH 2Z9LA 1V6DA 2ZTYA 1TGBA 8GCHF 3MH4A 4M7GA 2NU4E 4K3JA 4MNWA 3M35A 1E34B 5CHAB 4YIZA 4JYUH 1FZZA 1GMCG 1YPLH 2A4RA 5A8YA 5C3NA 2XWAA 2QAAA 2ZQ1A 3SUFA 4VGCB 1P0SH 3SP8A 2QF0A 3S7HB 2GV6A 1PPBH 4X8TH 4D7FA 1W0YH 1O3BA 1O2JA 2Y7XA 1G2MA 2ANKH 2YMSD 2ZFPH 5DN6D 1S81A 4B74A 1PMKA 1MBMA 1TYNA 4CH8B 2VIPA 1IQHA 3BTEE 1OP0A 3ELAH 4AGJA 4Z1MD 4DW2U 4GSOA 2BLWA 2NU3E 1TALA 4ZHMU 4R1BA 1C5TA 1SFQB 4MNVA 2R9PA 3UWIA 4Q4LA 5T6FA 3A8CA 1IQLA 3HKIB 3DA9B 2F43B 2XCNA 3MNCA 3UWJH 8ESTE 4X2XA 1EP5A 1FPCH 1TFXA 1T8NA 5A09A 1PJPA 3SBKA 1J14A 1SLXB 2UWLA 2XTTB 3RXTA 1UCYK 2PSXA 4K1SA 1TMUH 4JZ1A 1P11E 4WVPE 1O3PB 3LU9B 2P16A 4LZ4B 1SQRA 1S6FA 2CHAC 1SQOA 3PB1E 2KCPA 3VFEA 1IQIA 2PV9B 3QZRA 1AZZA 2WZQA 1SLVB 3RXGA 2JJ1D 4BTTB 4R8TB 2F9VA 4NFFA 4DIHH 2PTNA 2FESH 1EB2A 1J8AA 4QT8C 4ZKSU 1ZTJA 4I8HA 3BTKE 2FS8A 1TNHA 3FVFB 2XOKD 1A5IA 3ATWA 1FN6A 1O35A 1TPPA 2G55A 9ESTA 3QLPH 1AQ7A 1ELDE 1NFYA 5F53A 3MO6A 4AFUA 1G3BA 4NG9H 3T62A 1F5RA 1NT1A 4O3UA 3M7QA 3TIUA 1MKXH 5FX5A 1Y5AT 1CGJE 1AO5A 2PHBA 1KRNA 1J16A 2UUJB 4H6SB 1EAUA 2ZDMA 1HRTH 2RDEA 5ESBA 1GVZA 1UW7A 1B5GH 4CRAA 1S83A 1CGIE 1GCTB 2R0KA 3ZVBA 2QXHA 1HAYB 5C0UA 1BRCE 2KCYA 1OWDA 1ARBA 1O3EA 4TPIZ 1H4WA 1NZQH 1K1MA 2VB0A 4BOHA 7ESTE 4Z0DA 1SBWA 1N1LA 4Y71A 1TPKA 1CVWH 4GAWA 4TY6A 1XUFA 1HPJA 1JRSA 1LQDB 1PQAA 1KTTB 2SGQE 3TITA 4B2BA 3VXEH 2F9UA 4A1TA 8GCHG 3DSOA 1K1LA 3SU1A 5DGJA 4IS5A 5L6NH 1S82A 4TPYA 2FTMA 1IQKA 4BAOB 3SGQE 3MH5A 1ELCA 4IGDA 1FNIA 1O31A 2IJD1 3KQBA 3GCNA 1SGRE 4X0WU 3A7TA 3SO3A 1WU1A 1HB0B 3TU7H 3EE0B 1C1WH 1GBHA 3VEQB 1AUJA 2ILNA 4ZKRU 4X8VH 2CK3D 3KYGA 1KXBA 1UJ1A 2ZA5A 1BBRE 1O5GH 1F0UA 2LL4M 3PMAB 1H9IE 1AIXH 3GY8A 4H42U 3SNAA 3O8DA 5CP9A 2ZFTA 3MFJA 2BVXH 4MPVA 3OAAD 3PROA 1ZTKA 4AGKA 5JBTA 4IW4E 3RU4E 2XBWA 2VNTA 1O2SA 3FAOA 3N99A 2V6NA 2ZO3H 1P2OA 2KJ4A 4RKJB 4Y79A 3ZZAA 5DK1A 1Y8TA 2Z9JA 4RI0A 1UTKA 4GVUA 3BF6H 2WINI 3SQEE 1KXEA 1DLEA 1QFKH 1EAIA 2R0LA 1AZ8A 2A5IA 2GZ9A 3QTOH 1ANCA 1QURH 4X2YA 4UONA 1YY3A 2FOMB 3RXEA 1O2VA 2EI6A 2WPJS 2D1JA 1U6QA 1IQMA 3KQEA 1DWCH 3NRLA 3OY5U 1O3GA 1NM6A 1P10A 3SV9A 1ZZZA 2PKSC 3NK8A 2A1DB 2Z9KA 2DOIA 3A80A 4DY7B 1YCPK 3ZZ4A 1MKWH 1HBTH 5DP9A 2OQ5A 1UVPA 3MO3A 1BTPA 2BY7X 1FI8A 3KNXA 1O3CA 3QWCH 2J97A 3LC3A 3VPKA 3SNDA 3MH7A 4X1QU 1V2TT 2WUCA 2Z8WA 5EGMA 2ZEBA 3WWFA 1O5CB 3K6YA 4AYVB 1GBDA 4U30A 3HMTA 1UTPA 1CE5A 1O3MA 2BX4A 5HGGA 3EAJA 4DIIH 1EJMA 5EQSA 3RC4A 3SHCH 2PR3A 4NWKA 1YLCA 4GCHF 3SU5A 3CENA 2SGEE 5IK2D 5IYTA 2BDCA 1V2NT 3FP7E 3HMRA 2P94A 5EIYA 1HJ8A 4I8KA 3SUGA 1RRKA 1QBVH 2CJIA 4RSPA 4Y0YE 1AU8A 3NCLA 3VGCC 3PRDA 5EXLA 1QB9A 3F2HA 2WV9A 4UFEH 3Q3YA 1TWXB 1TIOA 3QN7A 4FXGH 4ZXXH 1A0HB 1OP8A 4JZDH 2I9BA 2H9TH 1BZXE 1HPGA 4X1NU 1SGCA 3SRIA 4Y8XA 2G4TA 4ZKNU 3T28A 4D3CA 3SNBA 1HJAB 5HXFA 3PRBA 1C4U2 1O2RA 1OS8A 3SZEA 1O2OA 2LP6A 1URKA 5HMAA 5EJ1A 6CHAB 1C5QA 1FQ3A 2VGCC 2C90B 5I46H 1VJAU 2H9HA 1SOZA 4HFPB 4B2CA 1MQ6A 2BD9A 1MTSA 2GCTC 2ODPA 3N7DA 4X8SH 5CE1A 3HGNA 1HXEH 1O2LA 2P8OC 3LGTA 1NL2A 1QB1A 1DX5M 4D7GA 1YF4A 1GHZA 2YIPA 1PYTC 1C9PA 3GISB 5DO4H 3ZZ6A 4BAHB 2B8OH 3TJVA 4XOJA 1SQAA 1WTGH 5ESTE 1YM0A 3SGBE 4ZROA 3L6PA 1AMHA 1B0EA 2Y5HA 1I71A 1LKBA 1ZHPA 3GY6A 5KGOA 3LPRA 4BAQB 1THRH 3FOAA 2P95A 4IMQA 4ABHA 2QYIA 3ZVEA 2AMPA 1GGDB 1GL1A 1TLDA 2BB4A 1Z71A 4R1CA 4AB9A 3A85A 5DP3A 1S0QA 3EA7A 1FN8A 1YPGH 3ENSB 5DG6A 3LGIA 2D26C 4Z6AH 5JB8S 1A0HA 2IPQX 2CV3A 1NRSH 1O38A 2UUFB 2ZDVH 4I8LA 1BRBE 5L30H 3BIUH 4MPWA 1OYQA 1ZMLA 3H7OA 1TA2A 4XBCA 2ZNKH 1P57B 4JYVH 1Z8GA 3VB5A 2W6ID 1P2NA 4XFQA 1W3CA 4OS7A 1IQFA 2BY9X 2WPMS 2ZCHP 1F0TA 2FOFA 3T5FH 3BG8A 1QL9A 3EA9A 2BQ7B 1C2LA 4CIKA 1B7XB 3NPSA 2Y82A 3GYLB 4GCHG 1GG6C 3RXLA 1O2QA 3MU4A 1HAZB 2GMTC 4K1EA 1FUJA 1UTQA 1C5OH 3DHKH 3RXIA 2A5AA 3M5MA 2QXGA 2YMSC 4BV7A 2KM0A 1ZSLA 3RXQA 1BTZA 1IQNA 2H6MA 1LQEA 4YM9A 3M37A 4OGXA 1COWD 2ZGCA 3GCHC 2JH6D 4OS5A 2J98B 2ZFQH 1AFQC 2LNCA 3UREA 1GMNA 1T8LA 1YLNA 3OSYA 1YLDA 1LKAA 5ETXA 3U28C 5EW1H 4K2YA 4CRDA 5GXPA 5HM9A 1TONA 1KI0A 4YOJA 1MBQA 4YESB 4YOGA 1BJVA 2AGGX 3ZVCA 1CEAA 1O3HA 1RTFB 1DPOA 2BY8X 1LVMA 3TJUA 3D62A 1RIWB 1LO6A 1JIRA 2ZCKP 1V2LT 3OE7D 4FOUC 3RXKA 1H9HE 1CSOE 2BD2A 3BTTE 1V2WT 2AIQA 1GVLA 1V2RT 2Z3DA 2IOTA 1JBUH 2XNIA 4X6OA 3E90B 5L2ZH 1JOUB 1FPHH 1OWJA 1SKYE 1VJ9U 3I29A 2C8WB 5B6OA 1K21H 7GCHF 1GHAF 1GBIA 1BDAA 4UDWH 1MD8A 1DWDH 2STAE 2BVSH 1SHHB 3F0PA 3WY8A 2ZU3A 3GDVA 3SV8A 2GGVB 3SW2B 3BG4C 4SGBE 1C5YB 1P2QA 1O2HA 3P95A 5AFZH 2QIQA 1K1PA 4WXIA 4E7NA 1C5LH 1BQYA 1ESBA 1PQ5A 2VVCA 5DP5A 1YCPH 2BZ6H 4UAOA 2QXJA 3N7OA 1K22H 3STJA 1W11U 3DSGA 4K69A 1EJAA 1NTPA 1ZRBA 1GHYH 2ZKSA 2P3TB 5EPNA 2ZZUH 2G52A 1EATA 5F8ZA 5F6MA 1CA0B 1AHTH 3SNEA 5FXLA 1ESTA 1SLWB 4FUHA 1BBRK 2JH0D 2HOBA 3NXPA 1QCPA 2QN5T 3MU0A 1O2GH 1A5GH 3B8JA 1QHRB 4WMDA 2W6JD 1DSUA 2Q6DA 1VGCC 2PUQH 3F2GA 1IAUA 2HGTH 1YPEH 3T29A 5C5OA 2EI7A 3VB6A 2BD4A 3F9FA 1XM1A 2ESTE 3RXHA 3Q3KA 1GHVH 4LZ1H 1F92A 5E2OA 1W12U 1GBKA 5FCKA 3GCOA 2ZC9H 1ANBA 4I8GA 4J2YB 4FUGA 3EQ0H 1NFUA 1C1OA 1HFDA 3ZLEA 1C2DA 1EB1H 1V2ST 1QBNA 4NSVA 3SV7A 1F5KU 4YT7H 1XKAC 1L0ZA 1THSH 4IN1A 1C5MD 3A7XA 4APMA 5C1UA 2FX4A 2DUCA 4PROA 1QRZA 2B5TB 4D9RA 1CT2E 5BRRE 3PTNA 3DSPA 4BANB 3UR9A 3P70B 7LPRA 1LCYA 1NRNH 1S85A 2UWOA 2YNBA 3RXAA 1DWBH 3MU8A 4MPUA 2XW9A 2OK5A 1BMAA 3UR6A 4B75A 4Q63A 4CH2B 2FXRA 1ZYOA 2Z7FE 3PV5A 5A8XA 1Z40A 1D6WA 2ZGXH 2AHME 2WSSD 5CS1A 3K9XB 1HJ9A 1Z6JH 4Z0EA 4WH8A 1O2MA 2ODQA 2TGTA 2GVFA 4M9FA 3UQOA 1ZOMA 2XCFA 1ZRKA 3PV4A 5LPRA 2F83A 3SU6A 2FX6A 1IOEA 4VGCC 1KTSB 3FZZA 4NIYA 3SU0A 3ZIAD 5SGAE 1HLTH 7GCHG 1O3IA 1GBJA 5C67A 2ZHEH 4ESTE 1A5HA 2ANWA 1HDTH 2KAIB 2FOAA 2HWLB 4ISLA 2WV4A 2YOLA 2THFB 1HUTH 4KGAA 2UUKB 1W7GH 5TJXA 1GP9A 2OC1A 1VR1H 2QF3A 2ZTXA 2L74A 2SNVA 2CXVA 4FU8A 1MTWA 2JETB 3UQVA 2CF9H 3HK6B 2O8LA 4X8UH 4AOQA 3A88A 1O3JA 4XBBA 2H5DA 3KN2A 4AN7A 1QJ7B 1C1PA 2GDEH 3HGPA 1Y3VA 3IWMA 2AYWA 1O5EH 2Z3EA 4ZMAH 2ZHWH 3LGWA 4LK4A 2QGRA 1AVWA 1D3QB 3D49H 3A87A 1E38B 2H2ZA 3ZVDA 1RD3B 4Y0ZE 4CHAB 1O3OA 2PF1A 3KIDU 1AWFH 2M2AA 3UPEA 4K8BA 1Q2WA 2C4FH 2A5KA 1SLUB 3LIWA 2BDBA 3QUMP 5JBBS 2BHGA 1P06A 1ZSKA 1ZPCA 2JH5D 5E0JA 3SJKA 2ZHQH 1P04A 1W81A 1UTOA 2OD3B 5C20A 2NWNA 1Y3YA 2H5CA 3LONA 5AHGH 5CT3A 4FUBA 4AFZA 3CP7A 1W0ZU 2XBYA 4NA8A 1C1SA 1W7XH 1PMLA 5FBIA 2ZPRA 1E79D 5FAHA 2ZFSA 1AB9B 1AN1E 3GOVB 1EAXA 4YXWD 1GCTC 3GDUA 2KAIA 5F8XA 1SB1H 2G4UA 1RJXB 2TRMA 1DVAH 1C2FA 1HAXB 1QL8A 1O3LA 3PMBB 1GJBB 5CT2A 5H4IB 4R1AA 2OBQA 1BTXA 4Q80A 2ZHDA 1Z8IB 2W3IA 2H9EH 4BVCA 1IHSH 1OSSA 3MWIU 1C9TA 1O3AA 1T31A 2FYRA 2VWOA 2BM2A 1DOJA 2VIQA 3D65E 3CNRA 1NRRH 1G36A 2K4RA 4JCNA 1JIMA 2Y7ZA 3GY7A 2FP7B 3E1XB 2V7QD 3LH3A 2ZPSA 3VXFH 3ZWZA 2VIVA 2SGAA 3RXVA 4Y76A 1V2VT 1C5UA 1F0SA 1UK3A 4F55A 3F3BA 5GNDA 1RTKA 2O8WA 4I32A 1JRTA 1HYLA 2BD5A 1RGQA 3OU0A 2IN2A 4AORA 2PFEA 1ZJKA 1Y3XA 2FOGA 2WYJA 3TH3H 1TX6A 3FN8A 2ZCLP 4U2WA 4XD7D 3RXRA 5A0BA 1BHXF 1V2UT 4FUJA 1GJ6A 5C1XA 3UTUH 4Q7XA 5DP4A 4ABAA 3GYMA 1KYNA 2P93A 2P3FH 3A8BA 4ZKOU 1Z7KA 1F0RA 1MABB 1D3PB 1GBFA 1O34A 2WUBA 4ABGA 1O3DA 1V2OT 2FS9A 5FBEA 2A7JA 5TCCA 1BMFD 3EGKH 4I8JA 1YGCH 1TRMA 4Y11E 1RXPA 4WH6A 1ELVA 1WUNH 1L4DA 1L4ZA 3HK3B 2R3YA 1DICA 1DFPA 3ZVGA 3S9AA 4E06H 4RT1A 3MO9A 2XYAA 1QA7A 2ZQ2A 1QB6A 1Y59T 5G4BA 1GDNA 2OC0A 2A0QB 2G5VA 3TGKE 1MU6B 4OS2A 2R3UA 3A84A 2F91A 2VH0A 2QF5A 4WJG2 1ZMJA 1L1JA 5HIZA 2ZDAH 1GI4A 1LTOA 3WW7A 2BQ6B 3B9FH 2DE8A 1PFXC 1WQSA 1WDIA 2PUXB 4BTIB 3M61U 1BOQA 3ATIA 9LPRA 2BDGA 2DOHX 1PPHE 4NGAH 1FY8E 2PGBB 4GHQA 4AYYB 2J8LA 5J4QA 2F9BH 2XRCA 1TBZH 1V2QT 1MTUA 4I33A 1V3XA 1SGFA 2R2WU 3E0NB 4XRNA 5HKKD 1Z1JA 1GBBA 1TQ0B 5ABWA 1CBWC 2FD6A 4XE4A 2PGQB 4A1VA 2OXSA 3LAQA 1MMJN 1C2MA 4F48B 1O2KA 4CRGA 2Z9IA 4D9QA 3FZDA 5E0HA 2G00A 1O3FA 1LHCH 3FP6E 2EQNA 4ZXYH 1JWTA 3DCLA 3S7KB 4H4FA 2BY5X 3ZV9A 2TPIZ 1TRYA 1EZXC 1GJ9B 1K2I1 1ORFA 1S0RA 1SOTA 2BDIA 4ZCNA 1TMTH 4MNYA 4I7YH 2ZGHA 5DP8A 2TBSA 5CS3A 4JK6A 1YXEA 1TNIA 1KLIH 2VIDA 5DP6A 2L6OA 3RC6A 1HJAC 1P12E 2QE7D 4A6LA 5EODA 5COEA 3PO1C 1BMMH 4DGJA 1CQQA 3V7TA 1H9LB 1K0HA 6CHAC 4ASHA 1P01A 1F5LA 1XUIA 2ANYA 2JJ2D 4F4OC 1W0KD 2BDAA 4UFDH 2PTCE 4YO9A 4K8YA 1EXFA 2HPQP 4NSYA 1HAIH 2K0QA 4HI3A 3SJOA 5LGOA 2VJ1A 1Z1IA 2O8MA 1UVOA 3OEED 2BD7A 1QJ6B 1EZSC 3I78A 1HV7A 1BMNH 1Z8JB 2QV1A 3SV2H 1G3DA 2X2ZA 5HYOA 1LPKB 1DWEH 1UTMA 3U98H 2J9NA 1KIGH 1TGSZ 2W7SA 2PLXA 4NZQA 3HPTB 5DJ7A 7KMEH 4WF8A 5GWZA 4MLFB 2SGDE 3LGVA 2ZU5A 1AWHB 3HN4A 2PKSB 1ZPZA 4IUAA 2HPQH 3U73A 5E0GA 3SI3H 1GPZA 4B6FA 3QTVH 4ZH8A 1C2GA 5EW2H 1W2KH 1WSSH 3A81A 2OTVA 1GGDC 5A8ZA 4K5ZA 1CT0E 1WTHD 4BXSA 2A31A 1SSXA 3U1JB 1W8KA 1QR3E 1CHOF 1MD7A 1W10U 3A82A 3OEHD 3UIRA 1EZQA 4X1PU 3HMSA 1UCYH 1C5WB 3ZZ3A 2EC9H 4A92A 1G30B 3PMHB 4HTCH 3E6PL 4BXWA 1AFEH 2ZWLH 1E1RD 1IQJA 4H6TA 1Y5UT 3RMMH 2RG3A 1CHGA 4YT6H 4Z09A 3TH2H 1A2CH 3BIVH 2ZFFH 1O2ZA 3MU1A 1GHBF 3KYFA 1GJAB 2WPDD 2F9OA 1WBGB 1XUHA 3SUDA 1TNKA 4K1TA 1BRAA 3RMNH 3T2NA 1TNJA 1NPMA 4UFGH 4Y7AA 3WWBA 3OTPA 3QDZB 3QGNB 5L2YH 3K65B 4NA9H 1VCQA 1NROH 2P59A 1C5VA 4BVWA 3MNBA 2FODA 3ITIA 1W0JD 2NU2E 1OWIA 5BPEA 1IQEA 3V3MA 2J8JA 3MNXA 2AS9A 1XXDA 4X1SU 1QQUA 4O97A 2TGPZ 3CS0A 1ZLRA 1QRXA 4DG4A 2ZU2A 4NZLA 3RP2A 2NU0E 3K6ZA 2XBVA 3SOSA 1AVXA 1LHFH 1RTLA 2BOHB 2BLOA 2SFAA 5KEDA 1SFIA 1TAWA 1DS2E 2Z3CA 1OYTH 3MTYA 2VGCB 2OC7A 1TBRH 3OTJE 2KL5A 1GL0E 2GP9B 1AD8H 3AK5A 2V35A 1T8MA 2PKAB 2GCTB 3RMLH 1DUEA 3ZZ7A 4Q7ZA 3Q76A 1DY8A 1GJDB 4FUIA 3W94A 2FZZA 3UOPA 4TY7A 1G32B 6GCHG 3SNCA 5T3HA 3BN9A 1EX3A 1RIWC 1DXPA 1N6XA 3BSQA 1GJCB 2CGAA 1PK4A 4I31A 3GY3A 1N6YA 1YP9A 1C1VH 3QX5H 4MDSA 2VU8E 2WPIS 1LPGB 3GICB 3R0FA 5CSQA 1H8IH 4ABBA 2V3MA 3H09A 1P2KA 3QZQA 5GCHG 4AG2A 1CT4E 1O0DH 2O8TA 1O2NA 3K65A 2ZDNA 4J1YA 1MTNC 3SV6A 1A0LA 3L3TA 5EQQA 2F3CE 1FY5A 2FO9A 4HGCA 1JMOH 3F68H 4FUFA 1DSTA 1GBLA 3RMOH 1BTUA 4UD9H 1EP6A 1MUEB 1EFRD 3P8OA 5E8EH 1GI9B 3M5LA 1A7SA 1CHOG 2KNFA 3BTDE 5DPAA 1DITH 3KEEA 3VB7A 1HNEE 1TMBH 2Q6FA 1A46H 4JK5A 3ZZBA 1W8BH 3A8AA 2JIZD 1Z8RA 1C5ZB 3RU4T 4CREA 3W1EA 1CA0C 3BEUA 3RXUA 2J34A 2RA0A 3A86A 4GHTA 1OPHB 2FYQA 4GPGA 2G51A 5K0HA 2EY4C 1OP2A 1ZJDA 3ODDA 1ZMNA 5AF9H 2PKAA 1UK4A 4K60A 5GIBA 1F2SE 1GHBG 2Q6GA 3AAUA 1PPEE 1LHGH 1JXPA 2O9QA 1O2PA 2DE9A 1A61H 2FOBA 1NK1A 2VWNA 2ULLA 4ABEA 1XXFA 2Y6TA 1MKXK 1W14U 2GMTB 1ELEE 3LKWA 4WWYA 1EAWA 1A4WH 1MH0A 2HGFA 2ZGBH 4X6PA 1DLKB 4Y8YA 4AB8A 2RDLA 5CT1A 1CU1A 1ARCA 3A7WA 1CEBA 1D9IA 4AZ2B 3GY2A 1HGTH 1EPTB 2A4QA 5HPGA 2YILA 2G8TA 1PPCE 1TGTA 2J98A 2GCHG 3PV2A 1OWKA 2GT7A 4CR9A 1BUIA 3FKSD 3SJ8A 1SGDE 1ELAA 1I5KA 5B6LA 3BTFE 3TPIZ 3KF2A 1FXYA 1KXCA 1L1NA 4ABDA 1HAPH 2FEQH 2GV7A 3VB3A 1O5AB 2FI4E 4IC5A 2W26A 3T27A 3SRJA 5CMXH 2VIWA 1HAHH 2XBXA 1FIWA 1H8ED 4ABJA 1ELBA 4FU9A 3U1IB 2OLGA 4NIXA 3S9CA 1LPZB 4RT0A 2Z94A 1SHYA 2FI3E 4O9VA 4IMZA 1KSNA 3F6UH 2BQWB 3UNQA 1N8OC 3A83A 3M3SA 1DANH 1MAXA 2IPHA 1C4Y2 1AKSB 3G01A 1ANDA 3BG4B 2FOEA 4B2AA 1GI3A 4OS1A 1JFNA 1C1MA 3EE7A 3HKJB 4WMEA 2WPLS 2ALPA 5C2ZA 1NS3A 3JZ2B 1ABIH 1SI5H 4ASUD 3ZZ9A 3LDXH 3M7UA 4NA7A 4BV5A 1ZHRA 4P00A 3BTHE 3MH6A 1H8HD 1O36A 2A4OA 3E6PH 1D3TB 2OUAA 2WYGA 4D76A 5CHAC 2Q8AA 2FLRH 1EPTA 2C93B 2EA3A 1GI6A 1T4VH 2ZP0H 5JPMH 4ZAEA 4DCDA 3NWUA 2EEKA 1YYY1 2QCYA 3O8CA 2W7UA 1HAOH 1TOMH 2ZPQA 4MPXA 3F2FA 3AAVA 2HPPP 1TGNA 2C8XB 2VVVA 2BOKA 3BTWE 5JDUB 1SQTA 2PSYA 4FVBA 4CR5A 4CHAC 1NN6A 1SR5C 4MVNA 1PPGE 1WAYB 2GKVE 2XC5A 1BRUP 2BLVA 4NIVA 2KCAA 5EOKA 3N7EA 3V0XA 1ANEA 1NC6A 4TT3D 1HCGA 3TNSA 5JBCS 2J4IA 3SU3A 2ZFRH 4BAMB 4I86A 1FJSA 1EOLA 1SGTA 1PQ8A 4MG3A 1XVOA 1C1QA 1PPZA 1MKWK 4P02A 3PYHA 1GMOA 4FU7A 2K8IA 1GHXH 1QBOA 5A0CA 2HPPH 1LHEH 3M3TA 3A7VA 2K51A 3AASA 2FWWA 5E2PA 2O8UA 5EXMA 3TLOA 1CGHA 2HNTE 4X6MA 1GMHF 1AGJA 2BXTH 1FMGA 2QJ2A 3GY4A 2HVXA 1B2IA 1MAYA 1EQ9A 3NUMA 3RDZA 1BTWA 4CBOA 2J38A 3T26A 2P3UB 2ZHFH 5PTPA 4R0IA 1O39A 1SGEE 1KXFA 2V0BA 4A5TS 4A1XA 5LPEA 2F9NA 2ZDKA 1K1IA 3OX7U 3P8FA 3KQDA 3UOUA 4DJZB 2J94A 1HIAB 1QZ8A 1K1JA 3BTME 1BT7A 4ISNA 1C4V2 4Q2KA 2Y80A 3RXBA 1TX8A 4BNRA 2GTBA 2TIOA 3PTBA 2AFQB 2TGDA 4B73A 1D4PB 2PK4A 3AVZA 4CRCA 5F03A 1GBAA 1C1RA 4E05H 2GD4B 1BJUA 3PLKA 2HNTC 3ZZCA 1ZTLA 5FPSA 1BMLA 4ZHAA 1EJNA 3SJIA 3SYJA 4F49A 4JMYA 4RN6A 3TGJE 1QQ4A 5EQRA 1QY6A 4DT4A 2V3OH 2VINA 2W5EA 2TGAA 1SPJA 3UNRA 2OCVB 3KGPA 1A0JA 1AY6H 4ISOA 3ZV8A 2Y5FA 2KX4A 1TPAE 1WXRA 4KIVA 2QJ4A 2BYAX 1YPKH 4R19A 3BT1A 1WQVH 3NKKA 2BX3A
chains in the Genus database with same CATH topology
1SGFG 2ZDLA 3RXDA 1PKRA 4U01A 3SU2A 1FY4A 3VB4A 1YPJH 1Q3XA 1OXGA 4TWWA 5LH8A 4APLA 4YLUA 1GJ4H 1T8OA 2XWBI 3URCA 2ZU1A 1P8VC 2AMQA 2HRVA 3KHVA 1XVMA 2J2UA 3ATLA 4KTUA 1SGQE 3MOCA 1O32A 2GX4A 3ZZDA 2B0FA 1OOKB 4IN2A 3GCTF 2VIOA 1HIAA 4LOYH 2A7HA 1S5SA 2QXIA 5GJ4B 1B0FA 3DT0H 3E0PB 4CRFA 4Z0FA 1O2TA 1XMNB 1GI7B 2ZGJA 1KY9A 1FAXA 1YBWA 1HAVB 4UEHH 1ZGIA 4A7IB 4X1RU 1O2IA 2FI5E 1ZGVA 1TE0A 4BAKB 3UY9A 1E36B 1T4UH 2CHAB 4ABFA 2ZU4A 4KTCA 1UVTH 1T32A 3LH1A 3RXPA 1TNLA 2Q1JA 1J17T 3TK5A 2A32A 1O30A 1GMHG 1NU9A 3V12A 3C27B 1OWHA 1GDUA 1UMAH 1QGFA 2HALA 3BEIB 5DKMA 1LDTT 3RLWH 2B7DH 1BBRH 1GBTA 4ZHLU 4MQAA 3LJOA 1VITF 2STBE 1LHDH 2F9PA 4INLA 1L1GA 3F9EA 1GI2A 1GMDF 2FOCA 3M5OA 2WV5A 5FX6A 1DXWA 2I6SA 5JYIA 2FTLE 1YCPM 5I25A 1MTVA 5C1YA 1P9SA 1MCTA 1UHBB 4KKDA 2C3SA 3PMJA 1LVBA 5IDKA 3SZNA 1DE7H 2IJOB 1FY3A 2I9AA 3DFLA 1BCUH 1C2JA 3DUXH 5CS5A 1BHTA 3KIVA 1FIZA 1O5DH 2Z6BD 8KME2 1Z6EA 2AMDA 3NZIA 2L0SA 1C2KA 1CA8B 3ZZ5A 1RS0A 2HLCA 1O3NA 3UNSA 3RXCA 1RFNA 4XSKU 4FUEA 3BTQE 1ZR0A 1UTLM 3P8GA 3RUOA 1OKXA 5FPTA 3SORA 2BMGB 3B23B 1FONA 3JZ1B 3URDA 1PPFE 2GDDA 1HAVA 1C1TA 1FAKH 2OQUA 3UFAA 1C1UH 1K1OA 3GY5A 1UTJA 1O2YA 3PWBA 4LXBH 3SQHE 1L2EA 1VITH 2Y81A 4Y8ZA 1O5FH 2ALVA 1P3CA 2QC2A 5GDSH 1BITA 1KLTA 3IG6B 8LPRA 3DFJA 1G2LA 2YNAA 1TA6A 1OWEA 1THPB 4SGAE 3R3GB 2Y8RA 3RXOA 1TX7A 4X2WA 1YPHE 3ESTA 4GLYA 5A0AE 1IQGA 1K1NA 3SHAH 3TJOA 2GT8A 2BTCE 4X2VA 4ISHH 2A2XH 3F9HA 1V2MT 4OS6A 2SGPE 4Y7BA 2PF2A 2LL3A 4AFQA 3GCTG 3PWCA 1P09A 1MZAA 1V2KT 4KTSA 3E8LA 1G3CA 3IITA 5AVDA 1UHBA 3Q77A 3ZVAA 4DVAU 1BIOA 3TK6A 2BXUH 2CMYA 4U32A 3W95A 2NU1E 2A45B 4B76A 5EU8A 1C5PA 6GCHF 3F9GA 4GUXA 1D6RA 1ESAA 4YZUA 1UK2A 2G81E 1ZHMA 1T7CA 1BTHH 1YPHC 1EASA 2BDYA 1PQ7A 1GI8B 3ZZ8A 3D23A 4NFEA 3RC5A 3E16B 1CBWB 1YPMH 5FHTA 2OBOA 2AERH 3ATMA 3A7YA 1CO7E 2XXLA 1ELFA 2XC0A 1D3DB 3O8RA 3RXSA 1VITG 2OINA 2BDHA 1MU8B 1GI0A 4O03A 5GCHF 1WOFA 1GMDG 1NY22 1EZUC 1KLJH 1KDQB 1IHTH 1SMFE 1J15A 2BY6X 1S6HA 3OY6U 1UVSH 4UE7H 3KCGH 1XUGA 2V3HH 4INKA 1AE8H 1BHXB 1TBQH 2JKHA 2UWPA 3SI4H 2C8ZB 3FFGA 1GI5A 4INHA 1SVPA 2FIRH 1KIVA 2Z8VA 3S9BA 4AX9H 4NIWA 2GZ7A 1DM4B 3PO1B 4ABIA 1QA0A 3LGUA 1P2IA 2Z9GA 2D2DA 2FMJA 3ZYDA 1INCA 1KXDA 1ELTA 2WPKS 3P92A 1P03A 4XBDA 3TH4H 3BV9B 1WYKA 3PLBA 3BT2A 4WMFA 3U8RH 1X7AC 1EUFA 2ZECA 1SGIB 1DDJA 1SC8U 2B9LA 2AGIX 3A7ZA 1UCYE 3VGCB 1ZPBA 2SNWA 2RCEA 2FPZA 1GCDA 2ASUB 2ZG0H 3HATH 1P2JA 1EKBB 3AW1A 1E37B 3STIA 5GPIB 1C5SA 4JYTA 1C5RA 1O2WA 2D8WA 3M3VA 3TJNA 2ANMH 1AUTC 4THNH 2GCHF 3A89A 3SGAE 5JB9S 1KDQA 1Y3UA 1XUKA 3A8DA 1DT2A 1Q31A 3TK9A 3KQCA 1TRNA 1GBEA 1GBCA 1PK2A 1C2IA 2SPTA 1I8NA 2A4GA 1GJ5H 2P8OB 3FP8E 1FLEE 3T25A 1A3BH 3I77A 1WV7H 5FCRA 4YTAA 3U9AH 1DUAA 1K9OE 3QGJA 1V2PT 4FUDA 2RA3A 1QRWA 4KP0A 1FDPA 3E3TA 3TVJB 5FPYA 3LOXA 2ZI2H 1O37A 1ID5H 2EI8A 4MNXA 4O3TA 3EA8A 1FV9A 2K13X 3RLYH 1KXAA 1GBMA 1P2MA 3H7TA 1M9UA 1LMWB 1P02A 4FUCA 3RM2H 5CS9A 1ACBE 2ZF0H 4OS4A 4TYDA 1NRPH 2VWMA 2VH6A 4OGYA 2AGEX 3EDXB 2ZIQH 1OX1A 3LGYA 3L33A 1MQ5A 4NCYA 3UUZA 4AG1A 3LT3A 3PLPA 1P9UA 3M36A 1GWAA 3U69H 1LVOA 3O8BA 4DT7B 3MNSA 1G9IE 2OP9A 1C5XB 1TQ7B 1VZQH 3RXFA 2VWLA 3ATKA 1EPTC 2SGFE 2FOHA 1C2HA 2J95A 3F1SB 4IBLH 5AFYH 2PWXA 3U8OH 1VCWA 3CS7A 5T6DA 2XC4A 4BVVA 2A7CA 4WY3A 1HPKA 3MI4A 1MZDA 4BVDA 3QO6A 5LPFA 3SJ9A 1AI8H 1GDQA 4D8NA 3ODFA 1ELGA 1EOJA 3U8TH 3TNTA 1GG6B 4YIVA 1S84A 5T6GA 1QJ1B 5K7RA 1O2UA 4YOIA 4UV6A 3MKPA 2ZTZA 1TB6H 1UO6A 5EPYA 3RU4D 1BA8B 2BLQA 4IC6A 1NU7B 1LVYA 1HXFH 4UFFH 3RXJA 1UVUH 1DY9A 3SU4A 1V2JT 3GCHB 1XUJA 3AW0A 4CRBA 2AEIH 2CF8H 1A1RA 1AFQB 1MTNB 4B71A 3H5CB 2GZ8A 1YKTA 1ZSJA 1HAGE 2LPRA 3S69A 2C8YB 2R2MB 1C1NA 3E91A 1H8DH 4Y6DA 4ISIH 3OYPA 2BD3A 2YIOA 4XDEA 3ZVFA 1SGYE 1SL3A 2FDAA 1GMCF 3EYDA 4FVDA 1E0FD 2VVUA 1K28D 3BEFB 5F8TA 1O5BB 2FM2A 4HZHA 3MHWU 1GVKB 3P6ZB 2FLBH 3GDSA 2OC8A 4TWYA 3ZYEA 1NFXA 3MMGA 3SN8A 3RXMA 4AFSA 1XX9A 3Q3XA 2QY0B 1H1BA 1XKBC 5C5NA 4RKOB 5JBAS 2ODYB 1ABJH 3MU5A 4B1TA 4CBNA 1J9CH 1SGPE 4YLQH 5DP7A 1GHWH 5EXNA 5TCAA 1KDUA 1P05A 1NO9H 3K2UA 3LJJA 4MTBA 2M5TA 4ZUHA 2BVRH 1UTNA 2A2QH 4E7RG 1HKYA 2HNTF 2I6QA 1F7ZA 4Z0KA 3V13A 1ETRH 4X6NA 1E35B 1O3KA 3P8NA 4JZIA 3DD2H 3BTGE 1FY1A 1O33A 2J92A 1A3EH 3S0NA 1Y5BT 1NFWA 1TABE 3MYWA 4Q7YA 6ESTA 3LC5A 2JETC 1ETSH 3RM0H 1TPSA 1GJ8B 2BZAA 3FANA 2UUYA 1BTYA 2CN0H 3QK1A 1GI1A 1PYTD 2WPHS 4KELA 3KL6A 4JZEH 2PW8H 1SG8B 1C2EA 1VCPA 4WXVA 1TPOA 5HM2A 1NRQH 5J4SA 1VGCB 4NWLA 1Y3WA 2BD8A 2AH4X 1TOCB 1G37A 1GJ7B 4DURA 1YC0A 1NL1A 3M5NA 1NESE 2Q8BA 1AE5A 1O2XA 6LPRA 1TGCA 1G3EA 3SUEA 4Y10E 2AIPA 5EG4A 4DOQA 1QIXB 1ETTH 3TGIE 1WCZA 2H1UA 3PM3A 1QL7A 3M7TA 1N8OB 1SGNE 4JZFH 1C5NH 5A2MH 1GHAG 2QA9E 1QTFA 4BTUB 2W3KA 2Y5GA 3C1KA 3Q00A 1TNGA 1AB9C 1P3EA 1AKSA 2G5NA 2K1QA 3P17H 2FEBA 1W13U 1QNJA 1MCVA 1BB0B 1AVGH 2Z9LA 1V6DA 2ZTYA 1TGBA 8GCHF 3MH4A 4M7GA 2NU4E 4K3JA 4MNWA 3M35A 1E34B 5CHAB 4YIZA 4JYUH 1FZZA 1GMCG 1YPLH 2A4RA 5A8YA 5C3NA 2XWAA 2QAAA 2ZQ1A 3SUFA 4VGCB 1P0SH 3SP8A 2QF0A 3S7HB 2GV6A 1PPBH 4X8TH 4D7FA 1W0YH 1O3BA 1O2JA 2Y7XA 1G2MA 2ANKH 2ZFPH 1S81A 4B74A 1PMKA 1MBMA 1TYNA 4CH8B 2VIPA 1IQHA 3BTEE 1OP0A 3ELAH 4AGJA 4DW2U 4GSOA 2BLWA 2NU3E 1TALA 4ZHMU 4R1BA 1C5TA 1SFQB 4MNVA 2R9PA 3UWIA 5T6FA 3A8CA 1IQLA 3HKIB 3DA9B 2XCNA 3MNCA 3UWJH 8ESTE 4X2XA 1EP5A 1FPCH 1TFXA 1T8NA 5A09A 1PJPA 3SBKA 1J14A 1SLXB 2UWLA 2XTTB 3RXTA 1UCYK 2PSXA 4K1SA 1TMUH 4JZ1A 1P11E 4WVPE 1O3PB 3LU9B 2P16A 4LZ4B 1S6FA 2CHAC 1SQOA 3PB1E 3VFEA 1IQIA 2PV9B 3QZRA 1AZZA 1SLVB 3RXGA 4BTTB 4R8TB 2F9VA 4NFFA 4DIHH 2PTNA 2FESH 1EB2A 1J8AA 4QT8C 4ZKSU 1ZTJA 4I8HA 3BTKE 2FS8A 1TNHA 3FVFB 1A5IA 3ATWA 1FN6A 1O35A 1TPPA 2G55A 9ESTA 3QLPH 1AQ7A 1ELDE 1NFYA 3MO6A 4AFUA 1G3BA 4NG9H 3T62A 1F5RA 1NT1A 4O3UA 3M7QA 3TIUA 1MKXH 5FX5A 1Y5AT 1CGJE 1AO5A 2PHBA 1KRNA 1J16A 2UUJB 4H6SB 1EAUA 2ZDMA 1HRTH 5ESBA 1GVZA 1B5GH 4CRAA 1S83A 1CGIE 1GCTB 2R0KA 3ZVBA 2QXHA 1HAYB 1BRCE 1OWDA 1ARBA 1O3EA 4TPIZ 1H4WA 1NZQH 1K1MA 2VB0A 4BOHA 7ESTE 4Z0DA 1SBWA 1N1LA 4Y71A 1TPKA 1CVWH 4GAWA 4TY6A 1XUFA 1HPJA 1JRSA 1LQDB 1PQAA 1KTTB 2SGQE 3TITA 4B2BA 3VXEH 2F9UA 4A1TA 8GCHG 1K1LA 3SU1A 5DGJA 4IS5A 5L6NH 1S82A 4TPYA 2FTMA 1IQKA 4BAOB 3SGQE 3MH5A 1ELCA 4IGDA 1FNIA 1O31A 3KQBA 3GCNA 1SGRE 4X0WU 3A7TA 3SO3A 1WU1A 1HB0B 3TU7H 3EE0B 1C1WH 1GBHA 3VEQB 1AUJA 2ILNA 4ZKRU 4X8VH 1KXBA 1UJ1A 2ZA5A 1BBRE 1O5GH 1F0UA