4DURA

The x-ray crystal structure of full-length type ii human plasminogen
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
789
structure length
756
Chain Sequence
LDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Plasminogen
publication title The X-ray crystal structure of full-length human plasminogen
pubmed doi rcsb
total genus 197
structure length 756
sequence length 789
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4durA07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4durA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4durA01
1W12U 1QBVH 1MAYA 1FY3A 2J4IA 4NFEA 3NPSA 1HAPH 5AVDA 4F4OC 2HVXA 4Z0KA 4X1SU 3VGCB 4MNVA 4I8JA 1FY5A 3SN8A 2IOTA 2J9NA 5GJ4B 4Z0DA 3TJOA 1IAUA 3LPRA 1S0RA 1BTYA 4A1XA 1VGCC 5JYIA 1ELVA 1N6YA 1SOZA 1UTMA 4IGDA 1SGFA 4INHA 1H4WA 5HM9A 4FVBA 2GMTB 3GDVA 1W3CA 4CRFA 1J16A 3ZZ7A 1B2IA 1BOQA 3LGTA 4JK5A 5C5OA 4IMZA 1CHOG 1TFXA 3O8BA 3RXGA 1P3EA 1XUKA 1D3DB 4MVNA 4Q7ZA 4RKOB 4ABEA 1IQFA 1QJ6B 3LGUA 1EZXC 4ZAEA 4NIXA 3FP7E 1C5RA 3VB3A 1NPMA 1O3DA 1O2KA 4D9QA 1F0RA 1JRSA 2G4UA 1YLDA 3LOXA 2UWOA 1AVGH 4ISHH 3QUMP 1AB9C 1Z8IB 5F6MA 1GMHG 4NG9H 1GHAF 1MD7A 2G5VA 1YPHC 4CRCA 2G5NA 3E6PL 4AZ2B 3KIDU 2FD6A 4H6TA 1RIWC 1YCPM 1NK1A 1C5WB 3Q3XA 1AY6H 4UONA 1X7AC 1EQ9A 1GBJA 3GCHC 5C1UA 1S6HA 2Y5FA 4O9VA 1O2OA 1TRNA 3F9HA 5LH8A 1SQOA 4X2VA 1C1VH 4H6SB 1PPBH 2HRVA 3I77A 3LC5A 2J38A 3NWUA 2PGQB 3RMMH 3U8RH 1AFQC 1FV9A 2ZA5A 2J92A 4NWKA 2WPMS 1EKBB 3I78A 5L6NH 1WTHD 5JPMH 1EAIA 4Y7BA 3M7UA 2QGRA 4ZHAA 4X8VH 3E0NB 1F0SA 4DY7B 3S7HB 3ESTA 1NY22 4TPIZ 1GG6B 4X1PU 1IQMA 1HPJA 3B8JA 2AIQA 1AIXH 4ZKNU 5J4SA 1SFQB 1CU1A 1ZTKA 2H9HA 1XXDA 1IQGA 3UQOA 1TABE 3TGKE 4R8TB 4E05H 1UHBB 4JZ1A 1F5LA 4OGYA 2WV5A 2CHAC 3A7TA 1G3BA 1TX7A 2VH0A 1SHYA 4A1VA 2Z9KA 2Y80A 3TITA 3PTBA 3KNXA 1GJ5H 4Z0FA 5C1YA 5A0BA 1GBFA 3SZNA 4XOJA 1ZPBA 2UUJB 4D8NA 2BZ6H 2QA9E 3RXVA 3L3TA 2A4GA 4R1AA 3PLPA 3MNXA 1TE0A 4LOYH 1XVOA 1C4V2 1DUEA 1DY9A 1DM4B 1Z40A 2ZKSA 1HNEE 2ZWLH 1DFPA 5EW2H 5GWZA 3BIVH 3U9AH 3HGPA 5DP8A 4D7GA 3VB6A 3EE0B 1WOFA 1O3HA 2W5EA 3UWJH 4INKA 5CS1A 2P94A 2XCFA 3RC6A 4NWLA 1C1TA 1NFYA 2FTLE 2Q8BA 3GCNA 1MH0A 2QC2A 4JZFH 1TRYA 1SGTA 1V2OT 4Y0ZE 2BQWB 3PV4A 4O97A 4YLQH 3BF6H 1P2NA 1NL1A 2V6NA 1ZPCA 2Y8RA 3RXDA 2XBVA 3BTTE 2V35A 3ZZCA 2WPKS 1C5QA 4Q80A 4ABIA 1Z8RA 3EA9A 4Q2KA 2I9AA 2FX4A 4D3CA 1C5MD 4U30A 1TGSZ 2GCTB 3A80A 4M7GA 4E7RG 2H9TH 3G01A 3ELAH 3SU4A 3Q76A 1V2ST 1EZQA 5A8XA 2AMQA 2P3UB 1PYTD 2PKAA 1UTPA 4ZUHA 4CREA 4BVVA 3P17H 1O2WA 2BD7A 5CE1A 3RXUA 1GCDA 5FPTA 5EXMA 3MU1A 4YOGA 1F2SE 3A84A 2YIPA 4X6PA 2O8MA 2HWLB 1CEBA 4WMFA 3TH4H 3URDA 2D1JA 1IQHA 3KEEA 1CHOF 1H9LB 1BRBE 1K1OA 1MZDA 3VGCC 5EW1H 2Z7FE 3RXBA 2ULLA 1TALA 2PUQH 2SPTA 3RM0H 3TU7H 5FPSA 4BAHB 1T7CA 5I46H 1TPSA 1KXFA 1UTNA 2VWNA 1TMBH 3MHWU 4ZROA 2GMTC 1ELBA 1T8NA 2THFB 3WY8A 1J14A 3SO3A 1P01A 1O2TA 4UD9H 4GSOA 1P2QA 3VPKA 2BOKA 2ESTE 1WUNH 3MU8A 3TH3H 4NCYA 4OGXA 1O5FH 2BD3A 5F8ZA 2D8WA 3A88A 1ZGIA 1O2QA 2XC5A 1UVUH 1JWTA 3SJKA 3O8RA 2C8WB 5ESTE 3DUXH 3PYHA 3SV8A 5A8YA 1BBRK 4JYUH 4BXWA 2PTCE 1SMFE 2A1DB 2GDDA 5DP9A 1BITA 3JZ2B 1JBUH 1MTUA 2BD2A 2F83A 2ZFFH 3M5NA 4AX9H 1O3OA 1XMNB 2FM2A 9LPRA 1DVAH 1HAHH 2ILNA 1GDUA 2B9LA 2Z9IA 2H6MA 1BTUA 1OP8A 4I8LA 4KP0A 1H9HE 3PO1B 2ZTXA 2SGEE 3PMJA 1EX3A 2QF3A 1T31A 3SI4H 5GXPA 5FBIA 4I8GA 4TWWA 2AMPA 1ELAA 3P95A 1PMLA 4B71A 1BMAA 3OX7U 1TX8A 4I31A 5DJ7A 1AMHA 3LAQA 5TJXA 1GI9B 2QJ4A 2FOCA 2AMDA 1B7XB 1A0LA 3SOSA 3SGAE 4YZUA 1GG6C 4R1BA 3E3TA 1GL0E 1LMWB 3SRJA 3BTKE 2IN2A 1BTHH 1DITH 1OWHA 3LKWA 1S83A 4AG2A 3SGQE 1CA8B 1G3DA 4ZMAH 1NRPH 2G55A 1GBKA 3RXSA 1GVLA 1DX5M 3ATIA 1D3QB 3MU4A 1SFIA 1E0FD 1L2EA 2ANMH 3V3MA 1BZXE 4Z6AH 1F5RA 4J2YB 3BTWE 1NRQH 1MKXK 2XXLA 5TCAA 3ZLEA 2ZGBH 3E8LA 4Q7YA 4DT7B 1T32A 3UTUH 1FI8A 2PKAB 2OC7A 2A0QB 1C1WH 1KDQA 1OXGA 2W3KA 2SNWA 4DGJA 2F91A 3N7OA 3RU4E 2TGPZ 5SGAE 1TWXB 3RXIA 1SOTA 2GVFA 2F9UA 3PTNA 1TIOA 5DP4A 3IG6B 2ASUB 2HPQH 3QN7A 2QXHA 3NK8A 1A5IA 1QURH 1NFUA 2ZU3A 1DLEA 1CT4E 1BHXF 1FZZA 3GDSA 1OWIA 2ZU1A 1ZZZA 5IYTA 4E7NA 4UFEH 1CBWB 1N8OB 2ZCLP 1UK3A 2A7CA 3BEUA 2QN5T 5BRRE 1C2JA 1QL9A 2R3YA 1QB1A 2PF1A 1PQ8A 4K1SA 1FY8E 1P2OA 4Y71A 4O3TA 5CSQA 1YPJH 1ZYOA 4D76A 1ELCA 3LH1A 1PK2A 1O2MA 1LKAA 1HJAB 4X1QU 2W26A 1QGFA 3ZV8A 5CT2A 5GDSH 2BDCA 3CS0A 1MCTA 1QJ7B 1TQ7B 4ZHLU 1K1PA 1DICA 2WINI 3MO9A 4JZIA 1B0FA 1DWBH 1GBLA 1EJMA 1GJBB 5E8EH 2Y7XA 3RM2H 4WMDA 1G37A 1GPZA 1S82A 1V2MT 1ESBA 4ZH8A 4CR5A 1A0HA 3ZVBA 1G36A 3MWIU 3OSYA 3GY2A 2ZHQH 4GHTA 1V6DA 2O8LA 1TA6A 5LPFA 2C4FH 1UCYH 1FAKH 1Y5AT 4K5ZA 4D9RA 1PPFE 4BAOB 3BTDE 3V12A 3CENA 2X2ZA 3A83A 4X8UH 5A2MH 4FVDA 4H42U 1V2JT 1MZAA 3RLWH 4UDWH 3M35A 3VB4A 5JDUB 1ZMNA 1F92A 7KMEH 1CSOE 3BG8A 3ZWZA 3DT0H 1HYLA 3GY4A 2FYQA 1FY1A 3MFJA 1SSXA 3SUDA 3T5FH 4NIWA 3UR9A 2UWLA 4VGCB 1LQDB 3TLOA 4NIVA 1C1OA 2ANYA 5F8TA 4WH8A 2F3CE 1L0ZA 3P8FA 1XM1A 3U8TH 2STAE 5C3NA 1V2UT 2WPJS 1CT0E 1YPLH 1TB6H 2BQ6B 2GZ9A 2QJ2A 1MBQA 2Y5HA 1GJ8B 2CV3A 4A5TS 4KTSA 5FBEA 3MKPA 2GT8A 2H1UA 2GV6A 3F68H 2B5TB 3M37A 4FU9A 3UFAA 3HMRA 1HPGA 2VIDA 1XUJA 1L4ZA 4MPXA 3S9AA 4K60A 5FX6A 1LDTT 3DFLA 4PROA 3VB7A 2ZDVH 3HPTB 2A7HA 1BIOA 2BLVA 2ZC9H 3P70B 3P8OA 4Y10E 3PO1C 4J1YA 4DURA 1SG8B 1KDQB 1CGJE 3E90B 3M61U 1MD8A 1C5PA 1W11U 1TPKA 6ESTA 2OQ5A 1HRTH 2ANWA 2BY8X 2BD8A 2PTNA 1J9CH 1T8MA 2ZO3H 1EOJA 1NESE 2NU1E 1O36A 1GBHA 4JMYA 3IITA 1MKWK 3MMGA 2QXJA 1C1SA 1TNJA 1ABJH 2OC8A 2FWWA 1PPCE 2WV4A 2OBQA 1UK4A 1UTOA 4JYTA 3SU1A 5E2PA 3TK5A 2K13X 2A4RA 2LL3A 2PHBA 2QY0B 1EATA 2ZDKA 1K2I1 3SQHE 3ZYEA 1FQ3A 4X2WA 2FEQH 1VJ9U 2IJOB 1IQLA 2FOGA 3FP6E 5EXNA 2J2UA 2O8WA 2Z9GA 3S7KB 4RN6A 4BAMB 4QT8C 1O2XA 1NT1A 1V2QT 3A8CA 1DPOA 2AGIX 3KCGH 3C1KA 3A8AA 1A0HB 1LHFH 2HPQP 1BBRE 2HOBA 1YKTA 1TOCB 1DS2E 2R3UA 4UFGH 4WF8A 1TA2A 2ANKH 4F49A 2XTTB 2C90B 1HUTH 3ENSB 2L0SA 3PROA 1C2EA 4MTBA 1BCUH 3ODDA 1QTFA 1PQ7A 4KTUA 1ZRKA 1QRXA 1AE5A 3GOVB 3RXRA 4YOJA 3K65A 2J8JA 3GY3A 3ZZ5A 5A0AE 1CBWC 4ABAA 5DG6A 1PJPA 3A7XA 3LGYA 1HAGE 3S9BA 1RFNA 2HPPP 2F9VA 2ZU2A 1QB6A 1KI0A 2C8YB 1O2VA 5HXFA 1XX9A 3RXQA 1GJAB 1AN1E 1ZHMA 3SUFA 3GISB 2SGQE 3JZ1B 5FXLA 1TPOA 4WMEA 2SGPE 2BDBA 1C1MA 1Q31A 3SGBE 1EZUC 1GI2A 1MMJN 1SR5C 2VGCB 3OTJE 1AU8A 2ZGJA 1PKRA 1DSUA 1UVPA 1LCYA 1TYNA 1G3EA 3A7YA 3M7QA 4HFPB 4MG3A 5EOKA 4ZKOU 1C5NH 1JIMA 1A61H 5JB8S 4Z09A 2F9PA 2F9BH 3UY9A 2HALA 3ZZDA 2GZ7A 4Y0YE 1YPKH 5EQSA 1TOMH 4ZKSU 1E36B 4XE4A 1SQAA 4BV7A 3TNTA 2OUAA 2OINA 2ZFPH 1WYKA 3PB1E 1GBEA 2PW8H 4JZEH 5COEA 2BDGA 2A5IA 1GMNA 1RXPA 2LNCA 1KDUA 1NC6A 1O35A 1O5CB 2AERH 3VB5A 2R2MB 2R0LA 4IBLH 2A2QH 1H9IE 4JZDH 1OP2A 5EQRA 3GCTG 4IS5A 2GX4A 3NCLA 1V2PT 5BPEA 2BLQA 2FS9A 4VGCC 5E0JA 4AOQA 1QIXB 1C4Y2 1S81A 1QCPA 3ZZAA 1ZTJA 2A45B 3A8DA 5A09A 2AH4X 2H5CA 1A0JA 4X2XA 1AD8H 5E0HA 4B74A 3U1JB 1HAZB 4WY3A 2PFEA 1GMCG 3BTFE 2DE8A 1V3XA 1TNKA 1Z8JB 1NRRH 1ELDE 5CS9A 1AUTC 1W7GH 1K1IA 1Q3XA 4A1TA 5A0CA 2P3TB 1DLKB 1WAYB 2Z94A 1C1UH 1Q2WA 3D49H 2VH6A 3A89A 1W14U 1O2NA 4K1EA 1D3PB 3SV9A 4YT6H 4KKDA 3GICB 2ZCHP 1O3BA 2OLGA 1AE8H 3KL6A 2EI8A 4IMQA 1WCZA 1C1PA 1GMOA 4B2CA 4AFUA 2SNVA 4MNYA 2ZTYA 3QGJA 4R1CA 7LPRA 1JRTA 3GY6A 2FESH 4SGBE 1EUFA 3BTEE 4IN2A 1WQVH 1ELEE 3K2UA 1YLCA 2BLWA 4ZXXH 1HAIH 1HAVA 3T27A 1ZGVA 3QX5H 1OWDA 5F8XA 3BTHE 5DKMA 2ZPSA 4NZQA 4OS7A 2Q6FA 3BTME 2C93B 4U01A 3AASA 4AGKA 1KY9A 1GBAA 1TGTA 4Y8YA 1A4WH 2HNTC 2BD4A 2P95A 4I8HA 2BVSH 1HGTH 1OYTH 1P03A 5AHGH 4R19A 1HB0B 1MTNB 1NU7B 1SGIB 1GWAA 3KQDA 3K65B 1TMTH 1O37A 2XWAA 3P8NA 8GCHG 3HMSA 2Y81A 3DFJA 1O2YA 3U8OH 4B73A 1O2ZA 4XSKU 3RXTA 3SU6A 1INCA 3A85A 2P59A 3SU0A 1KSNA 1KXDA 4CBOA 2HGFA 4CBNA 1ANDA 5CS5A 2ZHFH 3QZQA 1EJNA 3SNAA 3AW1A 3UNRA 1GMDG 1EB1H 2VINA 2G8TA 3LGVA 4DCDA 1UTQA 6CHAB 1HKYA 1C9TA 4YO9A 1KLIH 5G4BA 4LZ1H 1EPTA 3HK6B 1W0YH 2SGAA 3SJ8A 1GI1A 2GZ8A 1BHXB 2OQUA 5C20A 1AKSA 4BOHA 5I25A 3FVFB 1ABIH 1TRMA 1I8NA 1H8DH 4IC5A 3Q77A 2YNBA 1F0TA 5FX5A 2VVCA 3HATH 2G52A 1UK2A 1ZJKA 2STBE 3ZVCA 2PKSB 3RXHA 1NO9H 1C2FA 3A87A 2ODYB 1K21H 4K2YA 3MTYA 1THRH 2NU0E 1YCPH 4NA9H 3RXLA 1KTTB 3E16B 1SVPA 1ZRBA 3H5CB 2YOLA 2FDAA 1TPAE 3LIWA 1QRWA 4LXBH 2FOBA 1S5SA 1HLTH 3BEIB 1BT7A 1ESAA 3E1XB 1IQEA 3A7VA 1LHGH 4AB9A 2YIOA 2BTCE 1WBGB 2B7DH 3ZVGA 1F5KU 3LJJA 3RXPA 3B9FH 2C8ZB 2VGCC 2DOHX 3ATKA 3Q00A 1O5AB 3L33A 4ISNA 1RD3B 1PYTC 3A86A 3M5MA 4NGAH 3KQBA 3DHKH 1OWJA 5T3HA 2BMGB 5T6DA 1ARCA 1TX6A 1KIGH 3SRIA 5IDKA 4WWYA 5C2ZA 5JBCS 1C5XB 1HFDA 4JCNA 3STIA 3UR6A 5HPGA 4KTCA 2PK4A 4YT7H 4Y7AA 5JBBS 1Z71A 4BTIB 1LVYA 5T6FA 2CXVA 4CRAA 5CT3A 1LTOA 1Z7KA 3GCTF 4OS6A 1D4PB 3UREA 1O5GH 3TGJE 1JMOH 1CHGA 2A4QA 3ZVDA 4BAKB 1MBMA 1GMCF 1LVMA 1SGDE 1BA8B 1BMMH 1YGCH 2V0BA 6GCHG 1TGNA 3T26A 2ZEBA 3LH3A 2JETB 1G32B 4B2AA 3TGIE 4DW2U 3D65E 1Y3YA 4AGJA 1BB0B 1AI8H 3ZZ4A 4FUDA 2SGDE 2Z9JA 2UWPA 1FJSA 1TNHA 4THNH 3AVZA 1KLTA 3UNQA 3SJOA 3UWIA 1K1NA 1NS3A 3MO6A 3D62A 3ATMA 1BTPA 1O3FA 4NSVA 2ZFTA 5EG4A 3ZVEA 1K9OE 1GHXH 1RGQA 2FOEA 1TQ0B 3H7OA 1WV7H 3MNSA 3NUMA 5LPEA 4MLFB 1AVXA 2PF2A 1LO6A 2UUKB 2ZCKP 4ABGA 3RXCA 1O2JA 2RA0A 2VWLA 2ZP0H 2G81E 3SV2H 1CVWH 1AQ7A 1LHEH 5HYOA 1ZOMA 4O3UA 4XBDA 1L1JA 3E0PB 1D6RA 4X0WU 4H4FA 1ANCA 4BXSA 3U98H 2A5AA 2FP7B 2HNTE 3RC5A 5B6OA 4DJZB 2CN0H 2UUFB 3TK6A 1UO6A 2NU4E 1CO7E 3RU4T 1FONA 4DVAU 3KGPA 1SGNE 4DOQA 2QXGA 2D26C 1GBIA 1PFXC 1EAXA 1QA0A 4CHAB 1AKSB 3RDZA 8GCHF 1AWHB 4A92A 1A3EH 1OKXA 1QQ4A 2YILA 5FCKA 2EI7A 3T29A 1WU1A 2AYWA 1PPZA 1VCWA 4ASHA 2ZQ1A 5ABWA 2ZDNA 1IQNA 1ZMLA 3C27B 1MTNC 5FPYA 1FPCH 1THPB 2C3SA 3B23B 3PMAB 1AVWA 2VU8E 1Z6EA 5HMAA 4OS1A 2Y82A 5EPYA 4IUAA 1GMDF 1T8LA 3HMTA 3UQVA 2FZZA 4I33A 1P2JA 1ZSJA 5L2ZH 3BTQE 1S84A 3KQEA 3A7WA 1J15A 2CMYA 2D2DA 1G2LA 2BDAA 2OTVA 4HZHA 2O9QA 5F03A 1W2KH 1IOEA 4JK6A 4BTUB 2VIVA 1ETRH 2Y6TA 2BB4A 2PR3A 1C5OH 3MI4A 4Y6DA 1P10A 3BG4B 4IN1A 1O3PB 6CHAC 2GCTC 4ABFA 2ODPA 1TONA 1SHHB 2PV9B 2PSYA 2K4RA 1DWCH 5CP9A 2H2ZA 3RP2A 1NROH 4FUFA 3SU3A 1HJ8A 3BT2A 2BDIA 3GY5A 1CT2E 2WPIS 1SLXB 2ZGCA 3SUGA 4X8SH 2XBXA 1SI5H 3I29A 1J17T 1TGCA 3OY6U 1KIVA 1BRCE 1DDJA 1OWEA 2J34A 3QGNB 2K1QA 1UCYE 2SGFE 1HIAA 1V2TT 1FY4A 1ZR0A 2CJIA 3KHVA 4ISIH 2LL4M 2ZTZA 1N1LA 2VIQA 5EXLA 1S0QA 1DWDH 2BOHB 5DP5A 1CGHA 3PLKA 5AFYH 1SLWB 1T8OA 3QDZB 4GCHG 2GGVB 2FODA 1HAYB 1RTLA 4BTTB 1IHSH 1G30B 1IQJA 2W3IA 1MCVA 1E34B 1QQUA 1LHDH 1MQ5A 3Q3YA 4Y76A 3GCHB 3T62A 2B0FA 2OCVB 1P11E 5FHTA 4FUEA 5EPNA 2R2WU 2Z3DA 1AUJA 3PWCA 8LPRA 2A4OA 4E06H 3BEFB 2I9BA 1TBRH 1PQ5A 1GBCA 5HGGA 3RUOA 1BUIA 1Z1JA 2IPHA 1I5KA 1CA0B 1TMUH 1C5ZB 6GCHF 1QBOA 2VJ1A 3SBKA 2JH6D 4BV5A 2ZNKH 5DP3A 2W7SA 2BZAA 2FPZA 1Y3XA 3SNBA 1AFEH 2WPLS 1GHYH 1SBWA 3VXFH 1BMLA 1ESTA 5DK1A 4WXIA 1QRZA 3LDXH 4K69A 2ZGXH 1O5EH 1ZHPA 1JOUB 2XW9A 1M9UA 3RMOH 2ZHWH 1UVTH 2J95A 4GVUA 4CH2B 2XC4A 4KGAA 2B8OH 2FOMB 2ODQA 2ZI2H 5DP7A 1GJ6A 1EOLA 1BRUP 1BTXA 1IQKA 2ZHDA 1GGDB 3LGIA 3SHCH 4AFQA 3MYWA 1LHCH 4K8BA 1ELFA 4I7YH 1XKBC 1E35B 1OPHB 2I6SA 1MU8B 3H7TA 4ZKRU 1F0UA 1P05A 1PK4A 1FAXA 1OS8A 2BX3A 3T28A 2EEKA 3PWBA 1V2RT 4UFDH 1LPKB 3RXEA 1AZ8A 1P09A 1AZZA 1O33A 3K6ZA 1DWEH 2BVRH 2YNAA 3BN9A 1MTWA 1DSTA 2XBYA 2WUCA 1O3AA 4FUBA 1SGYE 1EASA 3TJNA 1ZJDA 2LPRA 1O2RA 2W7UA 1KXEA 3ITIA 5ETXA 1NN6A 2ZHEH 3ZV9A 1GBTA 1L1NA 4ZHMU 2O8TA 1SGPE 1YXEA 1Y5UT 1G2MA 2TGDA 3TIUA 4MPVA 1C2LA 4CHAC 3TJUA 3OU0A 1FNIA 4JYVH 2FS8A 1QJ1B 3T25A 2RA3A 4WJG2 3FANA 2O8UA 4CIKA 4Y79A 1SGRE 2TGAA 4X8TH 1J8AA 1FLEE 2KJ4A 2HLCA 1BBRH 4TWYA 1FMGA 1P02A 2BY6X 1HIAB 2J94A 5TCCA 1G9IE 9ESTA 5EQQA 2VWMA 3QWCH 1N8OC 1L1GA 4GHQA 3SU5A 4B76A 1Y59T 2K51A 2EA3A 1A46H 1BQYA 1GI8B 1YPEH 2P8OB 3ZZ8A 2VWOA 4CRDA 3W94A 2Q6GA 3EQ0H 1P8VC 4XBCA 2FO9A 1HJAC 1H8IH 1GI6A 2ZDLA 3A8BA 1NRNH 1YF4A 2GKVE 1V2NT 2AFQB 2AIPA 1BHTA 1GBDA 2QF0A 3TH2H 1P12E 2XBWA 3BG4C 1FUJA 2KAIA 2OC0A 1YC0A 2Z3EA 2WYJA 2OP9A 4UE7H 4FUIA 2BDHA 3W95A 3VXEH 3HKIB 2RCEA 3ZVAA 1G3CA 1ANBA 1NFXA 3QTVH 1GP9A 2ZQ2A 1C4U2 2BLOA 2PUXB 4MQAA 3F9EA 1AHTH 1O3KA 1OSSA 1ZLRA 1ZMJA 2P16A 1QBNA 1CQQA 4GCHF 4LK4A 2M5TA 1O2IA 3EGKH 4HI3A 1GI7B 2FOAA 3LGWA 1SPJA 3Q3KA 3ZYDA 5C1XA 4ABDA 4OS2A 3GY8A 3SV6A 1K1JA 3AAVA 2RDLA 2VVUA 1MKXH 2ZDMA 2OC1A 1VITG 3S0NA 4UAOA 1KYNA 3ZVFA 1GHVH 1QNJA 4BNRA 3SJIA 3SNEA 1C2DA 4INLA 3P6ZB 1EZSC 1FIZA 2JH5D 3ATWA 1A1RA 1QFKH 5CHAB 2GV7A 4B1TA 4IW4E 3QO6A 3SJ9A 1GCTB 3RXOA 3BTGE 3UIRA 1FPHH 1LKBA 1QY6A 4X1NU 3ZZ9A 1IQIA 4U2WA 3BT1A 1Y5BT 5LGOA 2BVXH 2VIOA 3FFGA 1YPMH 3F9FA 1HXEH 2NU2E 1O3GA 2TBSA 2FI3E 2XC0A 4Y8ZA 3SORA 3LONA 3TK9A 1CA0C 4FUCA 1OOKB 1RJXB 1BMNH 1GHWH 5J4QA 4R0IA 3ZZ6A 1TBZH 1UCYK 1UTKA 1RRKA 5GPIB 2BM2A 1PPHE 1O3CA 2BD5A 2ZIQH 1E38B 3M3SA 1AO5A 2HNTF 4FU8A 3RC4A 1Z6JH 2FLRH 1GHBG 2XWBI 1O3IA 2FIRH 1QA7A 2ZFRH 3A81A 4MNWA 1Z8GA 3RU4D 2OD3B 2FTMA 1EJAA 2CF8H 1ORFA 1EAWA 3U69H 1SL3A 1YYY1 1DE7H 1RTFB 1XKAC 1OYQA 1XUGA 1ETTH 2Q6DA 1GGDC 2ZG0H 3E6PH 3ATLA 1EXFA 5DGJA 1VCPA 1C5UA 2GCHG 1FIWA 1ETSH 3ODFA 3KN2A 4A7IB 2BHGA 4O03A 2ZPRA 1A5GH 2P3FH 4DG4A 1GI3A 2FXRA 4Q7XA 3UOUA 4XFQA 1SGFG 2EC9H 4FXGH 3DD2H 1ELGA 2C8XB 1GHZA 4NSYA 3P8GA 1TLDA 3RXFA 1ID5H 3M5LA 4MPUA 2ZU4A 1F7ZA 4NA7A 3DA9B 2UUYA 3O8DA 1P2MA 1I71A 1YPGH 2QV1A 5GCHG 1O3LA 1S6FA 2ZF0H 1C2HA 3QTOH 2NWNA 3MO3A 2QCYA 2JKHA 2G51A 2KAIB 2TPIZ 2VIWA 4APLA 3M3TA 4FUGA 1MTSA 2BY9X 2AEIH 2R0KA 5AFZH 2JH0D 1UVOA 2FOFA 2RG3A 3AW0A 3PMHB 2VB0A 2FX6A 1HAXB 4UFFH 2H9EH 1KXCA 1OP0A 3RXKA 1SGEE 4KELA 1EP5A 1C1NA 4BVWA 2TRMA 1TNIA 1VJAU 3MH6A 1P0SH 3FAOA 2A5KA 4IC6A 3VFEA 1O3NA 1ZTLA 1GVZA 1IHTH 5C5NA 1NFWA 1DXPA 4ABHA 1GVKB 8ESTE 5E2OA 5JBTA 3A82A 2Q1JA 4DIHH 2AGEX 2Z8WA 1YBWA 4GUXA 1RTKA 2DOIA 1GI5A 1ZSLA 2FLBH 1MAXA 1CE5A 3A7ZA 2BXUH 2Z3CA 2P8OC 2ZFSA 1BRAA 1DOJA 1ELTA 1GJ4H 3NXPA 1MUEB 1ACBE 8KME2 3RXMA 2V3HH 1V2WT 1KLJH 3M7TA 1H1BA 3S69A 1O31A 1O2HA 1O30A 1Y3VA 5LPRA 1VCQA 2FYRA 2PGBB 1KXBA 2ZFQH 2EI6A 2FMJA 3MH4A 3SQEE 3HGNA 4TY7A 3FP8E 4YM9A 4K3JA 3RMNH 4OS4A 1W10U 4I32A 5K7RA 1SC8U 1QR3E 5ESBA 4CRBA 1NM6A 1W8KA 1UMAH 1LPZB 1P57B 1YPHE 2BY5X 2Z6BD 3RLYH 1C2GA 1C9PA 1GMHF 1XUHA 3STJA 3V13A 2A2XH 2ZDAH 2J8LA 4AORA 1MKWH 2ALPA 2Y5GA 4WVPE 4NA8A 4K8YA 1VITF 1WQSA 1B0EA 1WSSH 2F9OA 5T6GA 5K0HA 1O32A 1P2KA 3SI3H 3EA7A 4MPWA 1QL8A 4MNXA 4NFFA 1WTGH 4BANB 5L2YH 3M36A 3SHAH 1HAVB 3M3VA 1BTZA 1Y8TA 3LU9B 3F6UH 1VZQH 3GCOA 3NKKA 3CS7A 1P06A 1B5GH 4X6MA 3EYDA 2HGTH 1C5YB 3SW2B 3KIVA 1TNGA 2DE9A 5H4IB 5EU8A 4ISOA 2NU3E 1XVMA 1FN6A 5CHAC 4Z0EA 2H5DA 1PPEE 4K1TA 2GDEH 1GCTC 1JXPA 1P2IA 1RS0A 2A31A 1ZSKA 3LJOA 3EA8A 4ESTE 1N6XA 2A32A 4X1RU 1O2UA 2OXSA 3SV7A 4AG1A 1C5VA 1GI4A 2WUBA 2XYAA 3OYPA 1GHBF 4GPGA 4LZ4B 3RXJA 1O5BB 2TGTA 2FOHA 1HJ9A 3PM3A 1GJ9B 2PLXA 1DT2A 5DP6A 2XRCA 1ANEA 1NZQH 2ZU5A 3E91A 1GBBA 5FCRA 1KRNA 3QK1A 1GDNA 3BIUH 3M5OA 4YESB 3ZZBA 2VIPA 3HKJB 5DO4H 1NU9A 3SU2A 1U6QA 2ZZUH 1D3TB 3EDXB 2GCHF 1AGJA 3UPEA 1TPPA 1EPTB 4AFSA 1PMKA 4APMA 3SUEA 3MU0A 3FZDA 1NL2A 1V2LT 4GLYA 4KIVA 2BD9A 1O5DH 1O3MA 4TYDA 6LPRA 1MTVA 1ZPZA 3S9CA 4TY6A 3GDUA 1HBTH 2GD4B 1URKA 1P9SA 3R0FA 1O2GH 1LQEA 5CS3A 3P92A 3LT3A 5GCHF 1K22H 2ZPQA 3MNBA 3QZRA 1W81A 1K1LA 1XXFA 2QYIA 5FAHA 5L30H 1DUAA 1NRSH 4A6LA 1O3JA 4MDSA 2A7JA 1OWKA 1LVOA 1LVBA 1LPGB 4AB8A 1JIRA 1GJDB 1Y3WA 4RSPA 1C5SA 3KF2A 3SNDA 2PSXA 1D9IA 2PWXA 5DPAA 3OY5U 7ESTE 1VR1H 1VGCB 2AS9A 4AYYB 2ZGHA 1O0DH 1FDPA 1O38A 7GCHG 3O8CA 1W7XH 2WPHS 1THSH 3URCA 2SFAA 4NIYA 4XBBA 2AGGX 1CGIE 3PLBA 2KNFA 4D7FA 3R3GB 1P3CA 2XNIA 4DIIH 1MQ6A 2ZECA 1ZHRA 4ABBA 4FU7A 1BJUA 1A3BH 1GJCB 4TPYA 2HPPH 2BQ7B 1C1RA 3F9GA 1GBMA 1D6WA 1P9UA 4WXVA 5E0GA 2BXTH 3ZZ3A 4ISLA 1W13U 1DANH 3GYLB 1SGQE 3MH7A 2F9NA 3HK3B 1YM0A 4CH8B 4UEHH 2PKSC 2QAAA 1ARBA 2BY7X 2CF9H 1HDTH 1AB9B 2ALVA 1TNLA 1DXWA 3KQCA 1XUFA 2GT7A 1HPKA 3F1SB 4XDEA 4I8KA 3U73A 1V2VT 3K9XB 3TNSA 3SNCA 1YP9A 3MU5A 3TVJB 3NZIA 1RIWB 4SGAE 2BX4A 3RXAA 1O3EA 5A8ZA 2OBOA 1Z1IA 1SLUB 1O2SA 1C2IA 1C2KA 2BDYA 1GHAG 5EGMA 3L6PA 1FN8A 1KXAA 4FUHA 3TPIZ 1GI0A 3SP8A 1Y3UA 2V3OH 4Y8XA 4AFZA 4ZXYH 1UTLM 3CP7A 4WH6A 2I6QA 3RMLH 1AFQB 1GDQA 3IWMA 3QLPH 2Z8VA 3BSQA 2FI4E 2WYGA 4AN7A 1GL1A 4B2BA 1QB9A 4X2YA 1HV7A 2QIQA 1HXFH 4FUJA 2FI5E 3VEQB 3PMBB 5JB9S 1VITH 4BVCA 4CR9A 2GP9B 1EP6A 3AAUA 3TJVA 4RKJB 1TGBA 3HN4A 4CRGA 5CMXH 4OS5A 2DUCA 4UV6A 3UUZA 1BDAA 1BTWA 5EODA 1V2KT 1TBQH 1YCPK 3U1IB 4HGCA 1FXYA 2JETC 1P04A 2CHAB 2Z9LA 1SGCA 3BV9B 4AYVB 2QXIA 2VVVA 3EAJA 1O39A 1L4DA 5AF9H 3K6YA 1O34A 1AWFH 3UNSA 1NTPA 4B75A 1HCGA 4GAWA 3V0XA 1XUIA 1DY8A 3D23A 1EB2A 2VNTA 4BVDA 1JFNA 1C5LH 1A5HA 2CGAA 1A7SA 1KTSB 4X6NA 5CT1A 3V7TA 1UVSH 1W0ZU 4HTCH 4BAQB 3T2NA 1UJ1A 1E37B 1EAUA 4NZLA 1C2MA 1C1QA 1UTJA 1K1MA 1W8BH 1SB1H 2Y7ZA 5PTPA 1SLVB 2GTBA 4YOIA 1S85A 4U32A 2Q8AA 1K28D 1T4VH 1EPTC 1O2PA 3GY7A 4X6OA 5C67A 1UHBA 1HAOH 4ABJA 3UOPA 2P93A 1CEAA 3GYMA 3LC3A 3MOCA 1A2CH 1BJVA 4Y11E 2BYAX 1QHRB 1SQTA 2G00A 1PPGE 2XCNA 1GJ7B 2G4TA 1MU6B 5HM2A 4YLUA 3MNCA 2R9PA 3FZZA 2TIOA 5JBAS 1QL7A 1O2LA 1PQAA 1T4UH 4YTAA 1C5TA 5GIBA 1OX1A 1TAWA 3MH5A 2FEBA 7GCHF
chains in the Genus database with same CATH superfamily
1W12U 1QBVH 1MAYA 1FY3A 2J4IA 3OFND 3NPSA 4NFEA 1HAPH 5AVDA 4F4OC 2HVXA 3FN8A 4Z0KA 4X1SU 3H09A 3VGCB 4MNVA 4I8JA 1FY5A 3SN8A 2IOTA 2J9NA 5GJ4B 4Z0DA 3TJOA 1IAUA 3LPRA 1S0RA 1BTYA 4A1XA 1VGCC 5JYIA 1ELVA 1N6YA 1SOZA 1UTMA 4IGDA 1SGFA 4INHA 1H4WA 5HM9A 4FVBA 2GMTB 3GDVA 1W3CA 4CRFA 1J16A 3ZZ7A 1B2IA 1BOQA 3LGTA 4JK5A 5C5OA 4IMZA 1NBMD 1CHOG 1TFXA 3O8BA 3RXGA 1P3EA 1XUKA 1D3DB 2PP6A 4MVNA 4Q7ZA 4RKOB 4ABEA 1IQFA 1QJ6B 3LGUA 1EZXC 4ZAEA 4NIXA 3FP7E 1C5RA 3VB3A 1NPMA 1O3DA 1O2KA 4D9QA 1F0RA 1JRSA 2G4UA 1YLDA 3LOXA 2UWOA 1AVGH 4ISHH 3QUMP 1AB9C 1Z8IB 5F6MA 1GMHG 4NG9H 1GHAF 1MD7A 2G5VA 1YPHC 4CRCA 2G5NA 3E6PL 4AZ2B 3KIDU 2FD6A 4H6TA 1RIWC 1YCPM 1NK1A 1C5WB 3Q3XA 1AY6H 4UONA 1X7AC 1EQ9A 1GBJA 3GCHC 5C1UA 3KYFA 1S6HA 2Y5FA 4O9VA 1O2OA 1TRNA 3WW7A 3F9HA 5LH8A 1SQOA 4X2VA 1C1VH 2WSSD 1PPBH 2HRVA 3I77A 4H6SB 3LC5A 2J38A 3NWUA 2PGQB 3RMMH 3U8RH 1AFQC 1FV9A 2ZA5A 2J92A 4NWKA 2WPMS 1EKBB 3I78A 5L6NH 1WTHD 5JPMH 1EAIA 4Y7BA 3M7UA 2QGRA 4ZHAA 4X8VH 3E0NB 1F0SA 4DY7B 3S7HB 3ESTA 1NY22 4TPIZ 1GG6B 4X1PU 1IQMA 1HPJA 3B8JA 2AIQA 1AIXH 4ZKNU 5J4SA 1SFQB 1CU1A 1ZTKA 2H9HA 1XXDA 1IQGA 3UQOA 1TABE 3TGKE 4R8TB 4E05H 3OEHD 1UHBB 4JZ1A 1F5LA 4OGYA 2WV5A 2CHAC 3A7TA 1G3BA 1TX7A 2VH0A 1SHYA 4A1VA 2KM0A 2Z9KA 2Y80A 3TITA 3PTBA 3KNXA 1GJ5H 3MQKC 4Z0FA 5C1YA 5A0BA 1GBFA 3SZNA 2KCYA 1ZPBA 2UUJB 4XOJA 4D8NA 2BZ6H 2QA9E 3RXVA 3L3TA 2A4GA 4R1AA 3PLPA 3MNXA 1TE0A 4LOYH 1XVOA 1C4V2 1OHHD 1DUEA 1DY9A 1DM4B 1Z40A 2ZKSA 1HNEE 4DT4A 2ZWLH 1DFPA 5EW2H 5GWZA 1KMHB 3BIVH 3U9AH 3HGPA 5DP8A 4D7GA 2K0QA 3DSPA 3VB6A 3EE0B 1WOFA 1O3HA 2W5EA 3UWJH 4INKA 5CS1A 2P94A 4RT0A 1E1QD 2XCFA 3RC6A 4NWLA 3U28C 1C1TA 1NFYA 2FTLE 2Q8BA 3GCNA 1MH0A 2QC2A 4JZFH 1TRYA 1SGTA 1V2OT 4Y0ZE 2BQWB 3PV4A 4RT1A 4O97A 4YLQH 3BF6H 1P2NA 1NL1A 2V6NA 2F43B 1ZPCA 2Y8RA 3RXDA 2XBVA 3BTTE 2V35A 3ZZCA 2WPKS 1C5QA 4Q80A 4ABIA 1Z8RA 3EA9A 4Q2KA 4M9FA 2I9AA 2FX4A 4D3CA 1C5MD 4U30A 1TGSZ 2GCTB 3A80A 4M7GA 4E7RG 2H9TH 2VBCA 3G01A 3ELAH 3SU4A 3Q76A 1V2ST 1EZQA 5A8XA 2AMQA 2P3UB 1PYTD 2PKAA 1UTPA 4ZUHA 4CREA 4BVVA 3P17H 1O2WA 2BD7A 5CE1A 3RXUA 1GCDA 5FPTA 5EXMA 3MU1A 4YOGA 1F2SE 3A84A 2YIPA 4X6PA 2O8MA 2HWLB 1CEBA 4WMFA 3TH4H 3URDA 2D1JA 1IQHA 3KEEA 1CHOF 1H9LB 1BRBE 1K1OA 1MZDA 3VGCC 5EW1H 2Z7FE 3RXBA 2ULLA 1TALA 2PUQH 2SPTA 2L6OA 3RM0H 3TU7H 5FPSA 4BAHB 1T7CA 5I46H 1TPSA 1KXFA 1UTNA 2VWNA 1TMBH 3MHWU 4ZROA 2GMTC 1ELBA 1T8NA 2THFB 3WY8A 1J14A 3SO3A 1P01A 1O2TA 4UD9H 4GSOA 1P2QA 3VPKA 2BOKA 2ESTE 1WUNH 3MU8A 3TH3H 2LP6A 4NCYA 4OGXA 1O5FH 2BD3A 5F8ZA 2D8WA 3A88A 1ZGIA 1O2QA 2XC5A 1UVUH 1JWTA 3SJKA 4TSFD 3O8RA 2C8WB 5ESTE 3DUXH 3PYHA 3SV8A 5A8YA 1BBRK 4JYUH 4BXWA 2PTCE 1SMFE 2A1DB 2GDDA 5DP9A 1BITA 2IPQX 3JZ2B 1JBUH 1MTUA 2BD2A 2F83A 2ZFFH 3M5NA 4AX9H 1O3OA 1XMNB 2FM2A 4HG6A 9LPRA 1DVAH 1HAHH 2ILNA 1GDUA 2B9LA 3OTPA 2Z9IA 2H6MA 1BTUA 1OP8A 4I8LA 4KP0A 1H9HE 3PO1B 2ZTXA 2SGEE 3PMJA 1EX3A 2QF3A 1T31A 3SI4H 5GXPA 5FBIA 4I8GA 4TWWA 2AMPA 3F0OA 1ELAA 3P95A 1PMLA 4B71A 1BMAA 3OX7U 1TX8A 4I31A 5DJ7A 1AMHA 3LAQA 5TJXA 1GI9B 2QJ4A 2FOCA 2AHME 2AMDA 1B7XB 1A0LA 3SOSA 3SGAE 1YLNA 1GG6C 4YZUA 3E3TA 1GL0E 1LMWB 4R1BA 3SRJA 3BTKE 2IN2A 1BTHH 1DITH 1OWHA 3LKWA 1S83A 4AG2A 3SGQE 1CA8B 1G3DA 4ZMAH 1NRPH 2G55A 1GBKA 3RXSA 1GVLA 1DX5M 3ATIA 1D3QB 3MU4A 1SFIA 1E0FD 1L2EA 2ANMH 3V3MA 5DN6D 1BZXE 4Z6AH 1F5RA 4J2YB 3BTWE 1NRQH 1MKXK 2XXLA 5TCAA 4FOUC 3FO8D 3ZLEA 2ZGBH 3E8LA 4Q7YA 4DT7B 1T32A 3UTUH 1FI8A 2PKAB 2RDEA 2OC7A 2A0QB 1C1WH 1KDQA 1OXGA 2W3KA 2SNWA 4DGJA 2F91A 3N7OA 3RU4E 2TGPZ 5SGAE 1TWXB 2KCOA 3RXIA 1SOTA 2GVFA 2F9UA 4I86A 3PTNA 1TIOA 5DP4A 3IG6B 2ASUB 2HPQH 3QN7A 2QXHA 3NK8A 1A5IA 1QURH 1NFUA 2K8IA 2ZU3A 1DLEA 1CT4E 1BHXF 1FZZA 3GDSA 1OWIA 2ZU1A 1ZZZA 5IYTA 4E7NA 4UFEH 1CBWB 1N8OB 2ZCLP 1UK3A 2A7CA 3BEUA 2QN5T 5BRRE 1C2JA 1QL9A 2R3YA 1QB1A 2PF1A 1PQ8A 4K1SA 1FY8E 1P2OA 2LELA 3F2GA 4O3TA 4Y71A 5CSQA 1YPJH 1ZYOA 4D76A 3NRLA 1ELCA 3LH1A 1PK2A 1O2MA 1LKAA 1HJAB 4X1QU 2W26A 1QGFA 3ZV8A 2HLDD 5CT2A 5GDSH 2BDCA 3CS0A 1MCTA 1QJ7B 1TQ7B 4ZHLU 1K1PA 1DICA 2WINI 3MO9A 4JZIA 1B0FA 1DWBH 1GBLA 1EJMA 1GJBB 5E8EH 2Y7XA 3RM2H 4WMDA 5EJZA 1G37A 1GPZA 1S82A 1V2MT 1ESBA 4ZH8A 4CR5A 1A0HA 3ZVBA 1G36A 3MWIU 3OSYA 3GY2A 2ZHQH 3N7DA 4GHTA 1V6DA 2O8LA 1TA6A 5LPFA 2C4FH 1UCYH 1FAKH 1Y5AT 4K5ZA 4D9RA 1PPFE 4BAOB 3BTDE 3V12A 3CENA 2X2ZA 3A83A 4X8UH 5A2MH 4FVDA 4H42U 1V2JT 1MZAA 3RLWH 4UDWH 3M35A 3VB4A 5JDUB 1ZMNA 1F92A 7KMEH 1CSOE 3BG8A 3ZWZA 3DT0H 1HYLA 3GY4A 2FYQA 1FY1A 3MFJA 1SSXA 3SUDA 3F2FA 3T5FH 4NIWA 3UR9A 2UWLA 4VGCB 1LQDB 3TLOA 4NIVA 1C1OA 2ANYA 5F8TA 4WH8A 2F3CE 1L0ZA 3P8FA 1XM1A 3CNRA 3U8TH 2STAE 5C3NA 4ACBA 1V2UT 2WPJS 1CT0E 1YPLH 1TB6H 2BQ6B 2GZ9A 5F53A 2QJ2A 1MBQA 2Y5HA 1GJ8B 2CV3A 4A5TS 4KTSA 5FBEA 3MKPA 2GT8A 2H1UA 2V7QD 2GV6A 3F68H 2B5TB 3M37A 4FU9A 3UFAA 3HMRA 3SYJA 1HPGA 2VIDA 1XUJA 1L4ZA 2GJGA 4MPXA 3S9AA 4K60A 5FX6A 1LDTT 3DFLA 4PROA 3VB7A 2ZDVH 3HPTB 2A7HA 1BIOA 2BLVA 2ZC9H 3P70B 3P8OA 4Y10E 3WWBA 5EJ1A 3PO1C 4J1YA 4DURA 1SG8B 1KDQB 1CGJE 3E90B 3M61U 1MD8A 1C5PA 1W11U 1TPKA 6ESTA 2OQ5A 1HRTH 2ANWA 2BY8X 2BD8A 2PTNA 1J9CH 1T8MA 2ZO3H 1EOJA 1NESE 2NU1E 1O36A 1GBHA 4JMYA 3IITA 1MKWK 3MMGA 2QXJA 1C1SA 1TNJA 1ABJH 2OC8A 1WXRA 2FWWA 1PPCE 2WV4A 5C94A 2OBQA 1UK4A 1UTOA 4JYTA 3SU1A 5E2PA 3TK5A 2K13X 2A4RA 2LL3A 2PHBA 2QY0B 1EATA 2ZDKA 3DSGA 3OAAD 1K2I1 3SQHE 3ZYEA 1FQ3A 4X2WA 2FEQH 1VJ9U 2IJOB 1IQLA 2FOGA 3FP6E 5EXNA 2J2UA 2O8WA 2Z9GA 3S7KB 4RN6A 4BAMB 4QT8C 1O2XA 1NT1A 1V2QT 3A8CA 1DPOA 2AGIX 3KCGH 3C1KA 3A8AA 1A0HB 1LHFH 2HPQP 1BBRE 2HOBA 1YKTA 1TOCB 1DS2E 2R3UA 4UFGH 4WF8A 1TA2A 2ANKH 4F49A 5C0TA 2XTTB 2C90B 1HUTH 3ENSB 2L0SA 3PROA 1C2EA 4MTBA 1BCUH 3ODDA 1QTFA 1PQ7A 4KTUA 1ZRKA 1QRXA 1AE5A 3GOVB 3RXRA 4YOJA 3K65A 2J8JA 3GY3A 3ZZ5A 5A0AE 1CBWC 4ABAA 2WZQA 5DG6A 1PJPA 3A7XA 3LGYA 1HAGE 3S9BA 1RFNA 2HPPP 2F9VA 2ZU2A 1QB6A 1KI0A 2C8YB 1O2VA 5HXFA 1XX9A 3RXQA 1GJAB 1AN1E 1ZHMA 3SUFA 3GISB 2SGQE 3JZ1B 5FXLA 1TPOA 4WMEA 2SGPE 2BDBA 1C1MA 1Q31A 3SGBE 1EZUC 1GI2A 1MMJN 1SR5C 2VGCB 3OTJE 1AU8A 2ZGJA 1PKRA 1DSUA 1UVPA 2KL5A 1LCYA 1TYNA 1G3EA 3A7YA 3M7QA 4HFPB 4MG3A 5EOKA 4ZKOU 4P00A 3SZEA 1C5NH 1JIMA 1A61H 5JB8S 4Z09A 2F9PA 2F9BH 2W6JD 3UY9A 2HALA 3ZZDA 2GZ7A 4Y0YE 1YPKH 5EQSA 1TOMH 3EE7A 4ZKSU 1E36B 4XE4A 1SQAA 4BV7A 3TNTA 2OUAA 2OINA 2ZFPH 1WYKA 3PB1E 1GBEA 2PW8H 4JZEH 5COEA 2BDGA 2A5IA 1GMNA 1RXPA 2LNCA 1KDUA 1NC6A 1O35A 1O5CB 2AERH 3VB5A 2R2MB 2R0LA 4IBLH 2A2QH 2RFKC 1H9IE 4JZDH 1OP2A 5EQRA 3GCTG 4IS5A 2GX4A 3NCLA 1V2PT 5BPEA 2BLQA 2FS9A 4VGCC 5E0JA 4AOQA 3PV2A 1QIXB 1C4Y2 1S81A 1QCPA 3ZZAA 1ZTJA 2A45B 3A8DA 5A09A 2AH4X 2H5CA 1A0JA 4X2XA 1AD8H 5E0HA 4B74A 3U1JB 1HAZB 4WY3A 2PFEA 1GMCG 3BTFE 2CK3D 1V3XA 1TNKA 1Z8JB 2DE8A 1NRRH 1ELDE 5CS9A 1AUTC 1W7GH 1K1IA 1Q3XA 4A1TA 5A0CA 2P3TB 1DLKB 1WAYB 2Z94A 1C1UH 1Q2WA 3D49H 2VH6A 3A89A 1W14U 5C17A 1O2NA 4K1EA 1D3PB 3SV9A 4YT6H 4KKDA 3GICB 2ZCHP 1O3BA 2OLGA 1AE8H 3KL6A 2EI8A 4IMQA 1WCZA 1C1PA 1GMOA 4B2CA 4AFUA 2SNVA 4MNYA 2ZTYA 3QGJA 4R1CA 7LPRA 1JRTA 3GY6A 2FESH 4XRNA 4SGBE 1EUFA 3BTEE 4IN2A 4P02A 1WQVH 5EIYA 1ELEE 3K2UA 1YLCA 2BLWA 4ZXXH 5FL7D 1HAIH 1HAVA 3T27A 1ZGVA 3QX5H 1OWDA 5F8XA 3BTHE 5DKMA 2ZPSA 4NZQA 4OS7A 2KR7A 2Q6FA 3BTME 2C93B 4U01A 3AASA 4AGKA 1KY9A 1GBAA 1TGTA 4Y8YA 1A4WH 2HNTC 2BD4A 2P95A 4I8HA 2BVSH 1HGTH 1OYTH 1P03A 5AHGH 4R19A 1HB0B 1MTNB 1NU7B 1SGIB 5GNDA 1GWAA 3KQDA 3K65B 1TMTH 1O37A 2XWAA 3P8NA 8GCHG 3HMSA 2Y81A 3DFJA 1O2YA 3U8OH 4B73A 1O2ZA 4XSKU 3RXTA 3SU6A 1INCA 3A85A 2P59A 3SU0A 1KSNA 1KXDA 4CBOA 2HGFA 4CBNA 1ANDA 5CS5A 2ZHFH 3QZQA 1EJNA 3SNAA 3AW1A 3UNRA 1GMDG 1EB1H 2VINA 2G8TA 3LGVA 4DCDA 1UTQA 4B6FA 6CHAB 1C9TA 1HKYA 4YO9A 1KLIH 5G4BA 4LZ1H 1EPTA 3HK6B 1W0YH 2SGAA 3SJ8A 1GI1A 2GZ8A 1BHXB 2OQUA 5C20A 1AKSA 4BOHA 5I25A 3FVFB 5T1VA 1ABIH 1TRMA 1I8NA 1H8DH 4IC5A 3Q77A 2YNBA 1F0TA 5FX5A 2VVCA 3HATH 2G52A 1UK2A 1ZJKA 2STBE 3ZVCA 2PKSB 3RXHA 1NO9H 1C2FA 3A87A 2ODYB 1K21H 4K2YA 3MTYA 1THRH 2NU0E 1YCPH 4NA9H 3RXLA 1KTTB 4Z1MD 3E16B 1SVPA 1ZRBA 3H5CB 2YOLA 2FDAA 1TPAE 3LIWA 1QRWA 4LXBH 3PRBA 2FOBA 1S5SA 1HLTH 3PV5A 3BEIB 1BT7A 1ESAA 3E1XB 1IQEA 3A7VA 1LHGH 4AB9A 2YIOA 2BTCE 1WBGB 2B7DH 3ZVGA 1F5KU 3LJJA 3RXPA 3B9FH 2C8ZB 2VGCC 2DOHX 3ATKA 3Q00A 1O5AB 3L33A 4ISNA 1RD3B 1PYTC 3A86A 3M5MA 4NGAH 3KQBA 3DHKH 1OWJA 5T3HA 2BMGB 5T6DA 1ARCA 1TX6A 1KIGH 3SRIA 5IDKA 4WWYA 5C2ZA 5JBCS 1C5XB 1HFDA 4JCNA 1NBME 3STIA 3UR6A 5HPGA 4KTCA 2PK4A 4YT7H 4Y7AA 5JBBS 1Z71A 4BTIB 1LVYA 5T6FA 2CXVA 4CRAA 5CT3A 1LTOA 1Z7KA 3GCTF 4OS6A 1D4PB 3UREA 2XNDD 1O5GH 3TGJE 1JMOH 1CHGA 2A4QA 3ZVDA 4BAKB 1MBMA 1GMCF 1LVMA 1SGDE 1BA8B 1BMMH 1YGCH 2V0BA 6GCHG 1TGNA 3T26A 2ZEBA 3LH3A 2JETB 1G32B 4B2AA 3TGIE 4DW2U 3D65E 3F2HA 1Y3YA 4AGJA 1BB0B 1AI8H 3ZZ4A 4FUDA 2SGDE 2Z9JA 2UWPA 1FJSA 1TNHA 4THNH 3W1EA 3AVZA 1KLTA 3UNQA 3SJOA 3UWIA 1K1NA 1NS3A 3MO6A 3D62A 3ATMA 5B6LA 1BTPA 1O3FA 4NSVA 2ZFTA 5EG4A 3ZVEA 1K9OE 1GHXH 1RGQA 2FOEA 1TQ0B 3H7OA 1WV7H 3MNSA 3NUMA 5LPEA 4MLFB 1AVXA 2PF2A 1LO6A 2UUKB 2ZCKP 4ABGA 3RXCA 1O2JA 2RA0A 2VWLA 2ZP0H 2G81E 3SV2H 1CVWH 1AQ7A 1LHEH 5HYOA 1ZOMA 4O3UA 4XBDA 1L1JA 3E0PB 1D6RA 4X0WU 4H4FA 1ANCA 4BXSA 3U98H 2A5AA 2FP7B 2HNTE 3RC5A 5B6OA 4DJZB 3FKSD 2CN0H 2UUFB 3TK6A 1UO6A 2NU4E 1CO7E 3RU4T 1FONA 4DVAU 3KGPA 1SGNE 4DOQA 2QXGA 2D26C 1GBIA 1PFXC 1EAXA 1QA0A 4CHAB 1AKSB 3RDZA 8GCHF 1AWHB 3DSOA 4A92A 1A3EH 2QE7D 2F4LA 1OKXA 1QQ4A 2YILA 5FCKA 2EI7A 3T29A 1WU1A 2AYWA 1PPZA 1VCWA 4ASHA 2ZQ1A 5ABWA 2ZDNA 1IQNA 1ZMLA 3C27B 1MTNC 5FPYA 4ASUD 1FPCH 1THPB 2C3SA 2KFWA 3B23B 3PMAB 1AVWA 2VU8E 1Z6EA 5HMAA 4OS1A 2Y82A 5EPYA 4IUAA 1GMDF 1T8LA 3HMTA 3UQVA 2FZZA 4I33A 1P2JA 1ZSJA 5L2ZH 2YMSD 3BTQE 1S84A 3KQEA 3A7WA 1J15A 2CMYA 2D2DA 1G2LA 2BDAA 2OTVA 4HZHA 2O9QA 2M2AA 5F03A 1W2KH 1IOEA 4JK6A 4BTUB 2VIVA 1ETRH 2Y6TA 2BB4A 2PR3A 1C5OH 3MI4A 4Y6DA 1P10A 3BG4B 4IN1A 1O3PB 6CHAC 3OEED 2GCTC 4ABFA 2ODPA 1TONA 1SHHB 2PV9B 2PSYA 2K4RA 1DWCH 5CP9A 2H2ZA 3RP2A 1NROH 4FUFA 3SU3A 1HJ8A 3BT2A 4Q4LA 2BDIA 3GY5A 2V3MA 1CT2E 2WPIS 1H8HD 1SLXB 2ZGCA 3SUGA 4X8SH 2XBXA 1SI5H 3I29A 1J17T 1TGCA 3OY6U 1KIVA 1BRCE 2J98A 1DDJA 1OWEA 2J34A 3QGNB 2K1QA 1UCYE 2SGFE 1HIAA 1V2TT 1FY4A 1ZR0A 2CJIA 3KHVA 4ISIH 2LL4M 2ZTZA 1N1LA 2VIQA 5EXLA 1S0QA 1DWDH 2BOHB 5DP5A 1CGHA 1FX0B 3OE7D 3PLKA 5AFYH 1SLWB 1T8OA 3QDZB 4GCHG 2GGVB 2FODA 1HAYB 1RTLA 4BTTB 1IHSH 1G30B 1IQJA 2W3IA 3DCLA 1MCVA 1E34B 1QQUA 1LHDH 1MQ5A 3Q3YA 4Y76A 3GCHB 4F55A 3T62A 2B0FA 5KGOA 2OCVB 1P11E 5FHTA 1YY3A 4FUEA 5EPNA 2R2WU 2Z3DA 1AUJA 3PWCA 8LPRA 2A4OA 4E06H 4YIVA 3BEFB 2I9BA 1TBRH 1PQ5A 1GBCA 5HGGA 3RUOA 1BUIA 1Z1JA 2IPHA 1I5KA 5HIZA 1CA0B 1TMUH 1C5ZB 6GCHF 1QBOA 2VJ1A 3SBKA 2JH6D 4BV5A 2ZNKH 5DP3A 2W7SA 2BZAA 2FPZA 1Y3XA 3SNBA 1AFEH 2WPLS 1GHYH 1SBWA 3VXFH 1BMLA 5DSFA 1ESTA 5DK1A 4WXIA 1QRZA 3LDXH 4K69A 2ZGXH 1O5EH 1ZHPA 1JOUB 2XW9A 2HVYB 1M9UA 3RMOH 2ZHWH 1UVTH 2QF4A 2J95A 4GVUA 4CH2B 2XC4A 4KGAA 2B8OH 2FOMB 2ODQA 2ZI2H 5DP7A 1GJ6A 1EOLA 1BRUP 1BTXA 1IQKA 2ZHDA 1GGDB 3LGIA 3SHCH 4AFQA 3MYWA 1LHCH 4K8BA 1ELFA 4I7YH 1XKBC 1E35B 2KX4A 1OPHB 2I6SA 3UB0A 1MU8B 3H7TA 4ZKRU 1F0UA 1P05A 1PK4A 1FAXA 1OS8A 2BX3A 3T28A 2EEKA 3PWBA 1V2RT 4UFDH 3VG8A 1LPKB 3RXEA 1AZ8A 1P09A 1AZZA 1O33A 3K6ZA 1DWEH 2BVRH 2YNAA 3BN9A 1MTWA 1DSTA 2XBYA 2WUCA 1O3AA 4FUBA 1SGYE 1EASA 3TJNA 1ZJDA 2LPRA 1O2RA 2W7UA 1KXEA 3ITIA 5ETXA 1NN6A 2ZHEH 3ZV9A 1GBTA 1L1NA 4ZHMU 2O8TA 1K0HA 1SGPE 1YXEA 1Y5UT 1G2MA 2TGDA 3TIUA 4MPVA 1C2LA 4CHAC 3TJUA 3OU0A 1FNIA 4JYVH 2FS8A 1QJ1B 3T25A 4RI0A 2RA3A 4WJG2 3FANA 1W0JD 2O8UA 4CIKA 4Y79A 1SGRE 2TGAA 4X8TH 1J8AA 1FLEE 2KJ4A 2HLCA 1BBRH 3UAIC 2J98B 4TWYA 1FMGA 1P02A 2BY6X 1HIAB 2J94A 5TCCA 1G9IE 9ESTA 5EQQA 2VWMA 3QWCH 1N8OC 1L1GA 4GHQA 3SU5A 4B76A 1Y59T 2K51A 2EA3A 1A46H 1BQYA 1GI8B 1YPEH 1BMFD 2P8OB 3ZZ8A 2VWOA 4CRDA 3W94A 2Q6GA 3EQ0H 1P8VC 4XBCA 2FO9A 1HJAC 1H8IH 1GI6A 2ZDLA 3A8BA 1NRNH 1YF4A 2GKVE 1V2NT 2AFQB 2AIPA 1BHTA 1GBDA 2QF0A 2XOKD 3TH2H 1P12E 2XBWA 3BG4C 1FUJA 2KAIA 2OC0A 1YC0A 2Z3EA 2WYJA 2OP9A 4UE7H 2L74A 4FUIA 2BDHA 3W95A 3VXEH 3HKIB 2RCEA 3ZVAA 1G3CA 1ANBA 1NFXA 3QTVH 1GP9A 2ZQ2A 1C4U2 2BLOA 2PUXB 4MQAA 3F9EA 1AHTH 1WDIA 1O3KA 1OSSA 1ZLRA 1ZMJA 2P16A 1QBNA 1CQQA 4GCHF 4LK4A 2M5TA 1O2IA 2JDID 3EGKH 4HI3A 1GI7B 2FOAA 3LGWA 1SPJA 3Q3KA 3ZYDA 5C1XA 5IK2D 4ABDA 4OS2A 3GY8A 3SV6A 1K1JA 1S6LA 3AAVA 2RDLA 2VVUA 1MKXH 2ZDMA 1MABB 2OC1A 1VITG 3S0NA 4UAOA 1KYNA 3ZVFA 1GHVH 1QNJA 4BNRA 3SJIA 1YWUA 3SNEA 1C2DA 4INLA 5HKKD 3P6ZB 1EZSC 1FIZA 2JH5D 3ATWA 1A1RA 1QFKH 5CHAB 2GV7A 4B1TA 4IW4E 3QO6A 3SJ9A 1GCTB 3RXOA 3BTGE 3UIRA 1FPHH 1LKBA 1QY6A 4X1NU 3ZZ9A 1IQIA 4U2WA 3BT1A 1Y5BT 5LGOA 2BVXH 2VIOA 3FFGA 1YPMH 3F9FA 1HXEH 2NU2E 1O3GA 2TBSA 2FI3E 2XC0A 4Y8ZA 3SORA 3LONA 3TK9A 1CA0C 4FUCA 1OOKB 1RJXB 1BMNH 1GHWH 5J4QA 4R0IA 3ZZ6A 1TBZH 1UCYK 1UTKA 1RRKA 5GPIB 2BM2A 1PPHE 1O3CA 2BD5A 2ZIQH 1E38B 3M3SA 1AO5A 2HNTF 2JIZD 4FU8A 3RC4A 1UW7A 1Z6JH 2FLRH 1GHBG 2XWBI 1O3IA 2FIRH 1QA7A 2ZFRH 3A81A 4MNWA 1Z8GA 3RU4D 2CF8H 2FTMA 1EJAA 2OD3B 4B6EA 1ORFA 1EAWA 3U69H 1SL3A 1YYY1 1DE7H 1RTFB 1XKAC 1OYQA 1XUGA 1ETTH 2Q6DA 1GGDC 2ZG0H 3KQ5A 3E6PH 3KYGA 3ATLA 1EXFA 5DGJA 1VCPA 1C5UA 2GCHG 1FIWA 1ETSH 3ODFA 2OK5A 3KN2A 4A7IB 2BHGA 4O03A 2ZPRA 1A5GH 2P3FH 4DG4A 1GI3A 2FXRA 4Q7XA 3UOUA 4XFQA 1SGFG 2EC9H 4FXGH 3DD2H 1ELGA 2C8XB 1GHZA 4NSYA 3P8GA 1QZ8A 1TLDA 3RXFA 1ID5H 3M5LA 4MPUA 2ZU4A 1F7ZA 4NA7A 3DA9B 2UUYA 3O8DA 1P2MA 1I71A 1YPGH 2QV1A 1COWD 5GCHG 1O3LA 1S6FA 2ZF0H 1C2HA 3QTOH 2NWNA 3MO3A 2QCYA 2JKHA 2G51A 2KAIB 2TPIZ 2VIWA 4APLA 3M3TA 4FUGA 1MTSA 2BY9X 2AEIH 2R0KA 5AFZH 2JH0D 1UVOA 2FOFA 2RG3A 3AW0A 3PMHB 2JJ1D 2QF5A 2VB0A 2FX6A 1HAXB 4UFFH 2H9EH 1KXCA 1OP0A 3RXKA 4OM9A 1SGEE 4KELA 1EP5A 1C1NA 4BVWA 2TRMA 1TNIA 1VJAU 3MH6A 1P0SH 3FAOA 2A5KA 4IC6A 3VFEA 1O3NA 1ZTLA 1GVZA 1IHTH 5C5NA 1NFWA 1DXPA 2EQNA 4ABHA 1GVKB 8ESTE 5E2OA 5JBTA 3A82A 2Q1JA 2YMSB 2AGEX 4DIHH 2Z8WA 1YBWA 4GUXA 1RTKA 2DOIA 1GI5A 1ZSLA 2FLBH 1MAXA 1CE5A 3A7ZA 2BXUH 2Z3CA 2P8OC 2ZFSA 3GS9A 1BRAA 1DOJA 1ELTA 1GJ4H 3NXPA 1MUEB 1ACBE 4XD7D 8KME2 2J97A 3RXMA 2V3HH 3N99A 4ZCNA 1V2WT 1KLJH 3M7TA 1H1BA 3S69A 1O31A 1O2HA 1O30A 1Y3VA 5LPRA 1VCQA 2FYRA 2PGBB 1KXBA 2ZFQH 2EI6A 2FMJA 3MH4A 3SQEE 3HGNA 4TY7A 3FP8E 4YM9A 4K3JA 3RMNH 4OS4A 1W10U 4I32A 5K7RA 1SC8U 1QR3E 5ESBA 4CRBA 1NM6A 1W8KA 3WWFA 1UMAH 1LPZB 1P57B 1YPHE 2BY5X 2Z6BD 3RLYH 1C2GA 1C9PA 1GMHF 1XUHA 3STJA 3V13A 2A2XH 2ZDAH 2J8LA 4AORA 1H8ED 1MKWH 2ALPA 4YXWD 2Y5GA 4WVPE 4NA8A 4K8YA 1VITF 1WQSA 1B0EA 1EFRD 2J5UA 1WSSH 2F9OA 5T6GA 5K0HA 1O32A 1P2KA 3SI3H 3EA7A 4FETA 4MPWA 1QL8A 4MNXA 4NFFA 1WTGH 4BANB 5L2YH 3M36A 4F48B 3SHAH 1HAVB 3M3VA 1BTZA 1Y8TA 3LU9B 3F6UH 1VZQH 3GCOA 3NKKA 3CS7A 1E1RD 1P06A 1B5GH 4X6MA 3EYDA 2HGTH 1C5YB 3SW2B 3KIVA 1TNGA 2DE9A 5H4IB 5EU8A 4ISOA 2NU3E 1XVMA 1FN6A 5CHAC 4Z0EA 2H5DA 1PPEE 4K1TA 2GDEH 1GCTC 1JXPA 1P2IA 1RS0A 2A31A 1ZSKA 3LJOA 3EA8A 4ESTE 1N6XA 2A32A 4X1RU 1O2UA 2OXSA 3SV7A 4AG1A 1C5VA 1GI4A 2WUBA 3N7EA 2XYAA 3OYPA 1GHBF 2WV9A 4GPGA 4LZ4B 3RXJA 1O5BB 2TGTA 5EJLA 2FOHA 1HJ9A 3PM3A 1GJ9B 2PLXA 1DT2A 5DP6A 2XRCA 1ANEA 1NZQH 2ZU5A 3E91A 1GBBA 5FCRA 1KRNA 3QK1A 1GDNA 3BIUH 3M5OA 4YESB 5CDFE 3ZZBA 2VIPA 3HKJB 5DO4H 1NU9A 3SU2A 1U6QA 2ZZUH 1D3TB 3EDXB 2GCHF 1AGJA 3UPEA 1TPPA 1EPTB 2JJ2D 4AFSA 1PMKA 4APMA 3SUEA 3MU0A 3FZDA 1NL2A 1V2LT 4GLYA 4KIVA 2BD9A 1O5DH 1O3MA 4TYDA 4AC9A 6LPRA 2IJD1 1MTVA 1ZPZA 3S9CA 4TY6A 3GDUA 1HBTH 2GD4B 1URKA 1P9SA 3R0FA 1O2GH 1LQEA 5CS3A 3P92A 4Q63A 3LT3A 5GCHF 1K22H 2ZPQA 3MNBA 3QZRA 1W81A 1K1LA 1XXFA 2QYIA 5FAHA 5L30H 1DUAA 1NRSH 4A6LA 1O3JA 4MDSA 2A7JA 1OWKA 1LVOA 1LVBA 1LPGB 4AB8A 1JIRA 2EY4C 1GJDB 1Y3WA 4RSPA 1C5SA 3KF2A 3SNDA 3F3BA 2PSXA 1D9IA 2PWXA 5DPAA 3OY5U 7ESTE 1VR1H 1VGCB 2AS9A 4AYYB 2ZGHA 1O0DH 1FDPA 1O38A 7GCHG 4ACAA 2KCPA 3O8CA 1W7XH 2WPHS 1THSH 3URCA 2SFAA 4NIYA 4XBBA 2AGGX 1CGIE 3PLBA 2KZ4A 2KNFA 4D7FA 3R3GB 2WPDD 1P3CA 2XNIA 4DIIH 1MQ6A 2ZECA 1ZHRA 4ABBA 4FU7A 1BJUA 1A3BH 1GJCB 4TPYA 2HPPH 2BQ7B 1C1RA 3F9GA 1GBMA 1D6WA 1P9UA 4WXVA 5E0GA 2BXTH 3FOAA 3ZZ3A 1SKYE 4ISLA 1W13U 1DANH 3GYLB 1SGQE 3MH7A 2F9NA 3HK3B 1YM0A 4CH8B 4UEHH 2PKSC 2QAAA 1ARBA 2BY7X 2CF9H 1HDTH 1AB9B 2ALVA 1TNLA 2YMSC 3AK5A 1DXWA 3KQCA 1XUFA 4TT3D 2GT7A 1HPKA 3F1SB 4XDEA 4I8KA 3U73A 1V2VT 3K9XB 3TNSA 3PRDA 3SNCA 1YP9A 1VKYA 3MU5A 3TVJB 3NZIA 1RIWB 4SGAE 2BX4A 3RXAA 5KECA 1O3EA 5A8ZA 2OBOA 1Z1IA 1SLUB 1O2SA 1C2IA 1C2KA 2BDYA 1GHAG 5EGMA 3L6PA 1FN8A 1KXAA 4FUHA 3TPIZ 1GI0A 3SP8A 1Y3UA 4YIZA 2V3OH 4Y8XA 4AFZA 4ZXYH 1UTLM 3CP7A 4WH6A 2I6QA 3RMLH 1AFQB 1GDQA 1SQRA 3IWMA 3QLPH 2Z8VA 3BSQA 2FI4E 2WYGA 4AN7A 1GL1A 4B2BA 1QB9A 4X2YA 5KEDA 1HV7A 2QIQA 1W0KD 1HXFH 4FUJA 2FI5E 3VEQB 3ZIAD 3PMBB 5JB9S 1VITH 4BVCA 4CR9A 2GP9B 1EP6A 3AAUA 3TJVA 4RKJB 1TGBA 3HN4A 5HIYA 4CRGA 5CMXH 4OS5A 2DUCA 4UV6A 3UUZA 1BDAA 1BTWA 5EODA 1V2KT 1TBQH 1YCPK 3U1IB 4HGCA 1FXYA 2JETC 1P04A 2CHAB 2Z9LA 1SGCA 3BV9B 2WHXA 4AYVB 2QXIA 2VVVA 2KCAA 3EAJA 1O39A 1L4DA 5AF9H 3K6YA 1O34A 1AWFH 3UNSA 1NTPA 4B75A 5C0UA 1HCGA 4GAWA 3V0XA 1XUIA 1DY8A 3D23A 1EB2A 2VNTA 4BVDA 1JFNA 1C5LH 1A5HA 2CGAA 1A7SA 1KTSB 4X6NA 5CT1A 3V7TA 1UVSH 1W0ZU 4HTCH 4BAQB 3T2NA 1UJ1A 1E37B 1EAUA 4NZLA 1C2MA 1C1QA 1UTJA 1K1MA 1W8BH 1SB1H 2W6ID 2Y7ZA 5PTPA 1SLVB 2GTBA 4YOIA 1S85A 4U32A 2Q8AA 1K28D 1T4VH 1EPTC 1O2PA 3GY7A 4X6OA 5C67A 1UHBA 1HAOH 4ABJA 3UOPA 2P93A 1CEAA 3GYMA 3LC3A 3MOCA 1A2CH 1BJVA 4Y11E 2BYAX 5CHBA 1QHRB 1SQTA 3F0PA 2G00A 1PPGE 2XCNA 1GJ7B 2G4TA 1MU6B 5HM2A 4YLUA 1E79D 3MNCA 2R9PA 3FZZA 2TIOA 5JBAS 1QL7A 1O2LA 1PQAA 1T4UH 4YTAA 1C5TA 5GIBA 1OX1A 1TAWA 3MH5A 2FEBA 7GCHF
chains in the Genus database with same CATH topology
1W12U 1QBVH 1MAYA 1FY3A 2J4IA 4NFEA 3NPSA 1HAPH 5AVDA 4F4OC 2HVXA 4Z0KA 4X1SU 3VGCB 4MNVA 4I8JA 1FY5A 3SN8A 2IOTA 2J9NA 5GJ4B 4Z0DA 3TJOA 1IAUA 3LPRA 1S0RA 1BTYA 4A1XA 1VGCC 5JYIA 1ELVA 1N6YA 1SOZA 1UTMA 4IGDA 1SGFA 4INHA 1H4WA 5HM9A 4FVBA 2GMTB 3GDVA 1W3CA 4CRFA 1J16A 3ZZ7A 1B2IA 1BOQA 3LGTA 4JK5A 5C5OA 4IMZA 1CHOG 1TFXA 3O8BA 3RXGA 1P3EA 1XUKA 1D3DB 4MVNA 4Q7ZA 4RKOB 4ABEA 1IQFA 1QJ6B 3LGUA 1EZXC 4ZAEA 4NIXA 3FP7E 1C5RA 3VB3A 1NPMA 1O3DA 1O2KA 4D9QA 1F0RA 1JRSA 2G4UA 1YLDA 3LOXA 2UWOA 1AVGH 4ISHH 3QUMP 1AB9C 1Z8IB 5F6MA 1GMHG 4NG9H 1GHAF 1MD7A 2G5VA 1YPHC 4CRCA 2G5NA 3E6PL 4AZ2B 3KIDU 2FD6A 4H6TA 1RIWC 1YCPM 1NK1A 1C5WB 3Q3XA 1AY6H 4UONA 1X7AC 1EQ9A 1GBJA 3GCHC 5C1UA 1S6HA 2Y5FA 4O9VA 1O2OA 1TRNA 3F9HA 5LH8A 1SQOA 4X2VA 1C1VH 4H6SB 1PPBH 2HRVA 3I77A 3LC5A 2J38A 3NWUA 2PGQB 3RMMH 3U8RH 1AFQC 1FV9A 2ZA5A 2J92A 4NWKA 2WPMS 1EKBB 3I78A 5L6NH 1WTHD 5JPMH 1EAIA 4Y7BA 3M7UA 2QGRA 4ZHAA 4X8VH 3E0NB 1F0SA 4DY7B 3S7HB 3ESTA 1NY22 4TPIZ 1GG6B 4X1PU 1IQMA 1HPJA 3B8JA 2AIQA 1AIXH 4ZKNU 5J4SA 1SFQB 1CU1A 1ZTKA 2H9HA 1XXDA 1IQGA 3UQOA 1TABE 3TGKE 4R8TB 4E05H 1UHBB 4JZ1A 1F5LA 4OGYA 2WV5A 2CHAC 3A7TA 1G3BA 1TX7A 2VH0A 1SHYA 4A1VA 2Z9KA 2Y80A 3TITA 3PTBA 3KNXA 1GJ5H 4Z0FA 5C1YA 5A0BA 1GBFA 3SZNA 4XOJA 1ZPBA 2UUJB 4D8NA 2BZ6H 2QA9E 3RXVA 3L3TA 2A4GA 4R1AA 3PLPA 3MNXA 1TE0A 4LOYH 1XVOA 1C4V2 1DUEA 1DY9A 1DM4B 1Z40A 2ZKSA 1HNEE 2ZWLH 1DFPA 5EW2H 5GWZA 3BIVH 3U9AH 3HGPA 5DP8A 4D7GA 3VB6A 3EE0B 1WOFA 1O3HA 2W5EA 3UWJH 4INKA 5CS1A 2P94A 2XCFA 3RC6A 4NWLA 1C1TA 1NFYA 2FTLE 2Q8BA 3GCNA 1MH0A 2QC2A 4JZFH 1TRYA 1SGTA 1V2OT 4Y0ZE 2BQWB 3PV4A 4O97A 4YLQH 3BF6H 1P2NA 1NL1A 2V6NA 1ZPCA 2Y8RA 3RXDA 2XBVA 3BTTE 2V35A 3ZZCA 2WPKS 1C5QA 4Q80A 4ABIA 1Z8RA 3EA9A 4Q2KA 2I9AA 2FX4A 4D3CA 1C5MD 4U30A 1TGSZ 2GCTB 3A80A 4M7GA 4E7RG 2H9TH 3G01A 3ELAH 3SU4A 3Q76A 1V2ST 1EZQA 5A8XA 2AMQA 2P3UB 1PYTD 2PKAA 1UTPA 4ZUHA 4CREA 4BVVA 3P17H 1O2WA 2BD7A 5CE1A 3RXUA 1GCDA 5FPTA 5EXMA 3MU1A 4YOGA 1F2SE 3A84A 2YIPA 4X6PA 2O8MA 2HWLB 1CEBA 4WMFA 3TH4H 3URDA 2D1JA 1IQHA 3KEEA 1CHOF 1H9LB 1BRBE 1K1OA 1MZDA 3VGCC 5EW1H 2Z7FE 3RXBA 2ULLA 1TALA 2PUQH 2SPTA 3RM0H 3TU7H 5FPSA 4BAHB 1T7CA 5I46H 1TPSA 1KXFA 1UTNA 2VWNA 1TMBH 3MHWU 4ZROA 2GMTC 1ELBA 1T8NA 2THFB 3WY8A 1J14A 3SO3A 1P01A 1O2TA 4UD9H 4GSOA 1P2QA 3VPKA 2BOKA 2ESTE 1WUNH 3MU8A 3TH3H 4NCYA 4OGXA 1O5FH 2BD3A 5F8ZA 2D8WA 3A88A 1ZGIA 1O2QA 2XC5A 1UVUH 1JWTA 3SJKA 3O8RA 2C8WB 5ESTE 3DUXH 3PYHA 3SV8A 5A8YA 1BBRK 4JYUH 4BXWA 2PTCE 1SMFE 2A1DB 2GDDA 5DP9A 1BITA 3JZ2B 1JBUH 1MTUA 2BD2A 2F83A 2ZFFH 3M5NA 4AX9H 1O3OA 1XMNB 2FM2A 9LPRA 1DVAH 1HAHH 2ILNA 1GDUA 2B9LA 2Z9IA 2H6MA 1BTUA 1OP8A 4I8LA 4KP0A 1H9HE 3PO1B 2ZTXA 2SGEE 3PMJA 1EX3A 2QF3A 1T31A 3SI4H 5GXPA 5FBIA 4I8GA 4TWWA 2AMPA 1ELAA 3P95A 1PMLA 4B71A 1BMAA 3OX7U 1TX8A 4I31A 5DJ7A 1AMHA 3LAQA 5TJXA 1GI9B 2QJ4A 2FOCA 2AMDA 1B7XB 1A0LA 3SOSA 3SGAE 4YZUA 1GG6C 4R1BA 3E3TA 1GL0E 1LMWB 3SRJA 3BTKE 2IN2A 1BTHH 1DITH 1OWHA 3LKWA 1S83A 4AG2A 3SGQE 1CA8B 1G3DA 4ZMAH 1NRPH 2G55A 1GBKA 3RXSA 1GVLA 1DX5M 3ATIA 1D3QB 3MU4A 1SFIA 1E0FD 1L2EA 2ANMH 3V3MA 1BZXE 4Z6AH 1F5RA 4J2YB 3BTWE 1NRQH 1MKXK 2XXLA 5TCAA 3ZLEA 2ZGBH 3E8LA 4Q7YA 4DT7B 1T32A 3UTUH 1FI8A 2PKAB 2OC7A 2A0QB 1C1WH 1KDQA 1OXGA 2W3KA 2SNWA 4DGJA 2F91A 3N7OA 3RU4E 2TGPZ 5SGAE 1TWXB 3RXIA 1SOTA 2GVFA 2F9UA 3PTNA 1TIOA 5DP4A 3IG6B 2ASUB 2HPQH 3QN7A 2QXHA 3NK8A 1A5IA 1QURH 1NFUA 2ZU3A 1DLEA 1CT4E 1BHXF 1FZZA 3GDSA 1OWIA 2ZU1A 1ZZZA 5IYTA 4E7NA 4UFEH 1CBWB 1N8OB 2ZCLP 1UK3A 2A7CA 3BEUA 2QN5T 5BRRE 1C2JA 1QL9A 2R3YA 1QB1A 2PF1A 1PQ8A 4K1SA 1FY8E 1P2OA 4Y71A 4O3TA 5CSQA 1YPJH 1ZYOA 4D76A 1ELCA 3LH1A 1PK2A 1O2MA 1LKAA 1HJAB 4X1QU 2W26A 1QGFA 3ZV8A 5CT2A 5GDSH 2BDCA 3CS0A 1MCTA 1QJ7B 1TQ7B 4ZHLU 1K1PA 1DICA 2WINI 3MO9A 4JZIA 1B0FA 1DWBH 1GBLA 1EJMA 1GJBB 5E8EH 2Y7XA 3RM2H 4WMDA 1G37A 1GPZA 1S82A 1V2MT 1ESBA 4ZH8A 4CR5A 1A0HA 3ZVBA 1G36A 3MWIU 3OSYA 3GY2A 2ZHQH 4GHTA 1V6DA 2O8LA 1TA6A 5LPFA 2C4FH 1UCYH 1FAKH 1Y5AT 4K5ZA 4D9RA 1PPFE 4BAOB 3BTDE 3V12A 3CENA 2X2ZA 3A83A 4X8UH 5A2MH 4FVDA 4H42U 1V2JT 1MZAA 3RLWH 4UDWH 3M35A 3VB4A 5JDUB 1ZMNA 1F92A 7KMEH 1CSOE 3BG8A 3ZWZA 3DT0H 1HYLA 3GY4A 2FYQA 1FY1A 3MFJA 1SSXA 3SUDA 3T5FH 4NIWA 3UR9A 2UWLA 4VGCB 1LQDB 3TLOA 4NIVA 1C1OA 2ANYA 5F8TA 4WH8A 2F3CE 1L0ZA 3P8FA 1XM1A 3U8TH 2STAE 5C3NA 1V2UT 2WPJS 1CT0E 1YPLH 1TB6H 2BQ6B 2GZ9A 2QJ2A 1MBQA 2Y5HA 1GJ8B 2CV3A 4A5TS 4KTSA 5FBEA 3MKPA 2GT8A 2H1UA 2GV6A 3F68H 2B5TB 3M37A 4FU9A 3UFAA 3HMRA 1HPGA 2VIDA 1XUJA 1L4ZA 4MPXA 3S9AA 4K60A 5FX6A 1LDTT 3DFLA 4PROA 3VB7A 2ZDVH 3HPTB 2A7HA 1BIOA 2BLVA 2ZC9H 3P70B 3P8OA 4Y10E 3PO1C 4J1YA 4DURA 1SG8B 1KDQB 1CGJE 3E90B 3M61U 1MD8A 1C5PA 1W11U 1TPKA 6ESTA 2OQ5A 1HRTH 2ANWA 2BY8X 2BD8A 2PTNA 1J9CH 1T8MA 2ZO3H 1EOJA 1NESE 2NU1E 1O36A 1GBHA 4JMYA 3IITA 1MKWK 3MMGA 2QXJA 1C1SA 1TNJA 1ABJH 2OC8A 2FWWA 1PPCE 2WV4A 2OBQA 1UK4A 1UTOA 4JYTA 3SU1A 5E2PA 3TK5A 2K13X 2A4RA 2LL3A 2PHBA 2QY0B 1EATA 2ZDKA 1K2I1 3SQHE 3ZYEA 1FQ3A 4X2WA 2FEQH 1VJ9U 2IJOB 1IQLA 2FOGA 3FP6E 5EXNA 2J2UA 2O8WA 2Z9GA 3S7KB 4RN6A 4BAMB 4QT8C 1O2XA 1NT1A 1V2QT 3A8CA 1DPOA 2AGIX 3KCGH 3C1KA 3A8AA 1A0HB 1LHFH 2HPQP 1BBRE 2HOBA 1YKTA 1TOCB 1DS2E 2R3UA 4UFGH 4WF8A 1TA2A 2ANKH 4F49A 2XTTB 2C90B 1HUTH 3ENSB 2L0SA 3PROA 1C2EA 4MTBA 1BCUH 3ODDA 1QTFA 1PQ7A 4KTUA 1ZRKA 1QRXA 1AE5A 3GOVB 3RXRA 4YOJA 3K65A 2J8JA 3GY3A 3ZZ5A 5A0AE 1CBWC 4ABAA 5DG6A 1PJPA 3A7XA 3LGYA 1HAGE 3S9BA 1RFNA 2HPPP 2F9VA 2ZU2A 1QB6A 1KI0A 2C8YB 1O2VA 5HXFA 1XX9A 3RXQA 1GJAB 1AN1E 1ZHMA 3SUFA 3GISB 2SGQE 3JZ1B 5FXLA 1TPOA 4WMEA 2SGPE 2BDBA 1C1MA 1Q31A 3SGBE 1EZUC 1GI2A 1MMJN 1SR5C 2VGCB 3OTJE 1AU8A 2ZGJA 1PKRA 1DSUA 1UVPA 2KL5A 1LCYA 1TYNA 1G3EA 3A7YA 3M7QA 4HFPB 4MG3A 5EOKA 4ZKOU 1C5NH 1JIMA 1A61H 5JB8S 4Z09A 2F9PA 2F9BH 3UY9A 2HALA 3ZZDA 2GZ7A 4Y0YE 1YPKH 5EQSA 1TOMH 4ZKSU 1E36B 4XE4A 1SQAA 4BV7A 3TNTA 2OUAA 2OINA 2ZFPH 1WYKA 3PB1E 1GBEA 2PW8H 4JZEH 5COEA 2BDGA 2A5IA 1GMNA 1RXPA 2LNCA 1KDUA 1NC6A 1O35A 1O5CB 2AERH 3VB5A 2R2MB 2R0LA 4IBLH 2A2QH 1H9IE 4JZDH 1OP2A 5EQRA 3GCTG 4IS5A 2GX4A 3NCLA 1V2PT 5BPEA 2BLQA 2FS9A 4VGCC 5E0JA 4AOQA 1QIXB 1C4Y2 1S81A 1QCPA 3ZZAA 1ZTJA 2A45B 3A8DA 5A09A 2AH4X 2H5CA 1A0JA 4X2XA 1AD8H 5E0HA 4B74A 3U1JB 1HAZB 4WY3A 2PFEA 1GMCG 3BTFE 2DE8A 1V3XA 1TNKA 1Z8JB 1NRRH 1ELDE 5CS9A 1AUTC 1W7GH 1K1IA 1Q3XA 4A1TA 5A0CA 2P3TB 1DLKB