5CT2A

The structure of the nk1 fragment of hgf/sf complexed with caps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 39
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5ct2A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5ct2A01
5CS9A 5CT2A 2F83A 3ZLEA 1I71A 1TPKA 4APLA 5I25A 5CT1A 1W81A 2YILA 4BV7A 1GMOA 2Z8VA 2J8JA 2Q8AA 2K13X 3LAQA 1NL1A 2K4RA 5COEA 2I9AA 3SP8A 5HPGA 4NZQA 2HPPP 4BVWA 2KJ4A 2YIOA 1PMKA 2LL4M 3K65A 1A0HA 5EOKA 4R1AA 4HZHA 1I8NA 1KIVA 4BVDA 3ZWZA 2HPQP 2Q8BA 2SPTA 2K51A 1KI0A 1HKYA 4UV6A 4A5TS 4D3CA 5CSQA 1HPJA 1CEAA 3HMSA 3HMTA 2I9BA 1KRNA 4BV5A 1I5KA 3HN4A 5CP9A 3SRJA 3KIVA 5EODA 1CEBA 2QJ4A 4UAOA 1URKA 1PK4A 2HGFA 2DOHX 4DURA 2KNFA 4Z0FA 4CIKA 2J8LA 2LL3A 3HMRA 4R1BA 1HPKA 2YIPA 3E6PL 1JFNA 1NK1A 3BT2A 2DOIA 1Z40A 4BVCA 5CS3A 2PF1A 4APMA 2X2ZA 1GP9A 1PKRA 1B2IA 3NXPA 2Y8RA 1KDUA 1NL2A 1PK2A 1PMLA 1W8KA 4O03A 2Z8WA 4IUAA 2QJ2A 2L0SA 3MKPA 1GMNA 2FEBA 2PF2A 3BT1A 2FD6A 2PK4A 4R1CA 4Z0EA 4Z09A 1BHTA 3U73A 3SRIA 1YXEA 4BVVA 4KIVA 4R19A 5CS1A 4Z0DA 5CS5A 5CT3A
chains in the Genus database with same CATH superfamily
5CS9A 5CT2A 2F83A 4YIZA 1I71A 1TPKA 3ZLEA 4APLA 5I25A 5CT1A 1W81A 4YIVA 2YILA 4BV7A 1GMOA 2Z8VA 2J8JA 2Q8AA 2K13X 3LAQA 1NL1A 2K4RA 5COEA 2I9AA 3SP8A 5HPGA 4NZQA 2HPPP 4BVWA 2KJ4A 2YIOA 1PMKA 2LL4M 3K65A 1A0HA 2KL5A 5EOKA 4R1AA 4HZHA 1I8NA 1KIVA 4BVDA 3ZWZA 2HPQP 2Q8BA 2SPTA 2K51A 1KI0A 1HKYA 4UV6A 4A5TS 4D3CA 5CSQA 1HPJA 1CEAA 3HMSA 3HMTA 2I9BA 1KRNA 4BV5A 1I5KA 3HN4A 5CP9A 3SRJA 3KIVA 5EODA 1CEBA 2QJ4A 4UAOA 1URKA 1PK4A 2HGFA 2DOHX 4DURA 2KNFA 4Z0FA 4CIKA 2J8LA 2LL3A 3HMRA 4R1BA 1HPKA 2YIPA 3E6PL 1JFNA 1NK1A 3BT2A 2DOIA 1Z40A 4BVCA 5CS3A 2PF1A 4APMA 2X2ZA 1GP9A 1PKRA 1B2IA 3NXPA 2Y8RA 1KDUA 1NL2A 1PK2A 1PMLA 1W8KA 4O03A 2Z8WA 4IUAA 2QJ2A 2L0SA 3MKPA 1GMNA 2FEBA 2PF2A 3BT1A 2FD6A 2PK4A 4R1CA 4Z0EA 4Z09A 1BHTA 3U73A 3SRIA 1YXEA 4BVVA 4KIVA 4R19A 5CS1A 4Z0DA 5CS5A 5CT3A
chains in the Genus database with same CATH topology
5CS9A 5CT2A 2F83A 4YIZA 1I71A 1TPKA 3ZLEA 4APLA 5I25A 5CT1A 1W81A 4YIVA 2YILA 4BV7A 1GMOA 2Z8VA 2J8JA 2Q8AA 2K13X 3LAQA 1NL1A 2K4RA 5COEA 2I9AA 3SP8A 5HPGA 4NZQA 2HPPP 4BVWA 2KJ4A 2YIOA 1PMKA 2LL4M 3K65A 1A0HA 2KL5A 5EOKA 4R1AA 4HZHA 1I8NA 1KIVA 4BVDA 3ZWZA 2HPQP 2Q8BA 2SPTA 2K51A 1KI0A 1HKYA 4UV6A 4A5TS 4D3CA 5CSQA 1HPJA 1CEAA 3HMSA 3HMTA 2I9BA 1KRNA 4BV5A 1I5KA 3HN4A 5CP9A 3SRJA 3KIVA 5EODA 1CEBA 2QJ4A 4UAOA 1URKA 1PK4A 2HGFA 2DOHX 4DURA 2KNFA 4Z0FA 4CIKA 2J8LA 2LL3A 3HMRA 4R1BA 1HPKA 2YIPA 3E6PL 1JFNA 1NK1A 3BT2A 2DOIA 1Z40A 4BVCA 5CS3A 2PF1A 4APMA 2X2ZA 1GP9A 1PKRA 1B2IA 3NXPA 2Y8RA 1KDUA 1NL2A 1PK2A 1PMLA 1W8KA 4O03A 2Z8WA 4IUAA 2QJ2A 2L0SA 3MKPA 1GMNA 2FEBA 2PF2A 3BT1A 2FD6A 2PK4A 4R1CA 4Z0EA 4Z09A 1BHTA 3U73A 3SRIA 1YXEA 4BVVA 4KIVA 4R19A 5CS1A 4Z0DA 5CS5A 5CT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CS9 A;  5CT2 A;  2F83 A;  3ZLE A;  1I71 A;  1TPK A;  4APL A;  5I25 A;  5CT1 A;  1W81 A;  2YIL A;  4BV7 A;  1GMO A;  2Z8V A;  2J8J A;  2Q8A A;  2K13 X;  3LAQ A;  1NL1 A;  2K4R A;  5COE A;  2I9A A;  3SP8 A;  5HPG A;  4NZQ A;  2HPP P;  4BVW A;  2KJ4 A;  2YIO A;  1PMK A;  2LL4 M;  3K65 A;  1A0H A;  5EOK A;  4R1A A;  4HZH A;  1I8N A;  1KIV A;  4BVD A;  3ZWZ A;  2HPQ P;  2Q8B A;  2SPT A;  2K51 A;  1KI0 A;  1HKY A;  4UV6 A;  4A5T S;  4D3C A;  5CSQ A;  1HPJ A;  1CEA A;  3HMS A;  3HMT A;  2I9B A;  1KRN A;  4BV5 A;  1I5K A;  3HN4 A;  5CP9 A;  3SRJ A;  3KIV A;  5EOD A;  1CEB A;  2QJ4 A;  4UAO A;  1URK A;  1PK4 A;  2HGF A;  2DOH X;  4DUR A;  2KNF A;  4Z0F A;  4CIK A;  2J8L A;  2LL3 A;  3HMR A;  4R1B A;  1HPK A;  2YIP A;  3E6P L;  1JFN A;  1NK1 A;  3BT2 A;  2DOI A;  1Z40 A;  4BVC A;  5CS3 A;  2PF1 A;  4APM A;  2X2Z A;  1GP9 A;  1PKR A;  1B2I A;  3NXP A;  2Y8R A;  1KDU A;  1NL2 A;  1PK2 A;  1PML A;  1W8K A;  4O03 A;  2Z8W A;  4IUA A;  2QJ2 A;  2L0S A;  3MKP A;  1GMN A;  2FEB A;  2PF2 A;  3BT1 A;  2FD6 A;  2PK4 A;  4R1C A;  4Z0E A;  4Z09 A;  1BHT A;  3U73 A;  3SRI A;  1YXE A;  4BVV A;  4KIV A;  4R19 A;  5CS1 A;  4Z0D A;  5CS5 A;  5CT3 A; 
#chains in the Genus database with same CATH topology
 5CS9 A;  5CT2 A;  2F83 A;  4YIZ A;  1I71 A;  1TPK A;  3ZLE A;  4APL A;  5I25 A;  5CT1 A;  1W81 A;  4YIV A;  2YIL A;  4BV7 A;  1GMO A;  2Z8V A;  2J8J A;  2Q8A A;  2K13 X;  3LAQ A;  1NL1 A;  2K4R A;  5COE A;  2I9A A;  3SP8 A;  5HPG A;  4NZQ A;  2HPP P;  4BVW A;  2KJ4 A;  2YIO A;  1PMK A;  2LL4 M;  3K65 A;  1A0H A;  2KL5 A;  5EOK A;  4R1A A;  4HZH A;  1I8N A;  1KIV A;  4BVD A;  3ZWZ A;  2HPQ P;  2Q8B A;  2SPT A;  2K51 A;  1KI0 A;  1HKY A;  4UV6 A;  4A5T S;  4D3C A;  5CSQ A;  1HPJ A;  1CEA A;  3HMS A;  3HMT A;  2I9B A;  1KRN A;  4BV5 A;  1I5K A;  3HN4 A;  5CP9 A;  3SRJ A;  3KIV A;  5EOD A;  1CEB A;  2QJ4 A;  4UAO A;  1URK A;  1PK4 A;  2HGF A;  2DOH X;  4DUR A;  2KNF A;  4Z0F A;  4CIK A;  2J8L A;  2LL3 A;  3HMR A;  4R1B A;  1HPK A;  2YIP A;  3E6P L;  1JFN A;  1NK1 A;  3BT2 A;  2DOI A;  1Z40 A;  4BVC A;  5CS3 A;  2PF1 A;  4APM A;  2X2Z A;  1GP9 A;  1PKR A;  1B2I A;  3NXP A;  2Y8R A;  1KDU A;  1NL2 A;  1PK2 A;  1PML A;  1W8K A;  4O03 A;  2Z8W A;  4IUA A;  2QJ2 A;  2L0S A;  3MKP A;  1GMN A;  2FEB A;  2PF2 A;  3BT1 A;  2FD6 A;  2PK4 A;  4R1C A;  4Z0E A;  4Z09 A;  1BHT A;  3U73 A;  3SRI A;  1YXE A;  4BVV A;  4KIV A;  4R19 A;  5CS1 A;  4Z0D A;  5CS5 A;  5CT3 A; 
#chains in the Genus database with same CATH homology
 5CS9 A;  5CT2 A;  2F83 A;  4YIZ A;  1I71 A;  1TPK A;  3ZLE A;  4APL A;  5I25 A;  5CT1 A;  1W81 A;  4YIV A;  2YIL A;  4BV7 A;  1GMO A;  2Z8V A;  2J8J A;  2Q8A A;  2K13 X;  3LAQ A;  1NL1 A;  2K4R A;  5COE A;  2I9A A;  3SP8 A;  5HPG A;  4NZQ A;  2HPP P;  4BVW A;  2KJ4 A;  2YIO A;  1PMK A;  2LL4 M;  3K65 A;  1A0H A;  2KL5 A;  5EOK A;  4R1A A;  4HZH A;  1I8N A;  1KIV A;  4BVD A;  3ZWZ A;  2HPQ P;  2Q8B A;  2SPT A;  2K51 A;  1KI0 A;  1HKY A;  4UV6 A;  4A5T S;  4D3C A;  5CSQ A;  1HPJ A;  1CEA A;  3HMS A;  3HMT A;  2I9B A;  1KRN A;  4BV5 A;  1I5K A;  3HN4 A;  5CP9 A;  3SRJ A;  3KIV A;  5EOD A;  1CEB A;  2QJ4 A;  4UAO A;  1URK A;  1PK4 A;  2HGF A;  2DOH X;  4DUR A;  2KNF A;  4Z0F A;  4CIK A;  2J8L A;  2LL3 A;  3HMR A;  4R1B A;  1HPK A;  2YIP A;  3E6P L;  1JFN A;  1NK1 A;  3BT2 A;  2DOI A;  1Z40 A;  4BVC A;  5CS3 A;  2PF1 A;  4APM A;  2X2Z A;  1GP9 A;  1PKR A;  1B2I A;  3NXP A;  2Y8R A;  1KDU A;  1NL2 A;  1PK2 A;  1PML A;  1W8K A;  4O03 A;  2Z8W A;  4IUA A;  2QJ2 A;  2L0S A;  3MKP A;  1GMN A;  2FEB A;  2PF2 A;  3BT1 A;  2FD6 A;  2PK4 A;  4R1C A;  4Z0E A;  4Z09 A;  1BHT A;  3U73 A;  3SRI A;  1YXE A;  4BVV A;  4KIV A;  4R19 A;  5CS1 A;  4Z0D A;  5CS5 A;  5CT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...