5CT2A

The structure of the nk1 fragment of hgf/sf complexed with caps
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
b'TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 39
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5ct2A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5ct2A01
5HPGA 4APLA 3E6PL 2HPPP 5COEA 2I9AA 2I9BA 3HN4A 3BT1A 1NL2A 2L0SA 3BT2A 4IUAA 3HMRA 1PKRA 2PF2A 1NK1A 3HMSA 1JFNA 2Y8RA 3ZLEA 3KIVA 4CIKA 4D3CA 1HPKA 1GP9A 4BV5A 4Z09A 2Q8BA 1I8NA 2LL4M 2DOHX 2QJ4A 2Q8AA 1CEBA 2K13X 1HKYA 4BVVA 5EODA 4BVCA 2J8LA 5CT3A 2YIPA 4HZHA 1KRNA 1KIVA 5CT2A 2YILA 1TPKA 2PF1A 1W81A 1B2IA 2DOIA 2HPQP 3SRJA 4R1AA 2FEBA 2Z8VA 2QJ2A 3HMTA 4A5TS 5CS9A 5CS1A 4BV7A 3NXPA 2F83A 1URKA 4R1CA 1NL1A 2KNFA 1A0HA 5CSQA 4DURA 2KJ4A 4APMA 1BHTA 1PMKA 2SPTA 5CS3A 4BVWA 3SP8A 4Z0FA 4O03A 5CP9A 1GMOA 4UAOA 5CS5A 4KIVA 2Z8WA 3MKPA 4BVDA 5EOKA 1PK4A 2X2ZA 1CEAA 5CT1A 1I71A 2LL3A 4R1BA 2J8JA 1I5KA 2K51A 2YIOA 3LAQA 4NZQA 4UV6A 4Z0EA 4R19A 1PK2A 1YXEA 2FD6A 1HPJA 2HGFA 3SRIA 2K4RA 5I25A 3K65A 2PK4A 1KI0A 3ZWZA 1Z40A 1GMNA 1PMLA 3U73A 1KDUA 1W8KA 4Z0DA
chains in the Genus database with same CATH superfamily
2KL5A 5HPGA 4APLA 3E6PL 2HPPP 5COEA 2I9AA 2I9BA 3HN4A 3BT1A 1NL2A 2L0SA 3BT2A 4IUAA 3HMRA 1PKRA 2PF2A 1NK1A 3HMSA 1JFNA 2Y8RA 3ZLEA 3KIVA 4CIKA 4D3CA 1HPKA 1GP9A 4BV5A 4Z09A 2Q8BA 1I8NA 2LL4M 4YIVA 2DOHX 2QJ4A 2Q8AA 1CEBA 2K13X 1HKYA 4BVVA 5EODA 4BVCA 2J8LA 5CT3A 2YIPA 4HZHA 1KRNA 1KIVA 5CT2A 2YILA 1TPKA 2PF1A 1W81A 1B2IA 2DOIA 2HPQP 3SRJA 4R1AA 2FEBA 2Z8VA 2QJ2A 3HMTA 4A5TS 5CS9A 5CS1A 4BV7A 3NXPA 2F83A 1URKA 4R1CA 1NL1A 2KNFA 1A0HA 5CSQA 4DURA 2KJ4A 4APMA 1BHTA 1PMKA 2SPTA 5CS3A 4BVWA 3SP8A 4Z0FA 4O03A 5CP9A 1GMOA 4UAOA 5CS5A 4KIVA 2Z8WA 3MKPA 4BVDA 5EOKA 1PK4A 2X2ZA 1CEAA 5CT1A 1I71A 2LL3A 4R1BA 2J8JA 1I5KA 2K51A 2YIOA 3LAQA 4NZQA 4UV6A 4Z0EA 4R19A 1PK2A 1YXEA 2FD6A 1HPJA 2HGFA 3SRIA 2K4RA 5I25A 4YIZA 3K65A 2PK4A 1KI0A 3ZWZA 1Z40A 1GMNA 1PMLA 3U73A 1KDUA 1W8KA 4Z0DA
chains in the Genus database with same CATH topology
2KL5A 5HPGA 4APLA 3E6PL 2HPPP 5COEA 2I9AA 2I9BA 3HN4A 3BT1A 1NL2A 2L0SA 3BT2A 4IUAA 3HMRA 1PKRA 2PF2A 1NK1A 3HMSA 1JFNA 2Y8RA 3ZLEA 3KIVA 4CIKA 4D3CA 1HPKA 1GP9A 4BV5A 4Z09A 2Q8BA 1I8NA 2LL4M 4YIVA 2DOHX 2QJ4A 2Q8AA 1CEBA 2K13X 1HKYA 4BVVA 5EODA 4BVCA 2J8LA 5CT3A 2YIPA 4HZHA 1KRNA 1KIVA 5CT2A 2YILA 1TPKA 2PF1A 1W81A 1B2IA 2DOIA 2HPQP 3SRJA 4R1AA 2FEBA 2Z8VA 2QJ2A 3HMTA 4A5TS 5CS9A 5CS1A 4BV7A 3NXPA 2F83A 1URKA 4R1CA 1NL1A 2KNFA 1A0HA 5CSQA 4DURA 2KJ4A 4APMA 1BHTA 1PMKA 2SPTA 5CS3A 4BVWA 3SP8A 4Z0FA 4O03A 5CP9A 1GMOA 4UAOA 5CS5A 4KIVA 2Z8WA 3MKPA 4BVDA 5EOKA 1PK4A 2X2ZA 1CEAA 5CT1A 1I71A 2LL3A 4R1BA 2J8JA 1I5KA 2K51A 2YIOA 3LAQA 4NZQA 4UV6A 4Z0EA 4R19A 1PK2A 1YXEA 2FD6A 1HPJA 2HGFA 3SRIA 2K4RA 5I25A 4YIZA 3K65A 2PK4A 1KI0A 3ZWZA 1Z40A 1GMNA 1PMLA 3U73A 1KDUA 1W8KA 4Z0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPG A;  4APL A;  3E6P L;  2HPP P;  5COE A;  2I9A A;  2I9B A;  3HN4 A;  3BT1 A;  1NL2 A;  2L0S A;  3BT2 A;  4IUA A;  3HMR A;  1PKR A;  2PF2 A;  1NK1 A;  3HMS A;  1JFN A;  2Y8R A;  3ZLE A;  3KIV A;  4CIK A;  4D3C A;  1HPK A;  1GP9 A;  4BV5 A;  4Z09 A;  2Q8B A;  1I8N A;  2LL4 M;  2DOH X;  2QJ4 A;  2Q8A A;  1CEB A;  2K13 X;  1HKY A;  4BVV A;  5EOD A;  4BVC A;  2J8L A;  5CT3 A;  2YIP A;  4HZH A;  1KRN A;  1KIV A;  5CT2 A;  2YIL A;  1TPK A;  2PF1 A;  1W81 A;  1B2I A;  2DOI A;  2HPQ P;  3SRJ A;  4R1A A;  2FEB A;  2Z8V A;  2QJ2 A;  3HMT A;  4A5T S;  5CS9 A;  5CS1 A;  4BV7 A;  3NXP A;  2F83 A;  1URK A;  4R1C A;  1NL1 A;  2KNF A;  1A0H A;  5CSQ A;  4DUR A;  2KJ4 A;  4APM A;  1BHT A;  1PMK A;  2SPT A;  5CS3 A;  4BVW A;  3SP8 A;  4Z0F A;  4O03 A;  5CP9 A;  1GMO A;  4UAO A;  5CS5 A;  4KIV A;  2Z8W A;  3MKP A;  4BVD A;  5EOK A;  1PK4 A;  2X2Z A;  1CEA A;  5CT1 A;  1I71 A;  2LL3 A;  4R1B A;  2J8J A;  1I5K A;  2K51 A;  2YIO A;  3LAQ A;  4NZQ A;  4UV6 A;  4Z0E A;  4R19 A;  1PK2 A;  1YXE A;  2FD6 A;  1HPJ A;  2HGF A;  3SRI A;  2K4R A;  5I25 A;  3K65 A;  2PK4 A;  1KI0 A;  3ZWZ A;  1Z40 A;  1GMN A;  1PML A;  3U73 A;  1KDU A;  1W8K A;  4Z0D A; 
#chains in the Genus database with same CATH topology
 2KL5 A;  5HPG A;  4APL A;  3E6P L;  2HPP P;  5COE A;  2I9A A;  2I9B A;  3HN4 A;  3BT1 A;  1NL2 A;  2L0S A;  3BT2 A;  4IUA A;  3HMR A;  1PKR A;  2PF2 A;  1NK1 A;  3HMS A;  1JFN A;  2Y8R A;  3ZLE A;  3KIV A;  4CIK A;  4D3C A;  1HPK A;  1GP9 A;  4BV5 A;  4Z09 A;  2Q8B A;  1I8N A;  2LL4 M;  4YIV A;  2DOH X;  2QJ4 A;  2Q8A A;  1CEB A;  2K13 X;  1HKY A;  4BVV A;  5EOD A;  4BVC A;  2J8L A;  5CT3 A;  2YIP A;  4HZH A;  1KRN A;  1KIV A;  5CT2 A;  2YIL A;  1TPK A;  2PF1 A;  1W81 A;  1B2I A;  2DOI A;  2HPQ P;  3SRJ A;  4R1A A;  2FEB A;  2Z8V A;  2QJ2 A;  3HMT A;  4A5T S;  5CS9 A;  5CS1 A;  4BV7 A;  3NXP A;  2F83 A;  1URK A;  4R1C A;  1NL1 A;  2KNF A;  1A0H A;  5CSQ A;  4DUR A;  2KJ4 A;  4APM A;  1BHT A;  1PMK A;  2SPT A;  5CS3 A;  4BVW A;  3SP8 A;  4Z0F A;  4O03 A;  5CP9 A;  1GMO A;  4UAO A;  5CS5 A;  4KIV A;  2Z8W A;  3MKP A;  4BVD A;  5EOK A;  1PK4 A;  2X2Z A;  1CEA A;  5CT1 A;  1I71 A;  2LL3 A;  4R1B A;  2J8J A;  1I5K A;  2K51 A;  2YIO A;  3LAQ A;  4NZQ A;  4UV6 A;  4Z0E A;  4R19 A;  1PK2 A;  1YXE A;  2FD6 A;  1HPJ A;  2HGF A;  3SRI A;  2K4R A;  5I25 A;  4YIZ A;  3K65 A;  2PK4 A;  1KI0 A;  3ZWZ A;  1Z40 A;  1GMN A;  1PML A;  3U73 A;  1KDU A;  1W8K A;  4Z0D A; 
#chains in the Genus database with same CATH homology
 2KL5 A;  5HPG A;  4APL A;  3E6P L;  2HPP P;  5COE A;  2I9A A;  2I9B A;  3HN4 A;  3BT1 A;  1NL2 A;  2L0S A;  3BT2 A;  4IUA A;  3HMR A;  1PKR A;  2PF2 A;  1NK1 A;  3HMS A;  1JFN A;  2Y8R A;  3ZLE A;  3KIV A;  4CIK A;  4D3C A;  1HPK A;  1GP9 A;  4BV5 A;  4Z09 A;  2Q8B A;  1I8N A;  2LL4 M;  4YIV A;  2DOH X;  2QJ4 A;  2Q8A A;  1CEB A;  2K13 X;  1HKY A;  4BVV A;  5EOD A;  4BVC A;  2J8L A;  5CT3 A;  2YIP A;  4HZH A;  1KRN A;  1KIV A;  5CT2 A;  2YIL A;  1TPK A;  2PF1 A;  1W81 A;  1B2I A;  2DOI A;  2HPQ P;  3SRJ A;  4R1A A;  2FEB A;  2Z8V A;  2QJ2 A;  3HMT A;  4A5T S;  5CS9 A;  5CS1 A;  4BV7 A;  3NXP A;  2F83 A;  1URK A;  4R1C A;  1NL1 A;  2KNF A;  1A0H A;  5CSQ A;  4DUR A;  2KJ4 A;  4APM A;  1BHT A;  1PMK A;  2SPT A;  5CS3 A;  4BVW A;  3SP8 A;  4Z0F A;  4O03 A;  5CP9 A;  1GMO A;  4UAO A;  5CS5 A;  4KIV A;  2Z8W A;  3MKP A;  4BVD A;  5EOK A;  1PK4 A;  2X2Z A;  1CEA A;  5CT1 A;  1I71 A;  2LL3 A;  4R1B A;  2J8J A;  1I5K A;  2K51 A;  2YIO A;  3LAQ A;  4NZQ A;  4UV6 A;  4Z0E A;  4R19 A;  1PK2 A;  1YXE A;  2FD6 A;  1HPJ A;  2HGF A;  3SRI A;  2K4R A;  5I25 A;  4YIZ A;  3K65 A;  2PK4 A;  1KI0 A;  3ZWZ A;  1Z40 A;  1GMN A;  1PML A;  3U73 A;  1KDU A;  1W8K A;  4Z0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...