3D7IA

Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
GEGMKVVAAAYPDLYDIIVKLNDTVFTGKTLDYKTQKLIAIGIVASRCDEVAIEKQMKSAMKELGITKEEIADVLRVVLLTSGMPAFTKAMKILEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords carboxymuconolactone decarboxylase family protein
publication title Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from METHANOCOCCUS JANNASCHII at 1.75 A resolution
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 33
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 3d7iA00
2PFXA 5DIKA 1LW1A 2PRRA 3C1LA 2OUWA 1P8CA 3LVYA 2CWQA 2GMYA 1GU9A 5DIPA 1KNCA 4G9QA 3D7IA 1VKEA 2QEUA 2IJCA 1ME5A 2Q0TA 2AF7A 2OYOA 2O4DA 3BEYA
chains in the Genus database with same CATH superfamily
3AA6A 2PFXA 3AA0A 5DIKA 1LW1A 2PRRA 3C1LA 4AKRA 2OUWA 1P8CA 3LVYA 5AFUK 2CWQA 2KXPA 2GMYA 1GU9A 3AA1A 5DIPA 3LK41 3AAAA 2JN8A 1KNCA 3LK2A 1IZNA 4G9QA 3LK3A 3D7IA 2ES9A 1VKEA 3AAEA 5ADXK 2QEUA 2KZ7A 2IJCA 1ME5A 3AA7A 2Q0TA 2AF7A 2OYOA 2O4DA 3BEYA
chains in the Genus database with same CATH topology
3AA6A 2PFXA 3AA0A 5DIKA 1LW1A 2PRRA 3C1LA 4AKRA 2OUWA 1P8CA 3LVYA 5AFUK 2CWQA 2KXPA 2GMYA 1GU9A 3AA1A 5DIPA 3LK41 3AAAA 2JN8A 1KNCA 3LK2A 1IZNA 4G9QA 3LK3A 3D7IA 2ES9A 1VKEA 3AAEA 5ADXK 2QEUA 2KZ7A 2IJCA 1ME5A 3AA7A 2Q0TA 2AF7A 2OYOA 2O4DA 3BEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFX A;  5DIK A;  1LW1 A;  2PRR A;  3C1L A;  2OUW A;  1P8C A;  3LVY A;  2CWQ A;  2GMY A;  1GU9 A;  5DIP A;  1KNC A;  4G9Q A;  3D7I A;  1VKE A;  2QEU A;  2IJC A;  1ME5 A;  2Q0T A;  2AF7 A;  2OYO A;  2O4D A;  3BEY A; 
#chains in the Genus database with same CATH topology
 3AA6 A;  2PFX A;  3AA0 A;  5DIK A;  1LW1 A;  2PRR A;  3C1L A;  4AKR A;  2OUW A;  1P8C A;  3LVY A;  5AFU K;  2CWQ A;  2KXP A;  2GMY A;  1GU9 A;  3AA1 A;  5DIP A;  3LK4 1;  3AAA A;  2JN8 A;  1KNC A;  3LK2 A;  1IZN A;  4G9Q A;  3LK3 A;  3D7I A;  2ES9 A;  1VKE A;  3AAE A;  5ADX K;  2QEU A;  2KZ7 A;  2IJC A;  1ME5 A;  3AA7 A;  2Q0T A;  2AF7 A;  2OYO A;  2O4D A;  3BEY A; 
#chains in the Genus database with same CATH homology
 3AA6 A;  2PFX A;  3AA0 A;  5DIK A;  1LW1 A;  2PRR A;  3C1L A;  4AKR A;  2OUW A;  1P8C A;  3LVY A;  5AFU K;  2CWQ A;  2KXP A;  2GMY A;  1GU9 A;  3AA1 A;  5DIP A;  3LK4 1;  3AAA A;  2JN8 A;  1KNC A;  3LK2 A;  1IZN A;  4G9Q A;  3LK3 A;  3D7I A;  2ES9 A;  1VKE A;  3AAE A;  5ADX K;  2QEU A;  2KZ7 A;  2IJC A;  1ME5 A;  3AA7 A;  2Q0T A;  2AF7 A;  2OYO A;  2O4D A;  3BEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...