2OYOA

Crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
DRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDHQIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Uncharacterized peroxidase-related protein (YP_604910.1) from Deinococcus geothermalis DSM 11300 at 1.51 A resolution
rcsb
source organism Deinococcus geothermalis
molecule tags Oxidoreductase
molecule keywords Uncharacterized peroxidase-related protein
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2oyoA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2oyoA02
2CWQA 1GU9A 2QEUA 3C1LA 1P8CA 2PRRA 2O4DA 1VKEA 2AF7A 4G9QA 2GMYA 2PFXA 2OYOA 1ME5A 5DIKA 3D7IA 1KNCA 2OUWA 3LVYA 5DIPA 1LW1A 2Q0TA 2IJCA 3BEYA
chains in the Genus database with same CATH superfamily
1Y9BA 1NTZJ 2J5UA 1IZNB 1CI6A 3RK3B 1EC5A 3PLNA 3P8MC 3Q5SA 2FYNB 1HF9A 2AEMA 2KK7A 2QJPC 4C46A 5KLVE 3VMYA 2QM8A 2ES9A 2IX7C 3VMXA 1EQ7A 1NTKK 2ZXXA 4H44B 4YXDC 1SQVG 3G71P 1YJNP 1KQSO 3E7KA 3L73E 2D2CB 2JWAA 1BCCG 2W83C 3LIEA 2HPCA 2RMZA 1PP9G 2V7QH 5KLIC 3USSA 1JCCA 2OYHB 1J1EB 2VRSA 2YO3A 3V2NA 1X0TA 5CCGD 3NTNA 3CCJP 3B5NB 3JCUH 2W6AA 1SQXK 1BE3G 5B66E 3O6QB 3CL3D 4I2LC 3SFEC 3CC7P 2Z4EA 3EWKA 1KNCA 4AKRA 2KNCB 5DIPA 3U1AA 3ITKA 3L73J 1L0NJ 1NTZG 3CWBD 3VTPC 2WT7B 2JWDA 2IDBA 1YQ4C 3M91A 4JYCA 4NPFX 4TLFA 2FYUG 1JMBA 1FDOA 1NU1J 2ZYGA 1CZQA 3H1LG 3L75J 2QEUA 3L4FA 1KC8Q 3KHUA 3MHVA 1NH4A 2GA1A 5AVTB 1NTKJ 1NTMK 1YBKA 2R3CA 2Y9ZA 3NXSA 2IBZG 1H0TA 3LK2A 1J2JB 5AVVB 2WPRA 3GHGA 3FGAD 5KAIE 4DJGA 1ZMEC 1LP1B 4IL6E 1FZCB 3CI9A 3BCCJ 1MFTA 1HJBA 2ZVNB 3MD0A 3TGUD 2CWQA 2NPSB 1VQLP 2E5YA 1J1EC 2JP3A 2QIWA 3L70E 5CBNA 2QM7A 1A02F 3HRNA 2WSSH 4Y99B 5DJUB 1GL2B 3L75D 1BE3D 3B71A 4M3LA 4Z1MH 1VQMP 1Y8AA 2IZ0A 3TGUE 1DEEG 1QVGO 1NO4A 1FDMA 1Y47A 2M5AB 1QX8A 1FU1A 1U7JA 1LT9A 3CWBG 3N7NA 1NKZB 1KN7A 1EZVE 2K9JA 3TDKA 3Q5PA 1URQB 3N4XA 1IFIA 2CPSA 2IBZI 1N7SC 3AEBC 3IAOA 4W80A 1H8AA 1GZLA 3H1IG 3IN6A 2IBZE 2WVRA 1H0TB 1FBMA 1NVOA 4PJ0E 2YMKA 5APUA 3C1LA 3OA7A 3V4QA 3V4WA 3AA6A 4HH2A 2M8RA 4OVNF 4I7ZC 4OGQC 3R2PA 1X22A 1JY3P 1HGVA 2W8ZA 3B4SA 3M0DC 3R4YA 1RE4C 5C39A 1IO4A 4N78D 3GG2A 1FAVA 1R5LA 1KILA 1KZUB 2ZT9B 2ZYDA 1URQD 3BCCE 5K5GB 2WTYA 2BCCG 3H1HJ 5B66H 3MZWB 4PV1D 3WUTA 1W2BO 3CCLP 1BSHA 2D2CC 1FZEA 2IFNA 1EXJA 3A7OA 2H89C 1NAYA 2JDIH 3G9RA 3D6YA 1ZN5A 2P1JA 1YTZT 2LR2A 3LW5J 1JTHA 2FBWC 4WY4B 4GIFA 2R32A 1OVVA 4MN4C 3II6A 3Q5RA 2N9YB 3AE5C 3HD7C 2FYNC 3L70D 1YHQP 2GM4A 1L0NE 2R44A 2ZJSE 1KILC 4PJ0H 1IJDB 2CK3H 3FWLA 3M9QA 3RK3C 5CBOA 3CX5D 1NTKG 5KAIH 4D6TE 2G3AA 2YIUB 4AYCA 1GD2E 1KQGB 5BU5A 4GDOA 1GL2A 2Y0DA 1KORA 5KJ7A 1JO5A 2HFED 3AE6C 1G1IA 2GUVA 2M3EA 2O01J 2ZFCA 4XA4A 2C9NY 3CCEP 2AXTH 2ZT9D 4DCKA 1QL2A 3LK41 1BE3J 1JM0A 1BGYD 1ZP0C 3I5CA 1JY2N 1LT9C 1ME5A 2P58A 2C0WA 1FDIA 1YQ3C 1GW3A 4OH8B 1M56D 1S5LX 1PP9J 1NTKE 2W6BA 4PD4D 2OUWA 3FWNA 1FOSE 4WWIA 2Q6QA 1KFMA 2E75B 1GK4A 4IOIH 1RY3A 1QEXA 2BEQD 2OGUA 3A0HE 2AXCA 1FZAA 3G3ZA 3HE4A 3SFDC 4YXWH 2KOGA 1AFOA 1G1JA 1KTMA 4IFFA 5AW5B 4H13C 4PD4I 2R5DA 3HD7B 3AA1A 1BGYJ 1JY2P 2KLVA 1IK9A 4BXLA 4RO0A 1PGJA 5BVZA 1OMIA 1PPJD 1M1KQ 1OW6A 1GL2D 1RH5B 2FYZA 5KJ7D 5CCHA 2WSCH 3BCCG 3F5HA 5AVZB 4RJTA 1YITP 3P7KA 1W2EA 3EFFK 3CCVP 2BEZF 4CPGA 1OWAA 1JMMA 2OYIB 4N78E 3Q1MA 3HE4B 1FJKA 1K9MQ 1KYOD 3HUSB 4RKUJ 5AW0B 5KTBA 1IZNA 1IFJA 4L75A 1LNQA 1N86A 4WY4A 3L75G 5CCGA 1QL1A 3LIDA 5KLVJ 2FYUJ 1JY3O 1SQXJ 3H1LJ 1L4AB 3O6QA 3V5BA 3IR9A 4C7RA 3Q3DA 3RK3E 1Q81Q 1T8ZA 1WMKA 3KZIE 3BVHA 1L0NG 3L73G 1SQBE 1X79B 1SQPD 1NTZE 2E76B 1FE6A 2WPSA 4KHXA 1GU9A 1KB9D 1CSBA 2P10A 3Q2YA 1NU1K 2AEJA 2M3BA 3H1KG 4WY4D 1L0LD 1K05A 3PH0A 1W5CE 2E76C 4JPZB 3SWYA 2HPCB 1LGHB 1NTMD 2B87A 4K3AA 3S1KA 2WQYC 3CCUP 2AXTE 1RF1A 2FYUE 1BCCJ 1E79H 2OARA 3H1LE 1VQ9P 1VQNP 5APTA 1PV3A 1KB9I 2WZ7A 1M90Q 1SQVJ 2KNCA 3B5NC 4Y99C 5CHXA 1PP9D 3HUSC 3KXDA 3CCQP 4W7YA 3H1JG 1CI6B 2QRXA 1EDKA 4OWFA 2P7JA 4DOJA 5DIKA 1N73A 2Q9IA 2N1TD 3A0HH 3B5ND 1HBWA 3CXHD 3L37A 1BCCE 3L72E 2M5AA 4H44C 3D6ZA 2UWJE 4BRYB 3QH9A 4U3FJ 3D70A 3OJAB 2OTJP 2XNDH 3L70J 1RQUA 4IFMA 1G2CA 1S5LE 2K9YA 3C9IA 3MUDA 3PHLA 1KQFB 5ADXK 2XDJA 3BASA 3AE1C 3W67A 2OYIA 2YKOA 1OXZA 1K04A 2M0BA 2O3JA 2E75C 3B5NA 3UIAA 1PL5A 2KYVA 4JF7A 5BU8B 2Q3EA 1PP9E 1YJWP 1ZW0A 1SQXE 1SLQA 3H32A 5KKZC 1HH0A 1EZVG 4ZMDA 4YTPC 1ZR4A 1N8RQ 3BATA 3L71G 1NYHA 3V2PA 2OYHC 1M57D 1T3JA 4QMAA 4DZOA 3V2RA 3NFQA 3LW5H 1QVFO 2LXBA 1URQA 1GU4A 3L74J 3GLMA 2ITAA 1JUNA 4HKZH 2KXPA 5AW6B 1SQQG 3KZIH 1L0LE 5CJ0A 4C7NA 3U59A 2N1TB 3KPEA 5E79H 2D2CD 1SQPJ 1LTTC 1UIXA 5KLVK 1Q82Q 3LVYA 1H88A 3L71E 1SQPE 2MJZA 1G2CB 5DJTB 2FYUK 2WSEH 1FZCA 1SP4A 2E74B 3A5TA 1U7MA 2YIUC 1NTZK 2E43A 3P8CD 1JCDA 1RE3C 2PP6A 3QWOC 2FFDC 1BDCA 2KZJA 1BSNA 3SWFA 4WB4A 1LWUC 2XZRA 2E74C 1EXIA 1E5WA 3P8CE 1GU5A 5AVSB 2IBZD 3RK2B 1YJ9P 2A45G 1VQ7P 1DIPA 2WMMA 4H0LB 3P32A 4NPEA 1LT9B 4G9QA 2KSEA 4IL6X 3RK2D 2WSCJ 3L72G 3H1HE 1VF5D 3W68A 3CC2P 1SQVK 1DD3A 1NAFA 4H0LC 5TJHA 1OVRA 3D71A 1NU1D 1GTWA 1SFCB 1OZHA 2IYOA 2KS1B 2C0XA 3V6IA 2W6JH 2P67A 1S5LH 3T97A 1VDFA 1LWUB 1QGKB 3L72J 1NKNA 3M0DA 4WBAA 5AVUB 2N9BA 3H1ID 2Q5UA 4RESB 5AW3B 2Q0TA 3AE4C 1D7MA 1KILB 1NTKD 3VMZA 4EDFA 1Q7YQ 2L5GB 2QJYB 3L36A 4HB1A 5CMZA 3H25A 3CCMP 3GF7A 1IK7A 1LTJC 1NTMJ 3GMAA 3SSUA 1PIXA 2IZ1A 3E1IA 3TGUJ 3HD7D 3L74D 1PPJG 3CWBE 4KJMA 2Q1KA 3CXHI 3H32B 1EDLA 3TGUG 1FC2C 1R5SA 5E79E 3WUVA 1ZXGA 1PGOA 3BRTB 5KJ7C 5APVA 3S4RA 3T97B 4D6TG 1VQ8P 4IFDK 2V7QJ 3HD7A 3A2AA 3H6PA 4EIJA 4I7ZB 2CPBA 1FZCC 2R5BA 2GUSA 5CCHD 2QJKC 2H43A 2FXPA 4UB8H 1SQPK 2FYUD 3H1LD 2KIKA 1IFNA 1N7SB 1NU1E 3HE5B 3M9BA 2ZXEB 4JYBA 3VYIA 1GDTA 1HJ0A 3G6EP 2YKPA 1JY3N 3AA0A 2Z5HA 1M1JB 2QVAA 5APWA 2K3RA 3AA7A 3H1HD 2QEXP 3AEEC 1S1CX 3BRVB 1KMIZ 4BWNA 1FZGA 3PP5A 1SQBD 4Y28J 5L8RJ 3PRJA 1SQBG 2K37A 2POHA 2YKQA 1LTBC 1JNMA 2PFXA 1NJIQ 1KD1Q 2J58A 3HTKB 2QA4P 3MGNA 2OYIC 1L2PA 1N7SA 1SQQE 3L74E 1JY2O 4U7JA 3G4SP 2H7HA 4UB6H 4GOFA 1EDIA 3H1JJ 2N1TA 3AAAA 4C7NB 1S2EA 1RF0A 1JTHB 3VMAA 2L91A 4GT1A 1KB9H 1U57A 1LTJB 4R4MA 1X9VA 5KAFH 2QJPB 4L76A 4JBZA 3EFGA 2NRGA 2HODB 2HYNA 3CCSP 2KLUA 5GTIE 1WRGA 2R3SA 1LWUA 4H13B 4KT0J 3AEDC 3JSVC 1USEA 5AVYB 1NOHA 1ZRTE 3CC4P 1BE3E 1P84E 2QJKB 1P8CA 1Q90D 3GF3A 2JEEA 1SQQJ 2JO1A 2YXQB 1KFNA 3H1KJ 4LGDE 3S9OA 4N6JA 1P84D 3RBXA 1MFZA 3L71J 2JR8A 1UIIA 2E42A 2W90A 2IPPA 3KQGA 2E75D 2LKMA 1L0LJ 2KZIA 4GKGA 1NGMB 2KXPB 1SS1A 1YI2P 1OW7A 3D7IA 2PAJA 4GOEA 3PJSK 1H89A 1M1JA 2OTLP 4UB8E 4W7ZA 1LTIC 2YO2A 2OQQA 2HR3A 1GK6A 3M9HA 5AVRB 1BDDA 3HE5A 3TK1A 1SFCA 1SVFA 2KS1A 3RL0D 3WMM0 1X8YA 2QJYC 3ZDMA 5KKZB 3I55P 1VQPP 2E76D 3TYYA 1VQOP 3NMDA 2KUBA 1MKMA 1T3UA 1AVYA 1JB0J 1LJ2A 1SQQK 2SPZA 3IF4A 4WVZA 5APYA 3RGUA 3RL0B 4PD4H 3GW6A 1OW8A 1L4AD 1L0LG 2PRRA 3CX5E 1AVOA 2DW3A 3CMAP 1PFIA 2ZYAA 3H1IE 5AW7B 2JKVA 4R4LA 1FZFA 2O4DA 3PTZA 1S4XA 4OGQD 1R8EA 1S72P 2V4HA 3MTUE 2AF7A 4PV1B 2BASA 1MZ9A 2H8PD 3IFMA 4YPCA 3FX0A 5GTHE 1Z56A 4N3YB 2FY8A 1HWTC 4EI2A 2HODA 2ZVOB 4UB6E 2KB7P 2Q3IA 5KLVD 4K35A 3TNUB 3CD6P 1RF0C 2IYPA 3H1JD 1SQXD 4PV1C 2YMYA 1HGZA 4O9BA 1VF5C 1IFMA 1KB9E 2A45I 4L74A 5EFWB 1LTJA 2XU6A 5KAFE 1NTZD 2A06D 3RK2C 4B86A 5CJ4A 4I1LA 3AE8C 5GTIH 3AEFC 5B5EH 4OGQB 1LW1A 1DX7A 2P2UA 4H13D 1P84H 1WT6A 1P84I 4LLHA 5AW2B 2FFDB 2IJCA 2O1KA 5APQA 1DD4A 1XTCC 1NTMG 1RQVA 4NPDA 3U1CA 4JQ0D 3E1RA 4H44D 1T6AA 3H1KD 3CLQA 1N73B 1N7SD 2WSEJ 3M0AA 3BEYA 1AQTA 1K73Q 3EQ2A 1IFDA 5APXA 1N2DC 3L71D 1SQVD 3AE3C 3OW2O 1EZVD 2K9JB 3B8EB 3L35A 2QSIA 1SQBJ 3KYQA 4ZKPA 1GMJA 1PZQA 2GMYA 1PPJE 1PGPA 1GL2C 2FXMA 5CCGC 5TISE 1M7LA 1MUUA 3M06A 2KI7B 5AW8B 2ZT9C 2FFDA 2Y0EA 2BCCD 3L75E 2OTKE 3HUSA 3RBZA 2Y0CA 1BGYG 2A06G 1KYOH 3CX5I 1L0LK 2BCCE 2RN0A 1FOSF 1ZRTD 3CMEP 4HJGH 4U3FD 2HG5D 2Y9YA 1L0NK 2WITA 1NWQA 1RF1C 1RE3A 1N7LA 1HUCA 4PD4E 1IFPA 1M1JC 1KYOI 3CX5H 3OAKA 1M8OB 2FKWB 2NPSD 2O01N 2QE7H 1T2KD 1HVVA 1GW4A 2K88A 1URQC 2ZAEB 3VN0A 3WUUA 3V2QA 4D6TJ 1BGYE 3AE7C 3RK3D 3AE2C 3AAEA 3WU2E 3WU2H 3H1KE 1RF1B 1OFCX 3MP7B 1AV1A 3FXEA 3SWKA 4ZKUA 5GTHH 2H88C 2G8YA 2JJLA 4XE5B 1KV4A 1VKEA 3CXHE 1PGQA 3L72D 1AJYA 2NPSA 2XKMA 3AEAC 2OYOA 1Q2NA 2LXCB 5H2FH 2Q7CA 2NPSC 2A06E 5AW4B 3MUDC 5AVWB 1FS0E 1DEBA 5B5EE 1S9KD 1YIJP 3H1JE 1L4AA 3AECC 4TT3H 3A0BE 1OVUA 2WSFJ 1YTZI 1VPCA 3L73D 1LTSC 2XV5A 1OX3A 1RHZB 4I6MC 1N73C 1EZVI 3C8VA 3FXDA 2KZ7A 1KQLA 2WSFH 2YNYA 2K1AA 2XNXA 5APSA 1HTLC 2HLOA 4AUWA 5AFUK 1JEKA 2WPQA 1FJPA 3LK3A 3RL0g 3GHGB 1L4AC 2W27A 4EYYQ 5TISH 1ZOYC 1Q86Q 3AEGC 2BCCJ 3H1HG 3VP8A 2YXRB 2KSJA 1KILD 3F89A 2I1KA 1VF5B 3JC22 2B88A 1AA0A 2IFMA 4L73A 5KLIB 2FXOA 1S9KE 1AQ5A 1S3JA 1SQBK 1KYOE 4H0LD 1LTAC 1VL2A 1CW5A 1BCCD 1YYCA 3AE9C 2O01H 1QLED 5AVXB 2B87B 5CCHC 2J59M 2WT7A 2WWWA 4BRYA 1T2KC 2B9BA 3H1IJ 1TU3F 4LC1A 4D6TD 4EOTA 1USDA 2RH0A 3JCUE 3TNUA 2I8DA 1SFCD 1VQ6P 2C9LY 1SQPG 3O8ZA 4GODA 4U3FE 5AVQB 2E74D 1J1DC 1L0ND 3A3YB 3CWBJ 3HTKA 3RL0C 1ZR2A 2OYHA 1J1DB 3ABVC 4HYTB 2NZ2A 1LP1A 3CXHH 3L74G 2MKVA 1VQKP 3I56P 1VQ4P 1LTGC 1NTME 3CCRP 1SFCC 3VOPA 4WY4C 5AW1B 4ASVA 1MV8A 3K5BA 5H2FE 1ZLLA 4A7PA 2N1TC 3VP9A 3TF5A 2I1JA 1A02J 1FZBA 1XTGB 5AW9B 1SQVE 2RKLA 1SQXG 4ASWA 3BCCD 4IL6H 2O1JA 1IC2A 2PGDA 4DT0A 3A0BH 2AEFA 5KLVG 2KP8A 1ZV8A 4ZNCA 3MIWA 2JN8A 1EDJA 1JOCA 1SQQD 2A45H 4XFJA 1OIPA 2Z5IA 1NHLA 4AQRD 1VQ5P 2B89A 1LT1A 3L70G 3TSIA 3CPWO 2E5TA 1RE4A 1NU1G 1KILE 4U3FG 2QG4A 1K8AQ 1DH3A 3GHGC 3KDPB 2WPVB 5M1BA
chains in the Genus database with same CATH topology
2CWQA 1GU9A 5ADXK 2KZ7A 2QEUA 3AA0A 3AA6A 3AA1A 4AKRA 2PRRA 1P8CA 3AAEA 3C1LA 3LK3A 3AA7A 5AFUK 3LK2A 2ES9A 2O4DA 1VKEA 2AF7A 4G9QA 2GMYA 2PFXA 2OYOA 3LK41 1ME5A 2KXPA 1IZNA 2JN8A 5DIKA 3D7IA 1KNCA 2OUWA 3AAAA 3LVYA 5DIPA 1LW1A 2Q0TA 2IJCA 3BEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWQ A;  1GU9 A;  2QEU A;  3C1L A;  1P8C A;  2PRR A;  2O4D A;  1VKE A;  2AF7 A;  4G9Q A;  2GMY A;  2PFX A;  2OYO A;  1ME5 A;  5DIK A;  3D7I A;  1KNC A;  2OUW A;  3LVY A;  5DIP A;  1LW1 A;  2Q0T A;  2IJC A;  3BEY A; 
#chains in the Genus database with same CATH topology
 1Y9B A;  1NTZ J;  2J5U A;  1IZN B;  1CI6 A;  3RK3 B;  1EC5 A;  3PLN A;  3P8M C;  3Q5S A;  2FYN B;  1HF9 A;  2AEM A;  2KK7 A;  2QJP C;  4C46 A;  5KLV E;  3VMY A;  2QM8 A;  2ES9 A;  2IX7 C;  3VMX A;  1EQ7 A;  1NTK K;  2ZXX A;  4H44 B;  4YXD C;  1SQV G;  3G71 P;  1YJN P;  1KQS O;  3E7K A;  3L73 E;  2D2C B;  2JWA A;  1BCC G;  2W83 C;  3LIE A;  2HPC A;  2RMZ A;  1PP9 G;  2V7Q H;  5KLI C;  3USS A;  1JCC A;  2OYH B;  1J1E B;  2VRS A;  2YO3 A;  3V2N A;  1X0T A;  5CCG D;  3NTN A;  3CCJ P;  3B5N B;  3JCU H;  2W6A A;  1SQX K;  1BE3 G;  5B66 E;  3O6Q B;  3CL3 D;  4I2L C;  3SFE C;  3CC7 P;  2Z4E A;  3EWK A;  1KNC A;  4AKR A;  2KNC B;  5DIP A;  3U1A A;  3ITK A;  3L73 J;  1L0N J;  1NTZ G;  3CWB D;  3VTP C;  2WT7 B;  2JWD A;  2IDB A;  1YQ4 C;  3M91 A;  4JYC A;  4NPF X;  4TLF A;  2FYU G;  1JMB A;  1FDO A;  1NU1 J;  2ZYG A;  1CZQ A;  3H1L G;  3L75 J;  2QEU A;  3L4F A;  1KC8 Q;  3KHU A;  3MHV A;  1NH4 A;  2GA1 A;  5AVT B;  1NTK J;  1NTM K;  1YBK A;  2R3C A;  2Y9Z A;  3NXS A;  2IBZ G;  1H0T A;  3LK2 A;  1J2J B;  5AVV B;  2WPR A;  3GHG A;  3FGA D;  5KAI E;  4DJG A;  1ZME C;  1LP1 B;  4IL6 E;  1FZC B;  3CI9 A;  3BCC J;  1MFT A;  1HJB A;  2ZVN B;  3MD0 A;  3TGU D;  2CWQ A;  2NPS B;  1VQL P;  2E5Y A;  1J1E C;  2JP3 A;  2QIW A;  3L70 E;  5CBN A;  2QM7 A;  1A02 F;  3HRN A;  2WSS H;  4Y99 B;  5DJU B;  1GL2 B;  3L75 D;  1BE3 D;  3B71 A;  4M3L A;  4Z1M H;  1VQM P;  1Y8A A;  2IZ0 A;  3TGU E;  1DEE G;  1QVG O;  1NO4 A;  1FDM A;  1Y47 A;  2M5A B;  1QX8 A;  1FU1 A;  1U7J A;  1LT9 A;  3CWB G;  3N7N A;  1NKZ B;  1KN7 A;  1EZV E;  2K9J A;  3TDK A;  3Q5P A;  1URQ B;  3N4X A;  1IFI A;  2CPS A;  2IBZ I;  1N7S C;  3AEB C;  3IAO A;  4W80 A;  1H8A A;  1GZL A;  3H1I G;  3IN6 A;  2IBZ E;  2WVR A;  1H0T B;  1FBM A;  1NVO A;  4PJ0 E;  2YMK A;  5APU A;  3C1L A;  3OA7 A;  3V4Q A;  3V4W A;  3AA6 A;  4HH2 A;  2M8R A;  4OVN F;  4I7Z C;  4OGQ C;  3R2P A;  1X22 A;  1JY3 P;  1HGV A;  2W8Z A;  3B4S A;  3M0D C;  3R4Y A;  1RE4 C;  5C39 A;  1IO4 A;  4N78 D;  3GG2 A;  1FAV A;  1R5L A;  1KIL A;  1KZU B;  2ZT9 B;  2ZYD A;  1URQ D;  3BCC E;  5K5G B;  2WTY A;  2BCC G;  3H1H J;  5B66 H;  3MZW B;  4PV1 D;  3WUT A;  1W2B O;  3CCL P;  1BSH A;  2D2C C;  1FZE A;  2IFN A;  1EXJ A;  3A7O A;  2H89 C;  1NAY A;  2JDI H;  3G9R A;  3D6Y A;  1ZN5 A;  2P1J A;  1YTZ T;  2LR2 A;  3LW5 J;  1JTH A;  2FBW C;  4WY4 B;  4GIF A;  2R32 A;  1OVV A;  4MN4 C;  3II6 A;  3Q5R A;  2N9Y B;  3AE5 C;  3HD7 C;  2FYN C;  3L70 D;  1YHQ P;  2GM4 A;  1L0N E;  2R44 A;  2ZJS E;  1KIL C;  4PJ0 H;  1IJD B;  2CK3 H;  3FWL A;  3M9Q A;  3RK3 C;  5CBO A;  3CX5 D;  1NTK G;  5KAI H;  4D6T E;  2G3A A;  2YIU B;  4AYC A;  1GD2 E;  1KQG B;  5BU5 A;  4GDO A;  1GL2 A;  2Y0D A;  1KOR A;  5KJ7 A;  1JO5 A;  2HFE D;  3AE6 C;  1G1I A;  2GUV A;  2M3E A;  2O01 J;  2ZFC A;  4XA4 A;  2C9N Y;  3CCE P;  2AXT H;  2ZT9 D;  4DCK A;  1QL2 A;  3LK4 1;  1BE3 J;  1JM0 A;  1BGY D;  1ZP0 C;  3I5C A;  1JY2 N;  1LT9 C;  1ME5 A;  2P58 A;  2C0W A;  1FDI A;  1YQ3 C;  1GW3 A;  4OH8 B;  1M56 D;  1S5L X;  1PP9 J;  1NTK E;  2W6B A;  4PD4 D;  2OUW A;  3FWN A;  1FOS E;  4WWI A;  2Q6Q A;  1KFM A;  2E75 B;  1GK4 A;  4IOI H;  1RY3 A;  1QEX A;  2BEQ D;  2OGU A;  3A0H E;  2AXC A;  1FZA A;  3G3Z A;  3HE4 A;  3SFD C;  4YXW H;  2KOG A;  1AFO A;  1G1J A;  1KTM A;  4IFF A;  5AW5 B;  4H13 C;  4PD4 I;  2R5D A;  3HD7 B;  3AA1 A;  1BGY J;  1JY2 P;  2KLV A;  1IK9 A;  4BXL A;  4RO0 A;  1PGJ A;  5BVZ A;  1OMI A;  1PPJ D;  1M1K Q;  1OW6 A;  1GL2 D;  1RH5 B;  2FYZ A;  5KJ7 D;  5CCH A;  2WSC H;  3BCC G;  3F5H A;  5AVZ B;  4RJT A;  1YIT P;  3P7K A;  1W2E A;  3EFF K;  3CCV P;  2BEZ F;  4CPG A;  1OWA A;  1JMM A;  2OYI B;  4N78 E;  3Q1M A;  3HE4 B;  1FJK A;  1K9M Q;  1KYO D;  3HUS B;  4RKU J;  5AW0 B;  5KTB A;  1IZN A;  1IFJ A;  4L75 A;  1LNQ A;  1N86 A;  4WY4 A;  3L75 G;  5CCG A;  1QL1 A;  3LID A;  5KLV J;  2FYU J;  1JY3 O;  1SQX J;  3H1L J;  1L4A B;  3O6Q A;  3V5B A;  3IR9 A;  4C7R A;  3Q3D A;  3RK3 E;  1Q81 Q;  1T8Z A;  1WMK A;  3KZI E;  3BVH A;  1L0N G;  3L73 G;  1SQB E;  1X79 B;  1SQP D;  1NTZ E;  2E76 B;  1FE6 A;  2WPS A;  4KHX A;  1GU9 A;  1KB9 D;  1CSB A;  2P10 A;  3Q2Y A;  1NU1 K;  2AEJ A;  2M3B A;  3H1K G;  4WY4 D;  1L0L D;  1K05 A;  3PH0 A;  1W5C E;  2E76 C;  4JPZ B;  3SWY A;  2HPC B;  1LGH B;  1NTM D;  2B87 A;  4K3A A;  3S1K A;  2WQY C;  3CCU P;  2AXT E;  1RF1 A;  2FYU E;  1BCC J;  1E79 H;  2OAR A;  3H1L E;  1VQ9 P;  1VQN P;  5APT A;  1PV3 A;  1KB9 I;  2WZ7 A;  1M90 Q;  1SQV J;  2KNC A;  3B5N C;  4Y99 C;  5CHX A;  1PP9 D;  3HUS C;  3KXD A;  3CCQ P;  4W7Y A;  3H1J G;  1CI6 B;  2QRX A;  1EDK A;  4OWF A;  2P7J A;  4DOJ A;  5DIK A;  1N73 A;  2Q9I A;  2N1T D;  3A0H H;  3B5N D;  1HBW A;  3CXH D;  3L37 A;  1BCC E;  3L72 E;  2M5A A;  4H44 C;  3D6Z A;  2UWJ E;  4BRY B;  3QH9 A;  4U3F J;  3D70 A;  3OJA B;  2OTJ P;  2XND H;  3L70 J;  1RQU A;  4IFM A;  1G2C A;  1S5L E;  2K9Y A;  3C9I A;  3MUD A;  3PHL A;  1KQF B;  5ADX K;  2XDJ A;  3BAS A;  3AE1 C;  3W67 A;  2OYI A;  2YKO A;  1OXZ A;  1K04 A;  2M0B A;  2O3J A;  2E75 C;  3B5N A;  3UIA A;  1PL5 A;  2KYV A;  4JF7 A;  5BU8 B;  2Q3E A;  1PP9 E;  1YJW P;  1ZW0 A;  1SQX E;  1SLQ A;  3H32 A;  5KKZ C;  1HH0 A;  1EZV G;  4ZMD A;  4YTP C;  1ZR4 A;  1N8R Q;  3BAT A;  3L71 G;  1NYH A;  3V2P A;  2OYH C;  1M57 D;  1T3J A;  4QMA A;  4DZO A;  3V2R A;  3NFQ A;  3LW5 H;  1QVF O;  2LXB A;  1URQ A;  1GU4 A;  3L74 J;  3GLM A;  2ITA A;  1JUN A;  4HKZ H;  2KXP A;  5AW6 B;  1SQQ G;  3KZI H;  1L0L E;  5CJ0 A;  4C7N A;  3U59 A;  2N1T B;  3KPE A;  5E79 H;  2D2C D;  1SQP J;  1LTT C;  1UIX A;  5KLV K;  1Q82 Q;  3LVY A;  1H88 A;  3L71 E;  1SQP E;  2MJZ A;  1G2C B;  5DJT B;  2FYU K;  2WSE H;  1FZC A;  1SP4 A;  2E74 B;  3A5T A;  1U7M A;  2YIU C;  1NTZ K;  2E43 A;  3P8C D;  1JCD A;  1RE3 C;  2PP6 A;  3QWO C;  2FFD C;  1BDC A;  2KZJ A;  1BSN A;  3SWF A;  4WB4 A;  1LWU C;  2XZR A;  2E74 C;  1EXI A;  1E5W A;  3P8C E;  1GU5 A;  5AVS B;  2IBZ D;  3RK2 B;  1YJ9 P;  2A45 G;  1VQ7 P;  1DIP A;  2WMM A;  4H0L B;  3P32 A;  4NPE A;  1LT9 B;  4G9Q A;  2KSE A;  4IL6 X;  3RK2 D;  2WSC J;  3L72 G;  3H1H E;  1VF5 D;  3W68 A;  3CC2 P;  1SQV K;  1DD3 A;  1NAF A;  4H0L C;  5TJH A;  1OVR A;  3D71 A;  1NU1 D;  1GTW A;  1SFC B;  1OZH A;  2IYO A;  2KS1 B;  2C0X A;  3V6I A;  2W6J H;  2P67 A;  1S5L H;  3T97 A;  1VDF A;  1LWU B;  1QGK B;  3L72 J;  1NKN A;  3M0D A;  4WBA A;  5AVU B;  2N9B A;  3H1I D;  2Q5U A;  4RES B;  5AW3 B;  2Q0T A;  3AE4 C;  1D7M A;  1KIL B;  1NTK D;  3VMZ A;  4EDF A;  1Q7Y Q;  2L5G B;  2QJY B;  3L36 A;  4HB1 A;  5CMZ A;  3H25 A;  3CCM P;  3GF7 A;  1IK7 A;  1LTJ C;  1NTM J;  3GMA A;  3SSU A;  1PIX A;  2IZ1 A;  3E1I A;  3TGU J;  3HD7 D;  3L74 D;  1PPJ G;  3CWB E;  4KJM A;  2Q1K A;  3CXH I;  3H32 B;  1EDL A;  3TGU G;  1FC2 C;  1R5S A;  5E79 E;  3WUV A;  1ZXG A;  1PGO A;  3BRT B;  5KJ7 C;  5APV A;  3S4R A;  3T97 B;  4D6T G;  1VQ8 P;  4IFD K;  2V7Q J;  3HD7 A;  3A2A A;  3H6P A;  4EIJ A;  4I7Z B;  2CPB A;  1FZC C;  2R5B A;  2GUS A;  5CCH D;  2QJK C;  2H43 A;  2FXP A;  4UB8 H;  1SQP K;  2FYU D;  3H1L D;  2KIK A;  1IFN A;  1N7S B;  1NU1 E;  3HE5 B;  3M9B A;  2ZXE B;  4JYB A;  3VYI A;  1GDT A;  1HJ0 A;  3G6E P;  2YKP A;  1JY3 N;  3AA0 A;  2Z5H A;  1M1J B;  2QVA A;  5APW A;  2K3R A;  3AA7 A;  3H1H D;  2QEX P;  3AEE C;  1S1C X;  3BRV B;  1KMI Z;  4BWN A;  1FZG A;  3PP5 A;  1SQB D;  4Y28 J;  5L8R J;  3PRJ A;  1SQB G;  2K37 A;  2POH A;  2YKQ A;  1LTB C;  1JNM A;  2PFX A;  1NJI Q;  1KD1 Q;  2J58 A;  3HTK B;  2QA4 P;  3MGN A;  2OYI C;  1L2P A;  1N7S A;  1SQQ E;  3L74 E;  1JY2 O;  4U7J A;  3G4S P;  2H7H A;  4UB6 H;  4GOF A;  1EDI A;  3H1J J;  2N1T A;  3AAA A;  4C7N B;  1S2E A;  1RF0 A;  1JTH B;  3VMA A;  2L91 A;  4GT1 A;  1KB9 H;  1U57 A;  1LTJ B;  4R4M A;  1X9V A;  5KAF H;  2QJP B;  4L76 A;  4JBZ A;  3EFG A;  2NRG A;  2HOD B;  2HYN A;  3CCS P;  2KLU A;  5GTI E;  1WRG A;  2R3S A;  1LWU A;  4H13 B;  4KT0 J;  3AED C;  3JSV C;  1USE A;  5AVY B;  1NOH A;  1ZRT E;  3CC4 P;  1BE3 E;  1P84 E;  2QJK B;  1P8C A;  1Q90 D;  3GF3 A;  2JEE A;  1SQQ J;  2JO1 A;  2YXQ B;  1KFN A;  3H1K J;  4LGD E;  3S9O A;  4N6J A;  1P84 D;  3RBX A;  1MFZ A;  3L71 J;  2JR8 A;  1UII A;  2E42 A;  2W90 A;  2IPP A;  3KQG A;  2E75 D;  2LKM A;  1L0L J;  2KZI A;  4GKG A;  1NGM B;  2KXP B;  1SS1 A;  1YI2 P;  1OW7 A;  3D7I A;  2PAJ A;  4GOE A;  3PJS K;  1H89 A;  1M1J A;  2OTL P;  4UB8 E;  4W7Z A;  1LTI C;  2YO2 A;  2OQQ A;  2HR3 A;  1GK6 A;  3M9H A;  5AVR B;  1BDD A;  3HE5 A;  3TK1 A;  1SFC A;  1SVF A;  2KS1 A;  3RL0 D;  3WMM 0;  1X8Y A;  2QJY C;  3ZDM A;  5KKZ B;  3I55 P;  1VQP P;  2E76 D;  3TYY A;  1VQO P;  3NMD A;  2KUB A;  1MKM A;  1T3U A;  1AVY A;  1JB0 J;  1LJ2 A;  1SQQ K;  2SPZ A;  3IF4 A;  4WVZ A;  5APY A;  3RGU A;  3RL0 B;  4PD4 H;  3GW6 A;  1OW8 A;  1L4A D;  1L0L G;  2PRR A;  3CX5 E;  1AVO A;  2DW3 A;  3CMA P;  1PFI A;  2ZYA A;  3H1I E;  5AW7 B;  2JKV A;  4R4L A;  1FZF A;  2O4D A;  3PTZ A;  1S4X A;  4OGQ D;  1R8E A;  1S72 P;  2V4H A;  3MTU E;  2AF7 A;  4PV1 B;  2BAS A;  1MZ9 A;  2H8P D;  3IFM A;  4YPC A;  3FX0 A;  5GTH E;  1Z56 A;  4N3Y B;  2FY8 A;  1HWT C;  4EI2 A;  2HOD A;  2ZVO B;  4UB6 E;  2KB7 P;  2Q3I A;  5KLV D;  4K35 A;  3TNU B;  3CD6 P;  1RF0 C;  2IYP A;  3H1J D;  1SQX D;  4PV1 C;  2YMY A;  1HGZ A;  4O9B A;  1VF5 C;  1IFM A;  1KB9 E;  2A45 I;  4L74 A;  5EFW B;  1LTJ A;  2XU6 A;  5KAF E;  1NTZ D;  2A06 D;  3RK2 C;  4B86 A;  5CJ4 A;  4I1L A;  3AE8 C;  5GTI H;  3AEF C;  5B5E H;  4OGQ B;  1LW1 A;  1DX7 A;  2P2U A;  4H13 D;  1P84 H;  1WT6 A;  1P84 I;  4LLH A;  5AW2 B;  2FFD B;  2IJC A;  2O1K A;  5APQ A;  1DD4 A;  1XTC C;  1NTM G;  1RQV A;  4NPD A;  3U1C A;  4JQ0 D;  3E1R A;  4H44 D;  1T6A A;  3H1K D;  3CLQ A;  1N73 B;  1N7S D;  2WSE J;  3M0A A;  3BEY A;  1AQT A;  1K73 Q;  3EQ2 A;  1IFD A;  5APX A;  1N2D C;  3L71 D;  1SQV D;  3AE3 C;  3OW2 O;  1EZV D;  2K9J B;  3B8E B;  3L35 A;  2QSI A;  1SQB J;  3KYQ A;  4ZKP A;  1GMJ A;  1PZQ A;  2GMY A;  1PPJ E;  1PGP A;  1GL2 C;  2FXM A;  5CCG C;  5TIS E;  1M7L A;  1MUU A;  3M06 A;  2KI7 B;  5AW8 B;  2ZT9 C;  2FFD A;  2Y0E A;  2BCC D;  3L75 E;  2OTK E;  3HUS A;  3RBZ A;  2Y0C A;  1BGY G;  2A06 G;  1KYO H;  3CX5 I;  1L0L K;  2BCC E;  2RN0 A;  1FOS F;  1ZRT D;  3CME P;  4HJG H;  4U3F D;  2HG5 D;  2Y9Y A;  1L0N K;  2WIT A;  1NWQ A;  1RF1 C;  1RE3 A;  1N7L A;  1HUC A;  4PD4 E;  1IFP A;  1M1J C;  1KYO I;  3CX5 H;  3OAK A;  1M8O B;  2FKW B;  2NPS D;  2O01 N;  2QE7 H;  1T2K D;  1HVV A;  1GW4 A;  2K88 A;  1URQ C;  2ZAE B;  3VN0 A;  3WUU A;  3V2Q A;  4D6T J;  1BGY E;  3AE7 C;  3RK3 D;  3AE2 C;  3AAE A;  3WU2 E;  3WU2 H;  3H1K E;  1RF1 B;  1OFC X;  3MP7 B;  1AV1 A;  3FXE A;  3SWK A;  4ZKU A;  5GTH H;  2H88 C;  2G8Y A;  2JJL A;  4XE5 B;  1KV4 A;  1VKE A;  3CXH E;  1PGQ A;  3L72 D;  1AJY A;  2NPS A;  2XKM A;  3AEA C;  2OYO A;  1Q2N A;  2LXC B;  5H2F H;  2Q7C A;  2NPS C;  2A06 E;  5AW4 B;  3MUD C;  5AVW B;  1FS0 E;  1DEB A;  5B5E E;  1S9K D;  1YIJ P;  3H1J E;  1L4A A;  3AEC C;  4TT3 H;  3A0B E;  1OVU A;  2WSF J;  1YTZ I;  1VPC A;  3L73 D;  1LTS C;  2XV5 A;  1OX3 A;  1RHZ B;  4I6M C;  1N73 C;  1EZV I;  3C8V A;  3FXD A;  2KZ7 A;  1KQL A;  2WSF H;  2YNY A;  2K1A A;  2XNX A;  5APS A;  1HTL C;  2HLO A;  4AUW A;  5AFU K;  1JEK A;  2WPQ A;  1FJP A;  3LK3 A;  3RL0 g;  3GHG B;  1L4A C;  2W27 A;  4EYY Q;  5TIS H;  1ZOY C;  1Q86 Q;  3AEG C;  2BCC J;  3H1H G;  3VP8 A;  2YXR B;  2KSJ A;  1KIL D;  3F89 A;  2I1K A;  1VF5 B;  3JC2 2;  2B88 A;  1AA0 A;  2IFM A;  4L73 A;  5KLI B;  2FXO A;  1S9K E;  1AQ5 A;  1S3J A;  1SQB K;  1KYO E;  4H0L D;  1LTA C;  1VL2 A;  1CW5 A;  1BCC D;  1YYC A;  3AE9 C;  2O01 H;  1QLE D;  5AVX B;  2B87 B;  5CCH C;  2J59 M;  2WT7 A;  2WWW A;  4BRY A;  1T2K C;  2B9B A;  3H1I J;  1TU3 F;  4LC1 A;  4D6T D;  4EOT A;  1USD A;  2RH0 A;  3JCU E;  3TNU A;  2I8D A;  1SFC D;  1VQ6 P;  2C9L Y;  1SQP G;  3O8Z A;  4GOD A;  4U3F E;  5AVQ B;  2E74 D;  1J1D C;  1L0N D;  3A3Y B;  3CWB J;  3HTK A;  3RL0 C;  1ZR2 A;  2OYH A;  1J1D B;  3ABV C;  4HYT B;  2NZ2 A;  1LP1 A;  3CXH H;  3L74 G;  2MKV A;  1VQK P;  3I56 P;  1VQ4 P;  1LTG C;  1NTM E;  3CCR P;  1SFC C;  3VOP A;  4WY4 C;  5AW1 B;  4ASV A;  1MV8 A;  3K5B A;  5H2F E;  1ZLL A;  4A7P A;  2N1T C;  3VP9 A;  3TF5 A;  2I1J A;  1A02 J;  1FZB A;  1XTG B;  5AW9 B;  1SQV E;  2RKL A;  1SQX G;  4ASW A;  3BCC D;  4IL6 H;  2O1J A;  1IC2 A;  2PGD A;  4DT0 A;  3A0B H;  2AEF A;  5KLV G;  2KP8 A;  1ZV8 A;  4ZNC A;  3MIW A;  2JN8 A;  1EDJ A;  1JOC A;  1SQQ D;  2A45 H;  4XFJ A;  1OIP A;  2Z5I A;  1NHL A;  4AQR D;  1VQ5 P;  2B89 A;  1LT1 A;  3L70 G;  3TSI A;  3CPW O;  2E5T A;  1RE4 A;  1NU1 G;  1KIL E;  4U3F G;  2QG4 A;  1K8A Q;  1DH3 A;  3GHG C;  3KDP B;  2WPV B;  5M1B A; 
#chains in the Genus database with same CATH homology
 2CWQ A;  1GU9 A;  5ADX K;  2KZ7 A;  2QEU A;  3AA0 A;  3AA6 A;  3AA1 A;  4AKR A;  2PRR A;  1P8C A;  3AAE A;  3C1L A;  3LK3 A;  3AA7 A;  5AFU K;  3LK2 A;  2ES9 A;  2O4D A;  1VKE A;  2AF7 A;  4G9Q A;  2GMY A;  2PFX A;  2OYO A;  3LK4 1;  1ME5 A;  2KXP A;  1IZN A;  2JN8 A;  5DIK A;  3D7I A;  1KNC A;  2OUW A;  3AAA A;  3LVY A;  5DIP A;  1LW1 A;  2Q0T A;  2IJC A;  3BEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...