2OYOA

Crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
DRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDHQIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of Uncharacterized peroxidase-related protein (YP_604910.1) from Deinococcus geothermalis DSM 11300 at 1.51 A resolution
rcsb
source organism Deinococcus geothermalis
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2oyoA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2oyoA02
4G9QA 3LVYA 2O4DA 2Q0TA 2PRRA 5DIPA 1GU9A 2OUWA 3C1LA 2IJCA 2PFXA 1ME5A 1P8CA 1LW1A 3D7IA 1KNCA 2GMYA 2OYOA 3BEYA 5DIKA 2AF7A 2QEUA 1VKEA 2CWQA
chains in the Genus database with same CATH superfamily
3B5ND 5AFUK 1AA0A 4PJ0E 3VP8A 1VF5B 2QM7A 2M5AB 2KS1A 3CWBE 1EC5A 1SQXJ 1ZR2A 1PP9E 3IFMA 2H7HA 2KOGA 4B86A 5CBOA 3L71E 2E76B 1YITP 3D6ZA 1W2EA 3L75J 1AVOA 3A0BH 1JO5A 1EXIA 1KQLA 1QGKB 1OVVA 1BE3J 2FXOA 2LXCB 4IL6X 3BCCD 1RQVA 3H1LD 1BGYG 1LNQA 4H44C 1S9KE 3BEYA 3A0BE 2J59M 3V5BA 1AQ5A 1KN7A 1URQC 5AW0B 4U3FD 4H0LD 5CCGD 2CK3H 3V2NA 4HYTB 1Q7YQ 5AW8B 1FDIA 1MFZA 1VPCA 2A45H 3HE4A 1M1KQ 3T97B 3TGUJ 3CCJP 1KILD 1GW3A 3CCQP 2LR2A 3F5HA 2NPSB 1GZLA 2WPQA 3II6A 1T2KD 1KC8Q 1KYOI 2K3RA 2K37A 2OTJP 4BRYB 2D2CB 2E75B 4Z1MH 1OFCX 2GM4A 4LC1A 3BCCG 1X79B 3H1HE 3HUSA 3H1LG 3D70A 1HUCA 1K73Q 5KJ7A 5AW5B 1PGJA 1BCCD 4U3FG 1QEXA 2LXBA 2ZVOB 1YQ3C 3Q3DA 3WMM0 1NTKE 3RK2B 4XA4A 3VYIA 1ZRTD 1ZOYC 1LTIC 3RK3B 4GOFA 4H13D 3H1KD 1J1DC 4IFDK 2PRRA 1LP1A 1S72P 1SS1A 2R3CA 1JY3N 2P67A 3TNUA 2M3EA 1KD1Q 1GL2D 5AVYB 3HD7A 2IBZI 3FX0A 2AEJA 1SQXE 1P84D 1SP4A 2FXPA 1L4AD 2POHA 1NO4A 2ZYAA 2OARA 2OYHB 3L75E 4OH8B 3HTKA 4W7ZA 2FBWC 1BCCG 3V2PA 1BE3E 1N7SC 4CPGA 3GLMA 2KSEA 2QJKB 2HG5D 2FXMA 1GD2E 4Y99B 2I1JA 1RF1A 4L75A 1IO4A 2KYVA 2JKVA 3H1KG 1SFCB 1PZQA 2R44A 3BATA 2N1TB 1KB9H 3OJAB 1SVFA 4AYCA 1G1IA 2DW3A 3TGUE 2WWWA 1VF5C 2NZ2A 1L0NJ 1M56D 3AAAA 2V4HA 1LJ2A 2A06E 3TK1A 2O4DA 1KB9E 1GU9A 1K9MQ 2P10A 1G1JA 1IFMA 4KT0J 2E76C 5B66H 3RBZA 1H8AA 3O6QB 4IFMA 2P2UA 3JCUH 3H6PA 4PV1D 3L73J 5B66E 2K88A 3CXHH 2XNXA 1NAYA 5AVSB 3AE3C 3B4SA 3CD6P 3JCUE 3UIAA 2HYNA 3L4FA 1OVUA 1KTMA 4WVZA 1SQVD 3E7KA 1FE6A 2QA4P 2YO2A 1OVRA 3AE8C 4RJTA 1LTGC 1KMIZ 4ZMDA 4GT1A 1TU3F 1OW6A 2O01N 4NPEA 1JTHA 5AW9B 1USEA 2NPSC 1NJIQ 5AVXB 5EFWB 5CCHC 2D2CC 2E75C 2KLUA 3B5NA 2IX7C 1PPJE 3CLQA 1SQBE 1R5LA 1NWQA 4RO0A 1KYOH 1DH3A 3VMZA 2PAJA 1NU1E 1BDDA 3AE7C 3RBXA 1SQVG 2JEEA 1G2CB 2GUVA 1KYOE 1A02F 1YJNP 2FFDA 5BVZA 3RK3C 2H43A 1JB0J 4I7ZB 2E5YA 3L36A 1OIPA 4PD4D 1IZNB 5CCGA 2C9NY 1L0NE 3AA6A 1SQQJ 1FZGA 5KLVK 2FYUE 2KS1B 1JY2O 3AE2C 1PGQA 1P8CA 1T6AA 4K3AA 1RQUA 3L74D 1KILA 2OYHC 2P7JA 1KQGB 1L0LD 3R2PA 2Y0EA 4HH2A 3LK41 2KNCA 1KFMA 2QJKC 1EXJA 3V4QA 4Y99C 2GA1A 1FU1A 3L35A 1OZHA 5TISH 3A3YB 3S1KA 3VMYA 2OYOA 2IDBA 1NTMD 2JO1A 2IBZE 1SFCC 4N78E 1VQ9P 5TISE 2N1TC 1JCCA 5B5EH 1AQTA 5KLIB 3H32A 3LK3A 3HE4B 2ZT9D 2JWAA 3CWBD 3G71P 1PP9D 3L74G 2XNDH 1NTZJ 5APXA 5B5EE 3L71D 2KUBA 1GL2C 1L0LG 4LLHA 4ASVA 1RY3A 1Y8AA 3HUSB 2N9YB 2ZVNB 1NKZB 1WT6A 1S9KD 3WUUA 1NTMG 4WY4D 1L4AA 1YJWP 2W6BA 3H1JE 4ZNCA 1SQPE 1UIIA 5KKZB 2Z4EA 2XDJA 3CWBG 2CWQA 1PP9G 2BCCE 1S2EA 3L70J 3L71G 1EDJA 2E5TA 1GK6A 1SQQE 2BEQD 3TNUB 1N73A 4IL6H 2PFXA 1J1DB 1S4XA 3AEGC 3HD7B 3V2QA 3H1HD 2WMMA 3PLNA 3KHUA 3PH0A 3P7KA 2KK7A 3GF3A 4IL6E 3GW6A 3HTKB 2J5UA 1VQ7P 1FDOA 1HH0A 1FS0E 3WU2H 3AE6C 4C46A 1JCDA 1ZW0A 1OW7A 1NTKD 2R3SA 3N4XA 1RF1B 1K8AQ 1ZLLA 5AW1B 1CZQA 5GTIH 3WU2E 3P8MC 1AV1A 4I7ZC 4RKUJ 1JOCA 2I8DA 2A45G 2MJZA 3CMAP 1EZVI 1U7MA 5GTIE 5DIKA 2HR3A 5APVA 3H1HG 1H89A 3KPEA 1SQXD 1OX3A 3OA7A 1PFIA 3Q5SA 1JEKA 2OTKE 3L75D 3IAOA 2K9JA 3AA7A 3RL0B 1FOSF 1BE3D 1H88A 3K5BA 1RH5B 2YXQB 1BGYJ 1NTKG 1JY2N 2G3AA 1Q82Q 3KDPB 4YTPC 2W90A 5AW4B 3SWFA 1NTZK 1LT1A 4OGQB 5DJTB 3M0DA 1AJYA 1E79H 4WBAA 4YPCA 2K9YA 3TGUD 5BU5A 5KLIC 3V4WA 2FYNB 1FC2C 1SQXG 4MN4C 4BXLA 3A0HE 2A06D 1KB9D 3MHVA 3L70E 1KQFB 3RK2D 1YI2P 3L75G 1RE3A 1BE3G 2Z5IA 2Y0CA 5AVZB 2Q6QA 3B5NB 1T3JA 1A02J 3HUSC 2YXRB 4IFFA 2YIUB 1OMIA 2RN0A 5KJ7C 3GHGA 2WPSA 2YKQA 1RE4A 4Y28J 3LW5H 5KKZC 1N8RQ 3CXHD 2SPZA 5L8RJ 1GMJA 3TGUG 1VL2A 3IF4A 2XU6A 5ADXK 3KQGA 3M06A 4NPDA 2P1JA 2IPPA 2A06G 2FFDB 3AA1A 1FZCA 1GDTA 3MTUE 4H0LB 1Q86Q 1ZN5A 2Y9ZA 2WZ7A 1Q2NA 3AE1C 3HD7C 1NKNA 1PPJD 2QSIA 1SQBD 2V7QJ 4L73A 4LGDE 4JQ0D 1KILB 4DJGA 2Q3IA 1SLQA 3ABVC 2QEUA 3G9RA 3M0AA 1VQKP 5CJ4A 3LVYA 1NU1D 3AEFC 1FJKA 2KNCB 3OAKA 4TT3H 5AVUB 1KYOD 2WSFJ 1RF1C 3QH9A 1M90Q 1NTKK 3H1KJ 3MUDA 1LGHB 4WY4A 5CBNA 4O9BA 1KZUB 5GTHH 2H88C 5KLVJ 4D6TJ 2OTLP 4N6JA 1LWUA 2QEXP 4G9QA 3A5TA 1L0ND 2ZYDA 3CX5I 1LT9A 2YNYA 3H32B 1PPJG 4HB1A 1SQBG 5GTHE 2FYUD 3V6IA 4JBZA 3U1AA 1UIXA 1RF0A 4H13B 2P58A 3RL0C 4AQRD 1MZ9A 3NXSA 1NU1G 3HRNA 3CI9A 3JC22 3AEAC 1GL2B 2QIWA 3RK3E 2ZXXA 1EZVE 2WT7A 4I2LC 5AW7B 1Q90D 1PL5A 1L4AB 2IBZD 2E42A 2NRGA 4N78D 2KI7B 4OGQC 1W2BO 1L0NG 2L5GB 3F89A 1HWTC 4NPFX 2HODB 4GODA 2FYNC 3MD0A 2FYUG 4C7RA 1EQ7A 3D71A 3H1ID 4JF7A 3SSUA 1ZXGA 2HLOA 1VQPP 1VQNP 1KV4A 4GIFA 1GK4A 4L76A 2JP3A 3C1LA 1K05A 1IC2A 1JM0A 5K5GB 3CCEP 2JN8A 3B5NC 2ITAA 2YO3A 3G4SP 3W67A 2G8YA 1KQSO 3BVHA 2QE7H 2WSFH 2ZFCA 2YIUC 3O8ZA 2JR8A 4GOEA 2IBZG 3H1JD 1SQPD 1LTTC 3T97A 2KZIA 1FZBA 4GKGA 1SQVJ 3CL3D 4DZOA 2AF7A 3S9OA 4RESB 2HPCA 1LTJA 4PV1B 1EDLA 3AECC 1YTZT 3MIWA 3H1IG 4AUWA 2FFDC 5KLVE 4D6TE 2BCCD 1S1CX 1H0TA 5CMZA 3TYYA 4EI2A 1SQQD 2WITA 4H0LC 5CCGC 2Y9YA 3JSVC 1WMKA 4H44D 1J1EC 2O01J 3SFDC 2Q0TA 1URQD 3MGNA 2C0XA 1KILC 1R5SA 2KZ7A 1N2DC 2PGDA 3H1JG 1DX7A 2K9JB 3EWKA 1W5CE 1SQPG 1MUUA 4WWIA 1LTAC 1T2KC 3FWNA 1LTSC 1X0TA 3L72J 3N7NA 3RGUA 1NU1K 3TSIA 3L73E 3ZDMA 4IOIH 2BCCG 2C0WA 4A7PA 2B87A 1YYCA 2O3JA 5AVQB 5KAFH 1M1JA 1SQQG 1VKEA 2WSEJ 1QL2A 4QMAA 1K04A 1X22A 2CPSA 3L74J 5APUA 5KAFE 3CPWO 3MP7B 4YXWH 3A7OA 4H13C 2HFED 2LKMA 2ZXEB 3CX5H 3L37A 1FBMA 2JJLA 1WRGA 2AXCA 3FGAD 1VDFA 1HVVA 2IFMA 2KIKA 2B89A 1X9VA 1NTMJ 2K1AA 2QVAA 2UWJE 3CX5E 2ZYGA 1R8EA 1L4AC 2E74D 2XKMA 3GHGB 3RL0g 2WSCJ 2JWDA 3AE5C 3CWBJ 1YBKA 5KTBA 5DJUB 2OYIA 3L70D 1BDCA 1FZCB 3VMXA 3CCLP 5CHXA 4I1LA 1J2JB 1N7SD 1D7MA 2O1JA 2M3BA 5AW6B 3M9HA 1SQVK 3HE5A 3A2AA 2IFNA 1N73C 3C9IA 5DIPA 1FZAA 2Q5UA 1LP1B 1QVGO 2OUWA 3NMDA 1GW4A 2KB7P 4K35A 1GTWA 3P32A 3V2RA 2ZT9B 1JUNA 4ZKPA 1QVFO 2WSSH 2KXPA 4JPZB 1JY3P 3I55P 3L72E 1VF5D 1YHQP 2IZ1A 1L2PA 2Q1KA 2QJPC 1CI6A 1DD3A 5KAIH 4I6MC 4OWFA 3PP5A 3CCSP 4PV1C 3KYQA 1KORA 3D6YA 3L70G 2KLVA 2E76D 1AVYA 3KXDA 4WY4B 3AA0A 5KAIE 1LWUB 1IFDA 1LT9B 1ZP0C 2OQQA 3M9BA 3SWYA 4GDOA 3PTZA 2WVRA 4KHXA 3NFQA 1GU4A 1NTZE 2Q3EA 3IR9A 1NTKJ 2W83C 1KFNA 4N3YB 1S5LX 5APTA 2WTYA 1AFOA 3GG2A 2WT7B 1IK9A 2NPSD 1L0LK 5CCHD 1PGOA 1XTCC 2D2CD 2E75D 3BASA 3FXEA 3M0DC 4EIJA 3P8CE 1NYHA 2W8ZA 2CPBA 3CXHI 2KP8A 3A0HH 1NTMK 1NOHA 3W68A 3EFGA 1MKMA 4R4LA 3Q5RA 1QLED 1HF9A 1RE3C 5H2FH 4HJGH 1VQ4P 3EFFK 4U7JA 1JTHB 2H8PD 2Q7CA 1ZR4A 1PV3A 1Q81Q 5H2FE 3RK3D 3BCCJ 1EZVD 3CC4P 1E5WA 3H1LJ 4UB8H 2RH0A 1URQA 3LIDA 3GHGC 2WPRA 2W6AA 1RE4C 5AVWB 1P84I 1DIPA 4U3FJ 3FXDA 4R4MA 1IFIA 4OVNF 2W6JH 2YKPA 4UB8E 5BU8B 2HPCB 1LTJB 3KZIH 3VOPA 2YKOA 1IK7A 2KZJA 1FZCC 2E43A 1VQOP 1H0TB 2PP6A 4L74A 3KZIE 4YXDC 2XZRA 1JMBA 1EZVG 2ZT9C 3CMEP 1SFCD 5APSA 1HJ0A 1HTLC 1EDKA 1J1EB 1LTBC 1HGZA 2N1TD 2FKWB 3H25A 1JMMA 2B9BA 2R32A 1BCCJ 2IYPA 2Z5HA 3EQ2A 2H89C 4XE5B 2WPVB 1BGYE 3IN6A 2E74C 2M8RA 1U57A 5KLVD 3MUDC 4D6TD 1BSNA 1NH4A 4WY4C 1VQ5P 1CW5A 2B87B 1LWUC 3LK2A 1M1JB 2VRSA 2ZAEB 1YTZI 1SQBJ 1YQ4C 3GF7A 1LT9C 2AXTH 1M8OB 3CC2P 2ES9A 1PGPA 2IJCA 5E79H 1RF0C 2AXTE 1NU1J 1DD4A 1N7SA 1SQXK 3R4YA 3WUVA 3BCCE 4C7NA 5E79E 3H1LE 5AVRB 1VQMP 2KSJA 2Y0DA 3L73D 1DEEG 5KLVG 2IZ0A 4D6TG 1DEBA 3M9QA 2I1KA 3I56P 4U3FE 4JYCA 3VP9A 3PRJA 1Y47A 4WB4A 1JNMA 2FYUJ 2M5AA 4EYYQ 3Q5PA 2IYOA 3BRTB 3OW2O 2OYIB 1KILE 4JYBA 3CC7P 2MKVA 1QX8A 2N9BA 2V7QH 3HE5B 2QJYB 4ZKUA 3TDKA 3AEBC 3TF5A 3AEEC 2FY8A 2JDIH 1N73B 4PD4I 1LW1A 3L73G 3CX5D 3CXHE 1BCCE 3CCMP 2KXPB 2WQYC 1BSHA 5APQA 4W80A 1CI6B 1ZRTE 4DT0A 3USSA 3H1IJ 1LTJC 5AW3B 2QJPB 1IFJA 2NPSA 3GMAA 3H1KE 2L91A 1P84H 3ITKA 3U1CA 3Q1MA 5CCHA 3S4RA 4BRYA 1USDA 2GUSA 2QRXA 2W27A 1P84E 3H1JJ 1SQPJ 3CCUP 1T8ZA 1YIJP 3RK2C 1VQ8P 5AVVB 3L72D 3AE9C 1SQBK 4BWNA 1FAVA 2BEZF 3B71A 2BCCJ 2ZJSE 3PHLA 1IFPA 1PIXA 3U59A 4DCKA 2AEFA 2FYZA 3SWKA 1M1JC 1HJBA 1XTGB 2YMYA 3VN0A 1NGMB 2GMYA 3LIEA 1JY2P 1IFNA 5KJ7D 1N86A 2AEMA 2OYHA 3E1RA 2BASA 1NHLA 1GU5A 4KJMA 3CCVP 1L0NK 1NTZD 1QL1A 4M3LA 2O1KA 4EOTA 3L72G 1FDMA 1L0LJ 1ZV8A 2RKLA 1N7LA 2FYUK 2B88A 2R5DA 3VMAA 2RMZA 4EDFA 2A45I 4H44B 1HGVA 1FZFA 1M57D 4TLFA 1FZEA 5CJ0A 3AE4C 1URQB 3M91A 3Q2YA 1SFCA 4HKZH 2N1TA 3HD7D 3AEDC 1Z56A 3P8CD 3H1IE 5C39A 1SQVE 2QM8A 1VQ6P 2OYIC 3G6EP 3C8VA 1FJPA 1GL2A 1PP9J 1NTZG 3B8EB 1FOSE 3L71J 2O01H 3O6QA 1T3UA 1S5LH 1MFTA 1NVOA 2QJYC 5TJHA 1Y9BA 1MV8A 4ASWA 4DOJA 1RHZB 1S5LE 1M7LA 3WUTA 3D7IA 1KNCA 2HODA 1X8YA 2YMKA 1JY3O 4PD4H 4UB6H 1HBWA 1OWAA 1SQPK 3BRVB 2QG4A 1OW8A 1OXZA 1U7JA 3RL0D 2WSEH 1S3JA 2E74B 5AW2B 3MZWB 4PD4E 4UB6E 5APYA 4W7YA 3G3ZA 3H1HJ 2Q9IA 3VTPC 2M0BA 3L74E 5M1BA 3NTNA 1ME5A 4OGQD 5AVTB 3QWOC 1SQQK 1L0LE 2OGUA 1CSBA 3I5CA 3FWLA 1N7SB 1ZMEC 1VQLP 5APWA 1KB9I 2J58A 1EDIA 4C7NB 1YJ9P 1G2CA 2R5BA 1NAFA 3AAEA 3LW5J 1BGYD 1IJDB 3PJSK 3CCRP 3SFEC 4AKRA 1NTME 2WSCH 4PJ0H 4XFJA 2C9LY 2XV5A 1IZNA 3E1IA
chains in the Genus database with same CATH topology
3AA6A 3LVYA 4G9QA 5AFUK 2O4DA 2Q0TA 3LK41 2PRRA 5DIPA 3AAEA 5ADXK 1GU9A 2OUWA 2KZ7A 3C1LA 2ES9A 4AKRA 2IJCA 2PFXA 3AA7A 1ME5A 3LK3A 1P8CA 1LW1A 3D7IA 3AA1A 1KNCA 2GMYA 2OYOA 3BEYA 2JN8A 5DIKA 3LK2A 2AF7A 2QEUA 1VKEA 2KXPA 3AAAA 1IZNA 3AA0A 2CWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9Q A;  3LVY A;  2O4D A;  2Q0T A;  2PRR A;  5DIP A;  1GU9 A;  2OUW A;  3C1L A;  2IJC A;  2PFX A;  1ME5 A;  1P8C A;  1LW1 A;  3D7I A;  1KNC A;  2GMY A;  2OYO A;  3BEY A;  5DIK A;  2AF7 A;  2QEU A;  1VKE A;  2CWQ A; 
#chains in the Genus database with same CATH topology
 3B5N D;  5AFU K;  1AA0 A;  4PJ0 E;  3VP8 A;  1VF5 B;  2QM7 A;  2M5A B;  2KS1 A;  3CWB E;  1EC5 A;  1SQX J;  1ZR2 A;  1PP9 E;  3IFM A;  2H7H A;  2KOG A;  4B86 A;  5CBO A;  3L71 E;  2E76 B;  1YIT P;  3D6Z A;  1W2E A;  3L75 J;  1AVO A;  3A0B H;  1JO5 A;  1EXI A;  1KQL A;  1QGK B;  1OVV A;  1BE3 J;  2FXO A;  2LXC B;  4IL6 X;  3BCC D;  1RQV A;  3H1L D;  1BGY G;  1LNQ A;  4H44 C;  1S9K E;  3BEY A;  3A0B E;  2J59 M;  3V5B A;  1AQ5 A;  1KN7 A;  1URQ C;  5AW0 B;  4U3F D;  4H0L D;  5CCG D;  2CK3 H;  3V2N A;  4HYT B;  1Q7Y Q;  5AW8 B;  1FDI A;  1MFZ A;  1VPC A;  2A45 H;  3HE4 A;  1M1K Q;  3T97 B;  3TGU J;  3CCJ P;  1KIL D;  1GW3 A;  3CCQ P;  2LR2 A;  3F5H A;  2NPS B;  1GZL A;  2WPQ A;  3II6 A;  1T2K D;  1KC8 Q;  1KYO I;  2K3R A;  2K37 A;  2OTJ P;  4BRY B;  2D2C B;  2E75 B;  4Z1M H;  1OFC X;  2GM4 A;  4LC1 A;  3BCC G;  1X79 B;  3H1H E;  3HUS A;  3H1L G;  3D70 A;  1HUC A;  1K73 Q;  5KJ7 A;  5AW5 B;  1PGJ A;  1BCC D;  4U3F G;  1QEX A;  2LXB A;  2ZVO B;  1YQ3 C;  3Q3D A;  3WMM 0;  1NTK E;  3RK2 B;  4XA4 A;  3VYI A;  1ZRT D;  1ZOY C;  1LTI C;  3RK3 B;  4GOF A;  4H13 D;  3H1K D;  1J1D C;  4IFD K;  2PRR A;  1LP1 A;  1S72 P;  1SS1 A;  2R3C A;  1JY3 N;  2P67 A;  3TNU A;  2M3E A;  1KD1 Q;  1GL2 D;  5AVY B;  3HD7 A;  2IBZ I;  3FX0 A;  2AEJ A;  1SQX E;  1P84 D;  1SP4 A;  2FXP A;  1L4A D;  2POH A;  1NO4 A;  2ZYA A;  2OAR A;  2OYH B;  3L75 E;  4OH8 B;  3HTK A;  4W7Z A;  2FBW C;  1BCC G;  3V2P A;  1BE3 E;  1N7S C;  4CPG A;  3GLM A;  2KSE A;  2QJK B;  2HG5 D;  2FXM A;  1GD2 E;  4Y99 B;  2I1J A;  1RF1 A;  4L75 A;  1IO4 A;  2KYV A;  2JKV A;  3H1K G;  1SFC B;  1PZQ A;  2R44 A;  3BAT A;  2N1T B;  1KB9 H;  3OJA B;  1SVF A;  4AYC A;  1G1I A;  2DW3 A;  3TGU E;  2WWW A;  1VF5 C;  2NZ2 A;  1L0N J;  1M56 D;  3AAA A;  2V4H A;  1LJ2 A;  2A06 E;  3TK1 A;  2O4D A;  1KB9 E;  1GU9 A;  1K9M Q;  2P10 A;  1G1J A;  1IFM A;  4KT0 J;  2E76 C;  5B66 H;  3RBZ A;  1H8A A;  3O6Q B;  4IFM A;  2P2U A;  3JCU H;  3H6P A;  4PV1 D;  3L73 J;  5B66 E;  2K88 A;  3CXH H;  2XNX A;  1NAY A;  5AVS B;  3AE3 C;  3B4S A;  3CD6 P;  3JCU E;  3UIA A;  2HYN A;  3L4F A;  1OVU A;  1KTM A;  4WVZ A;  1SQV D;  3E7K A;  1FE6 A;  2QA4 P;  2YO2 A;  1OVR A;  3AE8 C;  4RJT A;  1LTG C;  1KMI Z;  4ZMD A;  4GT1 A;  1TU3 F;  1OW6 A;  2O01 N;  4NPE A;  1JTH A;  5AW9 B;  1USE A;  2NPS C;  1NJI Q;  5AVX B;  5EFW B;  5CCH C;  2D2C C;  2E75 C;  2KLU A;  3B5N A;  2IX7 C;  1PPJ E;  3CLQ A;  1SQB E;  1R5L A;  1NWQ A;  4RO0 A;  1KYO H;  1DH3 A;  3VMZ A;  2PAJ A;  1NU1 E;  1BDD A;  3AE7 C;  3RBX A;  1SQV G;  2JEE A;  1G2C B;  2GUV A;  1KYO E;  1A02 F;  1YJN P;  2FFD A;  5BVZ A;  3RK3 C;  2H43 A;  1JB0 J;  4I7Z B;  2E5Y A;  3L36 A;  1OIP A;  4PD4 D;  1IZN B;  5CCG A;  2C9N Y;  1L0N E;  3AA6 A;  1SQQ J;  1FZG A;  5KLV K;  2FYU E;  2KS1 B;  1JY2 O;  3AE2 C;  1PGQ A;  1P8C A;  1T6A A;  4K3A A;  1RQU A;  3L74 D;  1KIL A;  2OYH C;  2P7J A;  1KQG B;  1L0L D;  3R2P A;  2Y0E A;  4HH2 A;  3LK4 1;  2KNC A;  1KFM A;  2QJK C;  1EXJ A;  3V4Q A;  4Y99 C;  2GA1 A;  1FU1 A;  3L35 A;  1OZH A;  5TIS H;  3A3Y B;  3S1K A;  3VMY A;  2OYO A;  2IDB A;  1NTM D;  2JO1 A;  2IBZ E;  1SFC C;  4N78 E;  1VQ9 P;  5TIS E;  2N1T C;  1JCC A;  5B5E H;  1AQT A;  5KLI B;  3H32 A;  3LK3 A;  3HE4 B;  2ZT9 D;  2JWA A;  3CWB D;  3G71 P;  1PP9 D;  3L74 G;  2XND H;  1NTZ J;  5APX A;  5B5E E;  3L71 D;  2KUB A;  1GL2 C;  1L0L G;  4LLH A;  4ASV A;  1RY3 A;  1Y8A A;  3HUS B;  2N9Y B;  2ZVN B;  1NKZ B;  1WT6 A;  1S9K D;  3WUU A;  1NTM G;  4WY4 D;  1L4A A;  1YJW P;  2W6B A;  3H1J E;  4ZNC A;  1SQP E;  1UII A;  5KKZ B;  2Z4E A;  2XDJ A;  3CWB G;  2CWQ A;  1PP9 G;  2BCC E;  1S2E A;  3L70 J;  3L71 G;  1EDJ A;  2E5T A;  1GK6 A;  1SQQ E;  2BEQ D;  3TNU B;  1N73 A;  4IL6 H;  2PFX A;  1J1D B;  1S4X A;  3AEG C;  3HD7 B;  3V2Q A;  3H1H D;  2WMM A;  3PLN A;  3KHU A;  3PH0 A;  3P7K A;  2KK7 A;  3GF3 A;  4IL6 E;  3GW6 A;  3HTK B;  2J5U A;  1VQ7 P;  1FDO A;  1HH0 A;  1FS0 E;  3WU2 H;  3AE6 C;  4C46 A;  1JCD A;  1ZW0 A;  1OW7 A;  1NTK D;  2R3S A;  3N4X A;  1RF1 B;  1K8A Q;  1ZLL A;  5AW1 B;  1CZQ A;  5GTI H;  3WU2 E;  3P8M C;  1AV1 A;  4I7Z C;  4RKU J;  1JOC A;  2I8D A;  2A45 G;  2MJZ A;  3CMA P;  1EZV I;  1U7M A;  5GTI E;  5DIK A;  2HR3 A;  5APV A;  3H1H G;  1H89 A;  3KPE A;  1SQX D;  1OX3 A;  3OA7 A;  1PFI A;  3Q5S A;  1JEK A;  2OTK E;  3L75 D;  3IAO A;  2K9J A;  3AA7 A;  3RL0 B;  1FOS F;  1BE3 D;  1H88 A;  3K5B A;  1RH5 B;  2YXQ B;  1BGY J;  1NTK G;  1JY2 N;  2G3A A;  1Q82 Q;  3KDP B;  4YTP C;  2W90 A;  5AW4 B;  3SWF A;  1NTZ K;  1LT1 A;  4OGQ B;  5DJT B;  3M0D A;  1AJY A;  1E79 H;  4WBA A;  4YPC A;  2K9Y A;  3TGU D;  5BU5 A;  5KLI C;  3V4W A;  2FYN B;  1FC2 C;  1SQX G;  4MN4 C;  4BXL A;  3A0H E;  2A06 D;  1KB9 D;  3MHV A;  3L70 E;  1KQF B;  3RK2 D;  1YI2 P;  3L75 G;  1RE3 A;  1BE3 G;  2Z5I A;  2Y0C A;  5AVZ B;  2Q6Q A;  3B5N B;  1T3J A;  1A02 J;  3HUS C;  2YXR B;  4IFF A;  2YIU B;  1OMI A;  2RN0 A;  5KJ7 C;  3GHG A;  2WPS A;  2YKQ A;  1RE4 A;  4Y28 J;  3LW5 H;  5KKZ C;  1N8R Q;  3CXH D;  2SPZ A;  5L8R J;  1GMJ A;  3TGU G;  1VL2 A;  3IF4 A;  2XU6 A;  5ADX K;  3KQG A;  3M06 A;  4NPD A;  2P1J A;  2IPP A;  2A06 G;  2FFD B;  3AA1 A;  1FZC A;  1GDT A;  3MTU E;  4H0L B;  1Q86 Q;  1ZN5 A;  2Y9Z A;  2WZ7 A;  1Q2N A;  3AE1 C;  3HD7 C;  1NKN A;  1PPJ D;  2QSI A;  1SQB D;  2V7Q J;  4L73 A;  4LGD E;  4JQ0 D;  1KIL B;  4DJG A;  2Q3I A;  1SLQ A;  3ABV C;  2QEU A;  3G9R A;  3M0A A;  1VQK P;  5CJ4 A;  3LVY A;  1NU1 D;  3AEF C;  1FJK A;  2KNC B;  3OAK A;  4TT3 H;  5AVU B;  1KYO D;  2WSF J;  1RF1 C;  3QH9 A;  1M90 Q;  1NTK K;  3H1K J;  3MUD A;  1LGH B;  4WY4 A;  5CBN A;  4O9B A;  1KZU B;  5GTH H;  2H88 C;  5KLV J;  4D6T J;  2OTL P;  4N6J A;  1LWU A;  2QEX P;  4G9Q A;  3A5T A;  1L0N D;  2ZYD A;  3CX5 I;  1LT9 A;  2YNY A;  3H32 B;  1PPJ G;  4HB1 A;  1SQB G;  5GTH E;  2FYU D;  3V6I A;  4JBZ A;  3U1A A;  1UIX A;  1RF0 A;  4H13 B;  2P58 A;  3RL0 C;  4AQR D;  1MZ9 A;  3NXS A;  1NU1 G;  3HRN A;  3CI9 A;  3JC2 2;  3AEA C;  1GL2 B;  2QIW A;  3RK3 E;  2ZXX A;  1EZV E;  2WT7 A;  4I2L C;  5AW7 B;  1Q90 D;  1PL5 A;  1L4A B;  2IBZ D;  2E42 A;  2NRG A;  4N78 D;  2KI7 B;  4OGQ C;  1W2B O;  1L0N G;  2L5G B;  3F89 A;  1HWT C;  4NPF X;  2HOD B;  4GOD A;  2FYN C;  3MD0 A;  2FYU G;  4C7R A;  1EQ7 A;  3D71 A;  3H1I D;  4JF7 A;  3SSU A;  1ZXG A;  2HLO A;  1VQP P;  1VQN P;  1KV4 A;  4GIF A;  1GK4 A;  4L76 A;  2JP3 A;  3C1L A;  1K05 A;  1IC2 A;  1JM0 A;  5K5G B;  3CCE P;  2JN8 A;  3B5N C;  2ITA A;  2YO3 A;  3G4S P;  3W67 A;  2G8Y A;  1KQS O;  3BVH A;  2QE7 H;  2WSF H;  2ZFC A;  2YIU C;  3O8Z A;  2JR8 A;  4GOE A;  2IBZ G;  3H1J D;  1SQP D;  1LTT C;  3T97 A;  2KZI A;  1FZB A;  4GKG A;  1SQV J;  3CL3 D;  4DZO A;  2AF7 A;  3S9O A;  4RES B;  2HPC A;  1LTJ A;  4PV1 B;  1EDL A;  3AEC C;  1YTZ T;  3MIW A;  3H1I G;  4AUW A;  2FFD C;  5KLV E;  4D6T E;  2BCC D;  1S1C X;  1H0T A;  5CMZ A;  3TYY A;  4EI2 A;  1SQQ D;  2WIT A;  4H0L C;  5CCG C;  2Y9Y A;  3JSV C;  1WMK A;  4H44 D;  1J1E C;  2O01 J;  3SFD C;  2Q0T A;  1URQ D;  3MGN A;  2C0X A;  1KIL C;  1R5S A;  2KZ7 A;  1N2D C;  2PGD A;  3H1J G;  1DX7 A;  2K9J B;  3EWK A;  1W5C E;  1SQP G;  1MUU A;  4WWI A;  1LTA C;  1T2K C;  3FWN A;  1LTS C;  1X0T A;  3L72 J;  3N7N A;  3RGU A;  1NU1 K;  3TSI A;  3L73 E;  3ZDM A;  4IOI H;  2BCC G;  2C0W A;  4A7P A;  2B87 A;  1YYC A;  2O3J A;  5AVQ B;  5KAF H;  1M1J A;  1SQQ G;  1VKE A;  2WSE J;  1QL2 A;  4QMA A;  1K04 A;  1X22 A;  2CPS A;  3L74 J;  5APU A;  5KAF E;  3CPW O;  3MP7 B;  4YXW H;  3A7O A;  4H13 C;  2HFE D;  2LKM A;  2ZXE B;  3CX5 H;  3L37 A;  1FBM A;  2JJL A;  1WRG A;  2AXC A;  3FGA D;  1VDF A;  1HVV A;  2IFM A;  2KIK A;  2B89 A;  1X9V A;  1NTM J;  2K1A A;  2QVA A;  2UWJ E;  3CX5 E;  2ZYG A;  1R8E A;  1L4A C;  2E74 D;  2XKM A;  3GHG B;  3RL0 g;  2WSC J;  2JWD A;  3AE5 C;  3CWB J;  1YBK A;  5KTB A;  5DJU B;  2OYI A;  3L70 D;  1BDC A;  1FZC B;  3VMX A;  3CCL P;  5CHX A;  4I1L A;  1J2J B;  1N7S D;  1D7M A;  2O1J A;  2M3B A;  5AW6 B;  3M9H A;  1SQV K;  3HE5 A;  3A2A A;  2IFN A;  1N73 C;  3C9I A;  5DIP A;  1FZA A;  2Q5U A;  1LP1 B;  1QVG O;  2OUW A;  3NMD A;  1GW4 A;  2KB7 P;  4K35 A;  1GTW A;  3P32 A;  3V2R A;  2ZT9 B;  1JUN A;  4ZKP A;  1QVF O;  2WSS H;  2KXP A;  4JPZ B;  1JY3 P;  3I55 P;  3L72 E;  1VF5 D;  1YHQ P;  2IZ1 A;  1L2P A;  2Q1K A;  2QJP C;  1CI6 A;  1DD3 A;  5KAI H;  4I6M C;  4OWF A;  3PP5 A;  3CCS P;  4PV1 C;  3KYQ A;  1KOR A;  3D6Y A;  3L70 G;  2KLV A;  2E76 D;  1AVY A;  3KXD A;  4WY4 B;  3AA0 A;  5KAI E;  1LWU B;  1IFD A;  1LT9 B;  1ZP0 C;  2OQQ A;  3M9B A;  3SWY A;  4GDO A;  3PTZ A;  2WVR A;  4KHX A;  3NFQ A;  1GU4 A;  1NTZ E;  2Q3E A;  3IR9 A;  1NTK J;  2W83 C;  1KFN A;  4N3Y B;  1S5L X;  5APT A;  2WTY A;  1AFO A;  3GG2 A;  2WT7 B;  1IK9 A;  2NPS D;  1L0L K;  5CCH D;  1PGO A;  1XTC C;  2D2C D;  2E75 D;  3BAS A;  3FXE A;  3M0D C;  4EIJ A;  3P8C E;  1NYH A;  2W8Z A;  2CPB A;  3CXH I;  2KP8 A;  3A0H H;  1NTM K;  1NOH A;  3W68 A;  3EFG A;  1MKM A;  4R4L A;  3Q5R A;  1QLE D;  1HF9 A;  1RE3 C;  5H2F H;  4HJG H;  1VQ4 P;  3EFF K;  4U7J A;  1JTH B;  2H8P D;  2Q7C A;  1ZR4 A;  1PV3 A;  1Q81 Q;  5H2F E;  3RK3 D;  3BCC J;  1EZV D;  3CC4 P;  1E5W A;  3H1L J;  4UB8 H;  2RH0 A;  1URQ A;  3LID A;  3GHG C;  2WPR A;  2W6A A;  1RE4 C;  5AVW B;  1P84 I;  1DIP A;  4U3F J;  3FXD A;  4R4M A;  1IFI A;  4OVN F;  2W6J H;  2YKP A;  4UB8 E;  5BU8 B;  2HPC B;  1LTJ B;  3KZI H;  3VOP A;  2YKO A;  1IK7 A;  2KZJ A;  1FZC C;  2E43 A;  1VQO P;  1H0T B;  2PP6 A;  4L74 A;  3KZI E;  4YXD C;  2XZR A;  1JMB A;  1EZV G;  2ZT9 C;  3CME P;  1SFC D;  5APS A;  1HJ0 A;  1HTL C;  1EDK A;  1J1E B;  1LTB C;  1HGZ A;  2N1T D;  2FKW B;  3H25 A;  1JMM A;  2B9B A;  2R32 A;  1BCC J;  2IYP A;  2Z5H A;  3EQ2 A;  2H89 C;  4XE5 B;  2WPV B;  1BGY E;  3IN6 A;  2E74 C;  2M8R A;  1U57 A;  5KLV D;  3MUD C;  4D6T D;  1BSN A;  1NH4 A;  4WY4 C;  1VQ5 P;  1CW5 A;  2B87 B;  1LWU C;  3LK2 A;  1M1J B;  2VRS A;  2ZAE B;  1YTZ I;  1SQB J;  1YQ4 C;  3GF7 A;  1LT9 C;  2AXT H;  1M8O B;  3CC2 P;  2ES9 A;  1PGP A;  2IJC A;  5E79 H;  1RF0 C;  2AXT E;  1NU1 J;  1DD4 A;  1N7S A;  1SQX K;  3R4Y A;  3WUV A;  3BCC E;  4C7N A;  5E79 E;  3H1L E;  5AVR B;  1VQM P;  2KSJ A;  2Y0D A;  3L73 D;  1DEE G;  5KLV G;  2IZ0 A;  4D6T G;  1DEB A;  3M9Q A;  2I1K A;  3I56 P;  4U3F E;  4JYC A;  3VP9 A;  3PRJ A;  1Y47 A;  4WB4 A;  1JNM A;  2FYU J;  2M5A A;  4EYY Q;  3Q5P A;  2IYO A;  3BRT B;  3OW2 O;  2OYI B;  1KIL E;  4JYB A;  3CC7 P;  2MKV A;  1QX8 A;  2N9B A;  2V7Q H;  3HE5 B;  2QJY B;  4ZKU A;  3TDK A;  3AEB C;  3TF5 A;  3AEE C;  2FY8 A;  2JDI H;  1N73 B;  4PD4 I;  1LW1 A;  3L73 G;  3CX5 D;  3CXH E;  1BCC E;  3CCM P;  2KXP B;  2WQY C;  1BSH A;  5APQ A;  4W80 A;  1CI6 B;  1ZRT E;  4DT0 A;  3USS A;  3H1I J;  1LTJ C;  5AW3 B;  2QJP B;  1IFJ A;  2NPS A;  3GMA A;  3H1K E;  2L91 A;  1P84 H;  3ITK A;  3U1C A;  3Q1M A;  5CCH A;  3S4R A;  4BRY A;  1USD A;  2GUS A;  2QRX A;  2W27 A;  1P84 E;  3H1J J;  1SQP J;  3CCU P;  1T8Z A;  1YIJ P;  3RK2 C;  1VQ8 P;  5AVV B;  3L72 D;  3AE9 C;  1SQB K;  4BWN A;  1FAV A;  2BEZ F;  3B71 A;  2BCC J;  2ZJS E;  3PHL A;  1IFP A;  1PIX A;  3U59 A;  4DCK A;  2AEF A;  2FYZ A;  3SWK A;  1M1J C;  1HJB A;  1XTG B;  2YMY A;  3VN0 A;  1NGM B;  2GMY A;  3LIE A;  1JY2 P;  1IFN A;  5KJ7 D;  1N86 A;  2AEM A;  2OYH A;  3E1R A;  2BAS A;  1NHL A;  1GU5 A;  4KJM A;  3CCV P;  1L0N K;  1NTZ D;  1QL1 A;  4M3L A;  2O1K A;  4EOT A;  3L72 G;  1FDM A;  1L0L J;  1ZV8 A;  2RKL A;  1N7L A;  2FYU K;  2B88 A;  2R5D A;  3VMA A;  2RMZ A;  4EDF A;  2A45 I;  4H44 B;  1HGV A;  1FZF A;  1M57 D;  4TLF A;  1FZE A;  5CJ0 A;  3AE4 C;  1URQ B;  3M91 A;  3Q2Y A;  1SFC A;  4HKZ H;  2N1T A;  3HD7 D;  3AED C;  1Z56 A;  3P8C D;  3H1I E;  5C39 A;  1SQV E;  2QM8 A;  1VQ6 P;  2OYI C;  3G6E P;  3C8V A;  1FJP A;  1GL2 A;  1PP9 J;  1NTZ G;  3B8E B;  1FOS E;  3L71 J;  2O01 H;  3O6Q A;  1T3U A;  1S5L H;  1MFT A;  1NVO A;  2QJY C;  5TJH A;  1Y9B A;  1MV8 A;  4ASW A;  4DOJ A;  1RHZ B;  1S5L E;  1M7L A;  3WUT A;  3D7I A;  1KNC A;  2HOD A;  1X8Y A;  2YMK A;  1JY3 O;  4PD4 H;  4UB6 H;  1HBW A;  1OWA A;  1SQP K;  3BRV B;  2QG4 A;  1OW8 A;  1OXZ A;  1U7J A;  3RL0 D;  2WSE H;  1S3J A;  2E74 B;  5AW2 B;  3MZW B;  4PD4 E;  4UB6 E;  5APY A;  4W7Y A;  3G3Z A;  3H1H J;  2Q9I A;  3VTP C;  2M0B A;  3L74 E;  5M1B A;  3NTN A;  1ME5 A;  4OGQ D;  5AVT B;  3QWO C;  1SQQ K;  1L0L E;  2OGU A;  1CSB A;  3I5C A;  3FWL A;  1N7S B;  1ZME C;  1VQL P;  5APW A;  1KB9 I;  2J58 A;  1EDI A;  4C7N B;  1YJ9 P;  1G2C A;  2R5B A;  1NAF A;  3AAE A;  3LW5 J;  1BGY D;  1IJD B;  3PJS K;  3CCR P;  3SFE C;  4AKR A;  1NTM E;  2WSC H;  4PJ0 H;  4XFJ A;  2C9L Y;  2XV5 A;  1IZN A;  3E1I A; 
#chains in the Genus database with same CATH homology
 3AA6 A;  3LVY A;  4G9Q A;  5AFU K;  2O4D A;  2Q0T A;  3LK4 1;  2PRR A;  5DIP A;  3AAE A;  5ADX K;  1GU9 A;  2OUW A;  2KZ7 A;  3C1L A;  2ES9 A;  4AKR A;  2IJC A;  2PFX A;  3AA7 A;  1ME5 A;  3LK3 A;  1P8C A;  1LW1 A;  3D7I A;  3AA1 A;  1KNC A;  2GMY A;  2OYO A;  3BEY A;  2JN8 A;  5DIK A;  3LK2 A;  2AF7 A;  2QEU A;  1VKE A;  2KXP A;  3AAA A;  1IZN A;  3AA0 A;  2CWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...