2OYOA

Crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
DRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDHQIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of Uncharacterized peroxidase-related protein (YP_604910.1) from Deinococcus geothermalis DSM 11300 at 1.51 A resolution
rcsb
source organism Deinococcus geothermalis
molecule tags Oxidoreductase
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2oyoA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2oyoA02
2OYOA 2QEUA 1VKEA 5DIKA 2AF7A 2GMYA 1P8CA 3D7IA 4G9QA 2CWQA 2O4DA 1ME5A 2PFXA 1LW1A 2OUWA 2IJCA 1GU9A 5DIPA 1KNCA 3LVYA 2Q0TA 2PRRA 3C1LA 3BEYA
chains in the Genus database with same CATH superfamily
2JWAA 2FKWB 2KUBA 2IBZD 3WU2E 1K8AQ 1OVVA 1QX8A 3L35A 3ITKA 3G4SP 1FZAA 5APTA 3A5TA 2IJCA 2IBZI 1EC5A 1PP9D 5DJUB 4TLFA 3IF4A 3G6EP 3V2QA 4H13D 4N3YB 4D6TE 1CW5A 2Z5IA 1HGVA 1L4AC 2OYHA 4AQRD 2KNCA 2O3JA 1L4AD 1SP4A 3N4XA 1SQPK 3B5NA 2BCCJ 3AE4C 1LTBC 4Y99C 1LT9B 1SQBG 3MZWB 3JCUH 1MFTA 1SQVJ 1SVFA 1SLQA 3O6QA 4ZMDA 1N73C 4IOIH 3BCCE 2KOGA 2P58A 5K5GB 1NWQA 1JTHB 1NTKK 1T6AA 4Z1MH 4GDOA 1BGYG 2FYZA 3CCJP 3CMEP 2PFXA 1UIIA 5KLVK 1BSHA 1HF9A 2JO1A 1YTZI 2QG4A 3AE8C 3LK3A 4DZOA 4B86A 4TT3H 3TK1A 1DD3A 1SQQD 1M8OB 2Q6QA 3KHUA 1BCCE 3L70E 3L74G 3NTNA 4K3AA 2M5AB 3RL0B 1RF0A 3L70D 4HKZH 3CWBD 2FXOA 1TU3F 1AA0A 1MV8A 2XNDH 1NTMG 1LTJB 4UB6H 1AJYA 1SQVD 4JPZB 5AW0B 3AA6A 2IYPA 3GHGC 2Z4EA 4NPEA 3MD0A 1JM0A 1KQFB 3TF5A 1CI6A 1SFCA 3RL0g 5APVA 3H32A 2WPQA 2HFED 1EDLA 3AEBC 3LIEA 3RK2C 5KKZC 3HD7C 4GOEA 3I55P 1M1JC 1EDJA 1P84D 3JCUE 2PAJA 3HD7D 2AXTH 3CXHE 2OTLP 1YI2P 2WSFJ 1MUUA 2FY8A 5BU5A 1P84I 2O01J 1GK4A 2ZT9B 1BE3G 1S9KE 1T3UA 1YJNP 2W27A 1MKMA 4HB1A 2KB7P 1ZV8A 5AW6B 2HODA 2P10A 3SFDC 2WMMA 3VOPA 1SQPJ 4C7RA 1GU5A 1OZHA 5B66H 3TYYA 1OW8A 2QJYC 1GK6A 1SQXK 1JY2N 1FDIA 4RJTA 1Q7YQ 3H1HD 1JMBA 1JUNA 5B5EH 1NU1K 2FYUE 3P8CE 3H1LG 1GD2E 4WY4C 3ZDMA 3SSUA 3M0DA 2HLOA 4WY4D 3H1KE 4EYYQ 5AVWB 2RMZA 4QMAA 4C7NA 2IBZG 4IL6X 4W80A 4K35A 1AVOA 2FXMA 4UB6E 3CC2P 3B71A 1EZVE 2LXBA 2KNCB 4JYBA 1PP9G 4OGQC 3LIDA 3B5NB 5AVYB 4OGQD 2ZJSE 2I8DA 3AE3C 3PJSK 2NPSB 2P2UA 3O6QB 1T2KC 4L74A 2ITAA 1PFIA 4W7YA 1KZUB 3P8MC 1T2KD 1RE4C 3HRNA 5AVQB 1HWTC 1NO4A 4Y99B 1RF1B 1EZVI 1KQGB 1SQPD 2WPVB 2MKVA 3CLQA 1FZCC 4I7ZC 3AEGC 3V6IA 3RBZA 2E76B 3V4QA 1OWAA 2QJKB 2E74B 2DW3A 1NTKD 1VQPP 2HYNA 1N8RQ 1L0LK 4UB8E 5M1BA 3AE7C 2OYIA 1NTZJ 2ZYGA 5BU8B 5KLVD 3MTUE 4W7ZA 2O1KA 4EDFA 1Q81Q 2KLVA 2C9NY 3H1IJ 1J1EC 5AW8B 5B66E 1IFMA 1PPJD 5CCHA 1S2EA 1SQQG 1ZN5A 1XTCC 4HYTB 3TSIA 4ASWA 2A45H 1N86A 3VYIA 1J1DB 3L71J 1IFNA 1NGMB 1YBKA 1PV3A 5CJ0A 1VQOP 1ZW0A 1DH3A 3QWOC 2KK7A 3L74E 1U7JA 3SFEC 4AYCA 3L70G 3CWBG 1GU4A 1CI6B 1X79B 3AEAC 3H32B 3A0HH 2W83C 1S4XA 1SQVG 2E75B 2MJZA 4PD4H 3AA1A 5AW3B 4NPDA 1QL1A 2YKQA 2KP8A 2CPSA 1NU1J 1A02J 1ZR2A 2E5YA 1M56D 3NMDA 2KXPA 4JQ0D 1N7SC 2WSCH 1NKZB 3A0BE 2Q1KA 1N7SD 5AW7B 3D6YA 2QJPB 3RK3E 2N1TC 4PV1C 3BATA 1AFOA 2HODB 2O01N 2J58A 1IZNA 2G3AA 3SWYA 4PV1D 4RO0A 2C0WA 4LC1A 1BSNA 2OTKE 1HJ0A 4ZKPA 3L71D 1OVUA 1D7MA 3MP7B 2RKLA 4GODA 2FBWC 1LTJA 2JN8A 3U1AA 5DIPA 1YTZT 2W6AA 1JY3O 1S5LE 1YHQP 3D6ZA 3VP8A 3AAEA 2V7QJ 1KMIZ 1NOHA 3SWKA 3RGUA 2B89A 1VQ5P 1OVRA 1SQXD 1OIPA 4I6MC 4YXWH 4OH8B 3H1HG 2O1JA 1U57A 5AW5B 1NU1D 5CCGC 2YMYA 1OXZA 3IR9A 1M1KQ 3C9IA 5CCGD 3L75J 3D71A 1L0LJ 3GF3A 3MUDA 3V5BA 1IJDB 2M8RA 1NVOA 1USDA 1BDCA 2B87B 1JNMA 3WMM0 3G71P 4OVNF 2Y0DA 3H1LE 3NXSA 2FXPA 2YIUC 1IK7A 1LT1A 1VF5C 2HG5D 2IBZE 1FBMA 1DX7A 2Y9YA 3AECC 1FS0E 3K5BA 2ES9A 1YJWP 2BASA 5APWA 4D6TJ 3HUSB 3TGUD 1PP9E 1VDFA 1EZVG 3FXEA 1LW1A 2C0XA 3AA0A 2OYIB 1SQPG 1KQLA 1E79H 1DD4A 2LR2A 3BCCJ 4H13C 3L73J 2P67A 2D2CB 2IZ1A 4GOFA 3R4YA 3O8ZA 3L75D 1L0LD 2FYNC 1NTKG 4EIJA 2KIKA 1NJIQ 3HE4A 5KLVG 2GMYA 4N78D 4AKRA 4XE5B 3B5ND 2XU6A 3CXHH 1L4AA 2NPSA 5AW2B 2IFMA 1USEA 5AVSB 1BCCJ 1PPJG 1ZP0C 1EXJA 2W6JH 3FWLA 1RF1A 4A7PA 4GIFA 3Q5RA 1KB9E 2H7HA 1SQQE 3PP5A 1ZOYC 2YKPA 1N73A 3N7NA 4KT0J 3E1RA 5CBOA 2L5GB 2WZ7A 5E79E 2KXPB 1KB9D 2ZAEB 3TNUB 1IC2A 1URQC 3CWBE 4IFMA 1RH5B 2O4DA 1URQD 1KB9I 3L73D 1SQBK 5TJHA 1IFPA 5L8RJ 1IZNB 1HUCA 1VQ9P 1SQVE 2QSIA 2H8PD 1RF0C 2KI7B 1VKEA 5H2FE 5AVTB 1K73Q 1JY3P 1NH4A 1YITP 2BCCD 3D70A 1HTLC 2G8YA 2LKMA 2R32A 1GW4A 3RK3B 3V2NA 2JP3A 2HR3A 2XV5A 3LW5H 2W8ZA 1FZBA 3R2PA 1MFZA 3L71G 3CCMP 3FX0A 1GZLA 5APXA 1VQ6P 4H44B 1S3JA 1NTZK 4C46A 4H0LB 5GTHE 1P84E 2JEEA 3IAOA 2WQYC 1SFCD 1KILE 3GHGA 1QVGO 2IPPA 3L72J 1LTIC 3F89A 2VRSA 1L0NK 2WT7B 3OJAB 3WUUA 3A2AA 1KILC 1H88A 1KILD 1NTMK 1SQXG 1T8ZA 1K9MQ 3KPEA 3HD7A 4UB8H 2N9BA 1M1JA 2FYUJ 1NU1G 3OAKA 4BRYA 2QEXP 3H1KJ 1VPCA 3CCVP 3H1HE 4L76A 4L73A 1CZQA 1VF5B 2ZXEB 2FFDC 1JY2O 1GL2B 4KHXA 5GTIE 1Y9BA 4U7JA 1FC2C 4EOTA 3M0AA 4KJMA 5APYA 2QE7H 2RN0A 2Q5UA 5C39A 1LTTC 1R8EA 3PH0A 3VMYA 4L75A 1RHZB 3BRTB 2V4HA 2N9YB 1KTMA 3TGUG 3L72D 4GT1A 4PJ0H 2WITA 2H88C 5DJTB 1KQSO 1FJKA 4H13B 1PZQA 3GLMA 2NRGA 2XNXA 3FWNA 2OGUA 3HE4B 3CX5D 1Y47A 3CCLP 3RBXA 1S72P 2P1JA 3I5CA 2ZVOB 1SQPE 2K9JA 4WB4A 1SQBJ 1L4AB 3CX5I 1E5WA 2B87A 2QM7A 1L0LG 3A0BH 1ZRTE 2L91A 3C1LA 3VP9A 1LWUC 2KYVA 1N73B 1NTKE 2Z5HA 3II6A 2AF7A 3AEFC 1MZ9A 1BGYJ 5CJ4A 3HUSA 1DIPA 1WRGA 4U3FJ 1NKNA 3M06A 5KLVE 1ZRTD 2W90A 4HH2A 1QL2A 1FZCA 3CD6P 1N2DC 1S5LH 3H6PA 1PPJE 2JWDA 3M91A 3D7IA 2HPCA 3S9OA 1FOSE 3GMAA 3AE2C 4ZKUA 1H89A 1L0NJ 1PGOA 4NPFX 2M3EA 1NYHA 1OW6A 1KN7A 5CCHC 2D2CD 2M3BA 1NTMJ 1R5SA 2YMKA 5CCHD 2ZVNB 1KYOD 1LP1A 1HGZA 3HTKB 2ZYDA 1KYOI 1LT9C 1YIJP 3LVYA 3V2PA 1X0TA 3CCSP 5AVXB 5AW9B 3IFMA 5APUA 2BCCG 2A06D 2IDBA 4PJ0E 1BGYD 2WPRA 1FOSF 3GHGB 2K3RA 4U3FD 1OW7A 3VMXA 2WSEH 3GF7A 3A7OA 2QA4P 1KNCA 1G1IA 3MGNA 4DOJA 1ZR4A 1KC8Q 3P32A 4IFFA 1IFDA 3AE5C 4YXDC 1NTZD 3RK2B 5KKZB 3AEDC 3AE6C 3TNUA 1ZLLA 3HD7B 3L71E 5AW4B 1M1JB 1BE3J 1L0ND 1FZFA 3H1ID 4BRYB 1QGKB 3BEYA 1N7SA 2E43A 1JY2P 3RL0C 1EDKA 1SS1A 1NTMD 5KAFE 4RESB 3RL0D 2GA1A 2KZ7A 2N1TA 2WTYA 1LTJC 3PHLA 5KJ7C 3AE9C 1SQXE 3KDPB 1QEXA 5KJ7D 1NHLA 1Q82Q 3H1JJ 1J2JB 2QJYB 1LNQA 1GW3A 3H1LJ 1NU1E 3L37A 3C8VA 2K88A 3KXDA 2CPBA 1IO4A 3A3YB 4WY4B 4H44D 4DJGA 1FJPA 2YO3A 1KB9H 2ZXXA 1AV1A 4R4LA 1PP9J 2WT7A 3AAAA 2AEJA 1VQLP 2K9JB 5E79H 1BE3D 3L72G 2KS1B 2WSCJ 5CCGA 4OGQB 3CC7P 5DIKA 3CI9A 2UWJE 3TGUE 2ZT9C 2JJLA 3CC4P 2Q9IA 2ZT9D 4LLHA 4JF7A 1RE3C 5ADXK 3S4RA 2K37A 3Q1MA 3UIAA 1GDTA 2Q7CA 2A45I 1UIXA 2AXCA 5H2FH 1GL2A 1G1JA 3H1JD 1FZCB 4I7ZB 1LWUB 1FDOA 1GMJA 5KAIH 1KV4A 1H8AA 3JSVC 2K1AA 5TISH 2E42A 3M9BA 3L75E 1L0LE 2HPCB 1W2EA 2OARA 2YXRB 2GUSA 1RQUA 3AE1C 4PD4D 1PIXA 3AA7A 2FYUK 3E1IA 4N78E 5GTHH 1P84H 2IYOA 2E5TA 1EQ7A 4PD4I 1SQQJ 2WWWA 2AEFA 2OYHC 5AVUB 3FGAD 1LP1B 1LTSC 1J1EB 3B5NC 2POHA 2NPSC 1WMKA 3L70J 2YO2A 3CWBJ 5KTBA 1FDMA 2NPSD 4D6TD 1RF1C 1S5LX 3IN6A 2JR8A 1OMIA 2B88A 2B9BA 2E76C 3L73E 2QJKC 2Y0CA 2E74C 3KZIE 2E76D 1NAYA 2E74D 2A06G 5GTIH 4BWNA 2QIWA 3BCCD 3F5HA 4U3FG 3CMAP 2BCCE 3GW6A 1FU1A 3OW2O 1N7SB 4IL6E 3P7KA 1JCDA 1X22A 1URQA 1Q86Q 2WSFH 3CX5H 1NTZG 2O01H 4GKGA 2N1TB 4PV1B 1YQ4C 1M90Q 5AVVB 3M9HA 5KAIE 3T97A 1L0NG 1YQ3C 5TISE 1J1DC 3H1IG 4HJGH 3SWFA 1XTGB 1RQVA 1BCCD 3HTKA 3JC22 1K05A 4JBZA 1JMMA 1YYCA 1EXIA 2H89C 2IZ0A 1KD1Q 1VQ4P 1SFCC 4I2LC 3CCEP 4YTPC 5AVZB 1JCCA 4I1LA 3U1CA 1BDDA 1HH0A 1LTAC 1N7LA 2OYOA 3H1HJ 2E75C 2XDJA 1P8CA 3PRJA 1NAFA 2E75D 2CK3H 2IX7C 2WVRA 1OFCX 2I1KA 2K9YA 4XA4A 3B8EB 2R3SA 3G3ZA 3WUVA 3RK2D 3CCRP 3Q5PA 1KILA 5AFUK 1RY3A 2GUVA 3EFGA 3W67A 2QJPC 3Q2YA 2W6BA 1ME5A 2PGDA 1W2BO 1PGPA 3USSA 3LK2A 2R5DA 1KYOH 2YIUB 1M57D 1JO5A 3KQGA 2KZIA 3CXHD 3BRVB 3L72E 3LW5J 4N6JA 2R44A 3CXHI 3NFQA 1HVVA 2J59M 2YXQB 1S9KD 4MN4C 2FFDA 2A45G 1FE6A 3QH9A 2BEQD 2ZYAA 3M0DC 1ZMEC 2Q3EA 3CX5E 5CHXA 4G9QA 3H1JG 1X8YA 4WY4A 4RKUJ 1NTKJ 2P7JA 5EFWB 3VMAA 1H0TA 1CSBA 1G2CA 2KZJA 2QM8A 4WVZA 5KLVJ 3AEEC 2OTJP 2FYNB 1JOCA 5AVRB 2FYUD 3P8CD 2KS1A 2KSEA 2SPZA 5KLIC 2OYHB 3VMZA 2I1JA 4LGDE 1Q2NA 3L75G 3H1KD 3S1KA 4DT0A 1GTWA 1Z56A 1FAVA 2AEMA 2QEUA 2KSJA 1EZVD 1RE4A 5KAFH 1JB0J 3HUSC 2M0BA 1DEBA 4Y28J 4O9BA 1LWUA 2Y0EA 4BXLA 2NZ2A 3HE5A 4D6TG 2LXCB 1S1CX 2OYIC 2R3CA 3L74J 1KFMA 2AXTE 1SQBE 3H25A 1KYOE 1URQB 1GU9A 1T3JA 1LTGC 1DEEG 1HBWA 2YNYA 2D2CC 1X9VA 2J5UA 3VN0A 4DCKA 3EQ2A 2KLUA 2YKOA 3BCCG 3T97B 1SQBD 2CWQA 3L73G 3E7KA 2A06E 1VL2A 2PP6A 3BVHA 1BGYE 2IFNA 4U3FE 3CCUP 3OA7A 3W68A 1IFJA 3WUTA 1W5CE 1AQ5A 1U7MA 5B5EE 2C9LY 1NTZE 1LT9A 2V7QH 4OWFA 4ZNCA 1BCCG 4YPCA 5APQA 1SFCB 3GG2A 1L0NE 3H1IE 2R5BA 1JTHA 1VQ8P 1SQQK 4IFDK 3L74D 3U59A 2XKMA 3ABVC 1SQXJ 5BVZA 1NTME 4WBAA 1KILB 4JYCA 3VTPC 2XZRA 2ZFCA 1JEKA 1M7LA 4M3LA 3WU2H 1HJBA 5CBNA 4XFJA 2OUWA 3MHVA 1EDIA 3PLNA 4WWIA 3V4WA 1SQVK 3Q3DA 1OX3A 2N1TD 2M5AA 5CMZA 3CPWO 3RK3C 2FFDB 2H43A 3L4FA 3RK3D 4EI2A 3V2RA 1IFIA 5KJ7A 2PRRA 3TGUJ 3I56P 3LK41 1Q90D 4H44C 2RH0A 1JY3N 3PTZA 4H0LC 2QVAA 4CPGA 1IK9A 1LGHB 1PGJA 2BEZF 1BE3E 1LJ2A 2WSEJ 4AUWA 3EFFK 4H0LD 1VQKP 1H0TB 1VQNP 1FZEA 4ASVA 1G2CB 2Q3IA 2Y9ZA 3KYQA 3TDKA 2GM4A 1ZXGA 3L36A 5AW1B 3MUDC 4C7NB 4R4MA 2Q0TA 1VQMP 3B4SA 3KZIH 1QLED 3EWKA 1KFNA 3FXDA 3CCQP 2OQQA 3G9RA 1YJ9P 2WSSH 1K04A 1A02F 2JDIH 1AQTA 3H1JE 5KLIB 4IL6H 1L2PA 2FYUG 3A0HE 1AVYA 1KORA 3Q5SA 1QVFO 3M9QA 1WT6A 1GL2C 2JKVA 1PL5A 1Y8AA 3H1KG 1PGQA 1R5LA 1VF5D 1VQ7P 3CL3D 1RE3A 3MIWA 1GL2D 2WPSA 4PD4E 3HE5B 3BASA 3H1LD 1FZGA 2QRXA 5APSA
chains in the Genus database with same CATH topology
2OYOA 1IZNA 2QEUA 3AAEA 1VKEA 5AFUK 5DIKA 2AF7A 2GMYA 1P8CA 2KXPA 3D7IA 4AKRA 4G9QA 2CWQA 2O4DA 1ME5A 2PFXA 3AA7A 1LW1A 3LK2A 2KZ7A 2OUWA 3AAAA 2IJCA 3AA0A 1GU9A 2JN8A 5DIPA 3AA6A 1KNCA 2ES9A 3LVYA 3AA1A 2Q0TA 5ADXK 2PRRA 3LK3A 3C1LA 3LK41 3BEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYO A;  2QEU A;  1VKE A;  5DIK A;  2AF7 A;  2GMY A;  1P8C A;  3D7I A;  4G9Q A;  2CWQ A;  2O4D A;  1ME5 A;  2PFX A;  1LW1 A;  2OUW A;  2IJC A;  1GU9 A;  5DIP A;  1KNC A;  3LVY A;  2Q0T A;  2PRR A;  3C1L A;  3BEY A; 
#chains in the Genus database with same CATH topology
 2JWA A;  2FKW B;  2KUB A;  2IBZ D;  3WU2 E;  1K8A Q;  1OVV A;  1QX8 A;  3L35 A;  3ITK A;  3G4S P;  1FZA A;  5APT A;  3A5T A;  2IJC A;  2IBZ I;  1EC5 A;  1PP9 D;  5DJU B;  4TLF A;  3IF4 A;  3G6E P;  3V2Q A;  4H13 D;  4N3Y B;  4D6T E;  1CW5 A;  2Z5I A;  1HGV A;  1L4A C;  2OYH A;  4AQR D;  2KNC A;  2O3J A;  1L4A D;  1SP4 A;  3N4X A;  1SQP K;  3B5N A;  2BCC J;  3AE4 C;  1LTB C;  4Y99 C;  1LT9 B;  1SQB G;  3MZW B;  3JCU H;  1MFT A;  1SQV J;  1SVF A;  1SLQ A;  3O6Q A;  4ZMD A;  1N73 C;  4IOI H;  3BCC E;  2KOG A;  2P58 A;  5K5G B;  1NWQ A;  1JTH B;  1NTK K;  1T6A A;  4Z1M H;  4GDO A;  1BGY G;  2FYZ A;  3CCJ P;  3CME P;  2PFX A;  1UII A;  5KLV K;  1BSH A;  1HF9 A;  2JO1 A;  1YTZ I;  2QG4 A;  3AE8 C;  3LK3 A;  4DZO A;  4B86 A;  4TT3 H;  3TK1 A;  1DD3 A;  1SQQ D;  1M8O B;  2Q6Q A;  3KHU A;  1BCC E;  3L70 E;  3L74 G;  3NTN A;  4K3A A;  2M5A B;  3RL0 B;  1RF0 A;  3L70 D;  4HKZ H;  3CWB D;  2FXO A;  1TU3 F;  1AA0 A;  1MV8 A;  2XND H;  1NTM G;  1LTJ B;  4UB6 H;  1AJY A;  1SQV D;  4JPZ B;  5AW0 B;  3AA6 A;  2IYP A;  3GHG C;  2Z4E A;  4NPE A;  3MD0 A;  1JM0 A;  1KQF B;  3TF5 A;  1CI6 A;  1SFC A;  3RL0 g;  5APV A;  3H32 A;  2WPQ A;  2HFE D;  1EDL A;  3AEB C;  3LIE A;  3RK2 C;  5KKZ C;  3HD7 C;  4GOE A;  3I55 P;  1M1J C;  1EDJ A;  1P84 D;  3JCU E;  2PAJ A;  3HD7 D;  2AXT H;  3CXH E;  2OTL P;  1YI2 P;  2WSF J;  1MUU A;  2FY8 A;  5BU5 A;  1P84 I;  2O01 J;  1GK4 A;  2ZT9 B;  1BE3 G;  1S9K E;  1T3U A;  1YJN P;  2W27 A;  1MKM A;  4HB1 A;  2KB7 P;  1ZV8 A;  5AW6 B;  2HOD A;  2P10 A;  3SFD C;  2WMM A;  3VOP A;  1SQP J;  4C7R A;  1GU5 A;  1OZH A;  5B66 H;  3TYY A;  1OW8 A;  2QJY C;  1GK6 A;  1SQX K;  1JY2 N;  1FDI A;  4RJT A;  1Q7Y Q;  3H1H D;  1JMB A;  1JUN A;  5B5E H;  1NU1 K;  2FYU E;  3P8C E;  3H1L G;  1GD2 E;  4WY4 C;  3ZDM A;  3SSU A;  3M0D A;  2HLO A;  4WY4 D;  3H1K E;  4EYY Q;  5AVW B;  2RMZ A;  4QMA A;  4C7N A;  2IBZ G;  4IL6 X;  4W80 A;  4K35 A;  1AVO A;  2FXM A;  4UB6 E;  3CC2 P;  3B71 A;  1EZV E;  2LXB A;  2KNC B;  4JYB A;  1PP9 G;  4OGQ C;  3LID A;  3B5N B;  5AVY B;  4OGQ D;  2ZJS E;  2I8D A;  3AE3 C;  3PJS K;  2NPS B;  2P2U A;  3O6Q B;  1T2K C;  4L74 A;  2ITA A;  1PFI A;  4W7Y A;  1KZU B;  3P8M C;  1T2K D;  1RE4 C;  3HRN A;  5AVQ B;  1HWT C;  1NO4 A;  4Y99 B;  1RF1 B;  1EZV I;  1KQG B;  1SQP D;  2WPV B;  2MKV A;  3CLQ A;  1FZC C;  4I7Z C;  3AEG C;  3V6I A;  3RBZ A;  2E76 B;  3V4Q A;  1OWA A;  2QJK B;  2E74 B;  2DW3 A;  1NTK D;  1VQP P;  2HYN A;  1N8R Q;  1L0L K;  4UB8 E;  5M1B A;  3AE7 C;  2OYI A;  1NTZ J;  2ZYG A;  5BU8 B;  5KLV D;  3MTU E;  4W7Z A;  2O1K A;  4EDF A;  1Q81 Q;  2KLV A;  2C9N Y;  3H1I J;  1J1E C;  5AW8 B;  5B66 E;  1IFM A;  1PPJ D;  5CCH A;  1S2E A;  1SQQ G;  1ZN5 A;  1XTC C;  4HYT B;  3TSI A;  4ASW A;  2A45 H;  1N86 A;  3VYI A;  1J1D B;  3L71 J;  1IFN A;  1NGM B;  1YBK A;  1PV3 A;  5CJ0 A;  1VQO P;  1ZW0 A;  1DH3 A;  3QWO C;  2KK7 A;  3L74 E;  1U7J A;  3SFE C;  4AYC A;  3L70 G;  3CWB G;  1GU4 A;  1CI6 B;  1X79 B;  3AEA C;  3H32 B;  3A0H H;  2W83 C;  1S4X A;  1SQV G;  2E75 B;  2MJZ A;  4PD4 H;  3AA1 A;  5AW3 B;  4NPD A;  1QL1 A;  2YKQ A;  2KP8 A;  2CPS A;  1NU1 J;  1A02 J;  1ZR2 A;  2E5Y A;  1M56 D;  3NMD A;  2KXP A;  4JQ0 D;  1N7S C;  2WSC H;  1NKZ B;  3A0B E;  2Q1K A;  1N7S D;  5AW7 B;  3D6Y A;  2QJP B;  3RK3 E;  2N1T C;  4PV1 C;  3BAT A;  1AFO A;  2HOD B;  2O01 N;  2J58 A;  1IZN A;  2G3A A;  3SWY A;  4PV1 D;  4RO0 A;  2C0W A;  4LC1 A;  1BSN A;  2OTK E;  1HJ0 A;  4ZKP A;  3L71 D;  1OVU A;  1D7M A;  3MP7 B;  2RKL A;  4GOD A;  2FBW C;  1LTJ A;  2JN8 A;  3U1A A;  5DIP A;  1YTZ T;  2W6A A;  1JY3 O;  1S5L E;  1YHQ P;  3D6Z A;  3VP8 A;  3AAE A;  2V7Q J;  1KMI Z;  1NOH A;  3SWK A;  3RGU A;  2B89 A;  1VQ5 P;  1OVR A;  1SQX D;  1OIP A;  4I6M C;  4YXW H;  4OH8 B;  3H1H G;  2O1J A;  1U57 A;  5AW5 B;  1NU1 D;  5CCG C;  2YMY A;  1OXZ A;  3IR9 A;  1M1K Q;  3C9I A;  5CCG D;  3L75 J;  3D71 A;  1L0L J;  3GF3 A;  3MUD A;  3V5B A;  1IJD B;  2M8R A;  1NVO A;  1USD A;  1BDC A;  2B87 B;  1JNM A;  3WMM 0;  3G71 P;  4OVN F;  2Y0D A;  3H1L E;  3NXS A;  2FXP A;  2YIU C;  1IK7 A;  1LT1 A;  1VF5 C;  2HG5 D;  2IBZ E;  1FBM A;  1DX7 A;  2Y9Y A;  3AEC C;  1FS0 E;  3K5B A;  2ES9 A;  1YJW P;  2BAS A;  5APW A;  4D6T J;  3HUS B;  3TGU D;  1PP9 E;  1VDF A;  1EZV G;  3FXE A;  1LW1 A;  2C0X A;  3AA0 A;  2OYI B;  1SQP G;  1KQL A;  1E79 H;  1DD4 A;  2LR2 A;  3BCC J;  4H13 C;  3L73 J;  2P67 A;  2D2C B;  2IZ1 A;  4GOF A;  3R4Y A;  3O8Z A;  3L75 D;  1L0L D;  2FYN C;  1NTK G;  4EIJ A;  2KIK A;  1NJI Q;  3HE4 A;  5KLV G;  2GMY A;  4N78 D;  4AKR A;  4XE5 B;  3B5N D;  2XU6 A;  3CXH H;  1L4A A;  2NPS A;  5AW2 B;  2IFM A;  1USE A;  5AVS B;  1BCC J;  1PPJ G;  1ZP0 C;  1EXJ A;  2W6J H;  3FWL A;  1RF1 A;  4A7P A;  4GIF A;  3Q5R A;  1KB9 E;  2H7H A;  1SQQ E;  3PP5 A;  1ZOY C;  2YKP A;  1N73 A;  3N7N A;  4KT0 J;  3E1R A;  5CBO A;  2L5G B;  2WZ7 A;  5E79 E;  2KXP B;  1KB9 D;  2ZAE B;  3TNU B;  1IC2 A;  1URQ C;  3CWB E;  4IFM A;  1RH5 B;  2O4D A;  1URQ D;  1KB9 I;  3L73 D;  1SQB K;  5TJH A;  1IFP A;  5L8R J;  1IZN B;  1HUC A;  1VQ9 P;  1SQV E;  2QSI A;  2H8P D;  1RF0 C;  2KI7 B;  1VKE A;  5H2F E;  5AVT B;  1K73 Q;  1JY3 P;  1NH4 A;  1YIT P;  2BCC D;  3D70 A;  1HTL C;  2G8Y A;  2LKM A;  2R32 A;  1GW4 A;  3RK3 B;  3V2N A;  2JP3 A;  2HR3 A;  2XV5 A;  3LW5 H;  2W8Z A;  1FZB A;  3R2P A;  1MFZ A;  3L71 G;  3CCM P;  3FX0 A;  1GZL A;  5APX A;  1VQ6 P;  4H44 B;  1S3J A;  1NTZ K;  4C46 A;  4H0L B;  5GTH E;  1P84 E;  2JEE A;  3IAO A;  2WQY C;  1SFC D;  1KIL E;  3GHG A;  1QVG O;  2IPP A;  3L72 J;  1LTI C;  3F89 A;  2VRS A;  1L0N K;  2WT7 B;  3OJA B;  3WUU A;  3A2A A;  1KIL C;  1H88 A;  1KIL D;  1NTM K;  1SQX G;  1T8Z A;  1K9M Q;  3KPE A;  3HD7 A;  4UB8 H;  2N9B A;  1M1J A;  2FYU J;  1NU1 G;  3OAK A;  4BRY A;  2QEX P;  3H1K J;  1VPC A;  3CCV P;  3H1H E;  4L76 A;  4L73 A;  1CZQ A;  1VF5 B;  2ZXE B;  2FFD C;  1JY2 O;  1GL2 B;  4KHX A;  5GTI E;  1Y9B A;  4U7J A;  1FC2 C;  4EOT A;  3M0A A;  4KJM A;  5APY A;  2QE7 H;  2RN0 A;  2Q5U A;  5C39 A;  1LTT C;  1R8E A;  3PH0 A;  3VMY A;  4L75 A;  1RHZ B;  3BRT B;  2V4H A;  2N9Y B;  1KTM A;  3TGU G;  3L72 D;  4GT1 A;  4PJ0 H;  2WIT A;  2H88 C;  5DJT B;  1KQS O;  1FJK A;  4H13 B;  1PZQ A;  3GLM A;  2NRG A;  2XNX A;  3FWN A;  2OGU A;  3HE4 B;  3CX5 D;  1Y47 A;  3CCL P;  3RBX A;  1S72 P;  2P1J A;  3I5C A;  2ZVO B;  1SQP E;  2K9J A;  4WB4 A;  1SQB J;  1L4A B;  3CX5 I;  1E5W A;  2B87 A;  2QM7 A;  1L0L G;  3A0B H;  1ZRT E;  2L91 A;  3C1L A;  3VP9 A;  1LWU C;  2KYV A;  1N73 B;  1NTK E;  2Z5H A;  3II6 A;  2AF7 A;  3AEF C;  1MZ9 A;  1BGY J;  5CJ4 A;  3HUS A;  1DIP A;  1WRG A;  4U3F J;  1NKN A;  3M06 A;  5KLV E;  1ZRT D;  2W90 A;  4HH2 A;  1QL2 A;  1FZC A;  3CD6 P;  1N2D C;  1S5L H;  3H6P A;  1PPJ E;  2JWD A;  3M91 A;  3D7I A;  2HPC A;  3S9O A;  1FOS E;  3GMA A;  3AE2 C;  4ZKU A;  1H89 A;  1L0N J;  1PGO A;  4NPF X;  2M3E A;  1NYH A;  1OW6 A;  1KN7 A;  5CCH C;  2D2C D;  2M3B A;  1NTM J;  1R5S A;  2YMK A;  5CCH D;  2ZVN B;  1KYO D;  1LP1 A;  1HGZ A;  3HTK B;  2ZYD A;  1KYO I;  1LT9 C;  1YIJ P;  3LVY A;  3V2P A;  1X0T A;  3CCS P;  5AVX B;  5AW9 B;  3IFM A;  5APU A;  2BCC G;  2A06 D;  2IDB A;  4PJ0 E;  1BGY D;  2WPR A;  1FOS F;  3GHG B;  2K3R A;  4U3F D;  1OW7 A;  3VMX A;  2WSE H;  3GF7 A;  3A7O A;  2QA4 P;  1KNC A;  1G1I A;  3MGN A;  4DOJ A;  1ZR4 A;  1KC8 Q;  3P32 A;  4IFF A;  1IFD A;  3AE5 C;  4YXD C;  1NTZ D;  3RK2 B;  5KKZ B;  3AED C;  3AE6 C;  3TNU A;  1ZLL A;  3HD7 B;  3L71 E;  5AW4 B;  1M1J B;  1BE3 J;  1L0N D;  1FZF A;  3H1I D;  4BRY B;  1QGK B;  3BEY A;  1N7S A;  2E43 A;  1JY2 P;  3RL0 C;  1EDK A;  1SS1 A;  1NTM D;  5KAF E;  4RES B;  3RL0 D;  2GA1 A;  2KZ7 A;  2N1T A;  2WTY A;  1LTJ C;  3PHL A;  5KJ7 C;  3AE9 C;  1SQX E;  3KDP B;  1QEX A;  5KJ7 D;  1NHL A;  1Q82 Q;  3H1J J;  1J2J B;  2QJY B;  1LNQ A;  1GW3 A;  3H1L J;  1NU1 E;  3L37 A;  3C8V A;  2K88 A;  3KXD A;  2CPB A;  1IO4 A;  3A3Y B;  4WY4 B;  4H44 D;  4DJG A;  1FJP A;  2YO3 A;  1KB9 H;  2ZXX A;  1AV1 A;  4R4L A;  1PP9 J;  2WT7 A;  3AAA A;  2AEJ A;  1VQL P;  2K9J B;  5E79 H;  1BE3 D;  3L72 G;  2KS1 B;  2WSC J;  5CCG A;  4OGQ B;  3CC7 P;  5DIK A;  3CI9 A;  2UWJ E;  3TGU E;  2ZT9 C;  2JJL A;  3CC4 P;  2Q9I A;  2ZT9 D;  4LLH A;  4JF7 A;  1RE3 C;  5ADX K;  3S4R A;  2K37 A;  3Q1M A;  3UIA A;  1GDT A;  2Q7C A;  2A45 I;  1UIX A;  2AXC A;  5H2F H;  1GL2 A;  1G1J A;  3H1J D;  1FZC B;  4I7Z B;  1LWU B;  1FDO A;  1GMJ A;  5KAI H;  1KV4 A;  1H8A A;  3JSV C;  2K1A A;  5TIS H;  2E42 A;  3M9B A;  3L75 E;  1L0L E;  2HPC B;  1W2E A;  2OAR A;  2YXR B;  2GUS A;  1RQU A;  3AE1 C;  4PD4 D;  1PIX A;  3AA7 A;  2FYU K;  3E1I A;  4N78 E;  5GTH H;  1P84 H;  2IYO A;  2E5T A;  1EQ7 A;  4PD4 I;  1SQQ J;  2WWW A;  2AEF A;  2OYH C;  5AVU B;  3FGA D;  1LP1 B;  1LTS C;  1J1E B;  3B5N C;  2POH A;  2NPS C;  1WMK A;  3L70 J;  2YO2 A;  3CWB J;  5KTB A;  1FDM A;  2NPS D;  4D6T D;  1RF1 C;  1S5L X;  3IN6 A;  2JR8 A;  1OMI A;  2B88 A;  2B9B A;  2E76 C;  3L73 E;  2QJK C;  2Y0C A;  2E74 C;  3KZI E;  2E76 D;  1NAY A;  2E74 D;  2A06 G;  5GTI H;  4BWN A;  2QIW A;  3BCC D;  3F5H A;  4U3F G;  3CMA P;  2BCC E;  3GW6 A;  1FU1 A;  3OW2 O;  1N7S B;  4IL6 E;  3P7K A;  1JCD A;  1X22 A;  1URQ A;  1Q86 Q;  2WSF H;  3CX5 H;  1NTZ G;  2O01 H;  4GKG A;  2N1T B;  4PV1 B;  1YQ4 C;  1M90 Q;  5AVV B;  3M9H A;  5KAI E;  3T97 A;  1L0N G;  1YQ3 C;  5TIS E;  1J1D C;  3H1I G;  4HJG H;  3SWF A;  1XTG B;  1RQV A;  1BCC D;  3HTK A;  3JC2 2;  1K05 A;  4JBZ A;  1JMM A;  1YYC A;  1EXI A;  2H89 C;  2IZ0 A;  1KD1 Q;  1VQ4 P;  1SFC C;  4I2L C;  3CCE P;  4YTP C;  5AVZ B;  1JCC A;  4I1L A;  3U1C A;  1BDD A;  1HH0 A;  1LTA C;  1N7L A;  2OYO A;  3H1H J;  2E75 C;  2XDJ A;  1P8C A;  3PRJ A;  1NAF A;  2E75 D;  2CK3 H;  2IX7 C;  2WVR A;  1OFC X;  2I1K A;  2K9Y A;  4XA4 A;  3B8E B;  2R3S A;  3G3Z A;  3WUV A;  3RK2 D;  3CCR P;  3Q5P A;  1KIL A;  5AFU K;  1RY3 A;  2GUV A;  3EFG A;  3W67 A;  2QJP C;  3Q2Y A;  2W6B A;  1ME5 A;  2PGD A;  1W2B O;  1PGP A;  3USS A;  3LK2 A;  2R5D A;  1KYO H;  2YIU B;  1M57 D;  1JO5 A;  3KQG A;  2KZI A;  3CXH D;  3BRV B;  3L72 E;  3LW5 J;  4N6J A;  2R44 A;  3CXH I;  3NFQ A;  1HVV A;  2J59 M;  2YXQ B;  1S9K D;  4MN4 C;  2FFD A;  2A45 G;  1FE6 A;  3QH9 A;  2BEQ D;  2ZYA A;  3M0D C;  1ZME C;  2Q3E A;  3CX5 E;  5CHX A;  4G9Q A;  3H1J G;  1X8Y A;  4WY4 A;  4RKU J;  1NTK J;  2P7J A;  5EFW B;  3VMA A;  1H0T A;  1CSB A;  1G2C A;  2KZJ A;  2QM8 A;  4WVZ A;  5KLV J;  3AEE C;  2OTJ P;  2FYN B;  1JOC A;  5AVR B;  2FYU D;  3P8C D;  2KS1 A;  2KSE A;  2SPZ A;  5KLI C;  2OYH B;  3VMZ A;  2I1J A;  4LGD E;  1Q2N A;  3L75 G;  3H1K D;  3S1K A;  4DT0 A;  1GTW A;  1Z56 A;  1FAV A;  2AEM A;  2QEU A;  2KSJ A;  1EZV D;  1RE4 A;  5KAF H;  1JB0 J;  3HUS C;  2M0B A;  1DEB A;  4Y28 J;  4O9B A;  1LWU A;  2Y0E A;  4BXL A;  2NZ2 A;  3HE5 A;  4D6T G;  2LXC B;  1S1C X;  2OYI C;  2R3C A;  3L74 J;  1KFM A;  2AXT E;  1SQB E;  3H25 A;  1KYO E;  1URQ B;  1GU9 A;  1T3J A;  1LTG C;  1DEE G;  1HBW A;  2YNY A;  2D2C C;  1X9V A;  2J5U A;  3VN0 A;  4DCK A;  3EQ2 A;  2KLU A;  2YKO A;  3BCC G;  3T97 B;  1SQB D;  2CWQ A;  3L73 G;  3E7K A;  2A06 E;  1VL2 A;  2PP6 A;  3BVH A;  1BGY E;  2IFN A;  4U3F E;  3CCU P;  3OA7 A;  3W68 A;  1IFJ A;  3WUT A;  1W5C E;  1AQ5 A;  1U7M A;  5B5E E;  2C9L Y;  1NTZ E;  1LT9 A;  2V7Q H;  4OWF A;  4ZNC A;  1BCC G;  4YPC A;  5APQ A;  1SFC B;  3GG2 A;  1L0N E;  3H1I E;  2R5B A;  1JTH A;  1VQ8 P;  1SQQ K;  4IFD K;  3L74 D;  3U59 A;  2XKM A;  3ABV C;  1SQX J;  5BVZ A;  1NTM E;  4WBA A;  1KIL B;  4JYC A;  3VTP C;  2XZR A;  2ZFC A;  1JEK A;  1M7L A;  4M3L A;  3WU2 H;  1HJB A;  5CBN A;  4XFJ A;  2OUW A;  3MHV A;  1EDI A;  3PLN A;  4WWI A;  3V4W A;  1SQV K;  3Q3D A;  1OX3 A;  2N1T D;  2M5A A;  5CMZ A;  3CPW O;  3RK3 C;  2FFD B;  2H43 A;  3L4F A;  3RK3 D;  4EI2 A;  3V2R A;  1IFI A;  5KJ7 A;  2PRR A;  3TGU J;  3I56 P;  3LK4 1;  1Q90 D;  4H44 C;  2RH0 A;  1JY3 N;  3PTZ A;  4H0L C;  2QVA A;  4CPG A;  1IK9 A;  1LGH B;  1PGJ A;  2BEZ F;  1BE3 E;  1LJ2 A;  2WSE J;  4AUW A;  3EFF K;  4H0L D;  1VQK P;  1H0T B;  1VQN P;  1FZE A;  4ASV A;  1G2C B;  2Q3I A;  2Y9Z A;  3KYQ A;  3TDK A;  2GM4 A;  1ZXG A;  3L36 A;  5AW1 B;  3MUD C;  4C7N B;  4R4M A;  2Q0T A;  1VQM P;  3B4S A;  3KZI H;  1QLE D;  3EWK A;  1KFN A;  3FXD A;  3CCQ P;  2OQQ A;  3G9R A;  1YJ9 P;  2WSS H;  1K04 A;  1A02 F;  2JDI H;  1AQT A;  3H1J E;  5KLI B;  4IL6 H;  1L2P A;  2FYU G;  3A0H E;  1AVY A;  1KOR A;  3Q5S A;  1QVF O;  3M9Q A;  1WT6 A;  1GL2 C;  2JKV A;  1PL5 A;  1Y8A A;  3H1K G;  1PGQ A;  1R5L A;  1VF5 D;  1VQ7 P;  3CL3 D;  1RE3 A;  3MIW A;  1GL2 D;  2WPS A;  4PD4 E;  3HE5 B;  3BAS A;  3H1L D;  1FZG A;  2QRX A;  5APS A; 
#chains in the Genus database with same CATH homology
 2OYO A;  1IZN A;  2QEU A;  3AAE A;  1VKE A;  5AFU K;  5DIK A;  2AF7 A;  2GMY A;  1P8C A;  2KXP A;  3D7I A;  4AKR A;  4G9Q A;  2CWQ A;  2O4D A;  1ME5 A;  2PFX A;  3AA7 A;  1LW1 A;  3LK2 A;  2KZ7 A;  2OUW A;  3AAA A;  2IJC A;  3AA0 A;  1GU9 A;  2JN8 A;  5DIP A;  3AA6 A;  1KNC A;  2ES9 A;  3LVY A;  3AA1 A;  2Q0T A;  5ADX K;  2PRR A;  3LK3 A;  3C1L A;  3LK4 1;  3BEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...