2OYOA

Crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
b'DRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDHQIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of Uncharacterized peroxidase-related protein (YP_604910.1) from Deinococcus geothermalis DSM 11300 at 1.51 A resolution
rcsb
source organism Deinococcus geothermalis
molecule tags Oxidoreductase
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2oyoA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2oyoA02
3LVYA 3D7IA 1VKEA 5DIKA 2PRRA 2Q0TA 2PFXA 1ME5A 1P8CA 1GU9A 4G9QA 2IJCA 5DIPA 1KNCA 3BEYA 2CWQA 3C1LA 2OUWA 2QEUA 2GMYA 1LW1A 2AF7A 2O4DA 2OYOA
chains in the Genus database with same CATH superfamily
2NPSB 1URQB 3FX0A 3OJAB 1NKZB 3L4FA 2IYOA 1SQVD 3F89A 4W7YA 1VQ8P 2FFDC 4Y99B 3SWKA 2KXPA 1VQKP 2IBZE 3D70A 1NGMB 1GTWA 5B66H 4QMAA 2L5GB 5AVXB 2ZYGA 4PJ0H 1SQVG 1OZHA 3V2QA 4GIFA 5KLIC 3B5NB 1BCCE 3G9RA 3TDKA 1NTMK 2E76D 2ZAEB 2E75C 2V7QJ 1SQPD 3TGUE 3CC2P 5APSA 3V2NA 3C8VA 2R3SA 4Y28J 1RF0C 1DD4A 4IL6E 2HODB 3H32B 1SQPG 1L0LJ 2Q0TA 2B87B 2P10A 1AQ5A 1KB9H 3BCCJ 3A0BH 2YIUC 3AE5C 4OH8B 1X8YA 4YPCA 2JWDA 1PIXA 2WITA 1NTMJ 1P84E 1BDCA 2WSFJ 3B8EB 3KZIE 2KLVA 2P58A 3QH9A 1PGJA 4RJTA 3HUSA 2H43A 1NVOA 2XNDH 3A0HE 3MZWB 3CX5H 2QRXA 2R5DA 4AYCA 1N7SA 4PD4E 3WUUA 1SVFA 2OYHA 3RGUA 1A02F 2HG5D 3EFFK 3VTPC 2K9JB 3TSIA 3H1ID 2XNXA 3P8CE 2JR8A 4IL6X 5GTIH 2YO2A 1LWUB 1T3UA 3H1IG 3LK41 1VF5B 3VYIA 3H6PA 1WMKA 2Q5UA 3HE4B 5APVA 3TYYA 1EZVI 1SQBG 5AVZB 5AVYB 3S1KA 1FS0E 3MGNA 4YXDC 1PGOA 1K04A 3ABVC 4MN4C 3OA7A 3AE4C 3CMEP 5AVRB 4RKUJ 1X79B 3IR9A 1N7SC 2J59M 2OYHC 1Y9BA 3PTZA 4K3AA 2KIKA 4I7ZB 1FE6A 1OVRA 3HE5B 1RQVA 3E1RA 1KFMA 1T3JA 1AVYA 2IZ0A 4XA4A 1SQQE 3H1JE 3B4SA 1NU1K 2KP8A 4R4MA 1S1CX 4NPFX 1L4AB 1RH5B 3MP7B 3CXHI 5KLVD 1U57A 2ZYAA 2SPZA 4G9QA 2LR2A 5DIPA 3RK3B 5KLVG 3B71A 3L75J 4JPZB 1FC2C 3CI9A 3L73G 5AVSB 4IFDK 1NTZE 1FZEA 3V2RA 2KNCB 3GHGA 4H44B 4L73A 2QEXP 1S72P 3L70J 1H0TA 1NU1J 2JO1A 1BDDA 2JP3A 1G2CB 4I1LA 1FDMA 2KS1B 2KSEA 1YYCA 1RHZB 3KQGA 1AQTA 2KOGA 1GD2E 1AA0A 3AA7A 2LXCB 1JY3N 1OFCX 3CMAP 5CCGD 1LTSC 1LTTC 1JO5A 3AE7C 3PLNA 2QJKB 2FYNC 3HTKA 1KYOD 2W6AA 3VN0A 2ES9A 4H0LD 4OGQB 2WSEJ 1KZUB 2BEZF 2M8RA 1DH3A 2GA1A 1TU3F 3V5BA 2D2CB 2J58A 4DJGA 2MKVA 2HPCA 1RQUA 1M1JC 1HGVA 2PP6A 4GDOA 1S3JA 1JEKA 2FYUK 5AW3B 1SQVK 3CXHH 2VRSA 5KAIE 1RF1A 2O4DA 3GHGC 1HJBA 1IK9A 3CLQA 3L71D 3LIDA 4U3FE 1KB9D 1LP1A 4C7NA 1MFTA 5APQA 4OGQD 2PGDA 1GL2A 1RY3A 3L71G 2IPPA 4JYBA 5KAFH 1PFIA 2LXBA 3NFQA 4UB6H 1SQPK 3LVYA 1T6AA 1BE3E 2L91A 1FU1A 3Q5PA 3RK2B 2YMKA 2FYUJ 1SQVJ 4B86A 1R8EA 3CX5D 1PP9D 1FDOA 1L0NK 3VP8A 4JYCA 2IBZD 5AW8B 3ITKA 1IZNA 2QVAA 1LWUC 2WT7A 2E75D 5KTBA 1PP9G 1GMJA 1H88A 1KD1Q 2OYIA 2IBZG 4BRYB 1H89A 1VF5C 2DW3A 1SQPJ 5H2FH 2E5TA 4K35A 1KN7A 2ZYDA 3GW6A 2ZXEB 2Q7CA 1JY2O 5APUA 1LT9B 1CI6A 3AA6A 2XU6A 2JKVA 2PRRA 1D7MA 1XTCC 1L0NJ 3RL0g 3CD6P 3G3ZA 1GL2C 2XDJA 1SFCA 1KQLA 4TLFA 1L0LE 1JTHA 2I1KA 3KXDA 3CCQP 1LTGC 3JC22 3RBXA 1KILA 1X0TA 3H1KJ 3HD7B 2G3AA 2Y0DA 3WUVA 1FDIA 1E5WA 1SQBK 5DIKA 5B5EH 2FXMA 5B66E 1KYOI 1M90Q 4PD4D 4PJ0E 1Y47A 1Q81Q 2H88C 3I56P 2OYIC 1L4AC 4HYTB 2O01J 1NAYA 1NAFA 3SFDC 1IO4A 4GOEA 3H1IJ 2Y0CA 2KUBA 1J1EB 4DCKA 5AVQB 1FZCA 1PGQA 3LIEA 1KV4A 1MUUA 3SWFA 3FWNA 1ZN5A 2AEFA 2V7QH 1BGYJ 1SFCC 3O6QA 1SQBJ 1X22A 3O8ZA 3D6YA 3AA1A 1KB9E 2CPBA 3A0BE 2M3EA 1KILE 4PV1C 1SQXD 2P2UA 1YHQP 2Q3IA 2GM4A 2E76B 2XV5A 3JSVC 3BATA 3N7NA 1KILC 3NXSA 5KKZB 1N7SD 1K73Q 4YXWH 1YI2P 4IFFA 1M57D 5BVZA 5KLVK 1GU9A 3CX5E 1PP9E 1M1KQ 1FZAA 1YTZI 4OVNF 4UB8H 2C9LY 4NPEA 1EDIA 2IBZI 4CPGA 4LC1A 2D2CC 3TNUA 3IF4A 2ZT9C 3CWBE 1GDTA 1FZCC 2WPQA 4EYYQ 2K3RA 3FGAD 3I5CA 3T97A 5GTIE 1SQQD 3H1JD 1M7LA 2WPVB 4WY4A 3L72E 2M5AB 1S2EA 5KLVJ 5CHXA 3AEAC 3USSA 2QJYB 1SQQG 3L73J 1EQ7A 3H1JG 4WBAA 1M8OB 1P8CA 1HJ0A 2YXRB 1KMIZ 3E1IA 3VMAA 2B88A 4JQ0D 3W68A 2OUWA 2OGUA 3L37A 2BCCJ 3VP9A 3M9BA 1ZP0C 2N1TC 1NTZD 2OTKE 1HH0A 1N73A 1GK4A 2JN8A 3BRTB 4BWNA 1P84I 4W80A 4H13D 4RESB 2FYZA 1K8AQ 1W5CE 1NTZG 3H1LJ 1J1DC 3A7OA 2A45G 2KYVA 3U1AA 5AW1B 2H8PD 1EDLA 2M3BA 3KDPB 1JNMA 1AFOA 1BSHA 4PD4I 4L74A 1HGZA 1T2KD 4WY4C 3RL0D 3H1HD 4W7ZA 1W2BO 2ITAA 2CPSA 2QSIA 2Q9IA 1JOCA 2FKWB 3R2PA 1LGHB 2JEEA 3VMXA 4M3LA 2JJLA 3AAAA 1JMMA 2HR3A 4WWIA 3WU2E 1VPCA 2QJPC 3K5BA 1SQXE 2HPCB 1FZGA 5GTHH 1Z56A 1N73C 4Z1MH 2ZFCA 1N8RQ 1FJPA 3L71J 1DEBA 2J5UA 3I55P 4U3FD 3V2PA 3U1CA 3C1LA 2JDIH 1RF1B 2O3JA 2Q1KA 1QGKB 2QG4A 2NPSA 1URQA 4U3FG 4C7NB 1Q82Q 3AAEA 1HVVA 1KQSO 1RE3A 4N3YB 1P84H 1FZFA 1BE3D 1IC2A 1YITP 1GW3A 2A06D 2HLOA 2FBWC 5CJ4A 3SWYA 1WT6A 1DEEG 3G6EP 2AEMA 1BE3G 3B5NA 2E74C 4DT0A 3UIAA 2HFED 2KB7P 3CL3D 1NWQA 2W8ZA 1BCCJ 2WSEH 2K9YA 2AXTH 2KZIA 1Q7YQ 4EIJA 1N86A 2Y0EA 4HJGH 3TGUJ 4IFMA 4TT3H 2WSSH 2HODA 3OAKA 1JUNA 1M1JA 1GL2D 2GUVA 2B87A 4H0LB 1G1IA 1OVUA 4LLHA 3LW5J 2E43A 1L0LD 4ZNCA 3NMDA 4L76A 2A45I 2NPSC 1URQC 5KAFE 1PZQA 1IFDA 1VQ7P 3N4XA 1RE3C 5AW5B 2MJZA 4Y99C 1VL2A 1L0LG 1NTMD 1GU4A 3SSUA 4I2LC 1K05A 2Q6QA 5CCHA 3AE1C 1ZW0A 3B5NC 5AW4B 1LTJB 3H1KE 1NTMG 1ZRTE 3V6IA 3M91A 2QIWA 3H1HE 2K9JA 2ZXXA 2Z5HA 1PGPA 1T8ZA 3PP5A 2G8YA 5APWA 1LWUA 5H2FE 1M56D 2FFDB 1SFCD 1RE4A 3CPWO 5AVWB 1AVOA 1GU5A 3HE4A 2Q3EA 5AVTB 3CCJP 4WB4A 5KLIB 2WWWA 4PV1D 5CBOA 1BGYE 3AE8C 3JCUH 1L2PA 1VQ5P 2E75B 1H8AA 2NRGA 2RMZA 1KILD 5KJ7A 3L74E 4NPDA 4D6TE 1NTKE 1NO4A 4I6MC 3AEGC 1YJ9P 3BRVB 1CZQA 1SQQK 1QVGO 3IFMA 5CCHC 1AJYA 1HBWA 5APXA 1N7LA 2A45H 2FXPA 2A06E 5AW7B 2YIUB 1EDKA 3AEBC 5B5EE 2XKMA 3HE5A 1J2JB 2YO3A 2ZT9D 1WRGA 1LNQA 3LK3A 3S9OA 2PFXA 2R32A 2KXPB 3CWBD 1NTZK 2B89A 1L4AA 1RE4C 1JMBA 3CCVP 1SQQJ 3H1JJ 2O01H 3S4RA 2ZVOB 2RKLA 1SS1A 3L72D 1G1JA 3CWBG 4AQRD 1PPJE 2O1JA 4GOFA 1FOSE 4HKZH 5EFWB 3L72G 5KJ7C 3V4WA 2KNCA 4EI2A 3BCCE 1NTZJ 3EWKA 5TISE 1VQOP 1KFNA 1JY2P 1JB0J 3L75D 1G2CA 1NTME 3L36A 1W2EA 2KS1A 1VQPP 3AECC 4I7ZC 3IAOA 1USEA 2KSJA 2W27A 1FZBA 1USDA 3D7IA 2BASA 4UB8E 2LKMA 3BASA 1VDFA 1SP4A 1XTGB 4WY4D 2O1KA 5BU5A 3HUSB 1S5LH 3AE2C 4EDFA 1N2DC 3FXEA 2Y9ZA 4LGDE 1HWTC 4AKRA 1A02J 3MHVA 1N7SB 3RK3E 2OYHB 3C9IA 1IK7A 1DD3A 2I8DA 1NKNA 2KZJA 2W83C 1SLQA 2FY8A 3QWOC 3RK3C 1QLED 1LT1A 4ZKPA 4BXLA 1AV1A 1VQ4P 4H44C 4YTPC 1JY3O 1MFZA 2RH0A 1VQ9P 5DJTB 2KK7A 1FBMA 3OW2O 1KB9I 2P67A 1E79H 1EXJA 4U3FJ 2IZ1A 1QEXA 1IFNA 1ZR2A 2N1TA 2OYOA 1SQXG 1QVFO 3Q1MA 2QJKC 1OX3A 1KORA 4N78E 5C39A 4OGQC 4HH2A 1BE3J 1MV8A 3CX5I 3Q3DA 1JCCA 3MIWA 2E74D 1Q90D 4ZMDA 2HYNA 2FYUD 3KPEA 3AEEC 1OW7A 2B9BA 4H13B 1KYOH 3M9QA 1L0LK 2E42A 4BRYA 2C9NY 5AW2B 2FYUG 2GUSA 3MUDA 4GT1A 3GLMA 4AUWA 1S4XA 1MKMA 3VMYA 2FYNB 4N6JA 1LT9A 5E79H 1KC8Q 2C0WA 1NHLA 1Q86Q 2AXCA 1EDJA 1NH4A 3WUTA 1VQMP 5GTHE 3CXHD 1CSBA 4EOTA 1KQGB 3RL0B 2R3CA 2NPSD 1URQD 2RN0A 2O01N 3L75E 2WTYA 1M1JB 1L0ND 3L35A 1OIPA 3RK2C 3CC7P 1GZLA 5AFUK 3L70E 3D71A 4C46A 1NU1E 3TF5A 3CCUP 2WMMA 3GHGB 1L0NG 3HD7A 3Q5SA 2H7HA 1H0TB 3B5ND 1VQLP 2P7JA 2ZVNB 2QA4P 3AE6C 2OTLP 3KHUA 2W6JH 3H1KD 1ZRTD 2GMYA 1KQFB 5ADXK 2IDBA 3GF7A 3MUDC 3HTKB 1LT9C 2AXTE 3H1KG 4KT0J 4R4LA 1KNCA 2K1AA 1Y8AA 3H1HG 4C7RA 1HF9A 2P1JA 5BU8B 2BEQD 4DOJA 1ZV8A 2PAJA 3M0DA 3AEDC 2QE7H 5APTA 2Z4EA 3PH0A 3ZDMA 1S9KE 3PRJA 1BGYD 1IJDB 1LTIC 3M9HA 1MZ9A 3M0AA 1ZR4A 4ASVA 3WMM0 4IL6H 1SQBD 2H89C 1ZOYC 1DX7A 2OQQA 2OARA 3L74D 1LTBC 5AW6B 5CCHD 1EZVE 1BGYG 3LW5H 3HD7C 4D6TD 3AA0A 1NTKD 1UIIA 1LP1B 2YKPA 1GL2B 3L74G 3KZIH 3HUSC 4XE5B 4D6TG 1NTKG 1JY2N 1PP9J 5CBNA 2WPSA 2FYUE 1KTMA 3CC4P 1SQVE 5L8RJ 5CMZA 2K37A 1J1EC 2A06G 4JF7A 3A0HH 1VF5D 4O9BA 1YTZT 3CCSP 2UWJE 4PD4H 3CWBJ 1EC5A 3F5HA 3CCRP 2K88A 1QL1A 2AF7A 3M0DC 2M5AA 3G4SP 1IZNB 2YKQA 3A2AA 1DIPA 3L72J 2WT7B 3H32A 3KYQA 1SQPE 1FOSF 3CXHE 5KJ7D 1QX8A 2OYIB 1PPJD 3JCUE 2M0BA 2AEJA 2E76C 2WZ7A 3RBZA 4GODA 2NZ2A 3D6ZA 3Q5RA 1LJ2A 2KLUA 3L73D 1CW5A 1L0NE 4XFJA 1CI6B 5KKZC 3WU2H 1PPJG 1BSNA 3Q2YA 3BCCD 3H25A 4UB6E 1SFCB 2BCCD 2IFMA 3CCLP 1JTHB 1PL5A 3BCCG 1OW8A 4A7PA 4PV1B 2KI7B 2BCCG 2KZ7A 4IOIH 1L4AD 3H1LD 4H13C 1KILB 3NTNA 2WQYC 2QEUA 3TK1A 5APYA 1SQXK 5DJUB 1LW1A 3M06A 2C0XA 3SFEC 2POHA 4U7JA 3H1LG 5M1BA 2N9BA 2QJYC 3RK3D 3FWLA 2CK3H 5AVUB 1YQ3C 3H1IE 1JCDA 1Q2NA 3EFGA 1ZLLA 4H44D 4WVZA 1T2KC 1JM0A 3GF3A 2IYPA 5TJHA 3RL0C 5AW9B 1OMIA 2W6BA 2ZT9B 3P7KA 1VKEA 1FZCB 1OW6A 2IFNA 2N9YB 1SQBE 3MTUE 1SQXJ 1X9VA 3HRNA 3O6QB 2R44A 1NYHA 4KJMA 4RO0A 3VOPA 1QL2A 3P8MC 4DZOA 3LK2A 2YMYA 5AW0B 1NJIQ 2E5YA 3W67A 3AE9C 4N78D 2N1TB 1EXIA 2D2CD 3EQ2A 3CCMP 1GK6A 1S5LE 5K5GB 2WSCH 4KHXA 4OWFA 1J1DB 3G71P 1ZXGA 1UIXA 1YIJP 1YJNP 1U7JA 1NOHA 3GMAA 1PV3A 4L75A 3TNUB 1ZMEC 5CCGA 1FAVA 2V4HA 1ME5A 3T97B 1BCCD 1IFPA 3IN6A 4WY4B 5KLVE 2YNYA 2N1TD 3L73E 1LTAC 3TGUD 1K9MQ 1RF1C 1BCCG 1R5SA 1GW4A 3RK2D 3VMZA 3PJSK 1YBKA 5KAIH 2BCCE 2IJCA 2WPRA 3TGUG 2Z5IA 2QJPB 1U7MA 1VQNP 2YKOA 2QM7A 3R4YA 4GKGA 3L70D 2ZJSE 1NU1D 2YXQB 1N73B 3L75G 1S5LX 4JBZA 5CJ0A 2OTJP 1P84D 3P32A 3H1LE 2WSCJ 1LTJA 3L70G 1IFMA 1NU1G 3BEYA 3CCEP 1VQ6P 2W90A 1KYOE 1OVVA 3H1HJ 5AVVB 5CCGC 2FFDA 1YJWP 1NTKK 2CWQA 5E79E 3A3YB 4H0LC 2JWAA 1IFJA 2QM8A 1OWAA 1FJKA 2E74B 3P8CD 1OXZA 3V4QA 3AEFC 2IX7C 2Y9YA 3GG2A 1S9KD 4ZKUA 3AE3C 3FXDA 4ASWA 3MD0A 2FXOA 3HD7D 3L71E 1RF0A 3II6A 1IFIA 3L74J 2R5BA 4D6TJ 2I1JA 1EZVD 1NTKJ 1JY3P 1YQ4C 3A5TA 1HTLC 1LTJC 3E7KA 1HUCA 2WVRA 4HB1A 5TISH 2XZRA 1R5LA 3PHLA 3U59A 1EZVG 2WSFH 3BVHA
chains in the Genus database with same CATH topology
3AA0A 3LVYA 1IZNA 3D7IA 2JN8A 3AA6A 1VKEA 5DIKA 3LK3A 2KZ7A 2PRRA 3AAEA 2Q0TA 1ME5A 2PFXA 1P8CA 1GU9A 4G9QA 2ES9A 2IJCA 5DIPA 1KNCA 3AAAA 3LK41 5AFUK 2KXPA 3BEYA 2CWQA 3C1LA 2OUWA 2QEUA 2GMYA 3AA7A 1LW1A 2AF7A 2O4DA 5ADXK 2OYOA 4AKRA 3LK2A 3AA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVY A;  3D7I A;  1VKE A;  5DIK A;  2PRR A;  2Q0T A;  2PFX A;  1ME5 A;  1P8C A;  1GU9 A;  4G9Q A;  2IJC A;  5DIP A;  1KNC A;  3BEY A;  2CWQ A;  3C1L A;  2OUW A;  2QEU A;  2GMY A;  1LW1 A;  2AF7 A;  2O4D A;  2OYO A; 
#chains in the Genus database with same CATH topology
 2NPS B;  1URQ B;  3FX0 A;  3OJA B;  1NKZ B;  3L4F A;  2IYO A;  1SQV D;  3F89 A;  4W7Y A;  1VQ8 P;  2FFD C;  4Y99 B;  3SWK A;  2KXP A;  1VQK P;  2IBZ E;  3D70 A;  1NGM B;  1GTW A;  5B66 H;  4QMA A;  2L5G B;  5AVX B;  2ZYG A;  4PJ0 H;  1SQV G;  1OZH A;  3V2Q A;  4GIF A;  5KLI C;  3B5N B;  1BCC E;  3G9R A;  3TDK A;  1NTM K;  2E76 D;  2ZAE B;  2E75 C;  2V7Q J;  1SQP D;  3TGU E;  3CC2 P;  5APS A;  3V2N A;  3C8V A;  2R3S A;  4Y28 J;  1RF0 C;  1DD4 A;  4IL6 E;  2HOD B;  3H32 B;  1SQP G;  1L0L J;  2Q0T A;  2B87 B;  2P10 A;  1AQ5 A;  1KB9 H;  3BCC J;  3A0B H;  2YIU C;  3AE5 C;  4OH8 B;  1X8Y A;  4YPC A;  2JWD A;  1PIX A;  2WIT A;  1NTM J;  1P84 E;  1BDC A;  2WSF J;  3B8E B;  3KZI E;  2KLV A;  2P58 A;  3QH9 A;  1PGJ A;  4RJT A;  3HUS A;  2H43 A;  1NVO A;  2XND H;  3A0H E;  3MZW B;  3CX5 H;  2QRX A;  2R5D A;  4AYC A;  1N7S A;  4PD4 E;  3WUU A;  1SVF A;  2OYH A;  3RGU A;  1A02 F;  2HG5 D;  3EFF K;  3VTP C;  2K9J B;  3TSI A;  3H1I D;  2XNX A;  3P8C E;  2JR8 A;  4IL6 X;  5GTI H;  2YO2 A;  1LWU B;  1T3U A;  3H1I G;  3LK4 1;  1VF5 B;  3VYI A;  3H6P A;  1WMK A;  2Q5U A;  3HE4 B;  5APV A;  3TYY A;  1EZV I;  1SQB G;  5AVZ B;  5AVY B;  3S1K A;  1FS0 E;  3MGN A;  4YXD C;  1PGO A;  1K04 A;  3ABV C;  4MN4 C;  3OA7 A;  3AE4 C;  3CME P;  5AVR B;  4RKU J;  1X79 B;  3IR9 A;  1N7S C;  2J59 M;  2OYH C;  1Y9B A;  3PTZ A;  4K3A A;  2KIK A;  4I7Z B;  1FE6 A;  1OVR A;  3HE5 B;  1RQV A;  3E1R A;  1KFM A;  1T3J A;  1AVY A;  2IZ0 A;  4XA4 A;  1SQQ E;  3H1J E;  3B4S A;  1NU1 K;  2KP8 A;  4R4M A;  1S1C X;  4NPF X;  1L4A B;  1RH5 B;  3MP7 B;  3CXH I;  5KLV D;  1U57 A;  2ZYA A;  2SPZ A;  4G9Q A;  2LR2 A;  5DIP A;  3RK3 B;  5KLV G;  3B71 A;  3L75 J;  4JPZ B;  1FC2 C;  3CI9 A;  3L73 G;  5AVS B;  4IFD K;  1NTZ E;  1FZE A;  3V2R A;  2KNC B;  3GHG A;  4H44 B;  4L73 A;  2QEX P;  1S72 P;  3L70 J;  1H0T A;  1NU1 J;  2JO1 A;  1BDD A;  2JP3 A;  1G2C B;  4I1L A;  1FDM A;  2KS1 B;  2KSE A;  1YYC A;  1RHZ B;  3KQG A;  1AQT A;  2KOG A;  1GD2 E;  1AA0 A;  3AA7 A;  2LXC B;  1JY3 N;  1OFC X;  3CMA P;  5CCG D;  1LTS C;  1LTT C;  1JO5 A;  3AE7 C;  3PLN A;  2QJK B;  2FYN C;  3HTK A;  1KYO D;  2W6A A;  3VN0 A;  2ES9 A;  4H0L D;  4OGQ B;  2WSE J;  1KZU B;  2BEZ F;  2M8R A;  1DH3 A;  2GA1 A;  1TU3 F;  3V5B A;  2D2C B;  2J58 A;  4DJG A;  2MKV A;  2HPC A;  1RQU A;  1M1J C;  1HGV A;  2PP6 A;  4GDO A;  1S3J A;  1JEK A;  2FYU K;  5AW3 B;  1SQV K;  3CXH H;  2VRS A;  5KAI E;  1RF1 A;  2O4D A;  3GHG C;  1HJB A;  1IK9 A;  3CLQ A;  3L71 D;  3LID A;  4U3F E;  1KB9 D;  1LP1 A;  4C7N A;  1MFT A;  5APQ A;  4OGQ D;  2PGD A;  1GL2 A;  1RY3 A;  3L71 G;  2IPP A;  4JYB A;  5KAF H;  1PFI A;  2LXB A;  3NFQ A;  4UB6 H;  1SQP K;  3LVY A;  1T6A A;  1BE3 E;  2L91 A;  1FU1 A;  3Q5P A;  3RK2 B;  2YMK A;  2FYU J;  1SQV J;  4B86 A;  1R8E A;  3CX5 D;  1PP9 D;  1FDO A;  1L0N K;  3VP8 A;  4JYC A;  2IBZ D;  5AW8 B;  3ITK A;  1IZN A;  2QVA A;  1LWU C;  2WT7 A;  2E75 D;  5KTB A;  1PP9 G;  1GMJ A;  1H88 A;  1KD1 Q;  2OYI A;  2IBZ G;  4BRY B;  1H89 A;  1VF5 C;  2DW3 A;  1SQP J;  5H2F H;  2E5T A;  4K35 A;  1KN7 A;  2ZYD A;  3GW6 A;  2ZXE B;  2Q7C A;  1JY2 O;  5APU A;  1LT9 B;  1CI6 A;  3AA6 A;  2XU6 A;  2JKV A;  2PRR A;  1D7M A;  1XTC C;  1L0N J;  3RL0 g;  3CD6 P;  3G3Z A;  1GL2 C;  2XDJ A;  1SFC A;  1KQL A;  4TLF A;  1L0L E;  1JTH A;  2I1K A;  3KXD A;  3CCQ P;  1LTG C;  3JC2 2;  3RBX A;  1KIL A;  1X0T A;  3H1K J;  3HD7 B;  2G3A A;  2Y0D A;  3WUV A;  1FDI A;  1E5W A;  1SQB K;  5DIK A;  5B5E H;  2FXM A;  5B66 E;  1KYO I;  1M90 Q;  4PD4 D;  4PJ0 E;  1Y47 A;  1Q81 Q;  2H88 C;  3I56 P;  2OYI C;  1L4A C;  4HYT B;  2O01 J;  1NAY A;  1NAF A;  3SFD C;  1IO4 A;  4GOE A;  3H1I J;  2Y0C A;  2KUB A;  1J1E B;  4DCK A;  5AVQ B;  1FZC A;  1PGQ A;  3LIE A;  1KV4 A;  1MUU A;  3SWF A;  3FWN A;  1ZN5 A;  2AEF A;  2V7Q H;  1BGY J;  1SFC C;  3O6Q A;  1SQB J;  1X22 A;  3O8Z A;  3D6Y A;  3AA1 A;  1KB9 E;  2CPB A;  3A0B E;  2M3E A;  1KIL E;  4PV1 C;  1SQX D;  2P2U A;  1YHQ P;  2Q3I A;  2GM4 A;  2E76 B;  2XV5 A;  3JSV C;  3BAT A;  3N7N A;  1KIL C;  3NXS A;  5KKZ B;  1N7S D;  1K73 Q;  4YXW H;  1YI2 P;  4IFF A;  1M57 D;  5BVZ A;  5KLV K;  1GU9 A;  3CX5 E;  1PP9 E;  1M1K Q;  1FZA A;  1YTZ I;  4OVN F;  4UB8 H;  2C9L Y;  4NPE A;  1EDI A;  2IBZ I;  4CPG A;  4LC1 A;  2D2C C;  3TNU A;  3IF4 A;  2ZT9 C;  3CWB E;  1GDT A;  1FZC C;  2WPQ A;  4EYY Q;  2K3R A;  3FGA D;  3I5C A;  3T97 A;  5GTI E;  1SQQ D;  3H1J D;  1M7L A;  2WPV B;  4WY4 A;  3L72 E;  2M5A B;  1S2E A;  5KLV J;  5CHX A;  3AEA C;  3USS A;  2QJY B;  1SQQ G;  3L73 J;  1EQ7 A;  3H1J G;  4WBA A;  1M8O B;  1P8C A;  1HJ0 A;  2YXR B;  1KMI Z;  3E1I A;  3VMA A;  2B88 A;  4JQ0 D;  3W68 A;  2OUW A;  2OGU A;  3L37 A;  2BCC J;  3VP9 A;  3M9B A;  1ZP0 C;  2N1T C;  1NTZ D;  2OTK E;  1HH0 A;  1N73 A;  1GK4 A;  2JN8 A;  3BRT B;  4BWN A;  1P84 I;  4W80 A;  4H13 D;  4RES B;  2FYZ A;  1K8A Q;  1W5C E;  1NTZ G;  3H1L J;  1J1D C;  3A7O A;  2A45 G;  2KYV A;  3U1A A;  5AW1 B;  2H8P D;  1EDL A;  2M3B A;  3KDP B;  1JNM A;  1AFO A;  1BSH A;  4PD4 I;  4L74 A;  1HGZ A;  1T2K D;  4WY4 C;  3RL0 D;  3H1H D;  4W7Z A;  1W2B O;  2ITA A;  2CPS A;  2QSI A;  2Q9I A;  1JOC A;  2FKW B;  3R2P A;  1LGH B;  2JEE A;  3VMX A;  4M3L A;  2JJL A;  3AAA A;  1JMM A;  2HR3 A;  4WWI A;  3WU2 E;  1VPC A;  2QJP C;  3K5B A;  1SQX E;  2HPC B;  1FZG A;  5GTH H;  1Z56 A;  1N73 C;  4Z1M H;  2ZFC A;  1N8R Q;  1FJP A;  3L71 J;  1DEB A;  2J5U A;  3I55 P;  4U3F D;  3V2P A;  3U1C A;  3C1L A;  2JDI H;  1RF1 B;  2O3J A;  2Q1K A;  1QGK B;  2QG4 A;  2NPS A;  1URQ A;  4U3F G;  4C7N B;  1Q82 Q;  3AAE A;  1HVV A;  1KQS O;  1RE3 A;  4N3Y B;  1P84 H;  1FZF A;  1BE3 D;  1IC2 A;  1YIT P;  1GW3 A;  2A06 D;  2HLO A;  2FBW C;  5CJ4 A;  3SWY A;  1WT6 A;  1DEE G;  3G6E P;  2AEM A;  1BE3 G;  3B5N A;  2E74 C;  4DT0 A;  3UIA A;  2HFE D;  2KB7 P;  3CL3 D;  1NWQ A;  2W8Z A;  1BCC J;  2WSE H;  2K9Y A;  2AXT H;  2KZI A;  1Q7Y Q;  4EIJ A;  1N86 A;  2Y0E A;  4HJG H;  3TGU J;  4IFM A;  4TT3 H;  2WSS H;  2HOD A;  3OAK A;  1JUN A;  1M1J A;  1GL2 D;  2GUV A;  2B87 A;  4H0L B;  1G1I A;  1OVU A;  4LLH A;  3LW5 J;  2E43 A;  1L0L D;  4ZNC A;  3NMD A;  4L76 A;  2A45 I;  2NPS C;  1URQ C;  5KAF E;  1PZQ A;  1IFD A;  1VQ7 P;  3N4X A;  1RE3 C;  5AW5 B;  2MJZ A;  4Y99 C;  1VL2 A;  1L0L G;  1NTM D;  1GU4 A;  3SSU A;  4I2L C;  1K05 A;  2Q6Q A;  5CCH A;  3AE1 C;  1ZW0 A;  3B5N C;  5AW4 B;  1LTJ B;  3H1K E;  1NTM G;  1ZRT E;  3V6I A;  3M91 A;  2QIW A;  3H1H E;  2K9J A;  2ZXX A;  2Z5H A;  1PGP A;  1T8Z A;  3PP5 A;  2G8Y A;  5APW A;  1LWU A;  5H2F E;  1M56 D;  2FFD B;  1SFC D;  1RE4 A;  3CPW O;  5AVW B;  1AVO A;  1GU5 A;  3HE4 A;  2Q3E A;  5AVT B;  3CCJ P;  4WB4 A;  5KLI B;  2WWW A;  4PV1 D;  5CBO A;  1BGY E;  3AE8 C;  3JCU H;  1L2P A;  1VQ5 P;  2E75 B;  1H8A A;  2NRG A;  2RMZ A;  1KIL D;  5KJ7 A;  3L74 E;  4NPD A;  4D6T E;  1NTK E;  1NO4 A;  4I6M C;  3AEG C;  1YJ9 P;  3BRV B;  1CZQ A;  1SQQ K;  1QVG O;  3IFM A;  5CCH C;  1AJY A;  1HBW A;  5APX A;  1N7L A;  2A45 H;  2FXP A;  2A06 E;  5AW7 B;  2YIU B;  1EDK A;  3AEB C;  5B5E E;  2XKM A;  3HE5 A;  1J2J B;  2YO3 A;  2ZT9 D;  1WRG A;  1LNQ A;  3LK3 A;  3S9O A;  2PFX A;  2R32 A;  2KXP B;  3CWB D;  1NTZ K;  2B89 A;  1L4A A;  1RE4 C;  1JMB A;  3CCV P;  1SQQ J;  3H1J J;  2O01 H;  3S4R A;  2ZVO B;  2RKL A;  1SS1 A;  3L72 D;  1G1J A;  3CWB G;  4AQR D;  1PPJ E;  2O1J A;  4GOF A;  1FOS E;  4HKZ H;  5EFW B;  3L72 G;  5KJ7 C;  3V4W A;  2KNC A;  4EI2 A;  3BCC E;  1NTZ J;  3EWK A;  5TIS E;  1VQO P;  1KFN A;  1JY2 P;  1JB0 J;  3L75 D;  1G2C A;  1NTM E;  3L36 A;  1W2E A;  2KS1 A;  1VQP P;  3AEC C;  4I7Z C;  3IAO A;  1USE A;  2KSJ A;  2W27 A;  1FZB A;  1USD A;  3D7I A;  2BAS A;  4UB8 E;  2LKM A;  3BAS A;  1VDF A;  1SP4 A;  1XTG B;  4WY4 D;  2O1K A;  5BU5 A;  3HUS B;  1S5L H;  3AE2 C;  4EDF A;  1N2D C;  3FXE A;  2Y9Z A;  4LGD E;  1HWT C;  4AKR A;  1A02 J;  3MHV A;  1N7S B;  3RK3 E;  2OYH B;  3C9I A;  1IK7 A;  1DD3 A;  2I8D A;  1NKN A;  2KZJ A;  2W83 C;  1SLQ A;  2FY8 A;  3QWO C;  3RK3 C;  1QLE D;  1LT1 A;  4ZKP A;  4BXL A;  1AV1 A;  1VQ4 P;  4H44 C;  4YTP C;  1JY3 O;  1MFZ A;  2RH0 A;  1VQ9 P;  5DJT B;  2KK7 A;  1FBM A;  3OW2 O;  1KB9 I;  2P67 A;  1E79 H;  1EXJ A;  4U3F J;  2IZ1 A;  1QEX A;  1IFN A;  1ZR2 A;  2N1T A;  2OYO A;  1SQX G;  1QVF O;  3Q1M A;  2QJK C;  1OX3 A;  1KOR A;  4N78 E;  5C39 A;  4OGQ C;  4HH2 A;  1BE3 J;  1MV8 A;  3CX5 I;  3Q3D A;  1JCC A;  3MIW A;  2E74 D;  1Q90 D;  4ZMD A;  2HYN A;  2FYU D;  3KPE A;  3AEE C;  1OW7 A;  2B9B A;  4H13 B;  1KYO H;  3M9Q A;  1L0L K;  2E42 A;  4BRY A;  2C9N Y;  5AW2 B;  2FYU G;  2GUS A;  3MUD A;  4GT1 A;  3GLM A;  4AUW A;  1S4X A;  1MKM A;  3VMY A;  2FYN B;  4N6J A;  1LT9 A;  5E79 H;  1KC8 Q;  2C0W A;  1NHL A;  1Q86 Q;  2AXC A;  1EDJ A;  1NH4 A;  3WUT A;  1VQM P;  5GTH E;  3CXH D;  1CSB A;  4EOT A;  1KQG B;  3RL0 B;  2R3C A;  2NPS D;  1URQ D;  2RN0 A;  2O01 N;  3L75 E;  2WTY A;  1M1J B;  1L0N D;  3L35 A;  1OIP A;  3RK2 C;  3CC7 P;  1GZL A;  5AFU K;  3L70 E;  3D71 A;  4C46 A;  1NU1 E;  3TF5 A;  3CCU P;  2WMM A;  3GHG B;  1L0N G;  3HD7 A;  3Q5S A;  2H7H A;  1H0T B;  3B5N D;  1VQL P;  2P7J A;  2ZVN B;  2QA4 P;  3AE6 C;  2OTL P;  3KHU A;  2W6J H;  3H1K D;  1ZRT D;  2GMY A;  1KQF B;  5ADX K;  2IDB A;  3GF7 A;  3MUD C;  3HTK B;  1LT9 C;  2AXT E;  3H1K G;  4KT0 J;  4R4L A;  1KNC A;  2K1A A;  1Y8A A;  3H1H G;  4C7R A;  1HF9 A;  2P1J A;  5BU8 B;  2BEQ D;  4DOJ A;  1ZV8 A;  2PAJ A;  3M0D A;  3AED C;  2QE7 H;  5APT A;  2Z4E A;  3PH0 A;  3ZDM A;  1S9K E;  3PRJ A;  1BGY D;  1IJD B;  1LTI C;  3M9H A;  1MZ9 A;  3M0A A;  1ZR4 A;  4ASV A;  3WMM 0;  4IL6 H;  1SQB D;  2H89 C;  1ZOY C;  1DX7 A;  2OQQ A;  2OAR A;  3L74 D;  1LTB C;  5AW6 B;  5CCH D;  1EZV E;  1BGY G;  3LW5 H;  3HD7 C;  4D6T D;  3AA0 A;  1NTK D;  1UII A;  1LP1 B;  2YKP A;  1GL2 B;  3L74 G;  3KZI H;  3HUS C;  4XE5 B;  4D6T G;  1NTK G;  1JY2 N;  1PP9 J;  5CBN A;  2WPS A;  2FYU E;  1KTM A;  3CC4 P;  1SQV E;  5L8R J;  5CMZ A;  2K37 A;  1J1E C;  2A06 G;  4JF7 A;  3A0H H;  1VF5 D;  4O9B A;  1YTZ T;  3CCS P;  2UWJ E;  4PD4 H;  3CWB J;  1EC5 A;  3F5H A;  3CCR P;  2K88 A;  1QL1 A;  2AF7 A;  3M0D C;  2M5A A;  3G4S P;  1IZN B;  2YKQ A;  3A2A A;  1DIP A;  3L72 J;  2WT7 B;  3H32 A;  3KYQ A;  1SQP E;  1FOS F;  3CXH E;  5KJ7 D;  1QX8 A;  2OYI B;  1PPJ D;  3JCU E;  2M0B A;  2AEJ A;  2E76 C;  2WZ7 A;  3RBZ A;  4GOD A;  2NZ2 A;  3D6Z A;  3Q5R A;  1LJ2 A;  2KLU A;  3L73 D;  1CW5 A;  1L0N E;  4XFJ A;  1CI6 B;  5KKZ C;  3WU2 H;  1PPJ G;  1BSN A;  3Q2Y A;  3BCC D;  3H25 A;  4UB6 E;  1SFC B;  2BCC D;  2IFM A;  3CCL P;  1JTH B;  1PL5 A;  3BCC G;  1OW8 A;  4A7P A;  4PV1 B;  2KI7 B;  2BCC G;  2KZ7 A;  4IOI H;  1L4A D;  3H1L D;  4H13 C;  1KIL B;  3NTN A;  2WQY C;  2QEU A;  3TK1 A;  5APY A;  1SQX K;  5DJU B;  1LW1 A;  3M06 A;  2C0X A;  3SFE C;  2POH A;  4U7J A;  3H1L G;  5M1B A;  2N9B A;  2QJY C;  3RK3 D;  3FWL A;  2CK3 H;  5AVU B;  1YQ3 C;  3H1I E;  1JCD A;  1Q2N A;  3EFG A;  1ZLL A;  4H44 D;  4WVZ A;  1T2K C;  1JM0 A;  3GF3 A;  2IYP A;  5TJH A;  3RL0 C;  5AW9 B;  1OMI A;  2W6B A;  2ZT9 B;  3P7K A;  1VKE A;  1FZC B;  1OW6 A;  2IFN A;  2N9Y B;  1SQB E;  3MTU E;  1SQX J;  1X9V A;  3HRN A;  3O6Q B;  2R44 A;  1NYH A;  4KJM A;  4RO0 A;  3VOP A;  1QL2 A;  3P8M C;  4DZO A;  3LK2 A;  2YMY A;  5AW0 B;  1NJI Q;  2E5Y A;  3W67 A;  3AE9 C;  4N78 D;  2N1T B;  1EXI A;  2D2C D;  3EQ2 A;  3CCM P;  1GK6 A;  1S5L E;  5K5G B;  2WSC H;  4KHX A;  4OWF A;  1J1D B;  3G71 P;  1ZXG A;  1UIX A;  1YIJ P;  1YJN P;  1U7J A;  1NOH A;  3GMA A;  1PV3 A;  4L75 A;  3TNU B;  1ZME C;  5CCG A;  1FAV A;  2V4H A;  1ME5 A;  3T97 B;  1BCC D;  1IFP A;  3IN6 A;  4WY4 B;  5KLV E;  2YNY A;  2N1T D;  3L73 E;  1LTA C;  3TGU D;  1K9M Q;  1RF1 C;  1BCC G;  1R5S A;  1GW4 A;  3RK2 D;  3VMZ A;  3PJS K;  1YBK A;  5KAI H;  2BCC E;  2IJC A;  2WPR A;  3TGU G;  2Z5I A;  2QJP B;  1U7M A;  1VQN P;  2YKO A;  2QM7 A;  3R4Y A;  4GKG A;  3L70 D;  2ZJS E;  1NU1 D;  2YXQ B;  1N73 B;  3L75 G;  1S5L X;  4JBZ A;  5CJ0 A;  2OTJ P;  1P84 D;  3P32 A;  3H1L E;  2WSC J;  1LTJ A;  3L70 G;  1IFM A;  1NU1 G;  3BEY A;  3CCE P;  1VQ6 P;  2W90 A;  1KYO E;  1OVV A;  3H1H J;  5AVV B;  5CCG C;  2FFD A;  1YJW P;  1NTK K;  2CWQ A;  5E79 E;  3A3Y B;  4H0L C;  2JWA A;  1IFJ A;  2QM8 A;  1OWA A;  1FJK A;  2E74 B;  3P8C D;  1OXZ A;  3V4Q A;  3AEF C;  2IX7 C;  2Y9Y A;  3GG2 A;  1S9K D;  4ZKU A;  3AE3 C;  3FXD A;  4ASW A;  3MD0 A;  2FXO A;  3HD7 D;  3L71 E;  1RF0 A;  3II6 A;  1IFI A;  3L74 J;  2R5B A;  4D6T J;  2I1J A;  1EZV D;  1NTK J;  1JY3 P;  1YQ4 C;  3A5T A;  1HTL C;  1LTJ C;  3E7K A;  1HUC A;  2WVR A;  4HB1 A;  5TIS H;  2XZR A;  1R5L A;  3PHL A;  3U59 A;  1EZV G;  2WSF H;  3BVH A; 
#chains in the Genus database with same CATH homology
 3AA0 A;  3LVY A;  1IZN A;  3D7I A;  2JN8 A;  3AA6 A;  1VKE A;  5DIK A;  3LK3 A;  2KZ7 A;  2PRR A;  3AAE A;  2Q0T A;  1ME5 A;  2PFX A;  1P8C A;  1GU9 A;  4G9Q A;  2ES9 A;  2IJC A;  5DIP A;  1KNC A;  3AAA A;  3LK4 1;  5AFU K;  2KXP A;  3BEY A;  2CWQ A;  3C1L A;  2OUW A;  2QEU A;  2GMY A;  3AA7 A;  1LW1 A;  2AF7 A;  2O4D A;  5ADX K;  2OYO A;  4AKR A;  3LK2 A;  3AA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...