2OYOA

Crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
DRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELVAVVVSGVNRCLYCAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDHQIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of Uncharacterized peroxidase-related protein (YP_604910.1) from Deinococcus geothermalis DSM 11300 at 1.51 A resolution
rcsb
source organism Deinococcus geothermalis
molecule tags Oxidoreductase
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2oyoA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2oyoA02
2PFXA 2IJCA 3BEYA 1VKEA 2OUWA 2OYOA 2AF7A 3D7IA 5DIKA 4G9QA 1LW1A 1GU9A 3C1LA 2PRRA 1KNCA 3LVYA 1P8CA 2Q0TA 1ME5A 2CWQA 2GMYA 2O4DA 2QEUA 5DIPA
chains in the Genus database with same CATH superfamily
1U7JA 1LGHB 3KYQA 1N86A 2M0BA 2IFMA 3CMAP 2QIWA 1IO4A 4CPGA 5APWA 2K9YA 2RN0A 5CJ4A 1NOHA 3S9OA 3CLQA 4AKRA 3BATA 4NPEA 3CCJP 2P67A 4N3YB 1LTTC 3TNUA 2QJPC 1SQBD 4GDOA 5CCGC 1DD3A 1L4AB 1DX7A 1K04A 3L75E 3LW5H 1PGOA 5KTBA 2YO3A 1FDOA 2WSCJ 2KNCA 4YXDC 5E79H 1S5LX 3L35A 3I56P 1LNQA 4UB6E 1OWAA 2XNDH 3W67A 1VF5D 2OYHB 2YMYA 1WT6A 1NWQA 2HG5D 1R8EA 2WSEJ 4EOTA 1AVOA 4Y28J 1HWTC 2DW3A 1LTJA 1ZOYC 1T2KC 1S1CX 1BCCE 2FYZA 1K73Q 3A7OA 3L72G 3VN0A 3L74E 4C7RA 1PL5A 2CPBA 4GOFA 3D70A 3NTNA 2E76C 5CBOA 4XE5B 1A02J 1RE3A 1AQ5A 2IZ0A 1SFCB 3L36A 1PFIA 1KYOH 4I7ZB 5KLIB 1BGYG 3IF4A 3MUDC 5KAFH 3VMAA 1VPCA 1JB0J 2B87A 1N73A 2ZXEB 5DIKA 1BE3J 2A06E 1JCCA 1KMIZ 2O1KA 2OGUA 2YKOA 2ZT9B 2FXPA 2HODB 2IYOA 4D6TJ 3KZIH 4TLFA 3AE3C 1PGJA 1KTMA 2QEXP 3H1KE 4IFMA 1K05A 5AW1B 3GLMA 2HLOA 3WUTA 1Q2NA 1GL2A 2KSJA 2WMMA 3PTZA 4JF7A 4RKUJ 1FS0E 4H0LB 5CJ0A 3V4WA 3FX0A 5AVTB 2YNYA 2ZFCA 5TISH 4YTPC 1P84E 4DT0A 1KILA 1L0LK 3VMYA 4JYBA 1IFMA 1LWUB 4H13D 1SQXD 2LXCB 3H1JE 2Q5UA 3GW6A 2R3CA 5B5EE 4U3FD 2JJLA 1QVGO 3RK2B 2PRRA 1P8CA 2NPSA 5KLVD 1SQVJ 2XU6A 2N1TC 1FZFA 3H1HE 2ITAA 4C46A 1GW4A 1D7MA 3FWNA 1OZHA 2BCCD 1BCCJ 5GTHE 1IZNB 2E75C 1XTCC 5KJ7A 3U1AA 1LJ2A 2IBZD 3L74J 1BE3G 1NTMD 5AW7B 2FYNC 1CI6B 1URQA 3Q5RA 2QJYB 3H6PA 2JKVA 2C9NY 3LK41 2G3AA 3CX5D 4WB4A 4D6TG 1JO5A 2FYUE 5AW5B 1GZLA 1EDIA 2K3RA 4BWNA 3M06A 4Y99C 1LTGC 1DIPA 1VQ4P 4BRYB 2OQQA 5APVA 2FFDC 1QVFO 3B5NC 1NTKJ 2D2CD 2PP6A 4IL6H 3G71P 1FDIA 1MUUA 1FJPA 5AVWB 1GK6A 1GW3A 1WRGA 2Z5HA 4DCKA 3RL0B 2QE7H 3EWKA 1ZMEC 1SQVK 1HF9A 1KILE 1YJNP 3A0BH 3H1KJ 1LTAC 3E1IA 3H1ID 1H89A 2A45G 5B66E 2WITA 3USSA 3BCCG 2YO2A 3H1LE 2P1JA 2V7QJ 5AVYB 5DJUB 5APUA 1N7SD 2WSFJ 2QRXA 2ZAEB 4EDFA 1SQVG 3L71D 3AA7A 2IDBA 3W68A 1L0ND 1LP1A 1W2EA 3L73E 2P58A 3A0HE 1SQQJ 2LR2A 4PD4E 1FZCC 2IJCA 2QJPB 1H0TA 1OW8A 1T8ZA 2C9LY 3H25A 4XFJA 1NTKK 1OW7A 2H7HA 3CL3D 1NHLA 2M5AB 1RQVA 3L72E 2R5DA 2QM8A 1VQLP 1RF0C 3P8MC 3MD0A 3C9IA 3MIWA 5KAIE 3L70J 1SVFA 2SPZA 1NTKG 1M1JA 2JWAA 3AE4C 1ME5A 3P32A 5KKZC 3L75D 2MJZA 2E42A 1S72P 3WMM0 1AA0A 3CMEP 1SQQK 1KZUB 4WY4D 2O1JA 1L4AA 1VQ9P 1YI2P 3B8EB 2E76B 3L4FA 1EDKA 2AXCA 5CCHC 5ADXK 5DJTB 3HUSB 1Y9BA 3M9BA 4GODA 4L76A 1M90Q 3TSIA 4H44D 1NVOA 1T6AA 1KD1Q 2B88A 2GUVA 1MZ9A 3F89A 1SQQG 2OYHA 2Y9ZA 5AW2B 2XNXA 1RE4A 1S2EA 2NZ2A 3QH9A 1PV3A 1FZAA 1Q86Q 1JY3N 1PZQA 3U1CA 1VF5C 3BRVB 1JM0A 5AW6B 1ZN5A 4OH8B 3VP9A 3IN6A 2ZVOB 1VQMP 5AVVB 3AECC 1NAFA 3L70G 1PP9J 5K5GB 2H89C 5L8RJ 2A06D 5APTA 1FZBA 3G4SP 3M91A 3RBZA 1SFCA 2GM4A 3L72J 1JOCA 2ZJSE 1BE3E 5AW8B 1VQ5P 3AEAC 4R4LA 2FXMA 2Q6QA 3TGUJ 3SWFA 1IFIA 1T3UA 4D6TE 4Z1MH 1KYOE 4DJGA 3ABVC 2Z4EA 1BGYJ 3AE1C 3ZDMA 2HODA 3KPEA 2JP3A 1KB9E 3V2QA 2QEUA 2N1TB 3UIAA 2FKWB 2KLVA 2M3BA 3CCMP 2BASA 2C0XA 3CX5H 1P84D 3M9HA 1YJ9P 3PJSK 2E75B 1MFTA 1UIXA 3CCQP 3CI9A 3CC2P 1AJYA 2KZIA 2K9JB 2FYNB 3H1JD 1YBKA 3AEEC 1MFZA 4WWIA 1W2BO 1KQLA 3E7KA 1LTSC 3AE5C 4ZKUA 2ZYDA 3CCVP 1M8OB 4OGQD 4Y99B 2ZYAA 1LWUA 3H1HD 3LIEA 3LW5J 1S5LH 1M7LA 2FFDB 1SQVE 3B5NB 1J1EC 5AVXB 1JTHB 2OYIC 1SQXK 2KOGA 3D6YA 1PP9G 5GTIE 3WUUA 4H13C 2Q1KA 1VQPP 2KS1B 1KNCA 3BASA 2XDJA 2O4DA 5H2FE 1HJBA 1K9MQ 2CK3H 3AE7C 5AW9B 5KLVK 3GMAA 2FYUD 1OVVA 4PV1D 1T3JA 4JBZA 3CCRP 1IZNA 5APYA 3TGUG 4YXWH 2KSEA 2AEMA 1EZVI 3HUSC 1GL2D 1SQXG 1P84I 1VDFA 2JWDA 2P7JA 1L0LJ 3JCUH 1ZXGA 1NO4A 3D71A 1CI6A 3WU2E 3KHUA 1NTKE 1ZW0A 3TDKA 1PPJE 3SWKA 3CXHE 4W80A 1GU9A 5KLVG 1TU3F 3L71J 3A5TA 3M0DC 3R4YA 3RK3D 4BRYA 1FZCB 1KILD 1FBMA 2IPPA 3OAKA 1K8AQ 1JMBA 3FXDA 3AE8C 2IBZG 2P2UA 2J59M 3AEBC 5C39A 3H1LD 3B71A 3BRTB 2D2CC 1KORA 4HJGH 2QM7A 4IL6E 4M3LA 2NPSD 2GMYA 1NU1J 4HB1A 3PH0A 1SS1A 2WPVB 3A3YB 2FY8A 1LT9C 3L73D 2I1JA 4I6MC 3AA6A 1NYHA 1EZVE 3GHGA 3CCEP 1IK9A 5KJ7D 1NTZJ 3V2NA 4UB6H 1FJKA 5AVRB 3VYIA 5KKZB 1SQQE 3R2PA 2R5BA 2QJKC 4RESB 1Q82Q 4TT3H 3AEFC 1URQD 2J5UA 3BCCJ 1YQ3C 1N7SC 2AXTE 3AEGC 4L74A 3GF7A 3HE4B 5CCGA 4NPDA 3H1IG 2YXQB 1GDTA 2M5AA 1L0LG 3HD7C 1YJWP 3OW2O 3L70E 4ZKPA 5AVZB 1E79H 2P10A 1NU1K 4LGDE 1OIPA 3L71G 1SQPJ 2E74D 2OTJP 2K1AA 2YKPA 1BSHA 1RF1C 4C7NB 1NTZK 2GA1A 2OARA 3AA0A 1VF5B 4PD4I 1OXZA 1FC2C 3Q3DA 1CW5A 2K37A 3LIDA 3OJAB 2WVRA 2JR8A 5CMZA 3MP7B 1NU1G 4UB8H 1KN7A 2W6BA 1S9KE 1KC8Q 2I1KA 2KIKA 3KQGA 3CWBJ 2AEFA 3CPWO 2Q0TA 2M3EA 3IFMA 4PJ0E 1SLQA 1NTZG 4LLHA 5AVSB 4WY4C 3HE5B 4IOIH 1S4XA 3MUDA 3A2AA 3II6A 1E5WA 2R44A 1QGKB 1YYCA 1G2CB 1JNMA 1SQPK 4N78D 1P84H 2R3SA 4NPFX 4H44C 5BU5A 2ZYGA 1NGMB 1NH4A 1DH3A 1YTZT 5B5EH 2WZ7A 1VQKP 1PP9E 1BDCA 2OUWA 1BE3D 2FBWC 1SQBJ 1G1JA 2YXRB 2IFNA 3QWOC 3VOPA 1SQPG 3RGUA 1VL2A 2KI7B 1Q7YQ 2FXOA 4D6TD 3V2PA 3EQ2A 1L4AD 3HTKB 5GTHH 3TGUE 2E75D 1Y8AA 3SFEC 1SQXE 1KB9D 4WVZA 3AE9C 2W6AA 1BGYE 3PP5A 3C8VA 2XV5A 2GUSA 1YQ4C 1U7MA 5AFUK 1J1EB 2YIUC 2OYIB 4XA4A 3CWBG 3PLNA 1FE6A 4H13B 4ASWA 1NKNA 2N1TA 4ASVA 1WMKA 2W27A 2HYNA 4IFDK 3G9RA 2WPQA 1FOSF 1QX8A 1N7LA 2IBZE 3AA1A 2IZ1A 4N6JA 1IC2A 3SSUA 1USDA 4K35A 1A02F 4R4MA 1SQBK 4KJMA 2K9JA 1IFJA 2Z5IA 1LTJC 1SQVD 3Q5SA 1KQFB 3P8CE 2WQYC 3PHLA 1MV8A 1BCCD 1KYOI 5E79E 1SFCD 2IX7C 3MHVA 3FGAD 4G9QA 3AE6C 3H32B 2FFDA 1NKZB 3L74D 2O01H 2Q3IA 3B5NA 1KB9I 1SQBG 1Q81Q 2W6JH 1RE3C 1JTHA 4OGQC 2Q3EA 3AAAA 5AW4B 1VQNP 3D7IA 2KS1A 1PGPA 2D2CB 1Y47A 2ZT9D 4HKZH 4ZNCA 1HH0A 1N73C 3H1IE 3MGNA 1AQTA 1UIIA 2KXPB 1L0LE 1NTKD 2KK7A 1HBWA 1PPJD 1HGZA 1LT9B 2W83C 2AF7A 2A45I 3RBXA 4RO0A 2HPCB 2YMKA 2J58A 2B89A 4PV1C 3L71E 3T97B 2PGDA 3VTPC 3IAOA 2QJKB 4H0LD 2WWWA 2BEQD 2RMZA 1GL2C 3H1KD 1AVYA 3KXDA 4JPZB 2L5GB 1SQXJ 3B4SA 5KAFE 3O6QB 1FZCA 1N7SB 2N9BA 4U3FJ 1JY2N 1ZV8A 4MN4C 1YITP 2VRSA 3N4XA 1NU1E 3RK3C 5KLVJ 3S4RA 1N2DC 2R32A 1KILC 2N9YB 1KFMA 1EZVD 3HD7B 3RK2D 3GF3A 1KQSO 2WSCH 3CC4P 1GU5A 3KZIE 1RF0A 1EXIA 1SQQD 4W7YA 2BCCJ 5CCHD 1VQ6P 1NTZE 1OVRA 2IYPA 1MKMA 1N8RQ 1NTMJ 1VKEA 2OTKE 4L75A 2NPSC 4OVNF 1RF1B 1IFDA 1EDJA 3BCCE 4OWFA 1LW1A 3E1RA 5AVUB 3CXHI 2WSEH 1PIXA 5CBNA 3JC22 4B86A 1VQOP 1ZR4A 5KJ7C 3H1LG 5TISE 3MZWB 1DD4A 3L70D 3FXEA 3EFGA 2HFED 1HTLC 1JY3P 1URQC 3HE4A 4A7PA 3NXSA 1Q90D 2QVAA 2HR3A 2M8RA 5CCHA 2YKQA 2KB7P 3FWLA 1KV4A 1ZRTE 3L73G 4WY4B 1SQPE 1J2JB 1USEA 4GKGA 3RL0D 1RY3A 3JSVC 3H1IJ 1J1DC 3D6ZA 1W5CE 1Z56A 3SFDC 3CD6P 2WT7B 1PGQA 2H88C 4U3FG 3Q2YA 3BEYA 4C7NA 1RQUA 1EXJA 1OVUA 1NTMK 4H44B 4HH2A 1S9KD 2Q7CA 3V4QA 1X8YA 2E74C 4HYTB 1DEBA 2E5YA 5M1BA 3P7KA 1L0NJ 5DIPA 3CWBE 3V5BA 5TJHA 2BCCG 4BXLA 1KB9H 1LTBC 1JY2P 3G3ZA 1HUCA 1NTMG 2KUBA 4U7JA 2W90A 1AFOA 3AAEA 5CCGD 4UB8E 1ZLLA 3HE5A 2JO1A 1OW6A 4KHXA 2OTLP 2PAJA 3TNUB 1BSNA 3CCSP 4PD4D 1LT1A 2A45H 1ZR2A 1IJDB 1PP9D 1G2CA 3A0BE 3S1KA 2Y0CA 4EI2A 2YIUB 2KNCB 2Y9YA 3L75J 3V6IA 1LTIC 3L72D 1FAVA 4GIFA 3O8ZA 3I5CA 1SQBE 3AEDC 4GT1A 3M9QA 3TGUD 1L0NK 5GTIH 1BDDA 1T2KD 4W7ZA 1M1JC 1KFNA 1HVVA 1BGYD 5AVQB 3F5HA 5H2FH 1M57D 3TF5A 3ITKA 1LTJB 4I2LC 3HTKA 3M0AA 4K3AA 2E76D 2JDIH 1EDLA 2BEZF 4AYCA 3VP8A 1L0NG 1L4AC 3WU2H 1S3JA 2ZVNB 1OFCX 3RL0g 1KQGB 4JQ0D 2OYIA 4OGQB 3CXHH 3BVHA 5AW3B 2OYOA 4IL6X 2B87B 1N73B 1FZGA 2KLUA 1U57A 1VQ7P 1QLED 2OYHC 3P8CD 1NAYA 3HRNA 1RE4C 1JUNA 2RH0A 4LC1A 2I8DA 5APSA 1QL2A 4YPCA 2QA4P 3HUSA 1YIJP 3IR9A 2WPRA 1GTWA 4PV1B 2V7QH 3C1LA 4ZMDA 3L75G 3N7NA 2C0WA 2ZXXA 2WSFH 3RK3E 2E43A 1GL2B 1HGVA 3L37A 1ZP0C 3NFQA 1RHZB 3M0DA 1M1KQ 3H32A 1EC5A 1FU1A 2B9BA 2H43A 1H8AA 2WSSH 2XZRA 4DZOA 1L0LD 1SFCC 3GHGB 4I7ZC 3RK3B 5KLIC 1JCDA 1OX3A 2O3JA 1KILB 2IBZI 2AXTH 2N1TD 2G8YA 2W8ZA 2KXPA 2KZJA 1GMJA 1L2PA 3CX5I 1RH5B 1LT9A 1BCCG 3HD7D 2CPSA 2ZT9C 1KYOD 1X9VA 1M56D 3H1JJ 2WTYA 2NPSB 2NRGA 2UWJE 1R5LA 2HPCA 3L74G 2AEJA 2Y0EA 4I1LA 4O9BA 3T97A 4EIJA 4DOJA 1YTZI 4U3FE 3PRJA 1NU1D 3K5BA 4L73A 2JEEA 1FZEA 4WBAA 3H1HJ 3WUVA 4GOEA 3Q1MA 3O6QA 1N7SA 5KLVE 2Q9IA 4AUWA 1IK7A 1IFPA 4H0LC 2KZ7A 3EFFK 2LXBA 1HJ0A 1URQB 1NTZD 2LKMA 3CC7P 3SWYA 2QG4A 1PPJG 3B5ND 1GU4A 2BCCE 2A06G 1G1IA 5EFWB 3AE2C 1X22A 3GG2A 3HD7A 3BCCD 1LWUC 3CCLP 2Y0DA 1NTME 2FYUJ 1IFNA 1FDMA 4PJ0H 2XKMA 1R5SA 1J1DB 3TK1A 3VMZA 3H1KG 3RK2C 3CX5E 3KDPB 1RF1A 2PFXA 5BU8B 5B66H 3VMXA 1AV1A 1X0TA 1JY3O 2K88A 5CHXA 1SP4A 2E74B 3G6EP 2ES9A 4JYCA 3CCUP 2RKLA 1QEXA 1ZRTD 2L91A 1JMMA 5APQA 4IFFA 1CZQA 1EZVG 1SQPD 1OMIA 3MTUE 5BVZA 1JEKA 2MKVA 1H88A 3A0HH 2QJYC 1S5LE 4PD4H 2KYVA 3H1JG 1X79B 2V4HA 1EQ7A 2JN8A 1CSBA 3H1LJ 1DEEG 2O01N 2E5TA 4KT0J 1LP1B 4WY4A 1NJIQ 3U59A 1FOSE 2O01J 3CXHD 5AW0B 1YHQP 4RJTA 2FYUK 1H0TB 3TYYA 4N78E 3H1HG 3CWBD 3L73J 1VQ8P 2KP8A 2WT7A 1GD2E 4AQRD 3LVYA 4EYYQ 1XTGB 3RL0C 2POHA 5KAIH 2WPSA 1L0NE 1JY2O 5APXA 3NMDA 2H8PD 4QMAA 3JCUE 3LK2A 3LK3A 1GK4A 3OA7A 3Q5PA 1QL1A 2QSIA 2FYUG 2CWQA 3I55P 3V2RA 3GHGC 1M1JB
chains in the Genus database with same CATH topology
2PFXA 5AFUK 2IJCA 3BEYA 3AAAA 3AA1A 1VKEA 2OUWA 2OYOA 2AF7A 5ADXK 1IZNA 3D7IA 2KZ7A 3LK41 2ES9A 3LK2A 3LK3A 1LW1A 3AA6A 4G9QA 5DIKA 3AA7A 1GU9A 3C1LA 2PRRA 1KNCA 2KXPA 2JN8A 3LVYA 3AAEA 1P8CA 2Q0TA 3AA0A 1ME5A 2CWQA 2GMYA 2O4DA 2QEUA 5DIPA 4AKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFX A;  2IJC A;  3BEY A;  1VKE A;  2OUW A;  2OYO A;  2AF7 A;  3D7I A;  5DIK A;  4G9Q A;  1LW1 A;  1GU9 A;  3C1L A;  2PRR A;  1KNC A;  3LVY A;  1P8C A;  2Q0T A;  1ME5 A;  2CWQ A;  2GMY A;  2O4D A;  2QEU A;  5DIP A; 
#chains in the Genus database with same CATH topology
 1U7J A;  1LGH B;  3KYQ A;  1N86 A;  2M0B A;  2IFM A;  3CMA P;  2QIW A;  1IO4 A;  4CPG A;  5APW A;  2K9Y A;  2RN0 A;  5CJ4 A;  1NOH A;  3S9O A;  3CLQ A;  4AKR A;  3BAT A;  4NPE A;  3CCJ P;  2P67 A;  4N3Y B;  1LTT C;  3TNU A;  2QJP C;  1SQB D;  4GDO A;  5CCG C;  1DD3 A;  1L4A B;  1DX7 A;  1K04 A;  3L75 E;  3LW5 H;  1PGO A;  5KTB A;  2YO3 A;  1FDO A;  2WSC J;  2KNC A;  4YXD C;  5E79 H;  1S5L X;  3L35 A;  3I56 P;  1LNQ A;  4UB6 E;  1OWA A;  2XND H;  3W67 A;  1VF5 D;  2OYH B;  2YMY A;  1WT6 A;  1NWQ A;  2HG5 D;  1R8E A;  2WSE J;  4EOT A;  1AVO A;  4Y28 J;  1HWT C;  2DW3 A;  1LTJ A;  1ZOY C;  1T2K C;  1S1C X;  1BCC E;  2FYZ A;  1K73 Q;  3A7O A;  3L72 G;  3VN0 A;  3L74 E;  4C7R A;  1PL5 A;  2CPB A;  4GOF A;  3D70 A;  3NTN A;  2E76 C;  5CBO A;  4XE5 B;  1A02 J;  1RE3 A;  1AQ5 A;  2IZ0 A;  1SFC B;  3L36 A;  1PFI A;  1KYO H;  4I7Z B;  5KLI B;  1BGY G;  3IF4 A;  3MUD C;  5KAF H;  3VMA A;  1VPC A;  1JB0 J;  2B87 A;  1N73 A;  2ZXE B;  5DIK A;  1BE3 J;  2A06 E;  1JCC A;  1KMI Z;  2O1K A;  2OGU A;  2YKO A;  2ZT9 B;  2FXP A;  2HOD B;  2IYO A;  4D6T J;  3KZI H;  4TLF A;  3AE3 C;  1PGJ A;  1KTM A;  2QEX P;  3H1K E;  4IFM A;  1K05 A;  5AW1 B;  3GLM A;  2HLO A;  3WUT A;  1Q2N A;  1GL2 A;  2KSJ A;  2WMM A;  3PTZ A;  4JF7 A;  4RKU J;  1FS0 E;  4H0L B;  5CJ0 A;  3V4W A;  3FX0 A;  5AVT B;  2YNY A;  2ZFC A;  5TIS H;  4YTP C;  1P84 E;  4DT0 A;  1KIL A;  1L0L K;  3VMY A;  4JYB A;  1IFM A;  1LWU B;  4H13 D;  1SQX D;  2LXC B;  3H1J E;  2Q5U A;  3GW6 A;  2R3C A;  5B5E E;  4U3F D;  2JJL A;  1QVG O;  3RK2 B;  2PRR A;  1P8C A;  2NPS A;  5KLV D;  1SQV J;  2XU6 A;  2N1T C;  1FZF A;  3H1H E;  2ITA A;  4C46 A;  1GW4 A;  1D7M A;  3FWN A;  1OZH A;  2BCC D;  1BCC J;  5GTH E;  1IZN B;  2E75 C;  1XTC C;  5KJ7 A;  3U1A A;  1LJ2 A;  2IBZ D;  3L74 J;  1BE3 G;  1NTM D;  5AW7 B;  2FYN C;  1CI6 B;  1URQ A;  3Q5R A;  2QJY B;  3H6P A;  2JKV A;  2C9N Y;  3LK4 1;  2G3A A;  3CX5 D;  4WB4 A;  4D6T G;  1JO5 A;  2FYU E;  5AW5 B;  1GZL A;  1EDI A;  2K3R A;  4BWN A;  3M06 A;  4Y99 C;  1LTG C;  1DIP A;  1VQ4 P;  4BRY B;  2OQQ A;  5APV A;  2FFD C;  1QVF O;  3B5N C;  1NTK J;  2D2C D;  2PP6 A;  4IL6 H;  3G71 P;  1FDI A;  1MUU A;  1FJP A;  5AVW B;  1GK6 A;  1GW3 A;  1WRG A;  2Z5H A;  4DCK A;  3RL0 B;  2QE7 H;  3EWK A;  1ZME C;  1SQV K;  1HF9 A;  1KIL E;  1YJN P;  3A0B H;  3H1K J;  1LTA C;  3E1I A;  3H1I D;  1H89 A;  2A45 G;  5B66 E;  2WIT A;  3USS A;  3BCC G;  2YO2 A;  3H1L E;  2P1J A;  2V7Q J;  5AVY B;  5DJU B;  5APU A;  1N7S D;  2WSF J;  2QRX A;  2ZAE B;  4EDF A;  1SQV G;  3L71 D;  3AA7 A;  2IDB A;  3W68 A;  1L0N D;  1LP1 A;  1W2E A;  3L73 E;  2P58 A;  3A0H E;  1SQQ J;  2LR2 A;  4PD4 E;  1FZC C;  2IJC A;  2QJP B;  1H0T A;  1OW8 A;  1T8Z A;  2C9L Y;  3H25 A;  4XFJ A;  1NTK K;  1OW7 A;  2H7H A;  3CL3 D;  1NHL A;  2M5A B;  1RQV A;  3L72 E;  2R5D A;  2QM8 A;  1VQL P;  1RF0 C;  3P8M C;  3MD0 A;  3C9I A;  3MIW A;  5KAI E;  3L70 J;  1SVF A;  2SPZ A;  1NTK G;  1M1J A;  2JWA A;  3AE4 C;  1ME5 A;  3P32 A;  5KKZ C;  3L75 D;  2MJZ A;  2E42 A;  1S72 P;  3WMM 0;  1AA0 A;  3CME P;  1SQQ K;  1KZU B;  4WY4 D;  2O1J A;  1L4A A;  1VQ9 P;  1YI2 P;  3B8E B;  2E76 B;  3L4F A;  1EDK A;  2AXC A;  5CCH C;  5ADX K;  5DJT B;  3HUS B;  1Y9B A;  3M9B A;  4GOD A;  4L76 A;  1M90 Q;  3TSI A;  4H44 D;  1NVO A;  1T6A A;  1KD1 Q;  2B88 A;  2GUV A;  1MZ9 A;  3F89 A;  1SQQ G;  2OYH A;  2Y9Z A;  5AW2 B;  2XNX A;  1RE4 A;  1S2E A;  2NZ2 A;  3QH9 A;  1PV3 A;  1FZA A;  1Q86 Q;  1JY3 N;  1PZQ A;  3U1C A;  1VF5 C;  3BRV B;  1JM0 A;  5AW6 B;  1ZN5 A;  4OH8 B;  3VP9 A;  3IN6 A;  2ZVO B;  1VQM P;  5AVV B;  3AEC C;  1NAF A;  3L70 G;  1PP9 J;  5K5G B;  2H89 C;  5L8R J;  2A06 D;  5APT A;  1FZB A;  3G4S P;  3M91 A;  3RBZ A;  1SFC A;  2GM4 A;  3L72 J;  1JOC A;  2ZJS E;  1BE3 E;  5AW8 B;  1VQ5 P;  3AEA C;  4R4L A;  2FXM A;  2Q6Q A;  3TGU J;  3SWF A;  1IFI A;  1T3U A;  4D6T E;  4Z1M H;  1KYO E;  4DJG A;  3ABV C;  2Z4E A;  1BGY J;  3AE1 C;  3ZDM A;  2HOD A;  3KPE A;  2JP3 A;  1KB9 E;  3V2Q A;  2QEU A;  2N1T B;  3UIA A;  2FKW B;  2KLV A;  2M3B A;  3CCM P;  2BAS A;  2C0X A;  3CX5 H;  1P84 D;  3M9H A;  1YJ9 P;  3PJS K;  2E75 B;  1MFT A;  1UIX A;  3CCQ P;  3CI9 A;  3CC2 P;  1AJY A;  2KZI A;  2K9J B;  2FYN B;  3H1J D;  1YBK A;  3AEE C;  1MFZ A;  4WWI A;  1W2B O;  1KQL A;  3E7K A;  1LTS C;  3AE5 C;  4ZKU A;  2ZYD A;  3CCV P;  1M8O B;  4OGQ D;  4Y99 B;  2ZYA A;  1LWU A;  3H1H D;  3LIE A;  3LW5 J;  1S5L H;  1M7L A;  2FFD B;  1SQV E;  3B5N B;  1J1E C;  5AVX B;  1JTH B;  2OYI C;  1SQX K;  2KOG A;  3D6Y A;  1PP9 G;  5GTI E;  3WUU A;  4H13 C;  2Q1K A;  1VQP P;  2KS1 B;  1KNC A;  3BAS A;  2XDJ A;  2O4D A;  5H2F E;  1HJB A;  1K9M Q;  2CK3 H;  3AE7 C;  5AW9 B;  5KLV K;  3GMA A;  2FYU D;  1OVV A;  4PV1 D;  1T3J A;  4JBZ A;  3CCR P;  1IZN A;  5APY A;  3TGU G;  4YXW H;  2KSE A;  2AEM A;  1EZV I;  3HUS C;  1GL2 D;  1SQX G;  1P84 I;  1VDF A;  2JWD A;  2P7J A;  1L0L J;  3JCU H;  1ZXG A;  1NO4 A;  3D71 A;  1CI6 A;  3WU2 E;  3KHU A;  1NTK E;  1ZW0 A;  3TDK A;  1PPJ E;  3SWK A;  3CXH E;  4W80 A;  1GU9 A;  5KLV G;  1TU3 F;  3L71 J;  3A5T A;  3M0D C;  3R4Y A;  3RK3 D;  4BRY A;  1FZC B;  1KIL D;  1FBM A;  2IPP A;  3OAK A;  1K8A Q;  1JMB A;  3FXD A;  3AE8 C;  2IBZ G;  2P2U A;  2J59 M;  3AEB C;  5C39 A;  3H1L D;  3B71 A;  3BRT B;  2D2C C;  1KOR A;  4HJG H;  2QM7 A;  4IL6 E;  4M3L A;  2NPS D;  2GMY A;  1NU1 J;  4HB1 A;  3PH0 A;  1SS1 A;  2WPV B;  3A3Y B;  2FY8 A;  1LT9 C;  3L73 D;  2I1J A;  4I6M C;  3AA6 A;  1NYH A;  1EZV E;  3GHG A;  3CCE P;  1IK9 A;  5KJ7 D;  1NTZ J;  3V2N A;  4UB6 H;  1FJK A;  5AVR B;  3VYI A;  5KKZ B;  1SQQ E;  3R2P A;  2R5B A;  2QJK C;  4RES B;  1Q82 Q;  4TT3 H;  3AEF C;  1URQ D;  2J5U A;  3BCC J;  1YQ3 C;  1N7S C;  2AXT E;  3AEG C;  4L74 A;  3GF7 A;  3HE4 B;  5CCG A;  4NPD A;  3H1I G;  2YXQ B;  1GDT A;  2M5A A;  1L0L G;  3HD7 C;  1YJW P;  3OW2 O;  3L70 E;  4ZKP A;  5AVZ B;  1E79 H;  2P10 A;  1NU1 K;  4LGD E;  1OIP A;  3L71 G;  1SQP J;  2E74 D;  2OTJ P;  2K1A A;  2YKP A;  1BSH A;  1RF1 C;  4C7N B;  1NTZ K;  2GA1 A;  2OAR A;  3AA0 A;  1VF5 B;  4PD4 I;  1OXZ A;  1FC2 C;  3Q3D A;  1CW5 A;  2K37 A;  3LID A;  3OJA B;  2WVR A;  2JR8 A;  5CMZ A;  3MP7 B;  1NU1 G;  4UB8 H;  1KN7 A;  2W6B A;  1S9K E;  1KC8 Q;  2I1K A;  2KIK A;  3KQG A;  3CWB J;  2AEF A;  3CPW O;  2Q0T A;  2M3E A;  3IFM A;  4PJ0 E;  1SLQ A;  1NTZ G;  4LLH A;  5AVS B;  4WY4 C;  3HE5 B;  4IOI H;  1S4X A;  3MUD A;  3A2A A;  3II6 A;  1E5W A;  2R44 A;  1QGK B;  1YYC A;  1G2C B;  1JNM A;  1SQP K;  4N78 D;  1P84 H;  2R3S A;  4NPF X;  4H44 C;  5BU5 A;  2ZYG A;  1NGM B;  1NH4 A;  1DH3 A;  1YTZ T;  5B5E H;  2WZ7 A;  1VQK P;  1PP9 E;  1BDC A;  2OUW A;  1BE3 D;  2FBW C;  1SQB J;  1G1J A;  2YXR B;  2IFN A;  3QWO C;  3VOP A;  1SQP G;  3RGU A;  1VL2 A;  2KI7 B;  1Q7Y Q;  2FXO A;  4D6T D;  3V2P A;  3EQ2 A;  1L4A D;  3HTK B;  5GTH H;  3TGU E;  2E75 D;  1Y8A A;  3SFE C;  1SQX E;  1KB9 D;  4WVZ A;  3AE9 C;  2W6A A;  1BGY E;  3PP5 A;  3C8V A;  2XV5 A;  2GUS A;  1YQ4 C;  1U7M A;  5AFU K;  1J1E B;  2YIU C;  2OYI B;  4XA4 A;  3CWB G;  3PLN A;  1FE6 A;  4H13 B;  4ASW A;  1NKN A;  2N1T A;  4ASV A;  1WMK A;  2W27 A;  2HYN A;  4IFD K;  3G9R A;  2WPQ A;  1FOS F;  1QX8 A;  1N7L A;  2IBZ E;  3AA1 A;  2IZ1 A;  4N6J A;  1IC2 A;  3SSU A;  1USD A;  4K35 A;  1A02 F;  4R4M A;  1SQB K;  4KJM A;  2K9J A;  1IFJ A;  2Z5I A;  1LTJ C;  1SQV D;  3Q5S A;  1KQF B;  3P8C E;  2WQY C;  3PHL A;  1MV8 A;  1BCC D;  1KYO I;  5E79 E;  1SFC D;  2IX7 C;  3MHV A;  3FGA D;  4G9Q A;  3AE6 C;  3H32 B;  2FFD A;  1NKZ B;  3L74 D;  2O01 H;  2Q3I A;  3B5N A;  1KB9 I;  1SQB G;  1Q81 Q;  2W6J H;  1RE3 C;  1JTH A;  4OGQ C;  2Q3E A;  3AAA A;  5AW4 B;  1VQN P;  3D7I A;  2KS1 A;  1PGP A;  2D2C B;  1Y47 A;  2ZT9 D;  4HKZ H;  4ZNC A;  1HH0 A;  1N73 C;  3H1I E;  3MGN A;  1AQT A;  1UII A;  2KXP B;  1L0L E;  1NTK D;  2KK7 A;  1HBW A;  1PPJ D;  1HGZ A;  1LT9 B;  2W83 C;  2AF7 A;  2A45 I;  3RBX A;  4RO0 A;  2HPC B;  2YMK A;  2J58 A;  2B89 A;  4PV1 C;  3L71 E;  3T97 B;  2PGD A;  3VTP C;  3IAO A;  2QJK B;  4H0L D;  2WWW A;  2BEQ D;  2RMZ A;  1GL2 C;  3H1K D;  1AVY A;  3KXD A;  4JPZ B;  2L5G B;  1SQX J;  3B4S A;  5KAF E;  3O6Q B;  1FZC A;  1N7S B;  2N9B A;  4U3F J;  1JY2 N;  1ZV8 A;  4MN4 C;  1YIT P;  2VRS A;  3N4X A;  1NU1 E;  3RK3 C;  5KLV J;  3S4R A;  1N2D C;  2R32 A;  1KIL C;  2N9Y B;  1KFM A;  1EZV D;  3HD7 B;  3RK2 D;  3GF3 A;  1KQS O;  2WSC H;  3CC4 P;  1GU5 A;  3KZI E;  1RF0 A;  1EXI A;  1SQQ D;  4W7Y A;  2BCC J;  5CCH D;  1VQ6 P;  1NTZ E;  1OVR A;  2IYP A;  1MKM A;  1N8R Q;  1NTM J;  1VKE A;  2OTK E;  4L75 A;  2NPS C;  4OVN F;  1RF1 B;  1IFD A;  1EDJ A;  3BCC E;  4OWF A;  1LW1 A;  3E1R A;  5AVU B;  3CXH I;  2WSE H;  1PIX A;  5CBN A;  3JC2 2;  4B86 A;  1VQO P;  1ZR4 A;  5KJ7 C;  3H1L G;  5TIS E;  3MZW B;  1DD4 A;  3L70 D;  3FXE A;  3EFG A;  2HFE D;  1HTL C;  1JY3 P;  1URQ C;  3HE4 A;  4A7P A;  3NXS A;  1Q90 D;  2QVA A;  2HR3 A;  2M8R A;  5CCH A;  2YKQ A;  2KB7 P;  3FWL A;  1KV4 A;  1ZRT E;  3L73 G;  4WY4 B;  1SQP E;  1J2J B;  1USE A;  4GKG A;  3RL0 D;  1RY3 A;  3JSV C;  3H1I J;  1J1D C;  3D6Z A;  1W5C E;  1Z56 A;  3SFD C;  3CD6 P;  2WT7 B;  1PGQ A;  2H88 C;  4U3F G;  3Q2Y A;  3BEY A;  4C7N A;  1RQU A;  1EXJ A;  1OVU A;  1NTM K;  4H44 B;  4HH2 A;  1S9K D;  2Q7C A;  3V4Q A;  1X8Y A;  2E74 C;  4HYT B;  1DEB A;  2E5Y A;  5M1B A;  3P7K A;  1L0N J;  5DIP A;  3CWB E;  3V5B A;  5TJH A;  2BCC G;  4BXL A;  1KB9 H;  1LTB C;  1JY2 P;  3G3Z A;  1HUC A;  1NTM G;  2KUB A;  4U7J A;  2W90 A;  1AFO A;  3AAE A;  5CCG D;  4UB8 E;  1ZLL A;  3HE5 A;  2JO1 A;  1OW6 A;  4KHX A;  2OTL P;  2PAJ A;  3TNU B;  1BSN A;  3CCS P;  4PD4 D;  1LT1 A;  2A45 H;  1ZR2 A;  1IJD B;  1PP9 D;  1G2C A;  3A0B E;  3S1K A;  2Y0C A;  4EI2 A;  2YIU B;  2KNC B;  2Y9Y A;  3L75 J;  3V6I A;  1LTI C;  3L72 D;  1FAV A;  4GIF A;  3O8Z A;  3I5C A;  1SQB E;  3AED C;  4GT1 A;  3M9Q A;  3TGU D;  1L0N K;  5GTI H;  1BDD A;  1T2K D;  4W7Z A;  1M1J C;  1KFN A;  1HVV A;  1BGY D;  5AVQ B;  3F5H A;  5H2F H;  1M57 D;  3TF5 A;  3ITK A;  1LTJ B;  4I2L C;  3HTK A;  3M0A A;  4K3A A;  2E76 D;  2JDI H;  1EDL A;  2BEZ F;  4AYC A;  3VP8 A;  1L0N G;  1L4A C;  3WU2 H;  1S3J A;  2ZVN B;  1OFC X;  3RL0 g;  1KQG B;  4JQ0 D;  2OYI A;  4OGQ B;  3CXH H;  3BVH A;  5AW3 B;  2OYO A;  4IL6 X;  2B87 B;  1N73 B;  1FZG A;  2KLU A;  1U57 A;  1VQ7 P;  1QLE D;  2OYH C;  3P8C D;  1NAY A;  3HRN A;  1RE4 C;  1JUN A;  2RH0 A;  4LC1 A;  2I8D A;  5APS A;  1QL2 A;  4YPC A;  2QA4 P;  3HUS A;  1YIJ P;  3IR9 A;  2WPR A;  1GTW A;  4PV1 B;  2V7Q H;  3C1L A;  4ZMD A;  3L75 G;  3N7N A;  2C0W A;  2ZXX A;  2WSF H;  3RK3 E;  2E43 A;  1GL2 B;  1HGV A;  3L37 A;  1ZP0 C;  3NFQ A;  1RHZ B;  3M0D A;  1M1K Q;  3H32 A;  1EC5 A;  1FU1 A;  2B9B A;  2H43 A;  1H8A A;  2WSS H;  2XZR A;  4DZO A;  1L0L D;  1SFC C;  3GHG B;  4I7Z C;  3RK3 B;  5KLI C;  1JCD A;  1OX3 A;  2O3J A;  1KIL B;  2IBZ I;  2AXT H;  2N1T D;  2G8Y A;  2W8Z A;  2KXP A;  2KZJ A;  1GMJ A;  1L2P A;  3CX5 I;  1RH5 B;  1LT9 A;  1BCC G;  3HD7 D;  2CPS A;  2ZT9 C;  1KYO D;  1X9V A;  1M56 D;  3H1J J;  2WTY A;  2NPS B;  2NRG A;  2UWJ E;  1R5L A;  2HPC A;  3L74 G;  2AEJ A;  2Y0E A;  4I1L A;  4O9B A;  3T97 A;  4EIJ A;  4DOJ A;  1YTZ I;  4U3F E;  3PRJ A;  1NU1 D;  3K5B A;  4L73 A;  2JEE A;  1FZE A;  4WBA A;  3H1H J;  3WUV A;  4GOE A;  3Q1M A;  3O6Q A;  1N7S A;  5KLV E;  2Q9I A;  4AUW A;  1IK7 A;  1IFP A;  4H0L C;  2KZ7 A;  3EFF K;  2LXB A;  1HJ0 A;  1URQ B;  1NTZ D;  2LKM A;  3CC7 P;  3SWY A;  2QG4 A;  1PPJ G;  3B5N D;  1GU4 A;  2BCC E;  2A06 G;  1G1I A;  5EFW B;  3AE2 C;  1X22 A;  3GG2 A;  3HD7 A;  3BCC D;  1LWU C;  3CCL P;  2Y0D A;  1NTM E;  2FYU J;  1IFN A;  1FDM A;  4PJ0 H;  2XKM A;  1R5S A;  1J1D B;  3TK1 A;  3VMZ A;  3H1K G;  3RK2 C;  3CX5 E;  3KDP B;  1RF1 A;  2PFX A;  5BU8 B;  5B66 H;  3VMX A;  1AV1 A;  1X0T A;  1JY3 O;  2K88 A;  5CHX A;  1SP4 A;  2E74 B;  3G6E P;  2ES9 A;  4JYC A;  3CCU P;  2RKL A;  1QEX A;  1ZRT D;  2L91 A;  1JMM A;  5APQ A;  4IFF A;  1CZQ A;  1EZV G;  1SQP D;  1OMI A;  3MTU E;  5BVZ A;  1JEK A;  2MKV A;  1H88 A;  3A0H H;  2QJY C;  1S5L E;  4PD4 H;  2KYV A;  3H1J G;  1X79 B;  2V4H A;  1EQ7 A;  2JN8 A;  1CSB A;  3H1L J;  1DEE G;  2O01 N;  2E5T A;  4KT0 J;  1LP1 B;  4WY4 A;  1NJI Q;  3U59 A;  1FOS E;  2O01 J;  3CXH D;  5AW0 B;  1YHQ P;  4RJT A;  2FYU K;  1H0T B;  3TYY A;  4N78 E;  3H1H G;  3CWB D;  3L73 J;  1VQ8 P;  2KP8 A;  2WT7 A;  1GD2 E;  4AQR D;  3LVY A;  4EYY Q;  1XTG B;  3RL0 C;  2POH A;  5KAI H;  2WPS A;  1L0N E;  1JY2 O;  5APX A;  3NMD A;  2H8P D;  4QMA A;  3JCU E;  3LK2 A;  3LK3 A;  1GK4 A;  3OA7 A;  3Q5P A;  1QL1 A;  2QSI A;  2FYU G;  2CWQ A;  3I55 P;  3V2R A;  3GHG C;  1M1J B; 
#chains in the Genus database with same CATH homology
 2PFX A;  5AFU K;  2IJC A;  3BEY A;  3AAA A;  3AA1 A;  1VKE A;  2OUW A;  2OYO A;  2AF7 A;  5ADX K;  1IZN A;  3D7I A;  2KZ7 A;  3LK4 1;  2ES9 A;  3LK2 A;  3LK3 A;  1LW1 A;  3AA6 A;  4G9Q A;  5DIK A;  3AA7 A;  1GU9 A;  3C1L A;  2PRR A;  1KNC A;  2KXP A;  2JN8 A;  3LVY A;  3AAE A;  1P8C A;  2Q0T A;  3AA0 A;  1ME5 A;  2CWQ A;  2GMY A;  2O4D A;  2QEU A;  5DIP A;  4AKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...