3C1LA

Crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
KISALDLGELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESGLSKLDREMIAVAVSSINHCYYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAAFFNMSNRVAAAIDMRPNDEYHAMAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative antioxidant defense protein Mlr4105
publication title Crystal structure of putative antioxidant defense protein (NP_105057.1) from Mesorhizobium loti at 2.00 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 3c1lA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 3c1lA02
2AF7A 3BEYA 2PFXA 2CWQA 1KNCA 2IJCA 2OYOA 2Q0TA 3D7IA 1GU9A 1ME5A 3LVYA 1P8CA 4G9QA 2QEUA 2PRRA 2O4DA 5DIKA 3C1LA 1LW1A 5DIPA 2OUWA 2GMYA 1VKEA
chains in the Genus database with same CATH superfamily
1SQPJ 1NOHA 3RK2B 1KMIZ 5KLVD 2WTYA 2ZT9B 1YI2P 3U1AA 2NPSC 1HJ0A 3A2AA 1QX8A 1ZR4A 2Q1KA 2KLUA 1MV8A 3GW6A 1Z56A 1VQ7P 3KXDA 1ZW0A 2FYUK 1H88A 4ZNCA 4DJGA 1N7LA 1G1IA 3L72G 2B89A 3L72E 4W7YA 2KUBA 3MZWB 3HE5B 1QEXA 5DIPA 2FXMA 3H6PA 4D6TG 5C39A 4D6TE 3MGNA 1H89A 4HJGH 3L70G 2K37A 3L70E 1Q81Q 1KORA 1SFCA 1LT9C 1R5LA 1AQ5A 1LGHB 5L8RJ 2RKLA 5K5GB 2XU6A 3BCCG 1OW6A 3RL0C 3BCCE 1GDTA 1RE4A 1EZVG 1YJNP 4L76A 2V7QJ 2C0WA 1EZVE 4KT0J 2XNXA 5KAIH 3EFFK 3W68A 4C7RA 5AVQB 3VP9A 1XTCC 1NTZK 1WT6A 2O01H 1SVFA 4K3AA 2LR2A 3O6QB 3ITKA 5GTHE 1YJWP 1PGOA 2KSJA 1SQVK 1NTMK 1PPJD 4N3YB 3KPEA 2E5TA 4DZOA 5KJ7D 2A06G 2V4HA 4GIFA 1L4AA 2A06E 3H32A 1TU3F 2N1TD 3EFGA 1N86A 3V2PA 3NTNA 1FS0E 4QMAA 4LLHA 1VL2A 3L72J 1BE3G 1NU1K 1BE3E 1FDIA 4WY4A 1IK7A 4D6TJ 1EXJA 2KB7P 2V7QH 2Z5HA 4N78D 5BU8B 2IYOA 1QVFO 4OGQC 3L70J 4I7ZC 3TNUA 2Q5UA 1AQTA 5KAFE 2I8DA 2QJPC 1OFCX 1NWQA 5H2FH 3E7KA 1M1JA 3BCCJ 2N1TB 2FFDB 1IZNB 1USDA 1RF1B 4RO0A 4C46A 1FZCC 4XA4A 2BCCG 1FDOA 1E79H 4H44B 2AEMA 1U7JA 1NHLA 2BCCE 3B5ND 3I56P 3M9HA 2HPCA 1VQKP 2K9JB 5M1BA 2PAJA 1HH0A 1K73Q 1HGVA 3TYYA 2WSFH 1ZRTE 1OWAA 2Q3IA 2CWQA 1LT1A 2Q6QA 1CI6B 1BE3J 4RESB 3L72D 1OXZA 5KLIC 4Z1MH 1VF5C 3O8ZA 1S4XA 2C9NY 1Y8AA 4XE5B 4D6TD 5APUA 1CW5A 2QM8A 1NKNA 1ZR2A 4N6JA 1VQOP 2XV5A 2KIKA 2HLOA 2OYIB 1ZLLA 2RMZA 2POHA 3L70D 3LK3A 3LW5J 4YTPC 2QRXA 1RE3A 1VQ9P 2KXPA 2QJYC 1N8RQ 5BU5A 1MKMA 1NTKK 2O3JA 2WPQA 3L71G 5AW5B 2BCCJ 2P2UA 3CCUP 2E74B 1N7SD 2KSEA 3GF3A 1A02F 1IJDB 1LP1A 3KQGA 1OW8A 1PZQA 1MFZA 1SQPK 4TT3H 2KZ7A 4NPDA 3VP8A 3AEDC 2WSSH 2O01N 3V4QA 1SQBD 2P10A 1GK6A 3LW5H 4H13D 2H43A 2WMMA 1JOCA 4JF7A 5CBNA 3II6A 2B88A 3VN0A 4G9QA 1BE3D 1RE4C 2WWWA 4GOFA 2CK3H 1LTGC 5DIKA 3BVHA 1HGZA 2WSEH 1N7SB 2WSCH 4EDFA 2W6AA 1FJPA 1RQUA 2WPRA 4UB6E 2NRGA 3CC7P 1EDKA 2M5AA 3KYQA 3D7IA 1BDDA 4O9BA 3V2RA 3CCQP 2MJZA 3CD6P 1URQD 3NFQA 4WBAA 3FWNA 5CJ0A 3WU2E 4BRYB 1SS1A 2Z4EA 1PP9D 1FU1A 2UWJE 1KILA 1L4AC 3CL3D 4H13B 1RQVA 2IJCA 1X9VA 2ZAEB 3L71J 1T3UA 3AE1C 2GUSA 3CMAP 2KLVA 2QVAA 1KZUB 2NPSD 4CPGA 2W90A 1J1EB 1LWUB 1T8ZA 4OVNF 1R8EA 1VDFA 3TF5A 1PGJA 1URQB 3OA7A 2L5GB 1PGQA 2GM4A 3L35A 1BCCG 3CXHH 5AW6B 1M1JC 1BCCE 1IFJA 3CX5I 1MFTA 1ZP0C 3HE5A 3UIAA 3V5BA 1MUUA 1FZBA 1JCDA 5CCHA 1KFNA 1PPJG 2WQYC 1S72P 1PPJE 1GD2E 2NPSB 1NJIQ 3M0AA 4YXWH 2WT7B 2JEEA 1GL2B 4OWFA 2E75C 3RL0D 3A0HE 1JMMA 2AEJA 1H8AA 1QVGO 3AEFC 3AE3C 1L2PA 1KB9D 3Q5SA 4Y28J 3SWFA 2QJKC 1FAVA 1VQ6P 2KK7A 1S2EA 3PRJA 5AVZB 3FGAD 4L75A 1GU9A 3L71D 5AW8B 1FDMA 3HE4A 4W80A 2ZFCA 5AVRB 2SPZA 4N78E 3M0DA 4IFDK 1QGKB 1T3JA 1FC2C 1WMKA 3GHGA 4KJMA 3WUUA 3TDKA 2R3CA 3O6QA 2E76C 4UB6H 1MZ9A 1X79B 2RN0A 3RK3C 1VQ8P 2FXPA 1LT9B 4HYTB 1H0TB 1QL2A 3JSVC 2YKQA 1JY2O 3RL0B 3H1IG 3P32A 1RE3C 1BCCJ 2JN8A 3LIEA 1M90Q 3H1IE 3F5HA 2LXCB 2AXTE 4PV1C 1AVOA 3PHLA 3ABVC 4W7ZA 1YITP 1LTJB 3E1RA 1JCCA 5B66E 2HYNA 1IFDA 3G4SP 2KS1B 1RF0A 4OGQD 1OVRA 1Q7YQ 5CBOA 2M0BA 4PD4D 5AVXB 4GODA 3VMXA 4BWNA 2A45H 3CX5D 4JBZA 3GF7A 1NKZB 2C9LY 1K04A 2KP8A 1PV3A 1N73B 2N1TA 2W6BA 5TJHA 2FFDA 5AW4B 1AFOA 1RF1A 1KTMA 2K9YA 4A7PA 3AE4C 1M1KQ 5KKZC 2CPSA 1GMJA 3JCUH 5CCGC 2MKVA 1S3JA 4OGQB 2LKMA 4Y99B 3VMYA 4I1LA 4I7ZB 3PLNA 3HD7A 4HKZH 1W2EA 2AEFA 2K9JA 1SQXG 2Z5IA 2P58A 2QJPB 1YHQP 1SQXE 2Y0EA 1S9KD 4EIJA 3H1IJ 1NAYA 1CZQA 3AAEA 3VYIA 1IFNA 1BCCD 1FZCB 1CI6A 3RBZA 1QLED 1KILC 1VF5D 1OMIA 1RHZB 3PJSK 2YIUC 4ASVA 2D2CC 4IL6E 3EWKA 4KHXA 5B5EH 1SQQK 1NO4A 1L0ND 2FBWC 2ZT9C 2GMYA 2OYIA 4U7JA 1SQBG 1VQNP 3I5CA 1SQBE 2XKMA 1AV1A 2B87A 2LXBA 3Q3DA 3R4YA 3KDPB 2FY8A 5KLIB 2ZYGA 1VF5B 3BEYA 1M57D 1JY3N 4IFFA 1S5LE 5EFWB 3BATA 3P8CE 1ZN5A 5B66H 5CCHC 1S1CX 2IX7C 2FYNC 1PP9G 1KN7A 2Y9ZA 1SQXJ 1YTZT 1DEEG 2XDJA 1PP9E 1KV4A 2KZJA 3E1IA 2Q0TA 3QWOC 2QJYB 1YYCA 2H7HA 3A0BE 5AVYB 2QIWA 3U1CA 3H1ID 3K5BA 3MIWA 1LW1A 1EDLA 5AW7B 1NH4A 2M3BA 1AA0A 2N9BA 1LTBC 1BGYD 2OYHC 1BSNA 5AVVB 3WUVA 2WPSA 1W2BO 5KLVK 1N7SA 3M0DC 2J5UA 4U3FG 3HRNA 3GHGC 4U3FE 4I6MC 3IF4A 1SQBJ 3LK2A 2H88C 2G3AA 1FJKA 4GDOA 4BRYA 1ZMEC 1L4AD 1ME5A 1PIXA 4AQRD 3L37A 1JY2N 3MD0A 2ZYDA 2P1JA 3G9RA 1PL5A 3OW2O 1Y9BA 3SFEC 4XFJA 2IFMA 3AECC 1NVOA 3B5NB 1NTMG 1QL1A 3I55P 1D7MA 4GKGA 1NTME 1J2JB 2JWAA 5GTHH 4IL6H 2O4DA 1HTLC 1LWUA 1GK4A 1PP9J 2J59M 2YMYA 1SQXD 1K9MQ 1KB9E 3N7NA 1P84E 1NU1G 3H32B 3JC22 1KILE 1NU1E 2YKOA 3L71E 1M8OB 2FFDC 1KQGB 1L0LD 2ZVNB 2R3SA 4H44C 2R5DA 5GTIE 4U3FJ 3H1JG 1JM0A 2QSIA 4PJ0E 1VPCA 1VQ5P 5KAFH 3H1HG 2WT7A 3H1JE 2HODB 1SFCC 3HD7C 3CCEP 2E75D 3H1HE 3QH9A 1IFMA 1GL2A 3M9QA 2ZJSE 3V2QA 3MHVA 2L91A 1G2CB 3AE5C 3AE9C 1HUCA 1FBMA 3RGUA 3A0BH 3L75D 1Q86Q 3FXEA 3T97A 3OJAB 2R44A 1KB9I 1FZAA 1LTSC 1P84I 1OIPA 1NTMJ 4PD4E 3P8CD 3HUSA 2E76D 2ZVOB 3RK3D 3CX5E 2YO3A 4R4MA 2ZXXA 2OUWA 2E75B 2FYUD 1H0TA 4DT0A 3G71P 3AE2C 1NU1J 2KNCB 1HF9A 1PGPA 4YPCA 4PV1D 1P8CA 3HTKA 1IO4A 5APXA 1KYOE 3GG2A 2OTJP 1FZEA 3RBXA 4WY4C 4M3LA 3RL0g 2IFNA 1LTJA 3CMEP 3VMAA 5AFUK 3AA0A 3C8VA 2E76B 1FOSE 1JEKA 4U3FD 3H1JJ 3CCLP 1S9KE 3H1HJ 1EDIA 2YXQB 1K8AQ 4PD4I 1NTKG 2JKVA 4H0LC 5AVSB 1NTKE 2QE7H 1KQLA 2DW3A 3LVYA 1N73A 3TGUD 1NYHA 1X0TA 5TISE 3AEEC 1KQSO 2W6JH 1WRGA 1L0NG 5CCGD 3G3ZA 1L0NE 1KYOI 1HJBA 4AUWA 1SQVD 1NTMD 3S9OA 5GTIH 3MP7B 3D70A 3FWLA 1J1DC 3AA1A 3NMDA 4WB4A 2BEQD 3CPWO 5AW9B 1P84D 1KILD 1NU1D 3CCJP 2QG4A 3U59A 3CWBG 3CWBE 2D2CD 5KAIE 1IK9A 5KKZB 3LIDA 3BRTB 1M56D 4DCKA 4LGDE 1ZOYC 2ZT9D 1EQ7A 4IOIH 4AYCA 1XTGB 3ZDMA 3CX5H 3H1JD 5AW0B 3WU2H 1YQ3C 3H1HD 1NTKJ 3PH0A 1GTWA 1JUNA 2HFED 4C7NB 1SQBK 5KTBA 1LTAC 1VQPP 3LK41 1KILB 1LNQA 1N2DC 1BGYG 1BGYE 2YIUB 2YO2A 4WVZA 1LJ2A 3CLQA 3V6IA 1T2KC 2Q9IA 2D2CB 2IPPA 4MN4C 1L0NJ 5CCHD 4TLFA 3CCSP 1M7LA 4GT1A 2IBZD 3B71A 2QEUA 5ADXK 2ITAA 3PTZA 5KJ7A 3BASA 5H2FE 5APVA 1IZNA 1GL2C 1OX3A 3V2NA 1EC5A 3D6YA 3OAKA 3CWBJ 1KYOD 3VOPA 3MTUE 2ZXEB 2C0XA 2JO1A 2Q7CA 3C9IA 5TISH 2E43A 1YIJP 3S1KA 4ZMDA 3H25A 2O01J 1KNCA 3L74G 2Y9YA 2FYNB 3HUSC 1GW3A 3L74E 4JYBA 3Q5RA 1E5WA 1DD3A 1U7MA 3GMAA 3A0HH 3AAAA 2YXRB 1KQFB 1NTKD 5DJUB 3CCRP 3CCMP 1L0LG 1L0LE 1JTHB 1BGYJ 1FZGA 3NXSA 2AXCA 2PRRA 2WZ7A 3B5NA 3F89A 2OYHB 1OZHA 3AA7A 3RK2C 5E79E 3HE4B 2PGDA 4NPFX 2GA1A 2I1JA 4ASWA 1KFMA 1SQPD 1LTJC 2PFXA 1HVVA 2I1KA 1IC2A 1K05A 3GHGB 1FOSF 1VQLP 1Q82Q 2ZYAA 3CI9A 2PP6A 1YBKA 1UIXA 4EI2A 3L75G 3L73G 3L75E 1SP4A 3PP5A 2M3EA 3L73E 3VMZA 4ZKUA 2AXTH 4L74A 1PFIA 1X8YA 5APQA 1USEA 2Y0CA 3CWBD 1N73C 3B4SA 4RKUJ 2E5YA 3TSIA 3AEBC 2YNYA 2JP3A 4H44D 3N4XA 3RK3E 3M9BA 1A02J 2Y0DA 3FX0A 5CMZA 1BSHA 3L74J 5AVUB 2FYUG 3MUDA 1EZVI 1SFCD 3HD7D 1LTIC 2FYUE 4Y99C 3IR9A 2HODA 2WSFJ 1NGMB 1Q90D 1GU4A 1G2CA 1L0LJ 1DEBA 4DOJA 1RY3A 2K1AA 3D6ZA 3H1KG 3AEAC 3R2PA 3H1KE 2W83C 1CSBA 5CJ4A 3AEGC 1GW4A 1UIIA 4WWIA 4IFMA 3IN6A 1JY3P 2VRSA 2NZ2A 1YQ4C 5AW3B 2WITA 3Q5PA 2AF7A 3Q1MA 1SFCB 3HD7B 3GLMA 4JYCA 3D71A 1NAFA 3L75J 3L73J 4AKRA 3TGUG 1GZLA 4EOTA 4ZKPA 3AE7C 3TGUE 2KNCA 1VKEA 2K88A 4WY4D 1NTZG 1IFIA 2IZ0A 1NTZE 5APTA 4JQ0D 2HG5D 2XZRA 3KZIE 1SQVG 2H8PD 2JDIH 1SQQG 4JPZB 1SQVE 3W67A 2E74D 1SQQE 1RF0C 5E79H 1DX7A 3V4WA 2KYVA 3S4RA 2JR8A 2FYUJ 2KZIA 1OVVA 3L74D 1HBWA 1HWTC 3H1LG 2KI7B 1KC8Q 2OYOA 1URQA 2R32A 1EXIA 3WUTA 4OH8B 4H0LD 3H1LE 1L4AB 1Y47A 2P67A 3VTPC 5KJ7C 2B87B 1DIPA 1OVUA 5AVWB 2N1TC 3SWYA 3CXHE 3IAOA 1JY2P 3H1KJ 4WY4B 1RF1C 3BCCD 1S5LH 2K3RA 1EZVD 2WSEJ 1FE6A 2WSCJ 2P7JA 2NPSA 4BXLA 2WPVB 3TNUB 3SSUA 1JO5A 1L0NK 1X22A 3Q2YA 4UB8E 4H0LB 2Q3EA 1M1JB 3B8EB 1AVYA 3AE6C 3TGUJ 1T6AA 3L73D 1BDCA 1RH5B 2A06D 2W27A 1NTZJ 1Q2NA 1DH3A 2XNDH 1SQVJ 3P7KA 5DJTB 5KLVG 5AW2B 1SQQJ 3M06A 3AE8C 3G6EP 5KLVE 2J58A 3CXHI 2IBZG 3B5NC 2HPCB 5CCGA 2B9BA 2IBZE 4LC1A 2CPBA 2OYIC 2HR3A 1LT9A 5APSA 3H1LJ 4R4LA 1EDJA 4L73A 1VQMP 1J1DB 3TK1A 2OTLP 4NPEA 3EQ2A 2QJKB 3FXDA 5BVZA 3AA6A 2G8YA 4C7NA 2BEZF 1YTZI 2OGUA 3BRVB 4GOEA 4B86A 1T2KD 3H1KD 1IFPA 2E74C 3KZIH 2KS1A 2FYZA 2WVRA 2GUVA 4HB1A 2BCCD 3RK3B 1W5CE 1ZXGA 1AJYA 2H89C 2IZ1A 1DD4A 3WMM0 2A45G 3MUDC 3CCVP 2IBZI 2KXPB 1KB9H 2YKPA 1P84H 4PV1B 1GL2D 2QA4P 2ES9A 1SLQA 4I2LC 3L4FA 1ZRTD 3A7OA 3C1LA 5AW1B 1NTZD 1GU5A 1SQPG 2FXOA 1G1JA 5KLVJ 5AVTB 2OARA 1R5SA 1SQPE 1JY3O 1ZV8A 1LP1B 1SQQD 2JJLA 1N7SC 3JCUE 1JNMA 2RH0A 2O1JA 4PJ0H 3IFMA 4K35A 1U57A 1OW7A 3H1LD 5CHXA 1SQXK 4UB8H 4RJTA 1VQ4P 2O1KA 4YXDC 2QM7A 2QEXP 1FZCA 4H13C 3CXHD 3SFDC 1FZFA 2A45I 4IL6X 1JTHA 2R5BA 2E42A 2W8ZA 3T97B 2OQQA 2IDBA 4EYYQ 3RK2D 2YMKA 3KHUA 3USSA 1L0LK 3L36A 2OYHA 4PD4H 2BASA 2IYPA 3A3YB 2OTKE 2N9YB 5B5EE 2M5AB 2M8RA 1KD1Q 1J1EC 3HUSB 1LTTC 1LWUC 3CC4P 2FKWB 1JMBA 1JB0J 5APYA 3M91A 1YJ9P 4HH2A 3A5TA 3P8MC 1URQC 5APWA 2KOGA 3CC2P 3SWKA 1KYOH 1S5LX 3HTKB 2JWDA
chains in the Genus database with same CATH topology
2KXPA 2AF7A 3BEYA 2PFXA 1IZNA 2CWQA 5AFUK 1KNCA 3AA0A 2IJCA 2OYOA 2Q0TA 3D7IA 3LK41 1GU9A 2KZ7A 1ME5A 3LVYA 1P8CA 4G9QA 2QEUA 5ADXK 2ES9A 2PRRA 3LK3A 2O4DA 4AKRA 3LK2A 3AAEA 3AA7A 5DIKA 3AA6A 3C1LA 2JN8A 3AA1A 1LW1A 5DIPA 3AAAA 2OUWA 2GMYA 1VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF7 A;  3BEY A;  2PFX A;  2CWQ A;  1KNC A;  2IJC A;  2OYO A;  2Q0T A;  3D7I A;  1GU9 A;  1ME5 A;  3LVY A;  1P8C A;  4G9Q A;  2QEU A;  2PRR A;  2O4D A;  5DIK A;  3C1L A;  1LW1 A;  5DIP A;  2OUW A;  2GMY A;  1VKE A; 
#chains in the Genus database with same CATH topology
 1SQP J;  1NOH A;  3RK2 B;  1KMI Z;  5KLV D;  2WTY A;  2ZT9 B;  1YI2 P;  3U1A A;  2NPS C;  1HJ0 A;  3A2A A;  1QX8 A;  1ZR4 A;  2Q1K A;  2KLU A;  1MV8 A;  3GW6 A;  1Z56 A;  1VQ7 P;  3KXD A;  1ZW0 A;  2FYU K;  1H88 A;  4ZNC A;  4DJG A;  1N7L A;  1G1I A;  3L72 G;  2B89 A;  3L72 E;  4W7Y A;  2KUB A;  3MZW B;  3HE5 B;  1QEX A;  5DIP A;  2FXM A;  3H6P A;  4D6T G;  5C39 A;  4D6T E;  3MGN A;  1H89 A;  4HJG H;  3L70 G;  2K37 A;  3L70 E;  1Q81 Q;  1KOR A;  1SFC A;  1LT9 C;  1R5L A;  1AQ5 A;  1LGH B;  5L8R J;  2RKL A;  5K5G B;  2XU6 A;  3BCC G;  1OW6 A;  3RL0 C;  3BCC E;  1GDT A;  1RE4 A;  1EZV G;  1YJN P;  4L76 A;  2V7Q J;  2C0W A;  1EZV E;  4KT0 J;  2XNX A;  5KAI H;  3EFF K;  3W68 A;  4C7R A;  5AVQ B;  3VP9 A;  1XTC C;  1NTZ K;  1WT6 A;  2O01 H;  1SVF A;  4K3A A;  2LR2 A;  3O6Q B;  3ITK A;  5GTH E;  1YJW P;  1PGO A;  2KSJ A;  1SQV K;  1NTM K;  1PPJ D;  4N3Y B;  3KPE A;  2E5T A;  4DZO A;  5KJ7 D;  2A06 G;  2V4H A;  4GIF A;  1L4A A;  2A06 E;  3H32 A;  1TU3 F;  2N1T D;  3EFG A;  1N86 A;  3V2P A;  3NTN A;  1FS0 E;  4QMA A;  4LLH A;  1VL2 A;  3L72 J;  1BE3 G;  1NU1 K;  1BE3 E;  1FDI A;  4WY4 A;  1IK7 A;  4D6T J;  1EXJ A;  2KB7 P;  2V7Q H;  2Z5H A;  4N78 D;  5BU8 B;  2IYO A;  1QVF O;  4OGQ C;  3L70 J;  4I7Z C;  3TNU A;  2Q5U A;  1AQT A;  5KAF E;  2I8D A;  2QJP C;  1OFC X;  1NWQ A;  5H2F H;  3E7K A;  1M1J A;  3BCC J;  2N1T B;  2FFD B;  1IZN B;  1USD A;  1RF1 B;  4RO0 A;  4C46 A;  1FZC C;  4XA4 A;  2BCC G;  1FDO A;  1E79 H;  4H44 B;  2AEM A;  1U7J A;  1NHL A;  2BCC E;  3B5N D;  3I56 P;  3M9H A;  2HPC A;  1VQK P;  2K9J B;  5M1B A;  2PAJ A;  1HH0 A;  1K73 Q;  1HGV A;  3TYY A;  2WSF H;  1ZRT E;  1OWA A;  2Q3I A;  2CWQ A;  1LT1 A;  2Q6Q A;  1CI6 B;  1BE3 J;  4RES B;  3L72 D;  1OXZ A;  5KLI C;  4Z1M H;  1VF5 C;  3O8Z A;  1S4X A;  2C9N Y;  1Y8A A;  4XE5 B;  4D6T D;  5APU A;  1CW5 A;  2QM8 A;  1NKN A;  1ZR2 A;  4N6J A;  1VQO P;  2XV5 A;  2KIK A;  2HLO A;  2OYI B;  1ZLL A;  2RMZ A;  2POH A;  3L70 D;  3LK3 A;  3LW5 J;  4YTP C;  2QRX A;  1RE3 A;  1VQ9 P;  2KXP A;  2QJY C;  1N8R Q;  5BU5 A;  1MKM A;  1NTK K;  2O3J A;  2WPQ A;  3L71 G;  5AW5 B;  2BCC J;  2P2U A;  3CCU P;  2E74 B;  1N7S D;  2KSE A;  3GF3 A;  1A02 F;  1IJD B;  1LP1 A;  3KQG A;  1OW8 A;  1PZQ A;  1MFZ A;  1SQP K;  4TT3 H;  2KZ7 A;  4NPD A;  3VP8 A;  3AED C;  2WSS H;  2O01 N;  3V4Q A;  1SQB D;  2P10 A;  1GK6 A;  3LW5 H;  4H13 D;  2H43 A;  2WMM A;  1JOC A;  4JF7 A;  5CBN A;  3II6 A;  2B88 A;  3VN0 A;  4G9Q A;  1BE3 D;  1RE4 C;  2WWW A;  4GOF A;  2CK3 H;  1LTG C;  5DIK A;  3BVH A;  1HGZ A;  2WSE H;  1N7S B;  2WSC H;  4EDF A;  2W6A A;  1FJP A;  1RQU A;  2WPR A;  4UB6 E;  2NRG A;  3CC7 P;  1EDK A;  2M5A A;  3KYQ A;  3D7I A;  1BDD A;  4O9B A;  3V2R A;  3CCQ P;  2MJZ A;  3CD6 P;  1URQ D;  3NFQ A;  4WBA A;  3FWN A;  5CJ0 A;  3WU2 E;  4BRY B;  1SS1 A;  2Z4E A;  1PP9 D;  1FU1 A;  2UWJ E;  1KIL A;  1L4A C;  3CL3 D;  4H13 B;  1RQV A;  2IJC A;  1X9V A;  2ZAE B;  3L71 J;  1T3U A;  3AE1 C;  2GUS A;  3CMA P;  2KLV A;  2QVA A;  1KZU B;  2NPS D;  4CPG A;  2W90 A;  1J1E B;  1LWU B;  1T8Z A;  4OVN F;  1R8E A;  1VDF A;  3TF5 A;  1PGJ A;  1URQ B;  3OA7 A;  2L5G B;  1PGQ A;  2GM4 A;  3L35 A;  1BCC G;  3CXH H;  5AW6 B;  1M1J C;  1BCC E;  1IFJ A;  3CX5 I;  1MFT A;  1ZP0 C;  3HE5 A;  3UIA A;  3V5B A;  1MUU A;  1FZB A;  1JCD A;  5CCH A;  1KFN A;  1PPJ G;  2WQY C;  1S72 P;  1PPJ E;  1GD2 E;  2NPS B;  1NJI Q;  3M0A A;  4YXW H;  2WT7 B;  2JEE A;  1GL2 B;  4OWF A;  2E75 C;  3RL0 D;  3A0H E;  1JMM A;  2AEJ A;  1H8A A;  1QVG O;  3AEF C;  3AE3 C;  1L2P A;  1KB9 D;  3Q5S A;  4Y28 J;  3SWF A;  2QJK C;  1FAV A;  1VQ6 P;  2KK7 A;  1S2E A;  3PRJ A;  5AVZ B;  3FGA D;  4L75 A;  1GU9 A;  3L71 D;  5AW8 B;  1FDM A;  3HE4 A;  4W80 A;  2ZFC A;  5AVR B;  2SPZ A;  4N78 E;  3M0D A;  4IFD K;  1QGK B;  1T3J A;  1FC2 C;  1WMK A;  3GHG A;  4KJM A;  3WUU A;  3TDK A;  2R3C A;  3O6Q A;  2E76 C;  4UB6 H;  1MZ9 A;  1X79 B;  2RN0 A;  3RK3 C;  1VQ8 P;  2FXP A;  1LT9 B;  4HYT B;  1H0T B;  1QL2 A;  3JSV C;  2YKQ A;  1JY2 O;  3RL0 B;  3H1I G;  3P32 A;  1RE3 C;  1BCC J;  2JN8 A;  3LIE A;  1M90 Q;  3H1I E;  3F5H A;  2LXC B;  2AXT E;  4PV1 C;  1AVO A;  3PHL A;  3ABV C;  4W7Z A;  1YIT P;  1LTJ B;  3E1R A;  1JCC A;  5B66 E;  2HYN A;  1IFD A;  3G4S P;  2KS1 B;  1RF0 A;  4OGQ D;  1OVR A;  1Q7Y Q;  5CBO A;  2M0B A;  4PD4 D;  5AVX B;  4GOD A;  3VMX A;  4BWN A;  2A45 H;  3CX5 D;  4JBZ A;  3GF7 A;  1NKZ B;  2C9L Y;  1K04 A;  2KP8 A;  1PV3 A;  1N73 B;  2N1T A;  2W6B A;  5TJH A;  2FFD A;  5AW4 B;  1AFO A;  1RF1 A;  1KTM A;  2K9Y A;  4A7P A;  3AE4 C;  1M1K Q;  5KKZ C;  2CPS A;  1GMJ A;  3JCU H;  5CCG C;  2MKV A;  1S3J A;  4OGQ B;  2LKM A;  4Y99 B;  3VMY A;  4I1L A;  4I7Z B;  3PLN A;  3HD7 A;  4HKZ H;  1W2E A;  2AEF A;  2K9J A;  1SQX G;  2Z5I A;  2P58 A;  2QJP B;  1YHQ P;  1SQX E;  2Y0E A;  1S9K D;  4EIJ A;  3H1I J;  1NAY A;  1CZQ A;  3AAE A;  3VYI A;  1IFN A;  1BCC D;  1FZC B;  1CI6 A;  3RBZ A;  1QLE D;  1KIL C;  1VF5 D;  1OMI A;  1RHZ B;  3PJS K;  2YIU C;  4ASV A;  2D2C C;  4IL6 E;  3EWK A;  4KHX A;  5B5E H;  1SQQ K;  1NO4 A;  1L0N D;  2FBW C;  2ZT9 C;  2GMY A;  2OYI A;  4U7J A;  1SQB G;  1VQN P;  3I5C A;  1SQB E;  2XKM A;  1AV1 A;  2B87 A;  2LXB A;  3Q3D A;  3R4Y A;  3KDP B;  2FY8 A;  5KLI B;  2ZYG A;  1VF5 B;  3BEY A;  1M57 D;  1JY3 N;  4IFF A;  1S5L E;  5EFW B;  3BAT A;  3P8C E;  1ZN5 A;  5B66 H;  5CCH C;  1S1C X;  2IX7 C;  2FYN C;  1PP9 G;  1KN7 A;  2Y9Z A;  1SQX J;  1YTZ T;  1DEE G;  2XDJ A;  1PP9 E;  1KV4 A;  2KZJ A;  3E1I A;  2Q0T A;  3QWO C;  2QJY B;  1YYC A;  2H7H A;  3A0B E;  5AVY B;  2QIW A;  3U1C A;  3H1I D;  3K5B A;  3MIW A;  1LW1 A;  1EDL A;  5AW7 B;  1NH4 A;  2M3B A;  1AA0 A;  2N9B A;  1LTB C;  1BGY D;  2OYH C;  1BSN A;  5AVV B;  3WUV A;  2WPS A;  1W2B O;  5KLV K;  1N7S A;  3M0D C;  2J5U A;  4U3F G;  3HRN A;  3GHG C;  4U3F E;  4I6M C;  3IF4 A;  1SQB J;  3LK2 A;  2H88 C;  2G3A A;  1FJK A;  4GDO A;  4BRY A;  1ZME C;  1L4A D;  1ME5 A;  1PIX A;  4AQR D;  3L37 A;  1JY2 N;  3MD0 A;  2ZYD A;  2P1J A;  3G9R A;  1PL5 A;  3OW2 O;  1Y9B A;  3SFE C;  4XFJ A;  2IFM A;  3AEC C;  1NVO A;  3B5N B;  1NTM G;  1QL1 A;  3I55 P;  1D7M A;  4GKG A;  1NTM E;  1J2J B;  2JWA A;  5GTH H;  4IL6 H;  2O4D A;  1HTL C;  1LWU A;  1GK4 A;  1PP9 J;  2J59 M;  2YMY A;  1SQX D;  1K9M Q;  1KB9 E;  3N7N A;  1P84 E;  1NU1 G;  3H32 B;  3JC2 2;  1KIL E;  1NU1 E;  2YKO A;  3L71 E;  1M8O B;  2FFD C;  1KQG B;  1L0L D;  2ZVN B;  2R3S A;  4H44 C;  2R5D A;  5GTI E;  4U3F J;  3H1J G;  1JM0 A;  2QSI A;  4PJ0 E;  1VPC A;  1VQ5 P;  5KAF H;  3H1H G;  2WT7 A;  3H1J E;  2HOD B;  1SFC C;  3HD7 C;  3CCE P;  2E75 D;  3H1H E;  3QH9 A;  1IFM A;  1GL2 A;  3M9Q A;  2ZJS E;  3V2Q A;  3MHV A;  2L91 A;  1G2C B;  3AE5 C;  3AE9 C;  1HUC A;  1FBM A;  3RGU A;  3A0B H;  3L75 D;  1Q86 Q;  3FXE A;  3T97 A;  3OJA B;  2R44 A;  1KB9 I;  1FZA A;  1LTS C;  1P84 I;  1OIP A;  1NTM J;  4PD4 E;  3P8C D;  3HUS A;  2E76 D;  2ZVO B;  3RK3 D;  3CX5 E;  2YO3 A;  4R4M A;  2ZXX A;  2OUW A;  2E75 B;  2FYU D;  1H0T A;  4DT0 A;  3G71 P;  3AE2 C;  1NU1 J;  2KNC B;  1HF9 A;  1PGP A;  4YPC A;  4PV1 D;  1P8C A;  3HTK A;  1IO4 A;  5APX A;  1KYO E;  3GG2 A;  2OTJ P;  1FZE A;  3RBX A;  4WY4 C;  4M3L A;  3RL0 g;  2IFN A;  1LTJ A;  3CME P;  3VMA A;  5AFU K;  3AA0 A;  3C8V A;  2E76 B;  1FOS E;  1JEK A;  4U3F D;  3H1J J;  3CCL P;  1S9K E;  3H1H J;  1EDI A;  2YXQ B;  1K8A Q;  4PD4 I;  1NTK G;  2JKV A;  4H0L C;  5AVS B;  1NTK E;  2QE7 H;  1KQL A;  2DW3 A;  3LVY A;  1N73 A;  3TGU D;  1NYH A;  1X0T A;  5TIS E;  3AEE C;  1KQS O;  2W6J H;  1WRG A;  1L0N G;  5CCG D;  3G3Z A;  1L0N E;  1KYO I;  1HJB A;  4AUW A;  1SQV D;  1NTM D;  3S9O A;  5GTI H;  3MP7 B;  3D70 A;  3FWL A;  1J1D C;  3AA1 A;  3NMD A;  4WB4 A;  2BEQ D;  3CPW O;  5AW9 B;  1P84 D;  1KIL D;  1NU1 D;  3CCJ P;  2QG4 A;  3U59 A;  3CWB G;  3CWB E;  2D2C D;  5KAI E;  1IK9 A;  5KKZ B;  3LID A;  3BRT B;  1M56 D;  4DCK A;  4LGD E;  1ZOY C;  2ZT9 D;  1EQ7 A;  4IOI H;  4AYC A;  1XTG B;  3ZDM A;  3CX5 H;  3H1J D;  5AW0 B;  3WU2 H;  1YQ3 C;  3H1H D;  1NTK J;  3PH0 A;  1GTW A;  1JUN A;  2HFE D;  4C7N B;  1SQB K;  5KTB A;  1LTA C;  1VQP P;  3LK4 1;  1KIL B;  1LNQ A;  1N2D C;  1BGY G;  1BGY E;  2YIU B;  2YO2 A;  4WVZ A;  1LJ2 A;  3CLQ A;  3V6I A;  1T2K C;  2Q9I A;  2D2C B;  2IPP A;  4MN4 C;  1L0N J;  5CCH D;  4TLF A;  3CCS P;  1M7L A;  4GT1 A;  2IBZ D;  3B71 A;  2QEU A;  5ADX K;  2ITA A;  3PTZ A;  5KJ7 A;  3BAS A;  5H2F E;  5APV A;  1IZN A;  1GL2 C;  1OX3 A;  3V2N A;  1EC5 A;  3D6Y A;  3OAK A;  3CWB J;  1KYO D;  3VOP A;  3MTU E;  2ZXE B;  2C0X A;  2JO1 A;  2Q7C A;  3C9I A;  5TIS H;  2E43 A;  1YIJ P;  3S1K A;  4ZMD A;  3H25 A;  2O01 J;  1KNC A;  3L74 G;  2Y9Y A;  2FYN B;  3HUS C;  1GW3 A;  3L74 E;  4JYB A;  3Q5R A;  1E5W A;  1DD3 A;  1U7M A;  3GMA A;  3A0H H;  3AAA A;  2YXR B;  1KQF B;  1NTK D;  5DJU B;  3CCR P;  3CCM P;  1L0L G;  1L0L E;  1JTH B;  1BGY J;  1FZG A;  3NXS A;  2AXC A;  2PRR A;  2WZ7 A;  3B5N A;  3F89 A;  2OYH B;  1OZH A;  3AA7 A;  3RK2 C;  5E79 E;  3HE4 B;  2PGD A;  4NPF X;  2GA1 A;  2I1J A;  4ASW A;  1KFM A;  1SQP D;  1LTJ C;  2PFX A;  1HVV A;  2I1K A;  1IC2 A;  1K05 A;  3GHG B;  1FOS F;  1VQL P;  1Q82 Q;  2ZYA A;  3CI9 A;  2PP6 A;  1YBK A;  1UIX A;  4EI2 A;  3L75 G;  3L73 G;  3L75 E;  1SP4 A;  3PP5 A;  2M3E A;  3L73 E;  3VMZ A;  4ZKU A;  2AXT H;  4L74 A;  1PFI A;  1X8Y A;  5APQ A;  1USE A;  2Y0C A;  3CWB D;  1N73 C;  3B4S A;  4RKU J;  2E5Y A;  3TSI A;  3AEB C;  2YNY A;  2JP3 A;  4H44 D;  3N4X A;  3RK3 E;  3M9B A;  1A02 J;  2Y0D A;  3FX0 A;  5CMZ A;  1BSH A;  3L74 J;  5AVU B;  2FYU G;  3MUD A;  1EZV I;  1SFC D;  3HD7 D;  1LTI C;  2FYU E;  4Y99 C;  3IR9 A;  2HOD A;  2WSF J;  1NGM B;  1Q90 D;  1GU4 A;  1G2C A;  1L0L J;  1DEB A;  4DOJ A;  1RY3 A;  2K1A A;  3D6Z A;  3H1K G;  3AEA C;  3R2P A;  3H1K E;  2W83 C;  1CSB A;  5CJ4 A;  3AEG C;  1GW4 A;  1UII A;  4WWI A;  4IFM A;  3IN6 A;  1JY3 P;  2VRS A;  2NZ2 A;  1YQ4 C;  5AW3 B;  2WIT A;  3Q5P A;  2AF7 A;  3Q1M A;  1SFC B;  3HD7 B;  3GLM A;  4JYC A;  3D71 A;  1NAF A;  3L75 J;  3L73 J;  4AKR A;  3TGU G;  1GZL A;  4EOT A;  4ZKP A;  3AE7 C;  3TGU E;  2KNC A;  1VKE A;  2K88 A;  4WY4 D;  1NTZ G;  1IFI A;  2IZ0 A;  1NTZ E;  5APT A;  4JQ0 D;  2HG5 D;  2XZR A;  3KZI E;  1SQV G;  2H8P D;  2JDI H;  1SQQ G;  4JPZ B;  1SQV E;  3W67 A;  2E74 D;  1SQQ E;  1RF0 C;  5E79 H;  1DX7 A;  3V4W A;  2KYV A;  3S4R A;  2JR8 A;  2FYU J;  2KZI A;  1OVV A;  3L74 D;  1HBW A;  1HWT C;  3H1L G;  2KI7 B;  1KC8 Q;  2OYO A;  1URQ A;  2R32 A;  1EXI A;  3WUT A;  4OH8 B;  4H0L D;  3H1L E;  1L4A B;  1Y47 A;  2P67 A;  3VTP C;  5KJ7 C;  2B87 B;  1DIP A;  1OVU A;  5AVW B;  2N1T C;  3SWY A;  3CXH E;  3IAO A;  1JY2 P;  3H1K J;  4WY4 B;  1RF1 C;  3BCC D;  1S5L H;  2K3R A;  1EZV D;  2WSE J;  1FE6 A;  2WSC J;  2P7J A;  2NPS A;  4BXL A;  2WPV B;  3TNU B;  3SSU A;  1JO5 A;  1L0N K;  1X22 A;  3Q2Y A;  4UB8 E;  4H0L B;  2Q3E A;  1M1J B;  3B8E B;  1AVY A;  3AE6 C;  3TGU J;  1T6A A;  3L73 D;  1BDC A;  1RH5 B;  2A06 D;  2W27 A;  1NTZ J;  1Q2N A;  1DH3 A;  2XND H;  1SQV J;  3P7K A;  5DJT B;  5KLV G;  5AW2 B;  1SQQ J;  3M06 A;  3AE8 C;  3G6E P;  5KLV E;  2J58 A;  3CXH I;  2IBZ G;  3B5N C;  2HPC B;  5CCG A;  2B9B A;  2IBZ E;  4LC1 A;  2CPB A;  2OYI C;  2HR3 A;  1LT9 A;  5APS A;  3H1L J;  4R4L A;  1EDJ A;  4L73 A;  1VQM P;  1J1D B;  3TK1 A;  2OTL P;  4NPE A;  3EQ2 A;  2QJK B;  3FXD A;  5BVZ A;  3AA6 A;  2G8Y A;  4C7N A;  2BEZ F;  1YTZ I;  2OGU A;  3BRV B;  4GOE A;  4B86 A;  1T2K D;  3H1K D;  1IFP A;  2E74 C;  3KZI H;  2KS1 A;  2FYZ A;  2WVR A;  2GUV A;  4HB1 A;  2BCC D;  3RK3 B;  1W5C E;  1ZXG A;  1AJY A;  2H89 C;  2IZ1 A;  1DD4 A;  3WMM 0;  2A45 G;  3MUD C;  3CCV P;  2IBZ I;  2KXP B;  1KB9 H;  2YKP A;  1P84 H;  4PV1 B;  1GL2 D;  2QA4 P;  2ES9 A;  1SLQ A;  4I2L C;  3L4F A;  1ZRT D;  3A7O A;  3C1L A;  5AW1 B;  1NTZ D;  1GU5 A;  1SQP G;  2FXO A;  1G1J A;  5KLV J;  5AVT B;  2OAR A;  1R5S A;  1SQP E;  1JY3 O;  1ZV8 A;  1LP1 B;  1SQQ D;  2JJL A;  1N7S C;  3JCU E;  1JNM A;  2RH0 A;  2O1J A;  4PJ0 H;  3IFM A;  4K35 A;  1U57 A;  1OW7 A;  3H1L D;  5CHX A;  1SQX K;  4UB8 H;  4RJT A;  1VQ4 P;  2O1K A;  4YXD C;  2QM7 A;  2QEX P;  1FZC A;  4H13 C;  3CXH D;  3SFD C;  1FZF A;  2A45 I;  4IL6 X;  1JTH A;  2R5B A;  2E42 A;  2W8Z A;  3T97 B;  2OQQ A;  2IDB A;  4EYY Q;  3RK2 D;  2YMK A;  3KHU A;  3USS A;  1L0L K;  3L36 A;  2OYH A;  4PD4 H;  2BAS A;  2IYP A;  3A3Y B;  2OTK E;  2N9Y B;  5B5E E;  2M5A B;  2M8R A;  1KD1 Q;  1J1E C;  3HUS B;  1LTT C;  1LWU C;  3CC4 P;  2FKW B;  1JMB A;  1JB0 J;  5APY A;  3M91 A;  1YJ9 P;  4HH2 A;  3A5T A;  3P8M C;  1URQ C;  5APW A;  2KOG A;  3CC2 P;  3SWK A;  1KYO H;  1S5L X;  3HTK B;  2JWD A; 
#chains in the Genus database with same CATH homology
 2KXP A;  2AF7 A;  3BEY A;  2PFX A;  1IZN A;  2CWQ A;  5AFU K;  1KNC A;  3AA0 A;  2IJC A;  2OYO A;  2Q0T A;  3D7I A;  3LK4 1;  1GU9 A;  2KZ7 A;  1ME5 A;  3LVY A;  1P8C A;  4G9Q A;  2QEU A;  5ADX K;  2ES9 A;  2PRR A;  3LK3 A;  2O4D A;  4AKR A;  3LK2 A;  3AAE A;  3AA7 A;  5DIK A;  3AA6 A;  3C1L A;  2JN8 A;  3AA1 A;  1LW1 A;  5DIP A;  3AAA A;  2OUW A;  2GMY A;  1VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...