3C1LA

Crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
KISALDLGELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESGLSKLDREMIAVAVSSINHCYYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAAFFNMSNRVAAAIDMRPNDEYHAMAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative antioxidant defense protein (NP_105057.1) from Mesorhizobium loti at 2.00 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
molecule keywords Putative antioxidant defense protein Mlr4105
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 3c1lA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 3c1lA02
3BEYA 2OUWA 2IJCA 1LW1A 2O4DA 2OYOA 1GU9A 5DIPA 2AF7A 4G9QA 3C1LA 3D7IA 2GMYA 2Q0TA 1KNCA 2PRRA 3LVYA 1VKEA 2PFXA 2CWQA 1P8CA 1ME5A 5DIKA 2QEUA
chains in the Genus database with same CATH superfamily
4A7PA 1SQXD 1YQ3C 3HD7C 1NTZK 1N2DC 1SQQD 3CI9A 5BU8B 2QJPB 3L36A 3LIEA 2AXTH 1EZVD 1SQPD 5KLIC 4YXDC 2A45H 2O4DA 4YPCA 3TGUE 1NU1K 1URQC 1HGZA 2YKPA 3NXSA 2HODB 2POHA 3HD7A 3HD7B 1Y9BA 2E74C 3SFEC 1GD2E 2AF7A 1J1DB 2OYIB 4M3LA 5TISH 1R8EA 1FOSE 1VQNP 1SQBK 1LJ2A 3GG2A 3L75E 3S4RA 1SQXG 1JCCA 2Y0CA 2H8PD 3KQGA 1OVVA 3RL0g 3MZWB 2GM4A 2HR3A 2IBZD 1SQBD 1EZVE 1SQPE 3OA7A 2H7HA 3BCCE 1NTZG 3H1KE 2PRRA 3JCUH 2M5AA 3TGUJ 1KTMA 2V4HA 3AEDC 1L0ND 2AEJA 3MP7B 4U3FD 3VP8A 2YO2A 1SQPK 5AVYB 4UB6H 1E79H 1S9KD 1RY3A 2E76B 3G6EP 5GTIH 3WUTA 4C7NB 5DIKA 2YXQB 1SQBG 3BEYA 1SQBE 1FE6A 1GK4A 1GK6A 2DW3A 1DEEG 3CXHI 5AW4B 2PAJA 2QE7H 1S4XA 3KPEA 1OW6A 1GDTA 3CCSP 1AFOA 1AJYA 1DH3A 4H44B 3RK3E 4EIJA 2FYUG 4BXLA 2WZ7A 4ZNCA 1BE3J 1ZLLA 1NTZE 2BCCJ 3O6QB 2C0WA 4XE5B 4DCKA 3CCJP 1UIXA 2G8YA 1LTJA 4H44D 5E79H 1OFCX 3CCVP 1JY3P 1S3JA 1SVFA 1HBWA 1JB0J 3CC7P 1MZ9A 1LTIC 3WMM0 1HH0A 4WBAA 4ASWA 1FZBA 4N78E 2QG4A 3GHGA 3AA1A 5APXA 2OTKE 3H32B 1L4AC 3NFQA 1ZW0A 4RO0A 3HUSA 1RHZB 3R2PA 3B71A 2Q3EA 2FYUK 3L70J 3MGNA 4QMAA 2RN0A 4W7ZA 5KLVD 1PGJA 2J59M 1SP4A 2FYUE 1GZLA 3CL3D 5CJ4A 1GL2B 1SFCD 4YTPC 1BCCD 2R32A 1LW1A 4JPZB 3E7KA 2OYOA 3HE5B 1KILB 1LWUA 3MTUE 3WU2E 3Q3DA 2W90A 1X79B 2IBZE 4UB6E 2WT7A 3HUSC 2KZIA 2ZT9D 1PFIA 2P1JA 1NTME 1L4AA 2ZJSE 1L0LJ 2JO1A 1T8ZA 2W6JH 4OGQB 1OMIA 5AVWB 4U3FJ 4IFDK 2J58A 2MKVA 3IR9A 4DZOA 3L72E 4XFJA 2Q0TA 3L37A 4OGQD 1KILA 3Q5SA 3H1KG 5GTIE 5KLVE 2KB7P 1JOCA 1X8YA 1YTZI 2FYUD 3IAOA 3H1JG 2FYNC 1JMMA 3B5NA 3D71A 1JCDA 1KB9E 2K37A 2O1KA 2FFDA 4UB8H 2QJYC 2ZYAA 2ITAA 3L75G 4JYBA 1SLQA 1S5LH 4W7YA 2OTJP 3AE1C 2AXTE 3VN0A 2WSCH 3AE4C 1NH4A 1AQTA 1EC5A 3A7OA 3AEAC 2O01J 3H32A 3L72D 1HUCA 1NHLA 1KYOI 3KZIE 4I7ZC 1IK9A 1BCCJ 1ZP0C 1WRGA 2UWJE 1D7MA 1FJKA 2IZ0A 3B8EB 1LWUB 1NU1G 3H6PA 1W2BO 3L75D 4BRYA 3Q2YA 2RH0A 4IFFA 5CCGD 1A02F 1KMIZ 1S5LX 1EQ7A 2YO3A 3GF7A 3O6QA 4RESB 1NO4A 1BGYJ 4TLFA 4W80A 3CCUP 1CW5A 4GOFA 3ITKA 1AVOA 5KKZC 3M9BA 4L74A 4R4LA 3BCCJ 1PP9J 3L71E 3T97A 1EDJA 2CPBA 2XZRA 3FX0A 1YBKA 1NU1E 3BVHA 1JY2P 2WPSA 2IFNA 3WUVA 2KZ7A 1PL5A 1RQUA 1BDCA 2N1TC 1GW4A 2PFXA 4R4MA 1PP9G 1X9VA 3A3YB 3FXDA 2GUSA 1QL1A 3FGAD 3CWBG 1J1DC 4CPGA 3IF4A 1LTJB 3A5TA 3RBXA 4PV1C 4IFMA 4ASVA 5CBNA 1VL2A 1MUUA 1Q82Q 1PPJE 2D2CB 3HE4A 2Y9ZA 1A02J 2KIKA 1SQVE 1VF5B 3L73J 5DIPA 3KYQA 1QLED 1BCCG 2OARA 5EFWB 2E76C 2KXPB 1BE3E 2OQQA 1HGVA 4EI2A 2JKVA 1LTAC 1T3UA 2QIWA 3GHGC 3PLNA 5CCHA 5KAFH 4WVZA 2H88C 3VYIA 4NPFX 1KQGB 1QX8A 4N3YB 1OVUA 3TGUD 2O01H 3M0AA 3TK1A 1IFJA 2QA4P 2WPRA 5CCHC 3VP9A 1NTKE 3A0BE 3GF3A 1JTHA 3II6A 4H44C 1UIIA 2W6BA 1VQLP 1P84I 2KS1B 1GTWA 1Y8AA 3FXEA 1CSBA 1CZQA 1N86A 3A2AA 1BSNA 5CCGA 3CC4P 3V4WA 3RL0C 1DEBA 2K9YA 3OJAB 5AW1B 1YIJP 1URQA 1KYOD 1L4AD 2A06D 3P8MC 4WY4A 1L0LG 2J5UA 1HTLC 3LK3A 4BRYB 2N9BA 1SQQJ 3H1IE 5CBOA 1T3JA 2W8ZA 2HODA 3A0HE 1T2KD 2ZVOB 1OWAA 2OGUA 1PP9D 2Z5IA 4WY4C 1GU5A 2GUVA 2B88A 3C8VA 5AVTB 1YITP 5L8RJ 2O3JA 2KNCB 2RKLA 4N6JA 2A45I 3AA6A 1NTMD 3M9HA 3RK2B 2BCCE 3VTPC 1RH5B 2WPVB 3HD7D 1JY3O 2QEXP 5TJHA 3L74E 1M1JA 1JNMA 3B5NB 1SS1A 2B87B 2FXPA 3G71P 3EFGA 1KYOE 1MV8A 3MD0A 3SSUA 1USDA 2QJPC 3AE3C 1J1EC 1K8AQ 3BCCD 4H13B 3TDKA 2HG5D 3VMXA 1KN7A 3MIWA 1FU1A 4HH2A 1FZGA 4IL6E 1FDOA 3GMAA 3CLQA 2FYUJ 2CK3H 3CWBD 2FY8A 4Y28J 1AA0A 2I8DA 2AEMA 5AVVB 1LNQA 1R5LA 1VDFA 3JSVC 3BATA 1G2CA 2E74D 3PHLA 2WT7B 3AEBC 1SQQG 1PGPA 2BCCD 2GA1A 3BCCG 5B66H 5KKZB 1EZVG 1SQPG 2NZ2A 2ZYGA 1IFNA 3G9RA 3RGUA 1VQ8P 1KILE 3CX5I 3H1HD 2L5GB 3RK3C 2N1TA 1Q2NA 1SQXE 2YMYA 3QH9A 1RF0A 2C0XA 3N7NA 1JMBA 2IFMA 2P67A 2P2UA 3Q5RA 3PP5A 4OGQC 1IK7A 2LR2A 1FZAA 4C46A 3OW2O 2KOGA 3TGUG 3I5CA 2JWAA 4L75A 4EDFA 1VKEA 2E75B 5APTA 1NAYA 2QVAA 2XV5A 1LT9A 1LTSC 4LC1A 1FZEA 2QEUA 4N78D 1N73B 2LKMA 2E5YA 2AEFA 3F89A 1BGYD 2E43A 2Q5UA 1KZUB 1LTGC 4PD4E 3ZDMA 4AUWA 1KILD 1EDKA 2KSJA 4K35A 3T97B 1JY3N 3H1JJ 3L73E 4YXWH 3IFMA 2OYIC 2B87A 2A06G 2IYPA 3AEFC 3L73G 3W68A 5KJ7A 3TSIA 3CC2P 1JY2O 1Q90D 2OYHA 3Q5PA 3WUUA 4JBZA 1GL2D 2Q7CA 1S72P 5AVZB 5GTHH 1G1IA 1M1KQ 2N9YB 2C9NY 3CXHE 1SQPJ 1LTJC 1SFCC 1NJIQ 1XTCC 2ZVNB 1YJNP 1M7LA 3L73D 1VF5D 4Z1MH 2K88A 2OYHC 4GOEA 2Y0EA 2M5AB 4B86A 3VMZA 1NOHA 3FWNA 3GLMA 5B5EE 3P8CD 1H0TB 1LTBC 2R3SA 1JEKA 2I1KA 3HTKB 4U3FE 1HJ0A 5H2FE 5KAIH 3AE5C 2Q9IA 1S1CX 1YI2P 3H1LE 3JC22 3L70G 1NU1D 1XTGB 3OAKA 5AW6B 4PV1D 1EXJA 1H0TA 5APYA 2OYIA 1M57D 2IJCA 3AA0A 5ADXK 1SQQK 2W6AA 1NU1J 2WSSH 3CXHD 2M3EA 1PZQA 2ZT9C 2JEEA 4PV1B 1JO5A 3B5NC 2YKOA 2JWDA 3M0DA 4D6TE 3CMAP 1W2EA 3CD6P 1T2KC 2JR8A 2KZJA 4I2LC 2FXOA 1P84H 4HB1A 4JQ0D 1DX7A 2B89A 1PPJD 3D7IA 2E42A 2NPSD 3LIDA 1SFCA 1NKZB 2KXPA 1KILC 2G3AA 1QGKB 3NMDA 2YIUC 1KQFB 2Q3IA 2QJYB 3S9OA 3V2QA 3V6IA 3H25A 3AAAA 1Y47A 2I1JA 4HYTB 3TNUA 3TYYA 3H1KJ 2R5DA 4D6TJ 1Z56A 3MUDA 1SQBJ 4L73A 1ME5A 1KQSO 1QL2A 1HVVA 1GMJA 1RE3A 2KYVA 1YTZT 2ZXXA 3CX5E 3MHVA 1LWUC 1P84D 3R4YA 3UIAA 2M8RA 3EQ2A 1FOSF 3QWOC 1RF1B 1VQKP 1WT6A 1OW8A 3CX5H 3CCLP 2XNXA 3RK3D 1NTZJ 1FZCA 3H1HE 2JDIH 3AE7C 1L0LE 1ZRTD 3M06A 2K3RA 3B4SA 1LGHB 2QSIA 3SWFA 2OTLP 3PTZA 1NTZD 2P7JA 4WB4A 1SQXJ 2WMMA 1DD3A 2NPSA 3C1LA 3V5BA 4EYYQ 2QJKB 1YJ9P 2FYNB 1NWQA 4WY4D 3A0BH 2YMKA 5K5GB 2FFDC 5AVRB 2KP8A 2KLVA 4HJGH 2WTYA 3AECC 1OX3A 2JN8A 1Q7YQ 1L0NE 2Z5HA 1X0TA 2IZ1A 1GW3A 3CX5D 4MN4C 5KAFE 1MFTA 3L4FA 1RE4C 2B9BA 2E76D 3H1KD 3I55P 3CMEP 2CWQA 1EDLA 2XNDH 3VMAA 2FXMA 3AA7A 3KDPB 1U7JA 3CWBJ 2R3CA 3H1HG 2N1TB 3H1LG 3V4QA 3L74D 1BE3G 4PJ0E 4DT0A 3TF5A 2HYNA 4JYCA 1YHQP 1JUNA 1ZR2A 1L0NK 1QEXA 2LXCB 2QM8A 1IFDA 1SQVG 5CHXA 1CI6A 3USSA 3G4SP 2E5TA 3V2RA 1FZCB 1J2JB 1ZOYC 2LXBA 4AQRD 1VQ5P 2ES9A 5M1BA 3SFDC 5APSA 1VQ7P 3CWBE 3D70A 3EWKA 5KLVJ 3VMYA 1PP9E 5AVQB 1L0LK 2QRXA 3P32A 2CPSA 1BDDA 2E75D 2NRGA 1FS0E 1U57A 1P84E 2WSCJ 3P8CE 1KORA 4I1LA 3VOPA 1ZR4A 1H88A 3L35A 3PH0A 2KI7B 3TNUB 4K3AA 3L71G 1N73A 3AAEA 1EDIA 3H1LD 4GKGA 1K04A 4H13D 4WY4B 2RMZA 3SWKA 1X22A 1KD1Q 1IJDB 1SQXK 3E1IA 1SFCB 2AXCA 2IX7C 3L75J 1NKNA 1N7SB 1PGOA 1ZV8A 3AE2C 2KNCA 3KZIH 4BWNA 2WITA 5AW2B 3SWYA 1CI6B 2H89C 2R44A 5H2FH 3MUDC 5APUA 1PV3A 2YXRB 2WPQA 1L0LD 3AEGC 2IPPA 1IFMA 3ABVC 3L70E 5AVXB 2K9JB 4LGDE 4ZKUA 5KTBA 3CCQP 4AKRA 2Y9YA 4U3FG 1KB9H 4PD4D 3F5HA 1BGYG 1BGYE 3AE8C 3C9IA 1URQD 4I6MC 3LW5J 2ZXEB 4L76A 5APWA 1QVGO 1GU4A 1K9MQ 4H0LB 1K73Q 2PGDA 1N7SC 2V7QH 2L91A 5GTHE 2Y0DA 3CCRP 3D6ZA 1SQQE 1ZXGA 3H1IJ 3K5BA 4H0LC 2VRSA 2YKQA 2H43A 1GL2C 1EZVI 3L72G 3N4XA 1BSHA 4Y99B 1RF1C 4C7RA 5B66E 2ZAEB 2NPSB 1KB9D 1OVRA 4PD4H 3WU2H 2OUWA 5AW3B 1FDMA 1HF9A 1NGMB 1NTMG 3KHUA 2ZFCA 2PP6A 1KFNA 1M1JB 3RBZA 1QVFO 1ZRTE 4IL6H 2O01N 2BASA 3L74J 3NTNA 2WSFJ 1N8RQ 2HLOA 1BE3D 3E1RA 3BRVB 5CCGC 3M91A 4I7ZB 4AYCA 3CPWO 4GODA 1KC8Q 2KLUA 1KYOH 1RQVA 1YJWP 1M90Q 1LTTC 1KQLA 2WVRA 1VPCA 2BCCG 2GMYA 1T6AA 1E5WA 5BU5A 2KK7A 3V2PA 3V2NA 4JF7A 4TT3H 4DOJA 1VQPP 1J1EB 1IZNA 1KNCA 2D2CD 3U1CA 3LVYA 2IYOA 5E79E 1FAVA 2WSEH 1NTKJ 3O8ZA 1URQB 3PJSK 4GIFA 1M56D 1PIXA 4NPDA 1VQOP 1OW7A 3LK41 1USEA 3HRNA 2XKMA 2D2CC 5KLIB 1YQ4C 4RKUJ 2KSEA 2WQYC 4RJTA 2KS1A 4PJ0H 3RK3B 1FZCC 2K9JA 2QJKC 2FFDB 1FC2C 1JTHB 1RE3C 5CJ0A 2IBZI 5AW0B 1L0NG 1OXZA 1SQVK 3BRTB 4OH8B 1ZMEC 2WSEJ 3AE9C 4NPEA 4PD4I 3H1JD 1FJPA 4DJGA 1N7SA 3CCMP 3H1LJ 2E75C 2OYHB 4U7JA 3AE6C 3JCUE 2YNYA 1IZNB 1L4AB 1RF0C 3HTKA 2HPCB 1KV4A 1VF5C 1EXIA 3HE4B 3L74G 2E74B 5AW8B 1W5CE 3G3ZA 1BCCE 1AV1A 1R5SA 3HE5A 5KJ7D 2KUBA 2Q6QA 1NTMJ 2XDJA 3M0DC 1TU3F 2P58A 2Q1KA 1NTKD 1PGQA 1PPJG 2BEQD 3AEEC 3BASA 1NAFA 3P7KA 1LT9B 3A0HH 4IL6X 4KJMA 5KJ7C 3I56P 3D6YA 1M8OB 3L71D 1DD4A 4HKZH 4IOIH 3HUSB 1IFPA 2XU6A 1LP1A 4OVNF 3W67A 3Q1MA 1JY2N 1U7MA 1KB9I 1VQMP 2JJLA 2FKWB 3GHGB 2IDBA 3H1IG 1FDIA 1IC2A 4ZMDA 3L70D 1L0NJ 1N73C 1GU9A 3B5ND 1LT1A 1MFZA 1LT9C 5DJTB 5TISE 3GW6A 1IFIA 2V7QJ 2MJZA 3RK2D 5BVZA 1VQ9P 2ZT9B 1GL2A 3EFFK 1WMKA 2R5BA 3U1AA 1IO4A 1AVYA 1SQVD 4D6TG 1NTKG 2M3BA 2QM7A 1N7LA 2WWWA 3PRJA 4Y99C 5CMZA 2O1JA 4WWIA 1HWTC 4LLHA 2ZYDA 5KLVK 1Q81Q 5AVUB 5AW5B 1LP1B 3IN6A 2YIUB 1YYCA 1VQ4P 1N7SD 2FBWC 1P8CA 1H89A 3CCEP 1S9KE 4C7NA 5AW9B 1FBMA 2WSFH 3U59A 4H0LD 2P10A 4ZKPA 1FZFA 3S1KA 2SPZA 2W27A 3L71J 5AW7B 5CCHD 1NTMK 1H8AA 2FYZA 2W83C 3RL0D 1RE4A 1G2CB 1S2EA 5DJUB 5KAIE 3KXDA 4EOTA 1NTKK 2JP3A 1MKMA 1G1JA 3H1JE 1S5LE 5B5EH 4H13C 1RF1A 4GT1A 3RL0B 2N1TD 4UB8E 1M1JC 5KLVG 4KT0J 2HPCA 4D6TD 5AVSB 4G9QA 1JM0A 1OIPA 3FWLA 3M9QA 4GDOA 4O9BA 3LK2A 5APVA 1Q86Q 1AQ5A 1VQ6P 2NPSC 3H1ID 2K1AA 2BEZF 1OZHA 3CXHH 3L72J 4OWFA 1HJBA 1SQVJ 5APQA 2Z4EA 2A06E 3RK2C 1NVOA 3LW5H 1DIPA 5AFUK 2HFED 2IBZG 3H1HJ 1NYHA 2C9LY 1K05A 1ZN5A 5C39A 1KFMA 2M0BA 4KHXA 4XA4A 2A45G 1L2PA
chains in the Genus database with same CATH topology
3BEYA 2OUWA 2IJCA 1LW1A 3LK3A 2O4DA 3AA0A 5ADXK 2KZ7A 2OYOA 1GU9A 5DIPA 2AF7A 4AKRA 4G9QA 2ES9A 3LK2A 3AA6A 3C1LA 3D7IA 2GMYA 2KXPA 2Q0TA 2JN8A 1KNCA 2PRRA 3AAAA 3AA1A 3LVYA 5AFUK 3AAEA 1VKEA 2PFXA 2CWQA 1IZNA 3LK41 1P8CA 1ME5A 3AA7A 5DIKA 2QEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEY A;  2OUW A;  2IJC A;  1LW1 A;  2O4D A;  2OYO A;  1GU9 A;  5DIP A;  2AF7 A;  4G9Q A;  3C1L A;  3D7I A;  2GMY A;  2Q0T A;  1KNC A;  2PRR A;  3LVY A;  1VKE A;  2PFX A;  2CWQ A;  1P8C A;  1ME5 A;  5DIK A;  2QEU A; 
#chains in the Genus database with same CATH topology
 4A7P A;  1SQX D;  1YQ3 C;  3HD7 C;  1NTZ K;  1N2D C;  1SQQ D;  3CI9 A;  5BU8 B;  2QJP B;  3L36 A;  3LIE A;  2AXT H;  1EZV D;  1SQP D;  5KLI C;  4YXD C;  2A45 H;  2O4D A;  4YPC A;  3TGU E;  1NU1 K;  1URQ C;  1HGZ A;  2YKP A;  3NXS A;  2HOD B;  2POH A;  3HD7 A;  3HD7 B;  1Y9B A;  2E74 C;  3SFE C;  1GD2 E;  2AF7 A;  1J1D B;  2OYI B;  4M3L A;  5TIS H;  1R8E A;  1FOS E;  1VQN P;  1SQB K;  1LJ2 A;  3GG2 A;  3L75 E;  3S4R A;  1SQX G;  1JCC A;  2Y0C A;  2H8P D;  3KQG A;  1OVV A;  3RL0 g;  3MZW B;  2GM4 A;  2HR3 A;  2IBZ D;  1SQB D;  1EZV E;  1SQP E;  3OA7 A;  2H7H A;  3BCC E;  1NTZ G;  3H1K E;  2PRR A;  3JCU H;  2M5A A;  3TGU J;  1KTM A;  2V4H A;  3AED C;  1L0N D;  2AEJ A;  3MP7 B;  4U3F D;  3VP8 A;  2YO2 A;  1SQP K;  5AVY B;  4UB6 H;  1E79 H;  1S9K D;  1RY3 A;  2E76 B;  3G6E P;  5GTI H;  3WUT A;  4C7N B;  5DIK A;  2YXQ B;  1SQB G;  3BEY A;  1SQB E;  1FE6 A;  1GK4 A;  1GK6 A;  2DW3 A;  1DEE G;  3CXH I;  5AW4 B;  2PAJ A;  2QE7 H;  1S4X A;  3KPE A;  1OW6 A;  1GDT A;  3CCS P;  1AFO A;  1AJY A;  1DH3 A;  4H44 B;  3RK3 E;  4EIJ A;  2FYU G;  4BXL A;  2WZ7 A;  4ZNC A;  1BE3 J;  1ZLL A;  1NTZ E;  2BCC J;  3O6Q B;  2C0W A;  4XE5 B;  4DCK A;  3CCJ P;  1UIX A;  2G8Y A;  1LTJ A;  4H44 D;  5E79 H;  1OFC X;  3CCV P;  1JY3 P;  1S3J A;  1SVF A;  1HBW A;  1JB0 J;  3CC7 P;  1MZ9 A;  1LTI C;  3WMM 0;  1HH0 A;  4WBA A;  4ASW A;  1FZB A;  4N78 E;  2QG4 A;  3GHG A;  3AA1 A;  5APX A;  2OTK E;  3H32 B;  1L4A C;  3NFQ A;  1ZW0 A;  4RO0 A;  3HUS A;  1RHZ B;  3R2P A;  3B71 A;  2Q3E A;  2FYU K;  3L70 J;  3MGN A;  4QMA A;  2RN0 A;  4W7Z A;  5KLV D;  1PGJ A;  2J59 M;  1SP4 A;  2FYU E;  1GZL A;  3CL3 D;  5CJ4 A;  1GL2 B;  1SFC D;  4YTP C;  1BCC D;  2R32 A;  1LW1 A;  4JPZ B;  3E7K A;  2OYO A;  3HE5 B;  1KIL B;  1LWU A;  3MTU E;  3WU2 E;  3Q3D A;  2W90 A;  1X79 B;  2IBZ E;  4UB6 E;  2WT7 A;  3HUS C;  2KZI A;  2ZT9 D;  1PFI A;  2P1J A;  1NTM E;  1L4A A;  2ZJS E;  1L0L J;  2JO1 A;  1T8Z A;  2W6J H;  4OGQ B;  1OMI A;  5AVW B;  4U3F J;  4IFD K;  2J58 A;  2MKV A;  3IR9 A;  4DZO A;  3L72 E;  4XFJ A;  2Q0T A;  3L37 A;  4OGQ D;  1KIL A;  3Q5S A;  3H1K G;  5GTI E;  5KLV E;  2KB7 P;  1JOC A;  1X8Y A;  1YTZ I;  2FYU D;  3IAO A;  3H1J G;  2FYN C;  1JMM A;  3B5N A;  3D71 A;  1JCD A;  1KB9 E;  2K37 A;  2O1K A;  2FFD A;  4UB8 H;  2QJY C;  2ZYA A;  2ITA A;  3L75 G;  4JYB A;  1SLQ A;  1S5L H;  4W7Y A;  2OTJ P;  3AE1 C;  2AXT E;  3VN0 A;  2WSC H;  3AE4 C;  1NH4 A;  1AQT A;  1EC5 A;  3A7O A;  3AEA C;  2O01 J;  3H32 A;  3L72 D;  1HUC A;  1NHL A;  1KYO I;  3KZI E;  4I7Z C;  1IK9 A;  1BCC J;  1ZP0 C;  1WRG A;  2UWJ E;  1D7M A;  1FJK A;  2IZ0 A;  3B8E B;  1LWU B;  1NU1 G;  3H6P A;  1W2B O;  3L75 D;  4BRY A;  3Q2Y A;  2RH0 A;  4IFF A;  5CCG D;  1A02 F;  1KMI Z;  1S5L X;  1EQ7 A;  2YO3 A;  3GF7 A;  3O6Q A;  4RES B;  1NO4 A;  1BGY J;  4TLF A;  4W80 A;  3CCU P;  1CW5 A;  4GOF A;  3ITK A;  1AVO A;  5KKZ C;  3M9B A;  4L74 A;  4R4L A;  3BCC J;  1PP9 J;  3L71 E;  3T97 A;  1EDJ A;  2CPB A;  2XZR A;  3FX0 A;  1YBK A;  1NU1 E;  3BVH A;  1JY2 P;  2WPS A;  2IFN A;  3WUV A;  2KZ7 A;  1PL5 A;  1RQU A;  1BDC A;  2N1T C;  1GW4 A;  2PFX A;  4R4M A;  1PP9 G;  1X9V A;  3A3Y B;  3FXD A;  2GUS A;  1QL1 A;  3FGA D;  3CWB G;  1J1D C;  4CPG A;  3IF4 A;  1LTJ B;  3A5T A;  3RBX A;  4PV1 C;  4IFM A;  4ASV A;  5CBN A;  1VL2 A;  1MUU A;  1Q82 Q;  1PPJ E;  2D2C B;  3HE4 A;  2Y9Z A;  1A02 J;  2KIK A;  1SQV E;  1VF5 B;  3L73 J;  5DIP A;  3KYQ A;  1QLE D;  1BCC G;  2OAR A;  5EFW B;  2E76 C;  2KXP B;  1BE3 E;  2OQQ A;  1HGV A;  4EI2 A;  2JKV A;  1LTA C;  1T3U A;  2QIW A;  3GHG C;  3PLN A;  5CCH A;  5KAF H;  4WVZ A;  2H88 C;  3VYI A;  4NPF X;  1KQG B;  1QX8 A;  4N3Y B;  1OVU A;  3TGU D;  2O01 H;  3M0A A;  3TK1 A;  1IFJ A;  2QA4 P;  2WPR A;  5CCH C;  3VP9 A;  1NTK E;  3A0B E;  3GF3 A;  1JTH A;  3II6 A;  4H44 C;  1UII A;  2W6B A;  1VQL P;  1P84 I;  2KS1 B;  1GTW A;  1Y8A A;  3FXE A;  1CSB A;  1CZQ A;  1N86 A;  3A2A A;  1BSN A;  5CCG A;  3CC4 P;  3V4W A;  3RL0 C;  1DEB A;  2K9Y A;  3OJA B;  5AW1 B;  1YIJ P;  1URQ A;  1KYO D;  1L4A D;  2A06 D;  3P8M C;  4WY4 A;  1L0L G;  2J5U A;  1HTL C;  3LK3 A;  4BRY B;  2N9B A;  1SQQ J;  3H1I E;  5CBO A;  1T3J A;  2W8Z A;  2HOD A;  3A0H E;  1T2K D;  2ZVO B;  1OWA A;  2OGU A;  1PP9 D;  2Z5I A;  4WY4 C;  1GU5 A;  2GUV A;  2B88 A;  3C8V A;  5AVT B;  1YIT P;  5L8R J;  2O3J A;  2KNC B;  2RKL A;  4N6J A;  2A45 I;  3AA6 A;  1NTM D;  3M9H A;  3RK2 B;  2BCC E;  3VTP C;  1RH5 B;  2WPV B;  3HD7 D;  1JY3 O;  2QEX P;  5TJH A;  3L74 E;  1M1J A;  1JNM A;  3B5N B;  1SS1 A;  2B87 B;  2FXP A;  3G71 P;  3EFG A;  1KYO E;  1MV8 A;  3MD0 A;  3SSU A;  1USD A;  2QJP C;  3AE3 C;  1J1E C;  1K8A Q;  3BCC D;  4H13 B;  3TDK A;  2HG5 D;  3VMX A;  1KN7 A;  3MIW A;  1FU1 A;  4HH2 A;  1FZG A;  4IL6 E;  1FDO A;  3GMA A;  3CLQ A;  2FYU J;  2CK3 H;  3CWB D;  2FY8 A;  4Y28 J;  1AA0 A;  2I8D A;  2AEM A;  5AVV B;  1LNQ A;  1R5L A;  1VDF A;  3JSV C;  3BAT A;  1G2C A;  2E74 D;  3PHL A;  2WT7 B;  3AEB C;  1SQQ G;  1PGP A;  2BCC D;  2GA1 A;  3BCC G;  5B66 H;  5KKZ B;  1EZV G;  1SQP G;  2NZ2 A;  2ZYG A;  1IFN A;  3G9R A;  3RGU A;  1VQ8 P;  1KIL E;  3CX5 I;  3H1H D;  2L5G B;  3RK3 C;  2N1T A;  1Q2N A;  1SQX E;  2YMY A;  3QH9 A;  1RF0 A;  2C0X A;  3N7N A;  1JMB A;  2IFM A;  2P67 A;  2P2U A;  3Q5R A;  3PP5 A;  4OGQ C;  1IK7 A;  2LR2 A;  1FZA A;  4C46 A;  3OW2 O;  2KOG A;  3TGU G;  3I5C A;  2JWA A;  4L75 A;  4EDF A;  1VKE A;  2E75 B;  5APT A;  1NAY A;  2QVA A;  2XV5 A;  1LT9 A;  1LTS C;  4LC1 A;  1FZE A;  2QEU A;  4N78 D;  1N73 B;  2LKM A;  2E5Y A;  2AEF A;  3F89 A;  1BGY D;  2E43 A;  2Q5U A;  1KZU B;  1LTG C;  4PD4 E;  3ZDM A;  4AUW A;  1KIL D;  1EDK A;  2KSJ A;  4K35 A;  3T97 B;  1JY3 N;  3H1J J;  3L73 E;  4YXW H;  3IFM A;  2OYI C;  2B87 A;  2A06 G;  2IYP A;  3AEF C;  3L73 G;  3W68 A;  5KJ7 A;  3TSI A;  3CC2 P;  1JY2 O;  1Q90 D;  2OYH A;  3Q5P A;  3WUU A;  4JBZ A;  1GL2 D;  2Q7C A;  1S72 P;  5AVZ B;  5GTH H;  1G1I A;  1M1K Q;  2N9Y B;  2C9N Y;  3CXH E;  1SQP J;  1LTJ C;  1SFC C;  1NJI Q;  1XTC C;  2ZVN B;  1YJN P;  1M7L A;  3L73 D;  1VF5 D;  4Z1M H;  2K88 A;  2OYH C;  4GOE A;  2Y0E A;  2M5A B;  4B86 A;  3VMZ A;  1NOH A;  3FWN A;  3GLM A;  5B5E E;  3P8C D;  1H0T B;  1LTB C;  2R3S A;  1JEK A;  2I1K A;  3HTK B;  4U3F E;  1HJ0 A;  5H2F E;  5KAI H;  3AE5 C;  2Q9I A;  1S1C X;  1YI2 P;  3H1L E;  3JC2 2;  3L70 G;  1NU1 D;  1XTG B;  3OAK A;  5AW6 B;  4PV1 D;  1EXJ A;  1H0T A;  5APY A;  2OYI A;  1M57 D;  2IJC A;  3AA0 A;  5ADX K;  1SQQ K;  2W6A A;  1NU1 J;  2WSS H;  3CXH D;  2M3E A;  1PZQ A;  2ZT9 C;  2JEE A;  4PV1 B;  1JO5 A;  3B5N C;  2YKO A;  2JWD A;  3M0D A;  4D6T E;  3CMA P;  1W2E A;  3CD6 P;  1T2K C;  2JR8 A;  2KZJ A;  4I2L C;  2FXO A;  1P84 H;  4HB1 A;  4JQ0 D;  1DX7 A;  2B89 A;  1PPJ D;  3D7I A;  2E42 A;  2NPS D;  3LID A;  1SFC A;  1NKZ B;  2KXP A;  1KIL C;  2G3A A;  1QGK B;  3NMD A;  2YIU C;  1KQF B;  2Q3I A;  2QJY B;  3S9O A;  3V2Q A;  3V6I A;  3H25 A;  3AAA A;  1Y47 A;  2I1J A;  4HYT B;  3TNU A;  3TYY A;  3H1K J;  2R5D A;  4D6T J;  1Z56 A;  3MUD A;  1SQB J;  4L73 A;  1ME5 A;  1KQS O;  1QL2 A;  1HVV A;  1GMJ A;  1RE3 A;  2KYV A;  1YTZ T;  2ZXX A;  3CX5 E;  3MHV A;  1LWU C;  1P84 D;  3R4Y A;  3UIA A;  2M8R A;  3EQ2 A;  1FOS F;  3QWO C;  1RF1 B;  1VQK P;  1WT6 A;  1OW8 A;  3CX5 H;  3CCL P;  2XNX A;  3RK3 D;  1NTZ J;  1FZC A;  3H1H E;  2JDI H;  3AE7 C;  1L0L E;  1ZRT D;  3M06 A;  2K3R A;  3B4S A;  1LGH B;  2QSI A;  3SWF A;  2OTL P;  3PTZ A;  1NTZ D;  2P7J A;  4WB4 A;  1SQX J;  2WMM A;  1DD3 A;  2NPS A;  3C1L A;  3V5B A;  4EYY Q;  2QJK B;  1YJ9 P;  2FYN B;  1NWQ A;  4WY4 D;  3A0B H;  2YMK A;  5K5G B;  2FFD C;  5AVR B;  2KP8 A;  2KLV A;  4HJG H;  2WTY A;  3AEC C;  1OX3 A;  2JN8 A;  1Q7Y Q;  1L0N E;  2Z5H A;  1X0T A;  2IZ1 A;  1GW3 A;  3CX5 D;  4MN4 C;  5KAF E;  1MFT A;  3L4F A;  1RE4 C;  2B9B A;  2E76 D;  3H1K D;  3I55 P;  3CME P;  2CWQ A;  1EDL A;  2XND H;  3VMA A;  2FXM A;  3AA7 A;  3KDP B;  1U7J A;  3CWB J;  2R3C A;  3H1H G;  2N1T B;  3H1L G;  3V4Q A;  3L74 D;  1BE3 G;  4PJ0 E;  4DT0 A;  3TF5 A;  2HYN A;  4JYC A;  1YHQ P;  1JUN A;  1ZR2 A;  1L0N K;  1QEX A;  2LXC B;  2QM8 A;  1IFD A;  1SQV G;  5CHX A;  1CI6 A;  3USS A;  3G4S P;  2E5T A;  3V2R A;  1FZC B;  1J2J B;  1ZOY C;  2LXB A;  4AQR D;  1VQ5 P;  2ES9 A;  5M1B A;  3SFD C;  5APS A;  1VQ7 P;  3CWB E;  3D70 A;  3EWK A;  5KLV J;  3VMY A;  1PP9 E;  5AVQ B;  1L0L K;  2QRX A;  3P32 A;  2CPS A;  1BDD A;  2E75 D;  2NRG A;  1FS0 E;  1U57 A;  1P84 E;  2WSC J;  3P8C E;  1KOR A;  4I1L A;  3VOP A;  1ZR4 A;  1H88 A;  3L35 A;  3PH0 A;  2KI7 B;  3TNU B;  4K3A A;  3L71 G;  1N73 A;  3AAE A;  1EDI A;  3H1L D;  4GKG A;  1K04 A;  4H13 D;  4WY4 B;  2RMZ A;  3SWK A;  1X22 A;  1KD1 Q;  1IJD B;  1SQX K;  3E1I A;  1SFC B;  2AXC A;  2IX7 C;  3L75 J;  1NKN A;  1N7S B;  1PGO A;  1ZV8 A;  3AE2 C;  2KNC A;  3KZI H;  4BWN A;  2WIT A;  5AW2 B;  3SWY A;  1CI6 B;  2H89 C;  2R44 A;  5H2F H;  3MUD C;  5APU A;  1PV3 A;  2YXR B;  2WPQ A;  1L0L D;  3AEG C;  2IPP A;  1IFM A;  3ABV C;  3L70 E;  5AVX B;  2K9J B;  4LGD E;  4ZKU A;  5KTB A;  3CCQ P;  4AKR A;  2Y9Y A;  4U3F G;  1KB9 H;  4PD4 D;  3F5H A;  1BGY G;  1BGY E;  3AE8 C;  3C9I A;  1URQ D;  4I6M C;  3LW5 J;  2ZXE B;  4L76 A;  5APW A;  1QVG O;  1GU4 A;  1K9M Q;  4H0L B;  1K73 Q;  2PGD A;  1N7S C;  2V7Q H;  2L91 A;  5GTH E;  2Y0D A;  3CCR P;  3D6Z A;  1SQQ E;  1ZXG A;  3H1I J;  3K5B A;  4H0L C;  2VRS A;  2YKQ A;  2H43 A;  1GL2 C;  1EZV I;  3L72 G;  3N4X A;  1BSH A;  4Y99 B;  1RF1 C;  4C7R A;  5B66 E;  2ZAE B;  2NPS B;  1KB9 D;  1OVR A;  4PD4 H;  3WU2 H;  2OUW A;  5AW3 B;  1FDM A;  1HF9 A;  1NGM B;  1NTM G;  3KHU A;  2ZFC A;  2PP6 A;  1KFN A;  1M1J B;  3RBZ A;  1QVF O;  1ZRT E;  4IL6 H;  2O01 N;  2BAS A;  3L74 J;  3NTN A;  2WSF J;  1N8R Q;  2HLO A;  1BE3 D;  3E1R A;  3BRV B;  5CCG C;  3M91 A;  4I7Z B;  4AYC A;  3CPW O;  4GOD A;  1KC8 Q;  2KLU A;  1KYO H;  1RQV A;  1YJW P;  1M90 Q;  1LTT C;  1KQL A;  2WVR A;  1VPC A;  2BCC G;  2GMY A;  1T6A A;  1E5W A;  5BU5 A;  2KK7 A;  3V2P A;  3V2N A;  4JF7 A;  4TT3 H;  4DOJ A;  1VQP P;  1J1E B;  1IZN A;  1KNC A;  2D2C D;  3U1C A;  3LVY A;  2IYO A;  5E79 E;  1FAV A;  2WSE H;  1NTK J;  3O8Z A;  1URQ B;  3PJS K;  4GIF A;  1M56 D;  1PIX A;  4NPD A;  1VQO P;  1OW7 A;  3LK4 1;  1USE A;  3HRN A;  2XKM A;  2D2C C;  5KLI B;  1YQ4 C;  4RKU J;  2KSE A;  2WQY C;  4RJT A;  2KS1 A;  4PJ0 H;  3RK3 B;  1FZC C;  2K9J A;  2QJK C;  2FFD B;  1FC2 C;  1JTH B;  1RE3 C;  5CJ0 A;  2IBZ I;  5AW0 B;  1L0N G;  1OXZ A;  1SQV K;  3BRT B;  4OH8 B;  1ZME C;  2WSE J;  3AE9 C;  4NPE A;  4PD4 I;  3H1J D;  1FJP A;  4DJG A;  1N7S A;  3CCM P;  3H1L J;  2E75 C;  2OYH B;  4U7J A;  3AE6 C;  3JCU E;  2YNY A;  1IZN B;  1L4A B;  1RF0 C;  3HTK A;  2HPC B;  1KV4 A;  1VF5 C;  1EXI A;  3HE4 B;  3L74 G;  2E74 B;  5AW8 B;  1W5C E;  3G3Z A;  1BCC E;  1AV1 A;  1R5S A;  3HE5 A;  5KJ7 D;  2KUB A;  2Q6Q A;  1NTM J;  2XDJ A;  3M0D C;  1TU3 F;  2P58 A;  2Q1K A;  1NTK D;  1PGQ A;  1PPJ G;  2BEQ D;  3AEE C;  3BAS A;  1NAF A;  3P7K A;  1LT9 B;  3A0H H;  4IL6 X;  4KJM A;  5KJ7 C;  3I56 P;  3D6Y A;  1M8O B;  3L71 D;  1DD4 A;  4HKZ H;  4IOI H;  3HUS B;  1IFP A;  2XU6 A;  1LP1 A;  4OVN F;  3W67 A;  3Q1M A;  1JY2 N;  1U7M A;  1KB9 I;  1VQM P;  2JJL A;  2FKW B;  3GHG B;  2IDB A;  3H1I G;  1FDI A;  1IC2 A;  4ZMD A;  3L70 D;  1L0N J;  1N73 C;  1GU9 A;  3B5N D;  1LT1 A;  1MFZ A;  1LT9 C;  5DJT B;  5TIS E;  3GW6 A;  1IFI A;  2V7Q J;  2MJZ A;  3RK2 D;  5BVZ A;  1VQ9 P;  2ZT9 B;  1GL2 A;  3EFF K;  1WMK A;  2R5B A;  3U1A A;  1IO4 A;  1AVY A;  1SQV D;  4D6T G;  1NTK G;  2M3B A;  2QM7 A;  1N7L A;  2WWW A;  3PRJ A;  4Y99 C;  5CMZ A;  2O1J A;  4WWI A;  1HWT C;  4LLH A;  2ZYD A;  5KLV K;  1Q81 Q;  5AVU B;  5AW5 B;  1LP1 B;  3IN6 A;  2YIU B;  1YYC A;  1VQ4 P;  1N7S D;  2FBW C;  1P8C A;  1H89 A;  3CCE P;  1S9K E;  4C7N A;  5AW9 B;  1FBM A;  2WSF H;  3U59 A;  4H0L D;  2P10 A;  4ZKP A;  1FZF A;  3S1K A;  2SPZ A;  2W27 A;  3L71 J;  5AW7 B;  5CCH D;  1NTM K;  1H8A A;  2FYZ A;  2W83 C;  3RL0 D;  1RE4 A;  1G2C B;  1S2E A;  5DJU B;  5KAI E;  3KXD A;  4EOT A;  1NTK K;  2JP3 A;  1MKM A;  1G1J A;  3H1J E;  1S5L E;  5B5E H;  4H13 C;  1RF1 A;  4GT1 A;  3RL0 B;  2N1T D;  4UB8 E;  1M1J C;  5KLV G;  4KT0 J;  2HPC A;  4D6T D;  5AVS B;  4G9Q A;  1JM0 A;  1OIP A;  3FWL A;  3M9Q A;  4GDO A;  4O9B A;  3LK2 A;  5APV A;  1Q86 Q;  1AQ5 A;  1VQ6 P;  2NPS C;  3H1I D;  2K1A A;  2BEZ F;  1OZH A;  3CXH H;  3L72 J;  4OWF A;  1HJB A;  1SQV J;  5APQ A;  2Z4E A;  2A06 E;  3RK2 C;  1NVO A;  3LW5 H;  1DIP A;  5AFU K;  2HFE D;  2IBZ G;  3H1H J;  1NYH A;  2C9L Y;  1K05 A;  1ZN5 A;  5C39 A;  1KFM A;  2M0B A;  4KHX A;  4XA4 A;  2A45 G;  1L2P A; 
#chains in the Genus database with same CATH homology
 3BEY A;  2OUW A;  2IJC A;  1LW1 A;  3LK3 A;  2O4D A;  3AA0 A;  5ADX K;  2KZ7 A;  2OYO A;  1GU9 A;  5DIP A;  2AF7 A;  4AKR A;  4G9Q A;  2ES9 A;  3LK2 A;  3AA6 A;  3C1L A;  3D7I A;  2GMY A;  2KXP A;  2Q0T A;  2JN8 A;  1KNC A;  2PRR A;  3AAA A;  3AA1 A;  3LVY A;  5AFU K;  3AAE A;  1VKE A;  2PFX A;  2CWQ A;  1IZN A;  3LK4 1;  1P8C A;  1ME5 A;  3AA7 A;  5DIK A;  2QEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...