3C1LA

Crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
b'KISALDLGELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESGLSKLDREMIAVAVSSINHCYYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAAFFNMSNRVAAAIDMRPNDEYHAMAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative antioxidant defense protein Mlr4105
molecule tags Oxidoreductase
source organism Mesorhizobium loti
publication title Crystal structure of putative antioxidant defense protein (NP_105057.1) from Mesorhizobium loti at 2.00 A resolution
rcsb
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 3c1lA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 3c1lA02
3LVYA 2AF7A 3BEYA 1LW1A 4G9QA 2QEUA 2Q0TA 1KNCA 1P8CA 2PFXA 2IJCA 2OUWA 1VKEA 2CWQA 2O4DA 5DIKA 1GU9A 3D7IA 2OYOA 1ME5A 2GMYA 3C1LA 2PRRA 5DIPA
chains in the Genus database with same CATH superfamily
3CCMP 2KXPA 1NH4A 2MKVA 4BWNA 3V2PA 3JCUE 1L0LG 3L70G 3M9HA 1KILC 2E74B 4U3FE 1JMBA 1M56D 4N3YB 4AYCA 4ZNCA 2FXPA 2A45H 3PTZA 1VL2A 4L74A 3A5TA 1SQBD 1L0LD 2CK3H 3L70D 1JY3N 2KB7P 2QG4A 2RMZA 3Q3DA 1GU4A 3A2AA 1M1JB 5CHXA 2H7HA 4D6TG 2YNYA 5KLVE 4IFFA 4OGQB 1NO4A 3RL0C 1A02J 3H1LG 2FYUJ 1WMKA 4DT0A 2CWQA 2IBZG 3TDKA 3V5BA 3HRNA 4YXDC 1E79H 1PP9D 3CXHI 4H44B 3MZWB 4DJGA 1KQLA 1VF5C 2ZXEB 3O6QB 4U3FG 4UB6E 1BCCE 3Q1MA 2O3JA 4H0LC 4I7ZC 1GU9A 1OZHA 2PGDA 3H1JD 3TSIA 2ES9A 2GA1A 1FDMA 3LVYA 1QEXA 2MJZA 2ZJSE 5KLVG 4GKGA 4RESB 1NAYA 3NMDA 3RL0D 2H88C 2IZ1A 1USDA 1Q2NA 3IAOA 3H1IJ 4H44C 5H2FE 3AEFC 2HPCA 1VQLP 3H1JE 2P7JA 5CJ4A 3HTKA 3N7NA 1L4AC 5AW9B 3LW5H 1LT9B 3V4QA 2V4HA 1BCCG 2KS1B 3CCUP 3JSVC 2E42A 2O4DA 1N2DC 2WSCH 3HUSC 3L72J 1X79B 3L75D 1JUNA 2AEFA 2C0XA 3ZDMA 2ZT9D 5CBOA 5CCHA 1JMMA 2E76C 3E7KA 2P2UA 4LC1A 1KYOE 5AW3B 1NTZG 3UIAA 3P32A 1NTMJ 2W27A 1OW7A 1U7JA 3VMYA 3EWKA 1S72P 2OYIB 3H1HG 3LK2A 1EDKA 3H1IE 2M3BA 3BCCD 2R32A 4KJMA 5M1BA 1T2KC 1U57A 1NTMD 2FFDB 3N4XA 3AA6A 1FE6A 4ZMDA 3BVHA 1T6AA 1SFCB 3HE4B 3VN0A 1N73A 5DIPA 3H1KJ 1RE3C 3PP5A 2H89C 1LTJA 2E5YA 1QVGO 1KV4A 1CW5A 2WPRA 2D2CD 1T3JA 1D7MA 2CPSA 2M5AA 3CLQA 3PH0A 3PJSK 4HJGH 2Y0EA 3H6PA 3MUDC 1CSBA 1G1IA 3RK3E 3TNUB 1BE3E 1QGKB 1RE3A 3K5BA 1VQKP 2P58A 2FYUE 2R5DA 2E5TA 3H1KD 1PGOA 2I1JA 3QWOC 2FYUK 3M0DC 5GTIH 3BATA 1J1EC 2NPSB 2PP6A 3IR9A 3Q5SA 2E43A 1LTIC 2O1KA 1Y8AA 1KFMA 1LGHB 1JOCA 2AXTE 3GF3A 4RKUJ 3T97A 2WT7B 1DEBA 1RF1A 1RF1B 3OJAB 1JCCA 1RY3A 1K9MQ 3CD6P 3AE5C 1MFZA 2WVRA 2HODA 2HFED 3HD7C 1R5SA 3D71A 3CCLP 1J2JB 2GMYA 3D6YA 2KLUA 2QVAA 1Y9BA 2JR8A 4GOEA 4ZKPA 2Q9IA 3L71E 1NKZB 2QJKB 1KORA 2BCCG 2J59M 3MGNA 2SPZA 5CBNA 4H0LB 1M8OB 1ZR2A 4B86A 1YJNP 1KYOI 1W5CE 3CC2P 1LWUA 5KJ7C 3CCQP 1LW1A 1EDJA 1KQFB 3I55P 1PPJG 1R8EA 1UIXA 2M0BA 2QJPC 3JC22 1SQQJ 2KZJA 1N73C 1LTTC 1PFIA 2JO1A 3P8CE 1SQVE 4RJTA 1NTKG 3TGUE 1M57D 5AVWB 3M0AA 2IJCA 1IC2A 1L0NK 1Q81Q 1N7SD 3H1ID 3CXHD 4JYBA 4QMAA 1YJWP 1EZVE 1QL1A 1FZBA 1JY3O 3RL0g 2H43A 1NTZJ 4H13D 2HODB 1YHQP 3WUUA 4A7PA 1HH0A 1P84H 4L75A 2A06D 4EIJA 1FZCB 3RK3D 3CXHE 3Q5PA 2XZRA 2RN0A 4WWIA 3AEGC 1GU5A 3M9QA 4WB4A 3Q2YA 1YTZI 5APVA 5CCGC 2O01J 4PV1C 3VP8A 1YJ9P 4JYCA 1QLED 5AW5B 5GTIE 1NGMB 3LK41 1FAVA 2O1JA 2Q5UA 2UWJE 4IOIH 5EFWB 1A02F 1JO5A 3AE4C 3H1HE 2AXTH 3KPEA 1QX8A 1EDIA 2KK7A 2WQYC 3H1IG 1NWQA 1HWTC 2QJYB 1VF5D 1FU1A 3TNUA 5KLVJ 1KFNA 4H0LD 4I1LA 1DD4A 1MV8A 2QRXA 1HBWA 1VQ7P 3KXDA 2IYOA 1FDIA 3M9BA 4U3FD 3USSA 1SQXK 3MUDA 4XA4A 1WT6A 1EQ7A 3H32A 4TLFA 2FXOA 3CXHH 2IZ0A 3L74J 4JF7A 5E79H 4ASVA 3AA7A 3V2RA 1KQGB 3V4WA 4YTPC 2B88A 3H1LJ 1BSNA 1IZNB 1ME5A 2NPSD 2KOGA 4L73A 3H1HD 1Y47A 1SQBG 1FDOA 4D6TJ 2RKLA 2A45G 2KZ7A 5CJ0A 4PD4D 1SQVK 4WVZA 5KAIE 2KNCB 2W83C 1AQ5A 3CC4P 2FYNC 4PJ0H 1OMIA 1EXJA 1VQPP 5AVTB 1VQMP 3CI9A 3G4SP 2E76D 2OYHA 2YXRB 1JY3P 2ITAA 3H1KG 4NPEA 3L35A 2ZXXA 5B66E 2P1JA 3RBXA 2BCCE 3CWBJ 3AAEA 5AFUK 2AEMA 1NU1G 4LGDE 1IZNA 2LKMA 4JBZA 3CMEP 2QJPB 1NU1K 1X9VA 2Q1KA 1FZAA 1L0NJ 1SQBE 3OAKA 3PHLA 4H44D 3T97B 1SFCA 3HE4A 3H25A 1AA0A 3CC7P 1DD3A 1L0ND 1LTJB 1SQQK 1N86A 2FKWB 5KLVD 4YXWH 4HKZH 2CPBA 4PD4E 3GHGA 1Q82Q 2YKQA 2KYVA 4EDFA 3ABVC 5AVSB 1N7LA 3M0DA 1SLQA 1NU1J 3L71J 3U59A 3CWBG 1S9KD 5B5EE 3SWFA 1SS1A 1EZVG 2B87A 1LP1B 1OVUA 2W8ZA 2FYNB 5AVVB 3BEYA 1PL5A 1URQC 2BCCD 2WITA 4Z1MH 5K5GB 2JN8A 3AE3C 1JY2O 1NYHA 2NPSC 1RE4A 1S5LE 3SSUA 2R5BA 2WPQA 5KLIC 1S9KE 3KZIH 1GDTA 2ZYGA 3MTUE 2LXCB 1EDLA 5CMZA 2RH0A 5TISH 4W7YA 1FS0E 3W67A 3A0HE 5DJUB 1LJ2A 2QM7A 3I5CA 4BRYB 1M1KQ 1W2EA 3OA7A 2K88A 5KAIH 1GZLA 2FYUD 3L74G 1P84I 4RO0A 2QA4P 3HE5A 5DIKA 3BCCJ 1J1EB 1CI6B 1NAFA 2NRGA 2OYOA 3O6QA 2ZYDA 4U7JA 1K05A 5B66H 3ITKA 1OVVA 1QL2A 2BASA 5AW7B 5L8RJ 3L75E 1FOSE 1H0TB 1NTME 2OQQA 3AEDC 4KHXA 4WY4C 3D6ZA 2WSFJ 1KZUB 1LTJC 4I6MC 1YIJP 1NTMK 2BCCJ 4D6TD 2BEQD 3CCRP 1X22A 3KHUA 2A45I 1NKNA 3QH9A 3HE5B 1SQBK 3FXDA 1NOHA 4DZOA 1HGVA 3WUTA 3B5ND 3GG2A 1Q7YQ 1BDDA 5KJ7D 1LNQA 1M1JA 3V6IA 3IFMA 3L36A 1NVOA 2BEZF 2YO2A 3CCEP 1JTHB 3P8MC 3CCJP 1SQVJ 3TGUJ 5CCGD 2KXPB 3L75G 1RHZB 3F5HA 3B5NA 1QVFO 2W6AA 2K1AA 2AEJA 1IFDA 3PLNA 1KN7A 3MD0A 4HB1A 1GL2D 3CX5I 3W68A 1EZVD 3HD7A 4N6JA 3CX5H 3WUVA 2FXMA 3U1AA 1FZGA 1G2CA 1NHLA 1ZRTE 1KYOH 2N9BA 1SQQG 2FFDC 2Q3IA 1Q90D 1GL2A 2QJKC 1KB9H 1VQOP 1RQUA 2POHA 1J1DC 1S2EA 1LTBC 2K9JA 3AE6C 3GHGB 1SQQD 5GTHH 3WMM0 1UIIA 3HD7B 1FJKA 1OVRA 1SVFA 4NPFX 2PFXA 1KYOD 2QE7H 3PRJA 5AW6B 1DX7A 5ADXK 3CX5D 3H1HJ 1NU1D 2OTJP 4C7NA 1KTMA 3KDPB 3M06A 3L75J 3VTPC 1FZCC 1OW6A 1S3JA 2YIUC 3AE8C 1SQQE 5C39A 5TJHA 2KI7B 5APWA 1GD2E 2OYHB 3RL0B 2HYNA 3IN6A 1L0LK 1GK6A 3CX5E 5DJTB 4JPZB 1KD1Q 2M8RA 4IL6H 4PV1B 1VQ9P 1JM0A 1SQVD 3CWBD 3HUSB 3JCUH 3TGUD 3GMAA 1H0TA 2JWDA 1X0TA 3Q5RA 2I1KA 3VMAA 1LP1A 1YYCA 3NXSA 1NTZE 1LTGC 1T3UA 1NTKD 2WPVB 3H1LE 1LTSC 2YIUB 3H32B 2WMMA 5GTHE 2HPCB 1VF5B 1IO4A 1SFCC 1JCDA 5CCHC 4HH2A 1PPJD 3LIEA 1T2KD 2K9YA 2L5GB 3L73G 3VMXA 2P67A 4EOTA 1KNCA 3MIWA 1S5LX 5APSA 3OW2O 2QM8A 1GW3A 1SQXD 1RF0C 4WBAA 1YTZT 2R3SA 1G1JA 4U3FJ 1VQ4P 1L4AA 5APQA 3NTNA 1BE3G 1RF1C 1ZRTD 2IYPA 2Q3EA 3AEBC 1K04A 1KB9D 2FYUG 4Y99B 4BRYA 1FOSF 4IL6E 3L4FA 5AVXB 3D70A 3B8EB 3CL3D 1BGYJ 3L72G 3R4YA 2E75B 1FC2C 3FGAD 1BSHA 2KS1A 2B89A 2KLVA 3FXEA 2KNCA 3P8CD 3S4RA 2PAJA 1RE4C 3AEAC 4EI2A 1N7SC 1L0LJ 3L70J 4GODA 2Q6QA 4O9BA 1H89A 1E5WA 1URQA 4N78E 2W6JH 2G3AA 3EFGA 2ZT9B 3HD7D 1H88A 2WSFH 4Y28J 5BU8B 1HUCA 3EFFK 1FZCA 1FZEA 2C0WA 3L71G 2WSCJ 1P8CA 4ZKUA 1JEKA 2I8DA 1SP4A 1VKEA 5AVUB 1L4AB 1URQD 1OFCX 3L72E 2HLOA 1BDCA 5APTA 2A06E 2NZ2A 5AVRB 4AKRA 1OWAA 1IJDB 4XFJA 1LWUB 2N1TB 3RK2C 2N1TA 2KUBA 4WY4B 1IFIA 2M3EA 5AVYB 2AXCA 1YITP 1JY2P 1L0NG 2IFNA 1NTKE 2QSIA 3L37A 5H2FH 2Y0DA 3B4SA 5KAFE 2XNDH 3TYYA 3AA1A 2GM4A 2LXBA 4IFMA 2OARA 1JNMA 3AAAA 3II6A 1FZFA 2WSSH 2OYHC 2QJYC 3M91A 1BCCD 1LTAC 2A06G 3B5NC 3AE1C 1DEEG 1N7SA 1SQPE 2V7QJ 2WZ7A 3C8VA 3GF7A 4K3AA 4MN4C 4R4MA 4W80A 3RK3C 1ZOYC 2YKPA 1JY2N 2IDBA 2QEUA 3AE7C 1HGZA 1L0NE 1SQBJ 4OGQD 1M1JC 1KC8Q 3FWNA 2WSEH 2O01H 1FBMA 3P7KA 2K3RA 1BGYG 3GW6A 4PJ0E 5KLIB 1HVVA 1BE3D 3BASA 4C7NB 4WY4D 4I7ZB 1PGPA 1PP9J 4IFDK 4KT0J 5AW0B 3H1JG 5BU5A 1LWUC 1BE3J 1SQPK 2KSJA 3L73E 1SQPG 5AW8B 4JQ0D 4N78D 2JDIH 2KP8A 4TT3H 5APYA 2YMKA 3CCSP 1SQPD 3S1KA 3C1LA 4I2LC 3F89A 2C9NY 1S4XA 2WSEJ 1YQ4C 3MP7B 4OVNF 3RK2D 4DCKA 4OWFA 2Q7CA 1G2CB 2OTKE 3L73J 5KTBA 2IX7C 1BGYE 3SWYA 2N9YB 4GOFA 3WU2H 2AF7A 1RQVA 1M7LA 2N1TC 3BCCE 2YKOA 3RK2B 3CMAP 1VPCA 2VRSA 2ZVOB 1R5LA 1FJPA 1TU3F 1Z56A 2G8YA 5APXA 3B5NB 3LW5J 1LT1A 3NFQA 2LR2A 2QEXP 4AUWA 3LIDA 1VQNP 2OUWA 3VP9A 1JTHA 4H13B 5KAFH 2C9LY 1OX3A 4PV1D 4DOJA 2Y0CA 2E76B 1KILD 2Z5IA 2ZVNB 2GUSA 1P84E 2NPSA 1EC5A 2OGUA 3G3ZA 3HTKB 4GT1A 3IF4A 1IFJA 5AVQB 4XE5B 1S5LH 3H1KE 1PGQA 2JKVA 3RGUA 3VMZA 2N1TD 1AV1A 1LT9A 1PZQA 1XTGB 1HF9A 2XU6A 1IFMA 5APUA 1EXIA 1NU1E 1OIPA 3B71A 5TISE 2E75C 4GDOA 1NTKJ 4M3LA 1N8RQ 4HYTB 3BRVB 2JWAA 1Q86Q 1YQ3C 5AVZB 2YXQB 1IFNA 1PIXA 2H8PD 1YBKA 1S1CX 2QIWA 1YI2P 4IL6X 2KSEA 5B5EH 1NJIQ 2IBZI 1ZP0C 3G9RA 3AE9C 1OXZA 2HG5D 2ZT9C 1PGJA 2XV5A 1GMJA 1SQXG 1JB0J 2D2CB 1EZVI 3BRTB 5BVZA 1GK4A 3L71D 2K37A 3CWBE 2JP3A 3SWKA 1ZN5A 1PP9E 3L73D 4GIFA 5CCGA 1X8YA 2Z4EA 3E1IA 3SFEC 1ZLLA 1WRGA 2FBWC 5AW1B 2WT7A 2YMYA 5E79E 1ZXGA 2W90A 1PPJE 2JEEA 4EYYQ 2XKMA 1L4AD 1URQB 3V2QA 1BGYD 3WU2E 5CCHD 3TF5A 1ZW0A 1SQVG 3TGUG 3L72D 1K73Q 2KIKA 3AE2C 5AW2B 1SQXE 5KKZC 4LLHA 3AECC 3VOPA 1VQ8P 2IFMA 3A3YB 3GLMA 3RBZA 4NPDA 3KQGA 2IPPA 2P10A 3G71P 3S9OA 1J1DB 3A0BE 4D6TE 4C7RA 3MHVA 2B87B 3RK3B 1PV3A 2E74D 1LT9C 1W2BO 1SQXJ 4ASWA 1MUUA 1CZQA 1USEA 2M5AB 2GUVA 2R3CA 2XDJA 5KJ7A 1IK9A 1U7MA 1KILE 2E75D 3FWLA 3VYIA 3TK1A 2ZAEB 1VQ5P 1KQSO 2J58A 2Q0TA 3SFDC 1GL2B 2DW3A 1VDFA 2ZFCA 2IBZD 1HJBA 1AFOA 2XNXA 4G9QA 3H1LD 1T8ZA 1K8AQ 2J5UA 2L91A 2D2CC 5AW4B 1NTKK 1SQPJ 2WPSA 1N73B 3LK3A 3L74D 1NTMG 3GHGC 4AQRD 4C46A 1GL2C 3BCCG 2V7QH 2Z5HA 2E74C 4PD4H 4W7ZA 3KYQA 1KILA 1IK7A 2FFDA 3AA0A 1NTZD 4CPGA 2Y9ZA 2OYIA 1MKMA 3U1CA 3E1RA 1AQTA 3D7IA 2WTYA 1HJ0A 1RF0A 1DIPA 3HUSA 1AVOA 4UB8H 2FYZA 2KZIA 1BCCJ 4OGQC 4R4LA 3CPWO 1GTWA 1AJYA 4Y99C 3O8ZA 5KKZB 2WWWA 1HTLC 4PD4I 1MZ9A 2YO3A 1N7SB 3AEEC 1H8AA 1AVYA 1KILB 2O01N 2FY8A 2R44A 1M90Q 5KLVK 1L2PA 4H13C 3L74E 3CCVP 1NTZK 2K9JB 1KB9I 1ZR4A 1DH3A 1VQ6P 1KB9E 3A0HH 1RH5B 4OH8B 1MFTA 3V2NA 1L0LE 3L70E 2JJLA 2Y9YA 3G6EP 3A0BH 3EQ2A 3R2PA 4WY4A 4L76A 2HR3A 2B9BA 1CI6A 3FX0A 4BXLA 3C9IA 4UB8E 3H1JJ 1OW8A 1PP9G 4K35A 3I56P 2ZYAA 1GW4A 1ZMEC 1SFCD 4UB6H 1P84D 4YPCA 2OTLP 1KMIZ 1XTCC 1ZV8A 1IFPA 2PRRA 3KZIE 2IBZE 3A7OA 2OYIC 2W6BA
chains in the Genus database with same CATH topology
2KXPA 3LVYA 2AF7A 3LK41 3BEYA 1LW1A 2JN8A 4G9QA 2QEUA 2Q0TA 2KZ7A 1KNCA 1P8CA 2IJCA 2PFXA 2OUWA 5AFUK 3AAEA 1VKEA 1IZNA 5ADXK 4AKRA 3LK3A 2CWQA 2O4DA 3AA0A 3AA7A 5DIKA 3LK2A 1GU9A 3D7IA 2OYOA 1ME5A 2GMYA 2ES9A 3C1LA 3AA1A 2PRRA 3AA6A 5DIPA 3AAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVY A;  2AF7 A;  3BEY A;  1LW1 A;  4G9Q A;  2QEU A;  2Q0T A;  1KNC A;  1P8C A;  2PFX A;  2IJC A;  2OUW A;  1VKE A;  2CWQ A;  2O4D A;  5DIK A;  1GU9 A;  3D7I A;  2OYO A;  1ME5 A;  2GMY A;  3C1L A;  2PRR A;  5DIP A; 
#chains in the Genus database with same CATH topology
 3CCM P;  2KXP A;  1NH4 A;  2MKV A;  4BWN A;  3V2P A;  3JCU E;  1L0L G;  3L70 G;  3M9H A;  1KIL C;  2E74 B;  4U3F E;  1JMB A;  1M56 D;  4N3Y B;  4AYC A;  4ZNC A;  2FXP A;  2A45 H;  3PTZ A;  1VL2 A;  4L74 A;  3A5T A;  1SQB D;  1L0L D;  2CK3 H;  3L70 D;  1JY3 N;  2KB7 P;  2QG4 A;  2RMZ A;  3Q3D A;  1GU4 A;  3A2A A;  1M1J B;  5CHX A;  2H7H A;  4D6T G;  2YNY A;  5KLV E;  4IFF A;  4OGQ B;  1NO4 A;  3RL0 C;  1A02 J;  3H1L G;  2FYU J;  1WMK A;  4DT0 A;  2CWQ A;  2IBZ G;  3TDK A;  3V5B A;  3HRN A;  4YXD C;  1E79 H;  1PP9 D;  3CXH I;  4H44 B;  3MZW B;  4DJG A;  1KQL A;  1VF5 C;  2ZXE B;  3O6Q B;  4U3F G;  4UB6 E;  1BCC E;  3Q1M A;  2O3J A;  4H0L C;  4I7Z C;  1GU9 A;  1OZH A;  2PGD A;  3H1J D;  3TSI A;  2ES9 A;  2GA1 A;  1FDM A;  3LVY A;  1QEX A;  2MJZ A;  2ZJS E;  5KLV G;  4GKG A;  4RES B;  1NAY A;  3NMD A;  3RL0 D;  2H88 C;  2IZ1 A;  1USD A;  1Q2N A;  3IAO A;  3H1I J;  4H44 C;  5H2F E;  3AEF C;  2HPC A;  1VQL P;  3H1J E;  2P7J A;  5CJ4 A;  3HTK A;  3N7N A;  1L4A C;  5AW9 B;  3LW5 H;  1LT9 B;  3V4Q A;  2V4H A;  1BCC G;  2KS1 B;  3CCU P;  3JSV C;  2E42 A;  2O4D A;  1N2D C;  2WSC H;  3HUS C;  3L72 J;  1X79 B;  3L75 D;  1JUN A;  2AEF A;  2C0X A;  3ZDM A;  2ZT9 D;  5CBO A;  5CCH A;  1JMM A;  2E76 C;  3E7K A;  2P2U A;  4LC1 A;  1KYO E;  5AW3 B;  1NTZ G;  3UIA A;  3P32 A;  1NTM J;  2W27 A;  1OW7 A;  1U7J A;  3VMY A;  3EWK A;  1S72 P;  2OYI B;  3H1H G;  3LK2 A;  1EDK A;  3H1I E;  2M3B A;  3BCC D;  2R32 A;  4KJM A;  5M1B A;  1T2K C;  1U57 A;  1NTM D;  2FFD B;  3N4X A;  3AA6 A;  1FE6 A;  4ZMD A;  3BVH A;  1T6A A;  1SFC B;  3HE4 B;  3VN0 A;  1N73 A;  5DIP A;  3H1K J;  1RE3 C;  3PP5 A;  2H89 C;  1LTJ A;  2E5Y A;  1QVG O;  1KV4 A;  1CW5 A;  2WPR A;  2D2C D;  1T3J A;  1D7M A;  2CPS A;  2M5A A;  3CLQ A;  3PH0 A;  3PJS K;  4HJG H;  2Y0E A;  3H6P A;  3MUD C;  1CSB A;  1G1I A;  3RK3 E;  3TNU B;  1BE3 E;  1QGK B;  1RE3 A;  3K5B A;  1VQK P;  2P58 A;  2FYU E;  2R5D A;  2E5T A;  3H1K D;  1PGO A;  2I1J A;  3QWO C;  2FYU K;  3M0D C;  5GTI H;  3BAT A;  1J1E C;  2NPS B;  2PP6 A;  3IR9 A;  3Q5S A;  2E43 A;  1LTI C;  2O1K A;  1Y8A A;  1KFM A;  1LGH B;  1JOC A;  2AXT E;  3GF3 A;  4RKU J;  3T97 A;  2WT7 B;  1DEB A;  1RF1 A;  1RF1 B;  3OJA B;  1JCC A;  1RY3 A;  1K9M Q;  3CD6 P;  3AE5 C;  1MFZ A;  2WVR A;  2HOD A;  2HFE D;  3HD7 C;  1R5S A;  3D71 A;  3CCL P;  1J2J B;  2GMY A;  3D6Y A;  2KLU A;  2QVA A;  1Y9B A;  2JR8 A;  4GOE A;  4ZKP A;  2Q9I A;  3L71 E;  1NKZ B;  2QJK B;  1KOR A;  2BCC G;  2J59 M;  3MGN A;  2SPZ A;  5CBN A;  4H0L B;  1M8O B;  1ZR2 A;  4B86 A;  1YJN P;  1KYO I;  1W5C E;  3CC2 P;  1LWU A;  5KJ7 C;  3CCQ P;  1LW1 A;  1EDJ A;  1KQF B;  3I55 P;  1PPJ G;  1R8E A;  1UIX A;  2M0B A;  2QJP C;  3JC2 2;  1SQQ J;  2KZJ A;  1N73 C;  1LTT C;  1PFI A;  2JO1 A;  3P8C E;  1SQV E;  4RJT A;  1NTK G;  3TGU E;  1M57 D;  5AVW B;  3M0A A;  2IJC A;  1IC2 A;  1L0N K;  1Q81 Q;  1N7S D;  3H1I D;  3CXH D;  4JYB A;  4QMA A;  1YJW P;  1EZV E;  1QL1 A;  1FZB A;  1JY3 O;  3RL0 g;  2H43 A;  1NTZ J;  4H13 D;  2HOD B;  1YHQ P;  3WUU A;  4A7P A;  1HH0 A;  1P84 H;  4L75 A;  2A06 D;  4EIJ A;  1FZC B;  3RK3 D;  3CXH E;  3Q5P A;  2XZR A;  2RN0 A;  4WWI A;  3AEG C;  1GU5 A;  3M9Q A;  4WB4 A;  3Q2Y A;  1YTZ I;  5APV A;  5CCG C;  2O01 J;  4PV1 C;  3VP8 A;  1YJ9 P;  4JYC A;  1QLE D;  5AW5 B;  5GTI E;  1NGM B;  3LK4 1;  1FAV A;  2O1J A;  2Q5U A;  2UWJ E;  4IOI H;  5EFW B;  1A02 F;  1JO5 A;  3AE4 C;  3H1H E;  2AXT H;  3KPE A;  1QX8 A;  1EDI A;  2KK7 A;  2WQY C;  3H1I G;  1NWQ A;  1HWT C;  2QJY B;  1VF5 D;  1FU1 A;  3TNU A;  5KLV J;  1KFN A;  4H0L D;  4I1L A;  1DD4 A;  1MV8 A;  2QRX A;  1HBW A;  1VQ7 P;  3KXD A;  2IYO A;  1FDI A;  3M9B A;  4U3F D;  3USS A;  1SQX K;  3MUD A;  4XA4 A;  1WT6 A;  1EQ7 A;  3H32 A;  4TLF A;  2FXO A;  3CXH H;  2IZ0 A;  3L74 J;  4JF7 A;  5E79 H;  4ASV A;  3AA7 A;  3V2R A;  1KQG B;  3V4W A;  4YTP C;  2B88 A;  3H1L J;  1BSN A;  1IZN B;  1ME5 A;  2NPS D;  2KOG A;  4L73 A;  3H1H D;  1Y47 A;  1SQB G;  1FDO A;  4D6T J;  2RKL A;  2A45 G;  2KZ7 A;  5CJ0 A;  4PD4 D;  1SQV K;  4WVZ A;  5KAI E;  2KNC B;  2W83 C;  1AQ5 A;  3CC4 P;  2FYN C;  4PJ0 H;  1OMI A;  1EXJ A;  1VQP P;  5AVT B;  1VQM P;  3CI9 A;  3G4S P;  2E76 D;  2OYH A;  2YXR B;  1JY3 P;  2ITA A;  3H1K G;  4NPE A;  3L35 A;  2ZXX A;  5B66 E;  2P1J A;  3RBX A;  2BCC E;  3CWB J;  3AAE A;  5AFU K;  2AEM A;  1NU1 G;  4LGD E;  1IZN A;  2LKM A;  4JBZ A;  3CME P;  2QJP B;  1NU1 K;  1X9V A;  2Q1K A;  1FZA A;  1L0N J;  1SQB E;  3OAK A;  3PHL A;  4H44 D;  3T97 B;  1SFC A;  3HE4 A;  3H25 A;  1AA0 A;  3CC7 P;  1DD3 A;  1L0N D;  1LTJ B;  1SQQ K;  1N86 A;  2FKW B;  5KLV D;  4YXW H;  4HKZ H;  2CPB A;  4PD4 E;  3GHG A;  1Q82 Q;  2YKQ A;  2KYV A;  4EDF A;  3ABV C;  5AVS B;  1N7L A;  3M0D A;  1SLQ A;  1NU1 J;  3L71 J;  3U59 A;  3CWB G;  1S9K D;  5B5E E;  3SWF A;  1SS1 A;  1EZV G;  2B87 A;  1LP1 B;  1OVU A;  2W8Z A;  2FYN B;  5AVV B;  3BEY A;  1PL5 A;  1URQ C;  2BCC D;  2WIT A;  4Z1M H;  5K5G B;  2JN8 A;  3AE3 C;  1JY2 O;  1NYH A;  2NPS C;  1RE4 A;  1S5L E;  3SSU A;  2R5B A;  2WPQ A;  5KLI C;  1S9K E;  3KZI H;  1GDT A;  2ZYG A;  3MTU E;  2LXC B;  1EDL A;  5CMZ A;  2RH0 A;  5TIS H;  4W7Y A;  1FS0 E;  3W67 A;  3A0H E;  5DJU B;  1LJ2 A;  2QM7 A;  3I5C A;  4BRY B;  1M1K Q;  1W2E A;  3OA7 A;  2K88 A;  5KAI H;  1GZL A;  2FYU D;  3L74 G;  1P84 I;  4RO0 A;  2QA4 P;  3HE5 A;  5DIK A;  3BCC J;  1J1E B;  1CI6 B;  1NAF A;  2NRG A;  2OYO A;  3O6Q A;  2ZYD A;  4U7J A;  1K05 A;  5B66 H;  3ITK A;  1OVV A;  1QL2 A;  2BAS A;  5AW7 B;  5L8R J;  3L75 E;  1FOS E;  1H0T B;  1NTM E;  2OQQ A;  3AED C;  4KHX A;  4WY4 C;  3D6Z A;  2WSF J;  1KZU B;  1LTJ C;  4I6M C;  1YIJ P;  1NTM K;  2BCC J;  4D6T D;  2BEQ D;  3CCR P;  1X22 A;  3KHU A;  2A45 I;  1NKN A;  3QH9 A;  3HE5 B;  1SQB K;  3FXD A;  1NOH A;  4DZO A;  1HGV A;  3WUT A;  3B5N D;  3GG2 A;  1Q7Y Q;  1BDD A;  5KJ7 D;  1LNQ A;  1M1J A;  3V6I A;  3IFM A;  3L36 A;  1NVO A;  2BEZ F;  2YO2 A;  3CCE P;  1JTH B;  3P8M C;  3CCJ P;  1SQV J;  3TGU J;  5CCG D;  2KXP B;  3L75 G;  1RHZ B;  3F5H A;  3B5N A;  1QVF O;  2W6A A;  2K1A A;  2AEJ A;  1IFD A;  3PLN A;  1KN7 A;  3MD0 A;  4HB1 A;  1GL2 D;  3CX5 I;  3W68 A;  1EZV D;  3HD7 A;  4N6J A;  3CX5 H;  3WUV A;  2FXM A;  3U1A A;  1FZG A;  1G2C A;  1NHL A;  1ZRT E;  1KYO H;  2N9B A;  1SQQ G;  2FFD C;  2Q3I A;  1Q90 D;  1GL2 A;  2QJK C;  1KB9 H;  1VQO P;  1RQU A;  2POH A;  1J1D C;  1S2E A;  1LTB C;  2K9J A;  3AE6 C;  3GHG B;  1SQQ D;  5GTH H;  3WMM 0;  1UII A;  3HD7 B;  1FJK A;  1OVR A;  1SVF A;  4NPF X;  2PFX A;  1KYO D;  2QE7 H;  3PRJ A;  5AW6 B;  1DX7 A;  5ADX K;  3CX5 D;  3H1H J;  1NU1 D;  2OTJ P;  4C7N A;  1KTM A;  3KDP B;  3M06 A;  3L75 J;  3VTP C;  1FZC C;  1OW6 A;  1S3J A;  2YIU C;  3AE8 C;  1SQQ E;  5C39 A;  5TJH A;  2KI7 B;  5APW A;  1GD2 E;  2OYH B;  3RL0 B;  2HYN A;  3IN6 A;  1L0L K;  1GK6 A;  3CX5 E;  5DJT B;  4JPZ B;  1KD1 Q;  2M8R A;  4IL6 H;  4PV1 B;  1VQ9 P;  1JM0 A;  1SQV D;  3CWB D;  3HUS B;  3JCU H;  3TGU D;  3GMA A;  1H0T A;  2JWD A;  1X0T A;  3Q5R A;  2I1K A;  3VMA A;  1LP1 A;  1YYC A;  3NXS A;  1NTZ E;  1LTG C;  1T3U A;  1NTK D;  2WPV B;  3H1L E;  1LTS C;  2YIU B;  3H32 B;  2WMM A;  5GTH E;  2HPC B;  1VF5 B;  1IO4 A;  1SFC C;  1JCD A;  5CCH C;  4HH2 A;  1PPJ D;  3LIE A;  1T2K D;  2K9Y A;  2L5G B;  3L73 G;  3VMX A;  2P67 A;  4EOT A;  1KNC A;  3MIW A;  1S5L X;  5APS A;  3OW2 O;  2QM8 A;  1GW3 A;  1SQX D;  1RF0 C;  4WBA A;  1YTZ T;  2R3S A;  1G1J A;  4U3F J;  1VQ4 P;  1L4A A;  5APQ A;  3NTN A;  1BE3 G;  1RF1 C;  1ZRT D;  2IYP A;  2Q3E A;  3AEB C;  1K04 A;  1KB9 D;  2FYU G;  4Y99 B;  4BRY A;  1FOS F;  4IL6 E;  3L4F A;  5AVX B;  3D70 A;  3B8E B;  3CL3 D;  1BGY J;  3L72 G;  3R4Y A;  2E75 B;  1FC2 C;  3FGA D;  1BSH A;  2KS1 A;  2B89 A;  2KLV A;  3FXE A;  2KNC A;  3P8C D;  3S4R A;  2PAJ A;  1RE4 C;  3AEA C;  4EI2 A;  1N7S C;  1L0L J;  3L70 J;  4GOD A;  2Q6Q A;  4O9B A;  1H89 A;  1E5W A;  1URQ A;  4N78 E;  2W6J H;  2G3A A;  3EFG A;  2ZT9 B;  3HD7 D;  1H88 A;  2WSF H;  4Y28 J;  5BU8 B;  1HUC A;  3EFF K;  1FZC A;  1FZE A;  2C0W A;  3L71 G;  2WSC J;  1P8C A;  4ZKU A;  1JEK A;  2I8D A;  1SP4 A;  1VKE A;  5AVU B;  1L4A B;  1URQ D;  1OFC X;  3L72 E;  2HLO A;  1BDC A;  5APT A;  2A06 E;  2NZ2 A;  5AVR B;  4AKR A;  1OWA A;  1IJD B;  4XFJ A;  1LWU B;  2N1T B;  3RK2 C;  2N1T A;  2KUB A;  4WY4 B;  1IFI A;  2M3E A;  5AVY B;  2AXC A;  1YIT P;  1JY2 P;  1L0N G;  2IFN A;  1NTK E;  2QSI A;  3L37 A;  5H2F H;  2Y0D A;  3B4S A;  5KAF E;  2XND H;  3TYY A;  3AA1 A;  2GM4 A;  2LXB A;  4IFM A;  2OAR A;  1JNM A;  3AAA A;  3II6 A;  1FZF A;  2WSS H;  2OYH C;  2QJY C;  3M91 A;  1BCC D;  1LTA C;  2A06 G;  3B5N C;  3AE1 C;  1DEE G;  1N7S A;  1SQP E;  2V7Q J;  2WZ7 A;  3C8V A;  3GF7 A;  4K3A A;  4MN4 C;  4R4M A;  4W80 A;  3RK3 C;  1ZOY C;  2YKP A;  1JY2 N;  2IDB A;  2QEU A;  3AE7 C;  1HGZ A;  1L0N E;  1SQB J;  4OGQ D;  1M1J C;  1KC8 Q;  3FWN A;  2WSE H;  2O01 H;  1FBM A;  3P7K A;  2K3R A;  1BGY G;  3GW6 A;  4PJ0 E;  5KLI B;  1HVV A;  1BE3 D;  3BAS A;  4C7N B;  4WY4 D;  4I7Z B;  1PGP A;  1PP9 J;  4IFD K;  4KT0 J;  5AW0 B;  3H1J G;  5BU5 A;  1LWU C;  1BE3 J;  1SQP K;  2KSJ A;  3L73 E;  1SQP G;  5AW8 B;  4JQ0 D;  4N78 D;  2JDI H;  2KP8 A;  4TT3 H;  5APY A;  2YMK A;  3CCS P;  1SQP D;  3S1K A;  3C1L A;  4I2L C;  3F89 A;  2C9N Y;  1S4X A;  2WSE J;  1YQ4 C;  3MP7 B;  4OVN F;  3RK2 D;  4DCK A;  4OWF A;  2Q7C A;  1G2C B;  2OTK E;  3L73 J;  5KTB A;  2IX7 C;  1BGY E;  3SWY A;  2N9Y B;  4GOF A;  3WU2 H;  2AF7 A;  1RQV A;  1M7L A;  2N1T C;  3BCC E;  2YKO A;  3RK2 B;  3CMA P;  1VPC A;  2VRS A;  2ZVO B;  1R5L A;  1FJP A;  1TU3 F;  1Z56 A;  2G8Y A;  5APX A;  3B5N B;  3LW5 J;  1LT1 A;  3NFQ A;  2LR2 A;  2QEX P;  4AUW A;  3LID A;  1VQN P;  2OUW A;  3VP9 A;  1JTH A;  4H13 B;  5KAF H;  2C9L Y;  1OX3 A;  4PV1 D;  4DOJ A;  2Y0C A;  2E76 B;  1KIL D;  2Z5I A;  2ZVN B;  2GUS A;  1P84 E;  2NPS A;  1EC5 A;  2OGU A;  3G3Z A;  3HTK B;  4GT1 A;  3IF4 A;  1IFJ A;  5AVQ B;  4XE5 B;  1S5L H;  3H1K E;  1PGQ A;  2JKV A;  3RGU A;  3VMZ A;  2N1T D;  1AV1 A;  1LT9 A;  1PZQ A;  1XTG B;  1HF9 A;  2XU6 A;  1IFM A;  5APU A;  1EXI A;  1NU1 E;  1OIP A;  3B71 A;  5TIS E;  2E75 C;  4GDO A;  1NTK J;  4M3L A;  1N8R Q;  4HYT B;  3BRV B;  2JWA A;  1Q86 Q;  1YQ3 C;  5AVZ B;  2YXQ B;  1IFN A;  1PIX A;  2H8P D;  1YBK A;  1S1C X;  2QIW A;  1YI2 P;  4IL6 X;  2KSE A;  5B5E H;  1NJI Q;  2IBZ I;  1ZP0 C;  3G9R A;  3AE9 C;  1OXZ A;  2HG5 D;  2ZT9 C;  1PGJ A;  2XV5 A;  1GMJ A;  1SQX G;  1JB0 J;  2D2C B;  1EZV I;  3BRT B;  5BVZ A;  1GK4 A;  3L71 D;  2K37 A;  3CWB E;  2JP3 A;  3SWK A;  1ZN5 A;  1PP9 E;  3L73 D;  4GIF A;  5CCG A;  1X8Y A;  2Z4E A;  3E1I A;  3SFE C;  1ZLL A;  1WRG A;  2FBW C;  5AW1 B;  2WT7 A;  2YMY A;  5E79 E;  1ZXG A;  2W90 A;  1PPJ E;  2JEE A;  4EYY Q;  2XKM A;  1L4A D;  1URQ B;  3V2Q A;  1BGY D;  3WU2 E;  5CCH D;  3TF5 A;  1ZW0 A;  1SQV G;  3TGU G;  3L72 D;  1K73 Q;  2KIK A;  3AE2 C;  5AW2 B;  1SQX E;  5KKZ C;  4LLH A;  3AEC C;  3VOP A;  1VQ8 P;  2IFM A;  3A3Y B;  3GLM A;  3RBZ A;  4NPD A;  3KQG A;  2IPP A;  2P10 A;  3G71 P;  3S9O A;  1J1D B;  3A0B E;  4D6T E;  4C7R A;  3MHV A;  2B87 B;  3RK3 B;  1PV3 A;  2E74 D;  1LT9 C;  1W2B O;  1SQX J;  4ASW A;  1MUU A;  1CZQ A;  1USE A;  2M5A B;  2GUV A;  2R3C A;  2XDJ A;  5KJ7 A;  1IK9 A;  1U7M A;  1KIL E;  2E75 D;  3FWL A;  3VYI A;  3TK1 A;  2ZAE B;  1VQ5 P;  1KQS O;  2J58 A;  2Q0T A;  3SFD C;  1GL2 B;  2DW3 A;  1VDF A;  2ZFC A;  2IBZ D;  1HJB A;  1AFO A;  2XNX A;  4G9Q A;  3H1L D;  1T8Z A;  1K8A Q;  2J5U A;  2L91 A;  2D2C C;  5AW4 B;  1NTK K;  1SQP J;  2WPS A;  1N73 B;  3LK3 A;  3L74 D;  1NTM G;  3GHG C;  4AQR D;  4C46 A;  1GL2 C;  3BCC G;  2V7Q H;  2Z5H A;  2E74 C;  4PD4 H;  4W7Z A;  3KYQ A;  1KIL A;  1IK7 A;  2FFD A;  3AA0 A;  1NTZ D;  4CPG A;  2Y9Z A;  2OYI A;  1MKM A;  3U1C A;  3E1R A;  1AQT A;  3D7I A;  2WTY A;  1HJ0 A;  1RF0 A;  1DIP A;  3HUS A;  1AVO A;  4UB8 H;  2FYZ A;  2KZI A;  1BCC J;  4OGQ C;  4R4L A;  3CPW O;  1GTW A;  1AJY A;  4Y99 C;  3O8Z A;  5KKZ B;  2WWW A;  1HTL C;  4PD4 I;  1MZ9 A;  2YO3 A;  1N7S B;  3AEE C;  1H8A A;  1AVY A;  1KIL B;  2O01 N;  2FY8 A;  2R44 A;  1M90 Q;  5KLV K;  1L2P A;  4H13 C;  3L74 E;  3CCV P;  1NTZ K;  2K9J B;  1KB9 I;  1ZR4 A;  1DH3 A;  1VQ6 P;  1KB9 E;  3A0H H;  1RH5 B;  4OH8 B;  1MFT A;  3V2N A;  1L0L E;  3L70 E;  2JJL A;  2Y9Y A;  3G6E P;  3A0B H;  3EQ2 A;  3R2P A;  4WY4 A;  4L76 A;  2HR3 A;  2B9B A;  1CI6 A;  3FX0 A;  4BXL A;  3C9I A;  4UB8 E;  3H1J J;  1OW8 A;  1PP9 G;  4K35 A;  3I56 P;  2ZYA A;  1GW4 A;  1ZME C;  1SFC D;  4UB6 H;  1P84 D;  4YPC A;  2OTL P;  1KMI Z;  1XTC C;  1ZV8 A;  1IFP A;  2PRR A;  3KZI E;  2IBZ E;  3A7O A;  2OYI C;  2W6B A; 
#chains in the Genus database with same CATH homology
 2KXP A;  3LVY A;  2AF7 A;  3LK4 1;  3BEY A;  1LW1 A;  2JN8 A;  4G9Q A;  2QEU A;  2Q0T A;  2KZ7 A;  1KNC A;  1P8C A;  2IJC A;  2PFX A;  2OUW A;  5AFU K;  3AAE A;  1VKE A;  1IZN A;  5ADX K;  4AKR A;  3LK3 A;  2CWQ A;  2O4D A;  3AA0 A;  3AA7 A;  5DIK A;  3LK2 A;  1GU9 A;  3D7I A;  2OYO A;  1ME5 A;  2GMY A;  2ES9 A;  3C1L A;  3AA1 A;  2PRR A;  3AA6 A;  5DIP A;  3AAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...