3C1LA

Crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
b'KISALDLGELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESGLSKLDREMIAVAVSSINHCYYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAAFFNMSNRVAAAIDMRPNDEYHAMAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative antioxidant defense protein Mlr4105
publication title Crystal structure of putative antioxidant defense protein (NP_105057.1) from Mesorhizobium loti at 2.00 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 3c1lA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 3c1lA02
2OUWA 2QEUA 5DIPA 2PFXA 1ME5A 2GMYA 1GU9A 2PRRA 5DIKA 3D7IA 2Q0TA 2AF7A 2CWQA 2O4DA 3C1LA 1LW1A 2IJCA 2OYOA 4G9QA 3BEYA 1P8CA 3LVYA 1KNCA 1VKEA
chains in the Genus database with same CATH superfamily
4W7YA 2W6JH 3G71P 4D6TD 1HVVA 2HFED 1SQXG 1NKZB 1R8EA 1VQ9P 3II6A 1EC5A 1S5LE 1FZAA 1PPJD 1W2EA 3N7NA 2ZYAA 4UB6E 3C8VA 1X9VA 3AE6C 1SQBK 1SQPK 1YITP 1FU1A 4GODA 1ZXGA 1ZP0C 2C0WA 3O8ZA 1PV3A 3CLQA 3E1IA 4AYCA 2O1KA 1SQVE 1KILC 3IR9A 2H7HA 3SWYA 3R2PA 3CMEP 1BSHA 3AE3C 1EXIA 1LTIC 4GKGA 1OVUA 1KILA 1ZRTD 3JCUH 3AEAC 2CK3H 1KB9D 2ZXEB 4L75A 5AW2B 4PV1C 2HPCB 1PGQA 1AFOA 1GW3A 3H32A 2E42A 2G3AA 2D2CC 2XV5A 3H1HE 1Q81Q 4M3LA 3ZDMA 2GUVA 1L0LG 3VMYA 1KD1Q 1WMKA 4HH2A 1OMIA 1PPJG 3VMXA 2KZ7A 1BGYG 2FFDC 2GUSA 3MTUE 3NFQA 5BU8B 5L8RJ 3NTNA 3SFDC 1FZCB 1VDFA 2KIKA 4C46A 1L0NE 1USDA 2FYUD 4I6MC 2FFDA 3L36A 2IBZI 1Q86Q 3CCJP 2P10A 1EDLA 4IFFA 1JB0J 3L72D 2KS1B 4GT1A 4IL6E 1RF0C 1OXZA 2FBWC 2YMYA 2QM7A 1QVFO 3H1KD 1YBKA 2XU6A 1LTGC 2IX7C 2POHA 1RF0A 2E74D 1OZHA 5TJHA 4KT0J 2JDIH 4YPCA 2ZVOB 1MFTA 1JY2P 2RKLA 3VMZA 5CHXA 2GA1A 1OWAA 2H88C 1J1DC 3MUDC 1OW7A 2KB7P 1GMJA 2N1TD 4UB6H 5B5EH 1X22A 1ZLLA 3ABVC 2Q3IA 2WTYA 4RJTA 5AVSB 1SQVJ 3RL0D 2QJKB 1KMIZ 4BRYB 4ZKUA 1VQOP 3CC2P 3M0AA 2KNCB 2FYUG 2JO1A 3L35A 1YQ3C 3L72G 1EZVE 3R4YA 3FWNA 3JC22 4GIFA 3H1KG 1NO4A 3H1HJ 4L73A 1GU9A 4BXLA 4B86A 3L71J 1WRGA 4JBZA 3CXHI 3G3ZA 4C7RA 3CCMP 5B66E 3GHGB 3CX5I 1KYOI 4ZKPA 1FS0E 1J2JB 4AUWA 2P7JA 3BCCE 3USSA 2QJYC 1LTAC 3RK3B 1KORA 1SQQE 1LGHB 1N73C 2CWQA 3S9OA 1K05A 2C0XA 1L0NJ 2BCCD 1IFJA 2ZYGA 2K9JB 1N73A 5E79H 1KILD 3L73D 2ITAA 1M8OB 5KLVE 3FXEA 2OQQA 1EDIA 4IL6H 2CPBA 3L75J 2KSEA 3H1IE 1SFCB 1KFMA 2L5GB 2VRSA 4R4LA 1FJKA 2NRGA 1NU1E 4PV1D 1M57D 2Q9IA 2MJZA 4DOJA 4H0LD 2AXTH 2Q5UA 1GK4A 3JSVC 4JYBA 2D2CD 2WITA 3SFEC 1FAVA 2K1AA 1FC2C 3WU2E 1VKEA 1OIPA 5AVTB 1IFNA 1SQXJ 3CX5H 1KYOH 1JCCA 3TF5A 1M1KQ 3HTKB 2W83C 3CPWO 3GW6A 3KDPB 3RK3E 3HD7C 1KNCA 1K04A 1LNQA 3L70G 4N78E 2WPQA 1M56D 4AKRA 1ME5A 1VQ5P 2BCCG 1LWUB 2R32A 2NPSB 1URQC 2JJLA 3AEFC 1FOSF 3HD7A 3EWKA 2AEFA 1SQBG 3VOPA 1PGOA 3L73G 2YO2A 3B4SA 1G2CA 1URQA 2YXRB 3B8EB 1IFMA 1U7JA 5K5GB 3N4XA 1BE3E 3L74E 1N2DC 3A0BH 3HE5B 5CCGC 2A06D 4I7ZC 1L4AB 5CJ4A 1RHZB 1MV8A 4XA4A 1QL1A 5CCGA 5KLIB 1KB9I 1X79B 1JEKA 3A5TA 1NTZE 1Y47A 1SQQJ 1NTME 2Q0TA 4EIJA 1LW1A 3TNUB 1L0LJ 1OX3A 2QJPB 1BGYJ 2WWWA 3HUSB 1CI6A 3MHVA 3TSIA 3S4RA 4EDFA 1FDIA 3TGUD 3JCUE 1ZOYC 1S3JA 4TLFA 1DEEG 5KLVJ 3RL0g 1DIPA 1NTKK 4Y99C 1SLQA 5AW5B 3TYYA 2Y0CA 3V2RA 3TDKA 1JY3P 3AE1C 2OYIB 5APWA 2M0BA 1H88A 3EFFK 1R5LA 3H32B 3OAKA 2A45G 2PP6A 2A06G 1UIIA 1N7LA 1OW6A 2I1KA 1T6AA 5KJ7C 1QGKB 2D2CB 1FBMA 1KB9H 1JY2O 3V4QA 1PGJA 2C9NY 1YJ9P 5DJUB 5KJ7A 3AE2C 5AW3B 2K3RA 1YHQP 3GMAA 3RBXA 3KQGA 4WY4B 2KXPA 1ZW0A 1PP9E 3TGUG 1M7LA 3TK1A 1G1JA 1VQ6P 1IK9A 2E76B 4IL6X 3L74J 2B87B 3B5NB 3QWOC 3CWBE 3L72J 3M9BA 3AE7C 5KKZC 1SQPE 3AA7A 2QRXA 1N86A 1X8YA 2RN0A 4H44C 3OA7A 5B5EE 2M5AA 5DJTB 3H1LE 1FDMA 4ASVA 3VP9A 1NTZJ 3GF3A 2H8PD 1H0TA 1NTMJ 4RKUJ 2YKPA 4EI2A 1RY3A 2HYNA 1IZNA 3IF4A 2O4DA 2YIUB 2IJCA 1AJYA 3K5BA 4XFJA 1T8ZA 1KQLA 3LK3A 1VF5C 2IBZE 5AVZB 2FYNC 3HD7D 5AVWB 4I1LA 1S9KD 1GL2B 3D7IA 3H1ID 1XTCC 3E1RA 2J59M 2CPSA 1URQD 4A7PA 1N7SB 1NVOA 1NU1D 2Y9ZA 4H0LC 3PH0A 3PTZA 3L71E 3L4FA 4Z1MH 2C9LY 2WT7B 1VQ4P 4U3FE 4D6TG 3L37A 3S1KA 2JKVA 5CCGD 1GW4A 4U7JA 1NAYA 2R44A 3EFGA 4GDOA 4PD4D 2WSEJ 3PP5A 1S1CX 1J1EB 2UWJE 2W90A 3BASA 2V7QJ 2N9BA 1ZN5A 3O6QA 2WSEH 2ZYDA 5E79E 3AA6A 1BCCD 2V7QH 3KHUA 5CMZA 2PFXA 1OFCX 1PGPA 2OARA 5AVXB 3HE4A 3CC4P 2ES9A 2WPRA 4OGQC 1PP9J 4HKZH 1JMMA 2P58A 1BE3D 4HB1A 3L70J 3E7KA 1AQTA 4WBAA 3GLMA 1Z56A 5CCHC 1P8CA 3WUTA 2QG4A 3L75E 2ZT9B 2RMZA 2AXTE 1RQVA 1L0NK 2OYHB 1FJPA 3FX0A 2K88A 2OTLP 3CWBJ 5EFWB 5CCHA 1SQBJ 3CXHE 3AE9C 1SQPJ 2QVAA 2YKOA 3RK2B 2HODB 1RH5B 1S2EA 1NTKD 3CX5E 1KYOE 2HLOA 3VP8A 3D6YA 1R5SA 3H1LJ 2XDJA 1HJ0A 2JN8A 1SQXE 1GU5A 2ZFCA 5H2FE 1QEXA 2A45I 2LKMA 3MUDA 2KLUA 1NOHA 2AXCA 4N3YB 5KJ7D 1LT9B 5GTHE 1PFIA 2IZ0A 1BCCG 3CMAP 5AVRB 5TISH 1KFNA 2ZXXA 1NYHA 3CCEP 2WQYC 1T2KC 1IO4A 2QA4P 3KZIE 3P8CE 3A0BE 2H89C 2RH0A 2HPCA 3A3YB 1OW8A 1NWQA 2Q1KA 2QE7H 1M1JB 3MZWB 1SVFA 3H1JD 2XKMA 4U3FJ 2J58A 1FZFA 4G9QA 3H6PA 2KI7B 3M9HA 4WWIA 4L74A 2IPPA 4EOTA 2P1JA 1EDJA 4H44D 1NTKG 2K37A 1FZCC 2KK7A 3BATA 3PHLA 3MIWA 1DX7A 2KLVA 2HG5D 2SPZA 3Q2YA 4K35A 1LTJB 1L0LE 1OVRA 1FZCA 1PPJE 2A45H 1BGYE 3M9QA 4W7ZA 4HJGH 2LR2A 1VF5D 4C7NB 3EQ2A 1W5CE 4JYCA 4OWFA 1SQQK 1U7MA 1NKNA 4ZNCA 2Q6QA 5AVUB 5AW6B 3AEBC 2PGDA 5DIKA 3TGUJ 3G4SP 3MGNA 1JM0A 3ITKA 3V2NA 3WMM0 2YMKA 3D71A 1JMBA 1ZRTE 2WSSH 3CXHH 3H1JG 3AEGC 2E74B 1P84I 1EXJA 1KB9E 4ZMDA 1KZUB 4WB4A 3FGAD 1SQVD 2QJKC 1K73Q 3T97B 1Y9BA 1NU1K 1FOSE 1JTHA 3AE5C 3M06A 2Z5IA 4GOFA 1ZR4A 1LT1A 1ZMEC 5AW4B 5H2FH 4LC1A 2E75D 2Y0DA 1AA0A 2WSCJ 4BRYA 2N1TB 3Q1MA 1JNMA 3C9IA 2QEXP 2KNCA 2I1JA 3UIAA 5GTHH 3VYIA 2FXMA 3RL0B 4GOEA 3LW5J 2WSCH 1XTGB 4OGQD 3H1HD 5KAFH 3BRTB 3L71D 1RF1B 3U59A 3GG2A 5CCHD 1VQ8P 1LTBC 4DCKA 3P32A 2FYUE 3KZIH 4AQRD 3GHGC 3LW5H 4YTPC 1LP1B 1NGMB 3L72E 3AECC 1MUUA 4HYTB 3GHGA 3RK3C 3H1KE 1E79H 5M1BA 3CCUP 4WVZA 1GDTA 5AW0B 1FZGA 1L0ND 4YXWH 4D6TJ 1E5WA 1RE3C 3LIEA 1P84H 5APSA 1SQVG 2IYPA 2OUWA 5BVZA 1VQ7P 1RE3A 2K9JA 1QVGO 3LK2A 2QM8A 4PD4I 4H13C 1SFCC 1NTZK 4IOIH 4JPZB 1NTMK 1NAFA 3U1CA 2O01N 1LTSC 1T2KD 1SFCA 4DT0A 1KILB 3H1HG 1KYOD 1WT6A 2KSJA 3H25A 2JWDA 2FXPA 2P67A 1BDDA 3KXDA 3W68A 2E5YA 3IN6A 1Q7YQ 2R5BA 4PV1B 1NJIQ 4NPDA 1FZEA 1T3UA 4H0LB 2M3BA 3MP7B 1YQ4C 1ZV8A 3HTKA 1KN7A 3VMAA 3BEYA 1L0NG 1LWUC 3CL3D 2NPSC 5APUA 1HH0A 3D70A 2JR8A 3P8CD 1EZVD 5CJ0A 1LWUA 1W2BO 1HWTC 2NPSA 3IFMA 2O01J 1M90Q 3M0DC 3AAAA 2FFDB 3CI9A 2KP8A 3L70E 1IFPA 3HE4B 3SSUA 1YJWP 2O01H 2BCCE 2KUBA 2FYUJ 3M0DA 1L4AC 3VTPC 2J5UA 3I55P 2JEEA 3HE5A 1SQBE 2YKQA 1KILE 1AVYA 3L73E 3BCCD 1L4AA 4QMAA 3H1KJ 5KTBA 1SQQD 1A02F 1Q90D 1VQNP 1GZLA 1L0LD 1VQPP 4ASWA 3CCSP 2QJPC 2XZRA 1DEBA 3HUSC 1BGYD 5CBNA 1CW5A 2YXQB 3TNUA 4LLHA 1GU4A 2LXBA 5TISE 1SP4A 1YTZT 1JO5A 1NTKJ 1HF9A 5AW1B 3F89A 5KLVD 4JF7A 5APTA 3HUSA 1J1DB 3AEEC 4I2LC 1FE6A 3QH9A 1EQ7A 3I56P 1EZVG 2IFMA 3RBZA 2KZIA 2OYIC 3BVHA 2G8YA 2JWAA 2KOGA 1AV1A 1HGZA 1MFZA 1SQVK 2ZJSE 2ZVNB 2R3CA 1HTLC 2OYIA 3AE8C 3V5BA 3M91A 1YJNP 1Y8AA 3F5HA 1JOCA 2PRRA 2BEQD 3BCCG 2IYOA 1K9MQ 3RK3D 2FY8A 1SQQG 4N78D 5AFUK 1LJ2A 1KTMA 3H1JJ 2A06E 2E75C 4DJGA 1GD2E 4WY4C 2FXOA 3AEDC 4UB8H 5BU5A 2XNDH 3CD6P 4IFMA 2B9BA 2E76C 2QJYB 3MD0A 4WY4A 3RGUA 5KAIH 5KLVG 3L74D 4KHXA 4H13D 1YYCA 4K3AA 1N73B 3FXDA 3B5NC 2BASA 1SFCD 2K9YA 1JY2N 2OGUA 3H1IG 3FWLA 1QLED 5AVQB 2BCCJ 2OTJP 5DIPA 4EYYQ 1A02J 1NU1G 2B87A 3B5NA 5GTIE 3TGUE 3HRNA 2HR3A 3L73J 3A2AA 1NTZD 2KZJA 1NTMD 5APVA 2ZAEB 3A0HH 2IDBA 3OW2O 3P8MC 2YIUC 1HJBA 2O3JA 4O9BA 4RO0A 2PAJA 1IK7A 1KQSO 2BEZF 1GL2C 4LGDE 1S5LH 1PIXA 2W6AA 3WUVA 2Q3EA 2NPSD 1N7SC 1YIJP 2V4HA 5KAFE 1JTHB 1CSBA 3U1AA 1GL2A 1SQXK 2B89A 2FYZA 2M8RA 2KYVA 4YXDC 1N7SA 2Z5HA 3B71A 2XNXA 3G6EP 1BE3G 3HD7B 3V2QA 3L74G 5AVYB 3CCQP 3Q5RA 1S72P 3AE4C 1L4AD 1G2CB 1URQB 5AW7B 3Q5PA 2WT7A 3NXSA 1J1EC 2R3SA 3NMDA 3SWFA 1P84E 1JY3O 2E5TA 1NTZG 2NZ2A 2WZ7A 1TU3F 1HBWA 1KC8Q 4D6TE 1NTMG 4OH8B 1VQLP 4I7ZB 5APYA 2R5DA 1PP9D 3CCRP 3L70D 1S4XA 2KS1A 1YTZI 2ZT9C 4NPEA 3AA0A 2OYHC 1IC2A 1CI6B 1UIXA 2QIWA 1VQMP 3CWBD 1SQBD 2P2UA 2GMYA 1SQPD 1L0LK 3RK2C 1H89A 1IJDB 1H8AA 1LTTC 2OYHA 1VL2A 3Q3DA 2E43A 1DD4A 4RESB 4PJ0E 1EZVI 1GK6A 3I5CA 4H13B 3H1LD 1KQGB 1S9KE 3WUUA 1QX8A 3LVYA 1Q82Q 2HODA 5ADXK 4Y99B 5KLVK 5GTIH 3KYQA 2WVRA 5AVVB 3G9RA 3IAOA 2LXCB 4DZOA 1Q2NA 1JUNA 5APQA 2OYOA 1MKMA 1N8RQ 1LT9C 2IBZD 2Z4EA 5CBOA 4TT3H 2YO3A 3V2PA 2I8DA 1L2PA 1LT9A 1VPCA 4WY4D 3D6ZA 4PD4E 1YI2P 2DW3A 2Y0EA 5AW8B 2AEJA 1PP9G 1GTWA 2FKWB 3P7KA 2E76D 3V6IA 1M1JC 1PL5A 4MN4C 3V4WA 2KXPB 1BCCE 1D7MA 2N9YB 4Y28J 1T3JA 1HUCA 4R4MA 4U3FD 3B5ND 1K8AQ 1X0TA 1USEA 4NPFX 3LK41 3PRJA 3CWBG 2AF7A 3Q5SA 1M1JA 1BSNA 1FZBA 2WSFJ 1SQPG 2IFNA 3GF7A 4CPGA 4OVNF 1PZQA 1U57A 3LIDA 3H1LG 3BRVB 2WSFH 3W67A 3AAEA 5C39A 1LTJC 4XE5B 1NH4A 2FYUK 4BWNA 2M5AB 5APXA 3SWKA 5KKZB 2GM4A 2AEMA 1LTJA 3BCCJ 5B66H 1H0TB 1AVOA 1G1IA 1NTKE 1S5LX 2IBZG 4H44B 1CZQA 1IZNB 1GL2D 1RQUA 1IFDA 4N6JA 3L75D 1DD3A 1JY3N 4W80A 3A7OA 3CCLP 5AW9B 1JCDA 2IZ1A 1N7SD 4KJMA 4C7NA 1BDCA 2WPSA 3CXHD 1DH3A 1IFIA 2QSIA 3CC7P 3AA1A 1VF5B 4JQ0D 3CX5D 3L71G 2FYNB 1KV4A 3C1LA 2E74C 3H1IJ 4U3FG 2O1JA 3VN0A 2W8ZA 1SQXD 2Q7CA 4PJ0H 1NU1J 1RE4C 3PJSK 1OVVA 1VQKP 2Y9YA 4UB8E 3OJAB 2JP3A 3T97A 2H43A 1RE4A 3H1JE 2N1TC 2B88A 2L91A 2QEUA 2OTKE 1SS1A 3WU2H 5KAIE 1QL2A 1AQ5A 1ZR2A 3O6QB 3RL0C 3PLNA 2W6BA 2N1TA 1RF1C 2WMMA 2WPVB 4L76A 1NHLA 2MKVA 4PD4H 2ZT9D 3CCVP 3L75G 1KQFB 1BCCJ 2E75B 1RF1A 1HGVA 2YNYA 3RK2D 2W27A 5KLIC 3A0HE 1MZ9A 1FDOA 2M3EA 1LP1A 1P84D 4OGQB 3KPEA 4IFDK 1BE3J 1EDKA
chains in the Genus database with same CATH topology
2OUWA 2QEUA 5DIPA 2PFXA 2JN8A 4AKRA 1ME5A 2KZ7A 2GMYA 1GU9A 2PRRA 3LK2A 3AA1A 3AAEA 3D7IA 5DIKA 2ES9A 3LK41 2KXPA 2Q0TA 2AF7A 2CWQA 1IZNA 5AFUK 2O4DA 5ADXK 3C1LA 1LW1A 3AAAA 2IJCA 3AA7A 2OYOA 4G9QA 3AA6A 3AA0A 3BEYA 1P8CA 3LVYA 1KNCA 1VKEA 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OUW A;  2QEU A;  5DIP A;  2PFX A;  1ME5 A;  2GMY A;  1GU9 A;  2PRR A;  5DIK A;  3D7I A;  2Q0T A;  2AF7 A;  2CWQ A;  2O4D A;  3C1L A;  1LW1 A;  2IJC A;  2OYO A;  4G9Q A;  3BEY A;  1P8C A;  3LVY A;  1KNC A;  1VKE A; 
#chains in the Genus database with same CATH topology
 4W7Y A;  2W6J H;  3G71 P;  4D6T D;  1HVV A;  2HFE D;  1SQX G;  1NKZ B;  1R8E A;  1VQ9 P;  3II6 A;  1EC5 A;  1S5L E;  1FZA A;  1PPJ D;  1W2E A;  3N7N A;  2ZYA A;  4UB6 E;  3C8V A;  1X9V A;  3AE6 C;  1SQB K;  1SQP K;  1YIT P;  1FU1 A;  4GOD A;  1ZXG A;  1ZP0 C;  2C0W A;  3O8Z A;  1PV3 A;  3CLQ A;  3E1I A;  4AYC A;  2O1K A;  1SQV E;  1KIL C;  3IR9 A;  2H7H A;  3SWY A;  3R2P A;  3CME P;  1BSH A;  3AE3 C;  1EXI A;  1LTI C;  4GKG A;  1OVU A;  1KIL A;  1ZRT D;  3JCU H;  3AEA C;  2CK3 H;  1KB9 D;  2ZXE B;  4L75 A;  5AW2 B;  4PV1 C;  2HPC B;  1PGQ A;  1AFO A;  1GW3 A;  3H32 A;  2E42 A;  2G3A A;  2D2C C;  2XV5 A;  3H1H E;  1Q81 Q;  4M3L A;  3ZDM A;  2GUV A;  1L0L G;  3VMY A;  1KD1 Q;  1WMK A;  4HH2 A;  1OMI A;  1PPJ G;  3VMX A;  2KZ7 A;  1BGY G;  2FFD C;  2GUS A;  3MTU E;  3NFQ A;  5BU8 B;  5L8R J;  3NTN A;  3SFD C;  1FZC B;  1VDF A;  2KIK A;  4C46 A;  1L0N E;  1USD A;  2FYU D;  4I6M C;  2FFD A;  3L36 A;  2IBZ I;  1Q86 Q;  3CCJ P;  2P10 A;  1EDL A;  4IFF A;  1JB0 J;  3L72 D;  2KS1 B;  4GT1 A;  4IL6 E;  1RF0 C;  1OXZ A;  2FBW C;  2YMY A;  2QM7 A;  1QVF O;  3H1K D;  1YBK A;  2XU6 A;  1LTG C;  2IX7 C;  2POH A;  1RF0 A;  2E74 D;  1OZH A;  5TJH A;  4KT0 J;  2JDI H;  4YPC A;  2ZVO B;  1MFT A;  1JY2 P;  2RKL A;  3VMZ A;  5CHX A;  2GA1 A;  1OWA A;  2H88 C;  1J1D C;  3MUD C;  1OW7 A;  2KB7 P;  1GMJ A;  2N1T D;  4UB6 H;  5B5E H;  1X22 A;  1ZLL A;  3ABV C;  2Q3I A;  2WTY A;  4RJT A;  5AVS B;  1SQV J;  3RL0 D;  2QJK B;  1KMI Z;  4BRY B;  4ZKU A;  1VQO P;  3CC2 P;  3M0A A;  2KNC B;  2FYU G;  2JO1 A;  3L35 A;  1YQ3 C;  3L72 G;  1EZV E;  3R4Y A;  3FWN A;  3JC2 2;  4GIF A;  3H1K G;  1NO4 A;  3H1H J;  4L73 A;  1GU9 A;  4BXL A;  4B86 A;  3L71 J;  1WRG A;  4JBZ A;  3CXH I;  3G3Z A;  4C7R A;  3CCM P;  5B66 E;  3GHG B;  3CX5 I;  1KYO I;  4ZKP A;  1FS0 E;  1J2J B;  4AUW A;  2P7J A;  3BCC E;  3USS A;  2QJY C;  1LTA C;  3RK3 B;  1KOR A;  1SQQ E;  1LGH B;  1N73 C;  2CWQ A;  3S9O A;  1K05 A;  2C0X A;  1L0N J;  2BCC D;  1IFJ A;  2ZYG A;  2K9J B;  1N73 A;  5E79 H;  1KIL D;  3L73 D;  2ITA A;  1M8O B;  5KLV E;  3FXE A;  2OQQ A;  1EDI A;  4IL6 H;  2CPB A;  3L75 J;  2KSE A;  3H1I E;  1SFC B;  1KFM A;  2L5G B;  2VRS A;  4R4L A;  1FJK A;  2NRG A;  1NU1 E;  4PV1 D;  1M57 D;  2Q9I A;  2MJZ A;  4DOJ A;  4H0L D;  2AXT H;  2Q5U A;  1GK4 A;  3JSV C;  4JYB A;  2D2C D;  2WIT A;  3SFE C;  1FAV A;  2K1A A;  1FC2 C;  3WU2 E;  1VKE A;  1OIP A;  5AVT B;  1IFN A;  1SQX J;  3CX5 H;  1KYO H;  1JCC A;  3TF5 A;  1M1K Q;  3HTK B;  2W83 C;  3CPW O;  3GW6 A;  3KDP B;  3RK3 E;  3HD7 C;  1KNC A;  1K04 A;  1LNQ A;  3L70 G;  4N78 E;  2WPQ A;  1M56 D;  4AKR A;  1ME5 A;  1VQ5 P;  2BCC G;  1LWU B;  2R32 A;  2NPS B;  1URQ C;  2JJL A;  3AEF C;  1FOS F;  3HD7 A;  3EWK A;  2AEF A;  1SQB G;  3VOP A;  1PGO A;  3L73 G;  2YO2 A;  3B4S A;  1G2C A;  1URQ A;  2YXR B;  3B8E B;  1IFM A;  1U7J A;  5K5G B;  3N4X A;  1BE3 E;  3L74 E;  1N2D C;  3A0B H;  3HE5 B;  5CCG C;  2A06 D;  4I7Z C;  1L4A B;  5CJ4 A;  1RHZ B;  1MV8 A;  4XA4 A;  1QL1 A;  5CCG A;  5KLI B;  1KB9 I;  1X79 B;  1JEK A;  3A5T A;  1NTZ E;  1Y47 A;  1SQQ J;  1NTM E;  2Q0T A;  4EIJ A;  1LW1 A;  3TNU B;  1L0L J;  1OX3 A;  2QJP B;  1BGY J;  2WWW A;  3HUS B;  1CI6 A;  3MHV A;  3TSI A;  3S4R A;  4EDF A;  1FDI A;  3TGU D;  3JCU E;  1ZOY C;  1S3J A;  4TLF A;  1DEE G;  5KLV J;  3RL0 g;  1DIP A;  1NTK K;  4Y99 C;  1SLQ A;  5AW5 B;  3TYY A;  2Y0C A;  3V2R A;  3TDK A;  1JY3 P;  3AE1 C;  2OYI B;  5APW A;  2M0B A;  1H88 A;  3EFF K;  1R5L A;  3H32 B;  3OAK A;  2A45 G;  2PP6 A;  2A06 G;  1UII A;  1N7L A;  1OW6 A;  2I1K A;  1T6A A;  5KJ7 C;  1QGK B;  2D2C B;  1FBM A;  1KB9 H;  1JY2 O;  3V4Q A;  1PGJ A;  2C9N Y;  1YJ9 P;  5DJU B;  5KJ7 A;  3AE2 C;  5AW3 B;  2K3R A;  1YHQ P;  3GMA A;  3RBX A;  3KQG A;  4WY4 B;  2KXP A;  1ZW0 A;  1PP9 E;  3TGU G;  1M7L A;  3TK1 A;  1G1J A;  1VQ6 P;  1IK9 A;  2E76 B;  4IL6 X;  3L74 J;  2B87 B;  3B5N B;  3QWO C;  3CWB E;  3L72 J;  3M9B A;  3AE7 C;  5KKZ C;  1SQP E;  3AA7 A;  2QRX A;  1N86 A;  1X8Y A;  2RN0 A;  4H44 C;  3OA7 A;  5B5E E;  2M5A A;  5DJT B;  3H1L E;  1FDM A;  4ASV A;  3VP9 A;  1NTZ J;  3GF3 A;  2H8P D;  1H0T A;  1NTM J;  4RKU J;  2YKP A;  4EI2 A;  1RY3 A;  2HYN A;  1IZN A;  3IF4 A;  2O4D A;  2YIU B;  2IJC A;  1AJY A;  3K5B A;  4XFJ A;  1T8Z A;  1KQL A;  3LK3 A;  1VF5 C;  2IBZ E;  5AVZ B;  2FYN C;  3HD7 D;  5AVW B;  4I1L A;  1S9K D;  1GL2 B;  3D7I A;  3H1I D;  1XTC C;  3E1R A;  2J59 M;  2CPS A;  1URQ D;  4A7P A;  1N7S B;  1NVO A;  1NU1 D;  2Y9Z A;  4H0L C;  3PH0 A;  3PTZ A;  3L71 E;  3L4F A;  4Z1M H;  2C9L Y;  2WT7 B;  1VQ4 P;  4U3F E;  4D6T G;  3L37 A;  3S1K A;  2JKV A;  5CCG D;  1GW4 A;  4U7J A;  1NAY A;  2R44 A;  3EFG A;  4GDO A;  4PD4 D;  2WSE J;  3PP5 A;  1S1C X;  1J1E B;  2UWJ E;  2W90 A;  3BAS A;  2V7Q J;  2N9B A;  1ZN5 A;  3O6Q A;  2WSE H;  2ZYD A;  5E79 E;  3AA6 A;  1BCC D;  2V7Q H;  3KHU A;  5CMZ A;  2PFX A;  1OFC X;  1PGP A;  2OAR A;  5AVX B;  3HE4 A;  3CC4 P;  2ES9 A;  2WPR A;  4OGQ C;  1PP9 J;  4HKZ H;  1JMM A;  2P58 A;  1BE3 D;  4HB1 A;  3L70 J;  3E7K A;  1AQT A;  4WBA A;  3GLM A;  1Z56 A;  5CCH C;  1P8C A;  3WUT A;  2QG4 A;  3L75 E;  2ZT9 B;  2RMZ A;  2AXT E;  1RQV A;  1L0N K;  2OYH B;  1FJP A;  3FX0 A;  2K88 A;  2OTL P;  3CWB J;  5EFW B;  5CCH A;  1SQB J;  3CXH E;  3AE9 C;  1SQP J;  2QVA A;  2YKO A;  3RK2 B;  2HOD B;  1RH5 B;  1S2E A;  1NTK D;  3CX5 E;  1KYO E;  2HLO A;  3VP8 A;  3D6Y A;  1R5S A;  3H1L J;  2XDJ A;  1HJ0 A;  2JN8 A;  1SQX E;  1GU5 A;  2ZFC A;  5H2F E;  1QEX A;  2A45 I;  2LKM A;  3MUD A;  2KLU A;  1NOH A;  2AXC A;  4N3Y B;  5KJ7 D;  1LT9 B;  5GTH E;  1PFI A;  2IZ0 A;  1BCC G;  3CMA P;  5AVR B;  5TIS H;  1KFN A;  2ZXX A;  1NYH A;  3CCE P;  2WQY C;  1T2K C;  1IO4 A;  2QA4 P;  3KZI E;  3P8C E;  3A0B E;  2H89 C;  2RH0 A;  2HPC A;  3A3Y B;  1OW8 A;  1NWQ A;  2Q1K A;  2QE7 H;  1M1J B;  3MZW B;  1SVF A;  3H1J D;  2XKM A;  4U3F J;  2J58 A;  1FZF A;  4G9Q A;  3H6P A;  2KI7 B;  3M9H A;  4WWI A;  4L74 A;  2IPP A;  4EOT A;  2P1J A;  1EDJ A;  4H44 D;  1NTK G;  2K37 A;  1FZC C;  2KK7 A;  3BAT A;  3PHL A;  3MIW A;  1DX7 A;  2KLV A;  2HG5 D;  2SPZ A;  3Q2Y A;  4K35 A;  1LTJ B;  1L0L E;  1OVR A;  1FZC A;  1PPJ E;  2A45 H;  1BGY E;  3M9Q A;  4W7Z A;  4HJG H;  2LR2 A;  1VF5 D;  4C7N B;  3EQ2 A;  1W5C E;  4JYC A;  4OWF A;  1SQQ K;  1U7M A;  1NKN A;  4ZNC A;  2Q6Q A;  5AVU B;  5AW6 B;  3AEB C;  2PGD A;  5DIK A;  3TGU J;  3G4S P;  3MGN A;  1JM0 A;  3ITK A;  3V2N A;  3WMM 0;  2YMK A;  3D71 A;  1JMB A;  1ZRT E;  2WSS H;  3CXH H;  3H1J G;  3AEG C;  2E74 B;  1P84 I;  1EXJ A;  1KB9 E;  4ZMD A;  1KZU B;  4WB4 A;  3FGA D;  1SQV D;  2QJK C;  1K73 Q;  3T97 B;  1Y9B A;  1NU1 K;  1FOS E;  1JTH A;  3AE5 C;  3M06 A;  2Z5I A;  4GOF A;  1ZR4 A;  1LT1 A;  1ZME C;  5AW4 B;  5H2F H;  4LC1 A;  2E75 D;  2Y0D A;  1AA0 A;  2WSC J;  4BRY A;  2N1T B;  3Q1M A;  1JNM A;  3C9I A;  2QEX P;  2KNC A;  2I1J A;  3UIA A;  5GTH H;  3VYI A;  2FXM A;  3RL0 B;  4GOE A;  3LW5 J;  2WSC H;  1XTG B;  4OGQ D;  3H1H D;  5KAF H;  3BRT B;  3L71 D;  1RF1 B;  3U59 A;  3GG2 A;  5CCH D;  1VQ8 P;  1LTB C;  4DCK A;  3P32 A;  2FYU E;  3KZI H;  4AQR D;  3GHG C;  3LW5 H;  4YTP C;  1LP1 B;  1NGM B;  3L72 E;  3AEC C;  1MUU A;  4HYT B;  3GHG A;  3RK3 C;  3H1K E;  1E79 H;  5M1B A;  3CCU P;  4WVZ A;  1GDT A;  5AW0 B;  1FZG A;  1L0N D;  4YXW H;  4D6T J;  1E5W A;  1RE3 C;  3LIE A;  1P84 H;  5APS A;  1SQV G;  2IYP A;  2OUW A;  5BVZ A;  1VQ7 P;  1RE3 A;  2K9J A;  1QVG O;  3LK2 A;  2QM8 A;  4PD4 I;  4H13 C;  1SFC C;  1NTZ K;  4IOI H;  4JPZ B;  1NTM K;  1NAF A;  3U1C A;  2O01 N;  1LTS C;  1T2K D;  1SFC A;  4DT0 A;  1KIL B;  3H1H G;  1KYO D;  1WT6 A;  2KSJ A;  3H25 A;  2JWD A;  2FXP A;  2P67 A;  1BDD A;  3KXD A;  3W68 A;  2E5Y A;  3IN6 A;  1Q7Y Q;  2R5B A;  4PV1 B;  1NJI Q;  4NPD A;  1FZE A;  1T3U A;  4H0L B;  2M3B A;  3MP7 B;  1YQ4 C;  1ZV8 A;  3HTK A;  1KN7 A;  3VMA A;  3BEY A;  1L0N G;  1LWU C;  3CL3 D;  2NPS C;  5APU A;  1HH0 A;  3D70 A;  2JR8 A;  3P8C D;  1EZV D;  5CJ0 A;  1LWU A;  1W2B O;  1HWT C;  2NPS A;  3IFM A;  2O01 J;  1M90 Q;  3M0D C;  3AAA A;  2FFD B;  3CI9 A;  2KP8 A;  3L70 E;  1IFP A;  3HE4 B;  3SSU A;  1YJW P;  2O01 H;  2BCC E;  2KUB A;  2FYU J;  3M0D A;  1L4A C;  3VTP C;  2J5U A;  3I55 P;  2JEE A;  3HE5 A;  1SQB E;  2YKQ A;  1KIL E;  1AVY A;  3L73 E;  3BCC D;  1L4A A;  4QMA A;  3H1K J;  5KTB A;  1SQQ D;  1A02 F;  1Q90 D;  1VQN P;  1GZL A;  1L0L D;  1VQP P;  4ASW A;  3CCS P;  2QJP C;  2XZR A;  1DEB A;  3HUS C;  1BGY D;  5CBN A;  1CW5 A;  2YXQ B;  3TNU A;  4LLH A;  1GU4 A;  2LXB A;  5TIS E;  1SP4 A;  1YTZ T;  1JO5 A;  1NTK J;  1HF9 A;  5AW1 B;  3F89 A;  5KLV D;  4JF7 A;  5APT A;  3HUS A;  1J1D B;  3AEE C;  4I2L C;  1FE6 A;  3QH9 A;  1EQ7 A;  3I56 P;  1EZV G;  2IFM A;  3RBZ A;  2KZI A;  2OYI C;  3BVH A;  2G8Y A;  2JWA A;  2KOG A;  1AV1 A;  1HGZ A;  1MFZ A;  1SQV K;  2ZJS E;  2ZVN B;  2R3C A;  1HTL C;  2OYI A;  3AE8 C;  3V5B A;  3M91 A;  1YJN P;  1Y8A A;  3F5H A;  1JOC A;  2PRR A;  2BEQ D;  3BCC G;  2IYO A;  1K9M Q;  3RK3 D;  2FY8 A;  1SQQ G;  4N78 D;  5AFU K;  1LJ2 A;  1KTM A;  3H1J J;  2A06 E;  2E75 C;  4DJG A;  1GD2 E;  4WY4 C;  2FXO A;  3AED C;  4UB8 H;  5BU5 A;  2XND H;  3CD6 P;  4IFM A;  2B9B A;  2E76 C;  2QJY B;  3MD0 A;  4WY4 A;  3RGU A;  5KAI H;  5KLV G;  3L74 D;  4KHX A;  4H13 D;  1YYC A;  4K3A A;  1N73 B;  3FXD A;  3B5N C;  2BAS A;  1SFC D;  2K9Y A;  1JY2 N;  2OGU A;  3H1I G;  3FWL A;  1QLE D;  5AVQ B;  2BCC J;  2OTJ P;  5DIP A;  4EYY Q;  1A02 J;  1NU1 G;  2B87 A;  3B5N A;  5GTI E;  3TGU E;  3HRN A;  2HR3 A;  3L73 J;  3A2A A;  1NTZ D;  2KZJ A;  1NTM D;  5APV A;  2ZAE B;  3A0H H;  2IDB A;  3OW2 O;  3P8M C;  2YIU C;  1HJB A;  2O3J A;  4O9B A;  4RO0 A;  2PAJ A;  1IK7 A;  1KQS O;  2BEZ F;  1GL2 C;  4LGD E;  1S5L H;  1PIX A;  2W6A A;  3WUV A;  2Q3E A;  2NPS D;  1N7S C;  1YIJ P;  2V4H A;  5KAF E;  1JTH B;  1CSB A;  3U1A A;  1GL2 A;  1SQX K;  2B89 A;  2FYZ A;  2M8R A;  2KYV A;  4YXD C;  1N7S A;  2Z5H A;  3B71 A;  2XNX A;  3G6E P;  1BE3 G;  3HD7 B;  3V2Q A;  3L74 G;  5AVY B;  3CCQ P;  3Q5R A;  1S72 P;  3AE4 C;  1L4A D;  1G2C B;  1URQ B;  5AW7 B;  3Q5P A;  2WT7 A;  3NXS A;  1J1E C;  2R3S A;  3NMD A;  3SWF A;  1P84 E;  1JY3 O;  2E5T A;  1NTZ G;  2NZ2 A;  2WZ7 A;  1TU3 F;  1HBW A;  1KC8 Q;  4D6T E;  1NTM G;  4OH8 B;  1VQL P;  4I7Z B;  5APY A;  2R5D A;  1PP9 D;  3CCR P;  3L70 D;  1S4X A;  2KS1 A;  1YTZ I;  2ZT9 C;  4NPE A;  3AA0 A;  2OYH C;  1IC2 A;  1CI6 B;  1UIX A;  2QIW A;  1VQM P;  3CWB D;  1SQB D;  2P2U A;  2GMY A;  1SQP D;  1L0L K;  3RK2 C;  1H89 A;  1IJD B;  1H8A A;  1LTT C;  2OYH A;  1VL2 A;  3Q3D A;  2E43 A;  1DD4 A;  4RES B;  4PJ0 E;  1EZV I;  1GK6 A;  3I5C A;  4H13 B;  3H1L D;  1KQG B;  1S9K E;  3WUU A;  1QX8 A;  3LVY A;  1Q82 Q;  2HOD A;  5ADX K;  4Y99 B;  5KLV K;  5GTI H;  3KYQ A;  2WVR A;  5AVV B;  3G9R A;  3IAO A;  2LXC B;  4DZO A;  1Q2N A;  1JUN A;  5APQ A;  2OYO A;  1MKM A;  1N8R Q;  1LT9 C;  2IBZ D;  2Z4E A;  5CBO A;  4TT3 H;  2YO3 A;  3V2P A;  2I8D A;  1L2P A;  1LT9 A;  1VPC A;  4WY4 D;  3D6Z A;  4PD4 E;  1YI2 P;  2DW3 A;  2Y0E A;  5AW8 B;  2AEJ A;  1PP9 G;  1GTW A;  2FKW B;  3P7K A;  2E76 D;  3V6I A;  1M1J C;  1PL5 A;  4MN4 C;  3V4W A;  2KXP B;  1BCC E;  1D7M A;  2N9Y B;  4Y28 J;  1T3J A;  1HUC A;  4R4M A;  4U3F D;  3B5N D;  1K8A Q;  1X0T A;  1USE A;  4NPF X;  3LK4 1;  3PRJ A;  3CWB G;  2AF7 A;  3Q5S A;  1M1J A;  1BSN A;  1FZB A;  2WSF J;  1SQP G;  2IFN A;  3GF7 A;  4CPG A;  4OVN F;  1PZQ A;  1U57 A;  3LID A;  3H1L G;  3BRV B;  2WSF H;  3W67 A;  3AAE A;  5C39 A;  1LTJ C;  4XE5 B;  1NH4 A;  2FYU K;  4BWN A;  2M5A B;  5APX A;  3SWK A;  5KKZ B;  2GM4 A;  2AEM A;  1LTJ A;  3BCC J;  5B66 H;  1H0T B;  1AVO A;  1G1I A;  1NTK E;  1S5L X;  2IBZ G;  4H44 B;  1CZQ A;  1IZN B;  1GL2 D;  1RQU A;  1IFD A;  4N6J A;  3L75 D;  1DD3 A;  1JY3 N;  4W80 A;  3A7O A;  3CCL P;  5AW9 B;  1JCD A;  2IZ1 A;  1N7S D;  4KJM A;  4C7N A;  1BDC A;  2WPS A;  3CXH D;  1DH3 A;  1IFI A;  2QSI A;  3CC7 P;  3AA1 A;  1VF5 B;  4JQ0 D;  3CX5 D;  3L71 G;  2FYN B;  1KV4 A;  3C1L A;  2E74 C;  3H1I J;  4U3F G;  2O1J A;  3VN0 A;  2W8Z A;  1SQX D;  2Q7C A;  4PJ0 H;  1NU1 J;  1RE4 C;  3PJS K;  1OVV A;  1VQK P;  2Y9Y A;  4UB8 E;  3OJA B;  2JP3 A;  3T97 A;  2H43 A;  1RE4 A;  3H1J E;  2N1T C;  2B88 A;  2L91 A;  2QEU A;  2OTK E;  1SS1 A;  3WU2 H;  5KAI E;  1QL2 A;  1AQ5 A;  1ZR2 A;  3O6Q B;  3RL0 C;  3PLN A;  2W6B A;  2N1T A;  1RF1 C;  2WMM A;  2WPV B;  4L76 A;  1NHL A;  2MKV A;  4PD4 H;  2ZT9 D;  3CCV P;  3L75 G;  1KQF B;  1BCC J;  2E75 B;  1RF1 A;  1HGV A;  2YNY A;  3RK2 D;  2W27 A;  5KLI C;  3A0H E;  1MZ9 A;  1FDO A;  2M3E A;  1LP1 A;  1P84 D;  4OGQ B;  3KPE A;  4IFD K;  1BE3 J;  1EDK A; 
#chains in the Genus database with same CATH homology
 2OUW A;  2QEU A;  5DIP A;  2PFX A;  2JN8 A;  4AKR A;  1ME5 A;  2KZ7 A;  2GMY A;  1GU9 A;  2PRR A;  3LK2 A;  3AA1 A;  3AAE A;  3D7I A;  5DIK A;  2ES9 A;  3LK4 1;  2KXP A;  2Q0T A;  2AF7 A;  2CWQ A;  1IZN A;  5AFU K;  2O4D A;  5ADX K;  3C1L A;  1LW1 A;  3AAA A;  2IJC A;  3AA7 A;  2OYO A;  4G9Q A;  3AA6 A;  3AA0 A;  3BEY A;  1P8C A;  3LVY A;  1KNC A;  1VKE A;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...