2PFXA

Crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
GMTKPKEPTALDLPMADPLPDETQKYFEICQEKLGMVPNVLKAYAFNVEKLNAFTAMYNDLMLGESQLSKLEREMIAVVVSSINKCFYCLVAHGAAVRQLSGDPQLGEMLVMNYRVAPLDARQRVMLDFAAKMTRASAEIEEADREVLRSHGFNDRDIWDIANVTGFFNMTNRVASATAMMPNAEYHGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of uncharacterized peroxidase-related protein (YP_614459.1) from Silicibacter sp. TM1040 at 1.70 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Oxidoreductase
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2pfxA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2pfxA02
2PRRA 5DIKA 1P8CA 2CWQA 5DIPA 3BEYA 3D7IA 3C1LA 2PFXA 1ME5A 2Q0TA 1LW1A 2QEUA 3LVYA 2OYOA 2OUWA 2IJCA 1KNCA 2AF7A 2O4DA 2GMYA 1GU9A 1VKEA 4G9QA
chains in the Genus database with same CATH superfamily
1KN7A 1JY2O 2K1AA 5CBOA 4C7NB 2B88A 1VL2A 1SQQD 2E76C 1L0LJ 2JR8A 3ABVC 2G3AA 2WSEJ 1JM0A 2FYZA 5TISE 3M91A 2WSCH 1FU1A 3L71E 4OH8B 2H43A 1OIPA 1SFCB 1SQPK 4IOIH 4L73A 1JMMA 2OYHB 1IK7A 1KD1Q 2BCCJ 1OVVA 4ZKUA 1SFCC 3H1IE 2OYHC 3N7NA 3L71G 2Y0EA 5CHXA 5KLVE 1QL1A 3L72D 1L4AB 1KILD 3CMAP 1PIXA 3AEBC 2ZYDA 4WVZA 2J59M 2QVAA 2H7HA 2LKMA 1LTTC 2FYNB 1YITP 3TYYA 2Q3EA 2SPZA 3MUDA 2HYNA 3H1HD 1KZUB 3H1IG 4N3YB 1L4AC 1T2KD 2N1TB 4NPFX 1SP4A 5KLVG 1IFJA 2OUWA 5CCHC 1URQD 1AQTA 5AVQB 1LT9B 3C8VA 5AW9B 1NTKE 2KYVA 1MV8A 2QJPC 2XKMA 3S1KA 2KXPB 2H88C 4IFMA 1URQA 4JPZB 2N1TC 1N7SB 5APQA 1KB9I 2JEEA 2AXCA 2IPPA 3L4FA 4U3FD 2KLVA 2JJLA 1L0NK 2GA1A 1K05A 5APSA 2QG4A 5DIPA 1VQMP 2K9JB 1NTKG 3A5TA 3OA7A 1GL2B 2V7QJ 3HD7C 1N7SC 1H0TB 3CXHE 2K9YA 2R5DA 1ZRTE 1FJPA 1KYOD 3CCUP 1SQPD 2HR3A 3CCMP 1SS1A 4AYCA 2HG5D 5KKZC 3MHVA 4H13B 3B8EB 1PV3A 2WQYC 3A7OA 1UIXA 5H2FE 2AXTH 3RBZA 3H1HJ 2ZJSE 2WVRA 3L35A 2FYUE 1K73Q 2FY8A 3CX5D 1XTCC 2A45G 3PP5A 3TF5A 2ZT9D 1QEXA 4EI2A 3KHUA 1KQGB 3WUVA 2XZRA 2M0BA 4H0LD 4OGQD 3WUUA 2BEQD 1HWTC 1OVUA 5ADXK 4YTPC 3H25A 1HGVA 1TU3F 1QVFO 3NTNA 4TT3H 2FYUG 1PL5A 2WPQA 1VQ5P 2P58A 4WWIA 3VMZA 3RL0B 3AE8C 4HYTB 3FX0A 3HE4B 2W90A 5M1BA 1HBWA 2RMZA 2OYIB 1K9MQ 5DJTB 1SQPJ 1VQ8P 1P84E 1YIJP 2IBZE 4K35A 3H1KJ 1M1KQ 4N78E 3KPEA 2JWAA 3BASA 1VQ4P 4GOEA 2B87B 1ZP0C 4D6TE 1S5LX 1VQNP 3CD6P 2OYIC 1N8RQ 5TJHA 3TGUJ 1NO4A 4DCKA 3L71D 3CL3D 2IJCA 2R32A 3IF4A 5GTIE 1OW6A 1NTZE 4D6TG 5C39A 1EQ7A 1Q90D 5AVYB 1SQQE 3H1ID 2CK3H 3IAOA 3CXHI 1Q81Q 2FYUK 5KLVD 3AE4C 4ZMDA 3BATA 1VQ6P 1MKMA 1MZ9A 3AE9C 1VF5C 1QX8A 1NTZG 2A45I 3CCQP 1OX3A 5B66H 5APVA 3GG2A 4GDOA 2KSJA 1RQVA 1GZLA 1RQUA 4TLFA 1SQXK 2WZ7A 3SWYA 4ZNCA 5KJ7D 1KQFB 3OAKA 3VMYA 1NTKD 3L72E 1KILB 2UWJE 1KILE 1FDIA 2QEXP 5KJ7A 5GTHH 1QVGO 1A02J 3L71J 2ZXEB 1LT9A 2FKWB 1Q86Q 2N9YB 4I6MC 1FOSF 2YIUB 1MUUA 1PGOA 1KFMA 1URQB 3L72G 3CXHD 1T3JA 3BEYA 2MJZA 2WITA 4RJTA 3H1IJ 1LP1A 2CPBA 2KLUA 5AW2B 3AE3C 1T2KC 5KLVJ 2K9JA 1FAVA 5KLIB 1H0TA 1NTZK 2WSFJ 2IX7C 4U3FE 1P84I 2IBZI 1JCCA 1FBMA 5AVXB 1ME5A 1DD3A 1FZCA 1LGHB 1PGJA 4IL6X 2FYUD 1VPCA 2ZYAA 2IFMA 1LNQA 1KYOE 2R3SA 1LJ2A 1X8YA 3B71A 1NTKJ 4ASVA 3WU2E 4XE5B 3AEEC 3L74E 3EQ2A 3AE6C 1ZW0A 1SQXD 3SWFA 4HB1A 2HODA 1JTHA 1VQ7P 3BCCE 3M9HA 1T6AA 2ZT9B 1YJNP 2QJYB 2AEJA 2KI7B 4G9QA 4H0LB 4GKGA 4OGQB 2GUVA 3L74G 3D7IA 3GF7A 1P84D 2PGDA 3A0BH 1GMJA 1ZXGA 1JO5A 4N78D 3QWOC 2WPRA 4UB8E 1LWUA 3II6A 1G1JA 4D6TD 2QJYC 2DW3A 3F5HA 3N4XA 1WT6A 1W5CE 2QRXA 3B4SA 3BCCG 4H0LC 2ZVOB 1BE3E 2B89A 4OGQC 4JBZA 1EXIA 2LXBA 1LTGC 2AXTE 3SFEC 1Q7YQ 2QJKC 3FGAD 3WUTA 1PFIA 2BEZF 2FYUJ 3CC2P 2O01J 3H1JE 2LXCB 3JSVC 3A0HE 1NTZD 4Y28J 1L0NE 4HJGH 2WWWA 1BE3G 1YQ4C 2YMYA 1IK9A 1FC2C 2V7QH 1Z56A 1DH3A 4I7ZB 1JY3N 3L70G 3H1JG 1ZOYC 2Z5HA 3CPWO 3S4RA 5CMZA 1L0NG 2PP6A 2O1KA 4PJ0E 1GW3A 4I7ZC 2WT7A 1U57A 2QE7H 4YPCA 2YKQA 3D6ZA 1P8CA 1AVYA 3AA6A 1YTZI 4D6TJ 3MGNA 1KYOI 1Q82Q 2M3BA 4H44D 1KQSO 3V6IA 1VQ9P 4K3AA 1KILA 2JKVA 2PFXA 1W2EA 4KJMA 1NTZJ 2KOGA 3MD0A 1PPJE 1LTIC 1BGYG 2GMYA 2POHA 3VMXA 3CX5I 5AVVB 3OW2O 5AW3B 1DD4A 1SQQJ 2FYNC 3NMDA 2KIKA 1NWQA 1NTME 1HVVA 3C1LA 3VTPC 3AE7C 5KJ7C 1LT9C 1JY2N 3G3ZA 1PPJG 3G6EP 4JYBA 5BU5A 1OVRA 3V4QA 1LP1B 1M57D 5B66E 1J2JB 1SQVK 1RH5B 5AW6B 2IZ1A 3CWBE 1NTMG 5B5EH 1IJDB 3TNUA 3D71A 5BU8B 1S9KD 1FZCB 2WPVB 3L72J 1KFNA 1XTGB 5DJUB 1GL2C 3PLNA 3L74D 2GUSA 1KB9H 2YKOA 1SVFA 1IC2A 2WSCJ 3LK2A 1VQPP 1NJIQ 3CWBG 1R8EA 1FZCC 4OWFA 1YYCA 5KAFH 2IYPA 2P2UA 1RE3A 1S4XA 1M1JA 3BCCD 3LW5J 4H13C 2MKVA 2P1JA 1AA0A 2HLOA 3LK3A 2NPSD 2OYOA 3AE1C 2JO1A 1FJKA 1PP9E 2QIWA 2Y0DA 1NH4A 3LIDA 2HODB 2G8YA 3KZIE 1USDA 1JTHB 2NPSA 3VP8A 1NAYA 4I1LA 1SQXE 4AKRA 4U3FJ 2B9BA 1NYHA 1VQLP 1KORA 1BE3D 1KNCA 1GK6A 2Q1KA 1U7MA 2QM7A 2Q5UA 1OWAA 1NTMK 2OTKE 1PP9G 1RY3A 1LWUB 4Z1MH 3L70D 4EIJA 2R3CA 2W6JH 1FZGA 2ZYGA 3H1JD 3D70A 1E79H 2OTJP 3G4SP 4EYYQ 3RL0C 1UIIA 1AJYA 1SQXG 1GU5A 1CSBA 1L0ND 1H89A 1LWUC 2YMKA 3L74J 4GT1A 5KAIE 1X22A 1IZNB 2KS1A 3BCCJ 1KTMA 5APXA 3MZWB 3Q2YA 4KHXA 2KZIA 5AW8B 1Y47A 2QM8A 1IO4A 3A0BE 1GU9A 1W2BO 2GM4A 1BGYD 1PZQA 1J1DB 5E79E 3B5ND 2WT7B 1BE3J 1NU1E 4HKZH 5APWA 3LVYA 5CCGD 4DJGA 3H32A 3B5NA 3H1JJ 3O6QA 3CC4P 3I55P 5CJ0A 3BVHA 1J1DC 1EZVD 1PPJD 3MTUE 5CCGA 2Z4EA 3FXEA 1JOCA 5CCHD 1L0NJ 4AQRD 1IFIA 1NU1G 2XNXA 2V4HA 1L0LK 4N6JA 1JEKA 1LTSC 1NTMD 1GW4A 2WSSH 3IN6A 4H44B 1WMKA 1QL2A 2HFED 3CCRP 3USSA 5CCHA 3VP9A 2KNCA 4UB6H 3K5BA 3MUDC 1KILC 2O4DA 4Y99B 2KP8A 1VKEA 1VQKP 4YXWH 3HD7D 3CWBD 2VRSA 1NGMB 4LC1A 3AA7A 1EDJA 3GHGB 3T97A 2W27A 2YIUC 4Y99C 5APYA 1BCCE 1FZEA 3HTKA 3P8CE 1J1EB 1URQC 1LT1A 2CWQA 3BRVB 1A02F 5CJ4A 3QH9A 3TNUB 1DEEG 1RF1A 4JF7A 2WSEH 2E74D 1YHQP 2AF7A 2P10A 3V5BA 1AQ5A 5KLIC 1FZBA 1J1EC 3U59A 2C0XA 1BCCG 1NHLA 5L8RJ 4EDFA 1DIPA 3PTZA 3Q5SA 1NU1K 2C9NY 2L91A 2A06E 1S9KE 3H1LE 1PP9D 1NTMJ 1M1JB 1YI2P 1LTJA 2YXQB 4L76A 1P84H 3HUSA 2Q6QA 3PH0A 1GU4A 1EXJA 3TDKA 3RK2D 4PD4H 5EFWB 1EDLA 2A06G 1RE3C 3ITKA 3H1LG 1M1JC 1YTZT 4I2LC 4RESB 2NPSB 2XNDH 3CWBJ 1S5LH 3JCUH 5AVUB 2JDIH 4L74A 5APTA 2E5YA 1BDDA 3M0AA 3NXSA 1IFMA 1N86A 3EWKA 2ZT9C 2KSEA 2LR2A 3V2PA 2XDJA 2NPSC 4NPDA 2R44A 2PAJA 2I8DA 1KB9E 1LTBC 2C0WA 3AA0A 3EFFK 1JY3P 3AEFC 2YNYA 1EDIA 2OQQA 2YO2A 4HH2A 2E75D 3L70E 3Q3DA 5KAFE 3RK3E 1SQBE 4JYCA 3SWKA 2CPSA 2QSIA 1M56D 1IZNA 2Y9YA 1PP9J 1KC8Q 1H88A 1FOSE 1OFCX 2E76B 3RGUA 2KS1B 2Q0TA 2M3EA 1SQVE 4BRYA 2XV5A 2FFDA 3JC22 2O01N 3S9OA 1SQXJ 4KT0J 1SQBG 1VF5D 1NU1D 2IZ0A 3GW6A 5AVTB 1N7LA 3V2RA 4YXDC 3MP7B 1YQ3C 3SSUA 4GODA 4EOTA 1JB0J 1QLED 3L73E 4M3LA 1SQVG 4RO0A 2M5AB 5AW7B 3F89A 3LW5H 3V4WA 1BGYE 3H32B 4DT0A 1HGZA 3OJAB 3B5NB 4O9BA 3O6QB 1FE6A 3FXDA 2OARA 2ES9A 2IFNA 4PV1D 2RKLA 1ZLLA 2IYOA 4JQ0D 1LTAC 1IFPA 3L73G 5DIKA 4W7YA 3L36A 3G9RA 2I1KA 2WTYA 1JY2P 3Q5PA 1K04A 3B5NC 3TSIA 1EZVE 5APUA 5AW5B 5AVRB 3KYQA 1BSHA 5CCGC 3W68A 2J5UA 1KQLA 3MIWA 5AW4B 1VQOP 2KNCB 2QJPB 5KTBA 5AVZB 3CCVP 1S72P 5CBNA 2FXOA 1BCCD 1KYOH 1SQBK 1BDCA 4IL6H 3P8CD 2YO3A 1CI6B 3P8MC 1NU1J 3NFQA 4A7PA 1GK4A 1EZVG 1RE4A 3WU2H 5K5GB 1NKNA 3GHGA 2K37A 3T97B 3HD7B 1DX7A 3HTKB 4MN4C 2KK7A 5AW1B 2H8PD 1OW8A 3CX5H 3V2NA 1MFTA 2A06D 4IFDK 3H1LD 1RF1B 1OW7A 2FXPA 3AE2C 2HPCA 5KKZB 2KZJA 2K3RA 1ZR2A 3GLMA 3E1IA 3L75E 5GTHE 2E74B 2WMMA 4QMAA 4UB8H 3H1KD 4UB6E 3FWLA 1RF1C 3IFMA 3GMAA 3M9QA 3HE5B 1EC5A 3HRNA 2D2CD 2JP3A 1CW5A 2OTLP 1LTJB 4WB4A 3SFDC 3GF3A 1OXZA 3HUSB 3TGUD 4DZOA 2RN0A 2E74C 1U7JA 4GIFA 3L75G 5KLVK 3A0HH 1BCCJ 1KV4A 3CI9A 1RF0A 1FZAA 1LTJC 3CC7P 2L5GB 1NOHA 2XU6A 3HUSC 4WY4D 5AVWB 3RK2B 1KB9D 1E5WA 1T3UA 4LGDE 2P67A 1KMIZ 1L0LE 3CCJP 3RBXA 5TISH 1N2DC 1HUCA 3KQGA 4WY4A 3TK1A 3RK3D 1N73A 1NAFA 1SQBD 3RL0g 1BSNA 2RH0A 2E5TA 1EDKA 3RK2C 1GD2E 4CPGA 1ZN5A 3M0DA 1NTKK 3H1LJ 1X0TA 5AFUK 2BCCE 1EZVI 2K88A 4L75A 2E42A 1IFDA 2N9BA 2OGUA 2E76D 4PJ0H 3CCLP 1HJ0A 1SQVD 1X9VA 1K8AQ 1L0LG 2ZXXA 3L37A 4GOFA 2E75B 2QA4P 1G2CA 2KUBA 3G71P 2Q9IA 2WSFH 1ZR4A 4PD4E 1FDOA 4BRYB 2P7JA 5AVSB 2JN8A 2IDBA 2FFDB 4XA4A 3M9BA 2ZFCA 2BCCG 1OMIA 1S3JA 3L73D 1S5LE 3JCUE 2NRGA 1HTLC 4C7NA 3IR9A 2E75C 3E7KA 2E43A 1SFCD 3CMEP 4B86A 3P32A 4DOJA 4AUWA 2IBZG 1FS0E 3A3YB 2KB7P 2FFDC 1YBKA 2JWDA 1VF5B 4BWNA 2M5AA 4C46A 3KXDA 1SFCA 3CCEP 2OYHA 1M7LA 1ZV8A 4ASWA 3UIAA 3L70J 2O1JA 3AEGC 1SQBJ 3WMM0 3O8ZA 1L2PA 1L4AD 1USEA 2W6BA 4ZKPA 4IFFA 3CCSP 2Y9ZA 1HJBA 2I1JA 3R4YA 3U1CA 5AW0B 2FBWC 3I5CA 1AFOA 1L4AA 1SQVJ 1SQQG 3CXHH 5BVZA 3AAEA 4NPEA 4PV1B 2R5BA 1G1IA 3CLQA 2N1TD 3V2QA 1FDMA 2A45H 4W80A 2NZ2A 3R2PA 4LLHA 2W83C 2BASA 2FXMA 3A2AA 4RKUJ 3AEDC 1Q2NA 2N1TA 4PV1C 5H2FH 4H44C 3EFGA 3L73J 1CI6A 1JCDA 1N7SD 2Q7CA 2AEMA 3AECC 1LW1A 3H1HE 3ZDMA 3AA1A 2O01H 2KXPA 1M90Q 1OZHA 1DEBA 4U7JA 1BGYJ 3HD7A 2AEFA 2O3JA 1N7SA 1YJWP 1MFZA 3BRTB 2C9LY 3AAAA 1GL2D 2ITAA 1HF9A 1ZRTD 1RE4C 3LK41 3KZIH 3L75D 2QEUA 3C9IA 3LIEA 1T8ZA 3PJSK 1SLQA 1VDFA 3GHGC 3AE5C 3W67A 1ZMEC 2YKPA 1GL2A 3AEAC 3H1HG 2HPCB 4WBAA 2J58A 4H13D 1AV1A 1YJ9P 3P7KA 2KZ7A 2YXRB 1R5SA 1SQQK 4PD4I 3I56P 1IFNA 3U1AA 3HE5A 1FZFA 2H89C 3PRJA 1GDTA 1JY3O 1PGQA 1D7MA 1HH0A 4IL6E 1SQPE 4W7ZA 1JMBA 3H1KE 2W8ZA 4R4LA 4U3FG 1Y8AA 3VOPA 3D6YA 1NVOA 2D2CB 2ZAEB 3H6PA 1L0LD 1RHZB 3VN0A 2Z5IA 3KDPB 5KAIH 3TGUE 1S2EA 3VYIA 5B5EE 1JNMA 3PHLA 5GTIH 3CX5E 3RL0D 1SQPG 2D2CC 3H1KG 2BCCD 2M8RA 1CZQA 3E1RA 1RF0C 4XFJA 4WY4B 1N73B 3L75J 3Q5RA 1R5LA 4OVNF 2IBZD 2QJKB 3TGUG 3HE4A 1QGKB 2Q3IA 1WRGA 1Y9BA 1NKZB 3FWNA 2OYIA 3RK3B 5E79H 1GTWA 4PD4D 2Y0CA 1JUNA 4WY4C 1N73C 1AVOA 2PRRA 4R4MA 1H8AA 1PGPA 3M0DC 1X79B 4C7RA 3VMAA 2B87A 1G2CB 1S1CX 2W6AA 3Q1MA 4BXLA 3RK3C 2WPSA 1M8OB 3M06A 2ZVNB
chains in the Genus database with same CATH topology
3AAEA 2PRRA 1IZNA 5DIKA 3AAAA 2JN8A 1P8CA 5ADXK 2CWQA 3AA0A 5DIPA 3BEYA 3D7IA 3AA6A 3C1LA 2PFXA 1ME5A 2KZ7A 3LK41 2Q0TA 4AKRA 1LW1A 2QEUA 3AA1A 3LVYA 3LK3A 3AA7A 2OYOA 2KXPA 2OUWA 3LK2A 2IJCA 1KNCA 2ES9A 2AF7A 2O4DA 2GMYA 5AFUK 1GU9A 1VKEA 4G9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRR A;  5DIK A;  1P8C A;  2CWQ A;  5DIP A;  3BEY A;  3D7I A;  3C1L A;  2PFX A;  1ME5 A;  2Q0T A;  1LW1 A;  2QEU A;  3LVY A;  2OYO A;  2OUW A;  2IJC A;  1KNC A;  2AF7 A;  2O4D A;  2GMY A;  1GU9 A;  1VKE A;  4G9Q A; 
#chains in the Genus database with same CATH topology
 1KN7 A;  1JY2 O;  2K1A A;  5CBO A;  4C7N B;  2B88 A;  1VL2 A;  1SQQ D;  2E76 C;  1L0L J;  2JR8 A;  3ABV C;  2G3A A;  2WSE J;  1JM0 A;  2FYZ A;  5TIS E;  3M91 A;  2WSC H;  1FU1 A;  3L71 E;  4OH8 B;  2H43 A;  1OIP A;  1SFC B;  1SQP K;  4IOI H;  4L73 A;  1JMM A;  2OYH B;  1IK7 A;  1KD1 Q;  2BCC J;  1OVV A;  4ZKU A;  1SFC C;  3H1I E;  2OYH C;  3N7N A;  3L71 G;  2Y0E A;  5CHX A;  5KLV E;  1QL1 A;  3L72 D;  1L4A B;  1KIL D;  3CMA P;  1PIX A;  3AEB C;  2ZYD A;  4WVZ A;  2J59 M;  2QVA A;  2H7H A;  2LKM A;  1LTT C;  2FYN B;  1YIT P;  3TYY A;  2Q3E A;  2SPZ A;  3MUD A;  2HYN A;  3H1H D;  1KZU B;  3H1I G;  4N3Y B;  1L4A C;  1T2K D;  2N1T B;  4NPF X;  1SP4 A;  5KLV G;  1IFJ A;  2OUW A;  5CCH C;  1URQ D;  1AQT A;  5AVQ B;  1LT9 B;  3C8V A;  5AW9 B;  1NTK E;  2KYV A;  1MV8 A;  2QJP C;  2XKM A;  3S1K A;  2KXP B;  2H88 C;  4IFM A;  1URQ A;  4JPZ B;  2N1T C;  1N7S B;  5APQ A;  1KB9 I;  2JEE A;  2AXC A;  2IPP A;  3L4F A;  4U3F D;  2KLV A;  2JJL A;  1L0N K;  2GA1 A;  1K05 A;  5APS A;  2QG4 A;  5DIP A;  1VQM P;  2K9J B;  1NTK G;  3A5T A;  3OA7 A;  1GL2 B;  2V7Q J;  3HD7 C;  1N7S C;  1H0T B;  3CXH E;  2K9Y A;  2R5D A;  1ZRT E;  1FJP A;  1KYO D;  3CCU P;  1SQP D;  2HR3 A;  3CCM P;  1SS1 A;  4AYC A;  2HG5 D;  5KKZ C;  3MHV A;  4H13 B;  3B8E B;  1PV3 A;  2WQY C;  3A7O A;  1UIX A;  5H2F E;  2AXT H;  3RBZ A;  3H1H J;  2ZJS E;  2WVR A;  3L35 A;  2FYU E;  1K73 Q;  2FY8 A;  3CX5 D;  1XTC C;  2A45 G;  3PP5 A;  3TF5 A;  2ZT9 D;  1QEX A;  4EI2 A;  3KHU A;  1KQG B;  3WUV A;  2XZR A;  2M0B A;  4H0L D;  4OGQ D;  3WUU A;  2BEQ D;  1HWT C;  1OVU A;  5ADX K;  4YTP C;  3H25 A;  1HGV A;  1TU3 F;  1QVF O;  3NTN A;  4TT3 H;  2FYU G;  1PL5 A;  2WPQ A;  1VQ5 P;  2P58 A;  4WWI A;  3VMZ A;  3RL0 B;  3AE8 C;  4HYT B;  3FX0 A;  3HE4 B;  2W90 A;  5M1B A;  1HBW A;  2RMZ A;  2OYI B;  1K9M Q;  5DJT B;  1SQP J;  1VQ8 P;  1P84 E;  1YIJ P;  2IBZ E;  4K35 A;  3H1K J;  1M1K Q;  4N78 E;  3KPE A;  2JWA A;  3BAS A;  1VQ4 P;  4GOE A;  2B87 B;  1ZP0 C;  4D6T E;  1S5L X;  1VQN P;  3CD6 P;  2OYI C;  1N8R Q;  5TJH A;  3TGU J;  1NO4 A;  4DCK A;  3L71 D;  3CL3 D;  2IJC A;  2R32 A;  3IF4 A;  5GTI E;  1OW6 A;  1NTZ E;  4D6T G;  5C39 A;  1EQ7 A;  1Q90 D;  5AVY B;  1SQQ E;  3H1I D;  2CK3 H;  3IAO A;  3CXH I;  1Q81 Q;  2FYU K;  5KLV D;  3AE4 C;  4ZMD A;  3BAT A;  1VQ6 P;  1MKM A;  1MZ9 A;  3AE9 C;  1VF5 C;  1QX8 A;  1NTZ G;  2A45 I;  3CCQ P;  1OX3 A;  5B66 H;  5APV A;  3GG2 A;  4GDO A;  2KSJ A;  1RQV A;  1GZL A;  1RQU A;  4TLF A;  1SQX K;  2WZ7 A;  3SWY A;  4ZNC A;  5KJ7 D;  1KQF B;  3OAK A;  3VMY A;  1NTK D;  3L72 E;  1KIL B;  2UWJ E;  1KIL E;  1FDI A;  2QEX P;  5KJ7 A;  5GTH H;  1QVG O;  1A02 J;  3L71 J;  2ZXE B;  1LT9 A;  2FKW B;  1Q86 Q;  2N9Y B;  4I6M C;  1FOS F;  2YIU B;  1MUU A;  1PGO A;  1KFM A;  1URQ B;  3L72 G;  3CXH D;  1T3J A;  3BEY A;  2MJZ A;  2WIT A;  4RJT A;  3H1I J;  1LP1 A;  2CPB A;  2KLU A;  5AW2 B;  3AE3 C;  1T2K C;  5KLV J;  2K9J A;  1FAV A;  5KLI B;  1H0T A;  1NTZ K;  2WSF J;  2IX7 C;  4U3F E;  1P84 I;  2IBZ I;  1JCC A;  1FBM A;  5AVX B;  1ME5 A;  1DD3 A;  1FZC A;  1LGH B;  1PGJ A;  4IL6 X;  2FYU D;  1VPC A;  2ZYA A;  2IFM A;  1LNQ A;  1KYO E;  2R3S A;  1LJ2 A;  1X8Y A;  3B71 A;  1NTK J;  4ASV A;  3WU2 E;  4XE5 B;  3AEE C;  3L74 E;  3EQ2 A;  3AE6 C;  1ZW0 A;  1SQX D;  3SWF A;  4HB1 A;  2HOD A;  1JTH A;  1VQ7 P;  3BCC E;  3M9H A;  1T6A A;  2ZT9 B;  1YJN P;  2QJY B;  2AEJ A;  2KI7 B;  4G9Q A;  4H0L B;  4GKG A;  4OGQ B;  2GUV A;  3L74 G;  3D7I A;  3GF7 A;  1P84 D;  2PGD A;  3A0B H;  1GMJ A;  1ZXG A;  1JO5 A;  4N78 D;  3QWO C;  2WPR A;  4UB8 E;  1LWU A;  3II6 A;  1G1J A;  4D6T D;  2QJY C;  2DW3 A;  3F5H A;  3N4X A;  1WT6 A;  1W5C E;  2QRX A;  3B4S A;  3BCC G;  4H0L C;  2ZVO B;  1BE3 E;  2B89 A;  4OGQ C;  4JBZ A;  1EXI A;  2LXB A;  1LTG C;  2AXT E;  3SFE C;  1Q7Y Q;  2QJK C;  3FGA D;  3WUT A;  1PFI A;  2BEZ F;  2FYU J;  3CC2 P;  2O01 J;  3H1J E;  2LXC B;  3JSV C;  3A0H E;  1NTZ D;  4Y28 J;  1L0N E;  4HJG H;  2WWW A;  1BE3 G;  1YQ4 C;  2YMY A;  1IK9 A;  1FC2 C;  2V7Q H;  1Z56 A;  1DH3 A;  4I7Z B;  1JY3 N;  3L70 G;  3H1J G;  1ZOY C;  2Z5H A;  3CPW O;  3S4R A;  5CMZ A;  1L0N G;  2PP6 A;  2O1K A;  4PJ0 E;  1GW3 A;  4I7Z C;  2WT7 A;  1U57 A;  2QE7 H;  4YPC A;  2YKQ A;  3D6Z A;  1P8C A;  1AVY A;  3AA6 A;  1YTZ I;  4D6T J;  3MGN A;  1KYO I;  1Q82 Q;  2M3B A;  4H44 D;  1KQS O;  3V6I A;  1VQ9 P;  4K3A A;  1KIL A;  2JKV A;  2PFX A;  1W2E A;  4KJM A;  1NTZ J;  2KOG A;  3MD0 A;  1PPJ E;  1LTI C;  1BGY G;  2GMY A;  2POH A;  3VMX A;  3CX5 I;  5AVV B;  3OW2 O;  5AW3 B;  1DD4 A;  1SQQ J;  2FYN C;  3NMD A;  2KIK A;  1NWQ A;  1NTM E;  1HVV A;  3C1L A;  3VTP C;  3AE7 C;  5KJ7 C;  1LT9 C;  1JY2 N;  3G3Z A;  1PPJ G;  3G6E P;  4JYB A;  5BU5 A;  1OVR A;  3V4Q A;  1LP1 B;  1M57 D;  5B66 E;  1J2J B;  1SQV K;  1RH5 B;  5AW6 B;  2IZ1 A;  3CWB E;  1NTM G;  5B5E H;  1IJD B;  3TNU A;  3D71 A;  5BU8 B;  1S9K D;  1FZC B;  2WPV B;  3L72 J;  1KFN A;  1XTG B;  5DJU B;  1GL2 C;  3PLN A;  3L74 D;  2GUS A;  1KB9 H;  2YKO A;  1SVF A;  1IC2 A;  2WSC J;  3LK2 A;  1VQP P;  1NJI Q;  3CWB G;  1R8E A;  1FZC C;  4OWF A;  1YYC A;  5KAF H;  2IYP A;  2P2U A;  1RE3 A;  1S4X A;  1M1J A;  3BCC D;  3LW5 J;  4H13 C;  2MKV A;  2P1J A;  1AA0 A;  2HLO A;  3LK3 A;  2NPS D;  2OYO A;  3AE1 C;  2JO1 A;  1FJK A;  1PP9 E;  2QIW A;  2Y0D A;  1NH4 A;  3LID A;  2HOD B;  2G8Y A;  3KZI E;  1USD A;  1JTH B;  2NPS A;  3VP8 A;  1NAY A;  4I1L A;  1SQX E;  4AKR A;  4U3F J;  2B9B A;  1NYH A;  1VQL P;  1KOR A;  1BE3 D;  1KNC A;  1GK6 A;  2Q1K A;  1U7M A;  2QM7 A;  2Q5U A;  1OWA A;  1NTM K;  2OTK E;  1PP9 G;  1RY3 A;  1LWU B;  4Z1M H;  3L70 D;  4EIJ A;  2R3C A;  2W6J H;  1FZG A;  2ZYG A;  3H1J D;  3D70 A;  1E79 H;  2OTJ P;  3G4S P;  4EYY Q;  3RL0 C;  1UII A;  1AJY A;  1SQX G;  1GU5 A;  1CSB A;  1L0N D;  1H89 A;  1LWU C;  2YMK A;  3L74 J;  4GT1 A;  5KAI E;  1X22 A;  1IZN B;  2KS1 A;  3BCC J;  1KTM A;  5APX A;  3MZW B;  3Q2Y A;  4KHX A;  2KZI A;  5AW8 B;  1Y47 A;  2QM8 A;  1IO4 A;  3A0B E;  1GU9 A;  1W2B O;  2GM4 A;  1BGY D;  1PZQ A;  1J1D B;  5E79 E;  3B5N D;  2WT7 B;  1BE3 J;  1NU1 E;  4HKZ H;  5APW A;  3LVY A;  5CCG D;  4DJG A;  3H32 A;  3B5N A;  3H1J J;  3O6Q A;  3CC4 P;  3I55 P;  5CJ0 A;  3BVH A;  1J1D C;  1EZV D;  1PPJ D;  3MTU E;  5CCG A;  2Z4E A;  3FXE A;  1JOC A;  5CCH D;  1L0N J;  4AQR D;  1IFI A;  1NU1 G;  2XNX A;  2V4H A;  1L0L K;  4N6J A;  1JEK A;  1LTS C;  1NTM D;  1GW4 A;  2WSS H;  3IN6 A;  4H44 B;  1WMK A;  1QL2 A;  2HFE D;  3CCR P;  3USS A;  5CCH A;  3VP9 A;  2KNC A;  4UB6 H;  3K5B A;  3MUD C;  1KIL C;  2O4D A;  4Y99 B;  2KP8 A;  1VKE A;  1VQK P;  4YXW H;  3HD7 D;  3CWB D;  2VRS A;  1NGM B;  4LC1 A;  3AA7 A;  1EDJ A;  3GHG B;  3T97 A;  2W27 A;  2YIU C;  4Y99 C;  5APY A;  1BCC E;  1FZE A;  3HTK A;  3P8C E;  1J1E B;  1URQ C;  1LT1 A;  2CWQ A;  3BRV B;  1A02 F;  5CJ4 A;  3QH9 A;  3TNU B;  1DEE G;  1RF1 A;  4JF7 A;  2WSE H;  2E74 D;  1YHQ P;  2AF7 A;  2P10 A;  3V5B A;  1AQ5 A;  5KLI C;  1FZB A;  1J1E C;  3U59 A;  2C0X A;  1BCC G;  1NHL A;  5L8R J;  4EDF A;  1DIP A;  3PTZ A;  3Q5S A;  1NU1 K;  2C9N Y;  2L91 A;  2A06 E;  1S9K E;  3H1L E;  1PP9 D;  1NTM J;  1M1J B;  1YI2 P;  1LTJ A;  2YXQ B;  4L76 A;  1P84 H;  3HUS A;  2Q6Q A;  3PH0 A;  1GU4 A;  1EXJ A;  3TDK A;  3RK2 D;  4PD4 H;  5EFW B;  1EDL A;  2A06 G;  1RE3 C;  3ITK A;  3H1L G;  1M1J C;  1YTZ T;  4I2L C;  4RES B;  2NPS B;  2XND H;  3CWB J;  1S5L H;  3JCU H;  5AVU B;  2JDI H;  4L74 A;  5APT A;  2E5Y A;  1BDD A;  3M0A A;  3NXS A;  1IFM A;  1N86 A;  3EWK A;  2ZT9 C;  2KSE A;  2LR2 A;  3V2P A;  2XDJ A;  2NPS C;  4NPD A;  2R44 A;  2PAJ A;  2I8D A;  1KB9 E;  1LTB C;  2C0W A;  3AA0 A;  3EFF K;  1JY3 P;  3AEF C;  2YNY A;  1EDI A;  2OQQ A;  2YO2 A;  4HH2 A;  2E75 D;  3L70 E;  3Q3D A;  5KAF E;  3RK3 E;  1SQB E;  4JYC A;  3SWK A;  2CPS A;  2QSI A;  1M56 D;  1IZN A;  2Y9Y A;  1PP9 J;  1KC8 Q;  1H88 A;  1FOS E;  1OFC X;  2E76 B;  3RGU A;  2KS1 B;  2Q0T A;  2M3E A;  1SQV E;  4BRY A;  2XV5 A;  2FFD A;  3JC2 2;  2O01 N;  3S9O A;  1SQX J;  4KT0 J;  1SQB G;  1VF5 D;  1NU1 D;  2IZ0 A;  3GW6 A;  5AVT B;  1N7L A;  3V2R A;  4YXD C;  3MP7 B;  1YQ3 C;  3SSU A;  4GOD A;  4EOT A;  1JB0 J;  1QLE D;  3L73 E;  4M3L A;  1SQV G;  4RO0 A;  2M5A B;  5AW7 B;  3F89 A;  3LW5 H;  3V4W A;  1BGY E;  3H32 B;  4DT0 A;  1HGZ A;  3OJA B;  3B5N B;  4O9B A;  3O6Q B;  1FE6 A;  3FXD A;  2OAR A;  2ES9 A;  2IFN A;  4PV1 D;  2RKL A;  1ZLL A;  2IYO A;  4JQ0 D;  1LTA C;  1IFP A;  3L73 G;  5DIK A;  4W7Y A;  3L36 A;  3G9R A;  2I1K A;  2WTY A;  1JY2 P;  3Q5P A;  1K04 A;  3B5N C;  3TSI A;  1EZV E;  5APU A;  5AW5 B;  5AVR B;  3KYQ A;  1BSH A;  5CCG C;  3W68 A;  2J5U A;  1KQL A;  3MIW A;  5AW4 B;  1VQO P;  2KNC B;  2QJP B;  5KTB A;  5AVZ B;  3CCV P;  1S72 P;  5CBN A;  2FXO A;  1BCC D;  1KYO H;  1SQB K;  1BDC A;  4IL6 H;  3P8C D;  2YO3 A;  1CI6 B;  3P8M C;  1NU1 J;  3NFQ A;  4A7P A;  1GK4 A;  1EZV G;  1RE4 A;  3WU2 H;  5K5G B;  1NKN A;  3GHG A;  2K37 A;  3T97 B;  3HD7 B;  1DX7 A;  3HTK B;  4MN4 C;  2KK7 A;  5AW1 B;  2H8P D;  1OW8 A;  3CX5 H;  3V2N A;  1MFT A;  2A06 D;  4IFD K;  3H1L D;  1RF1 B;  1OW7 A;  2FXP A;  3AE2 C;  2HPC A;  5KKZ B;  2KZJ A;  2K3R A;  1ZR2 A;  3GLM A;  3E1I A;  3L75 E;  5GTH E;  2E74 B;  2WMM A;  4QMA A;  4UB8 H;  3H1K D;  4UB6 E;  3FWL A;  1RF1 C;  3IFM A;  3GMA A;  3M9Q A;  3HE5 B;  1EC5 A;  3HRN A;  2D2C D;  2JP3 A;  1CW5 A;  2OTL P;  1LTJ B;  4WB4 A;  3SFD C;  3GF3 A;  1OXZ A;  3HUS B;  3TGU D;  4DZO A;  2RN0 A;  2E74 C;  1U7J A;  4GIF A;  3L75 G;  5KLV K;  3A0H H;  1BCC J;  1KV4 A;  3CI9 A;  1RF0 A;  1FZA A;  1LTJ C;  3CC7 P;  2L5G B;  1NOH A;  2XU6 A;  3HUS C;  4WY4 D;  5AVW B;  3RK2 B;  1KB9 D;  1E5W A;  1T3U A;  4LGD E;  2P67 A;  1KMI Z;  1L0L E;  3CCJ P;  3RBX A;  5TIS H;  1N2D C;  1HUC A;  3KQG A;  4WY4 A;  3TK1 A;  3RK3 D;  1N73 A;  1NAF A;  1SQB D;  3RL0 g;  1BSN A;  2RH0 A;  2E5T A;  1EDK A;  3RK2 C;  1GD2 E;  4CPG A;  1ZN5 A;  3M0D A;  1NTK K;  3H1L J;  1X0T A;  5AFU K;  2BCC E;  1EZV I;  2K88 A;  4L75 A;  2E42 A;  1IFD A;  2N9B A;  2OGU A;  2E76 D;  4PJ0 H;  3CCL P;  1HJ0 A;  1SQV D;  1X9V A;  1K8A Q;  1L0L G;  2ZXX A;  3L37 A;  4GOF A;  2E75 B;  2QA4 P;  1G2C A;  2KUB A;  3G71 P;  2Q9I A;  2WSF H;  1ZR4 A;  4PD4 E;  1FDO A;  4BRY B;  2P7J A;  5AVS B;  2JN8 A;  2IDB A;  2FFD B;  4XA4 A;  3M9B A;  2ZFC A;  2BCC G;  1OMI A;  1S3J A;  3L73 D;  1S5L E;  3JCU E;  2NRG A;  1HTL C;  4C7N A;  3IR9 A;  2E75 C;  3E7K A;  2E43 A;  1SFC D;  3CME P;  4B86 A;  3P32 A;  4DOJ A;  4AUW A;  2IBZ G;  1FS0 E;  3A3Y B;  2KB7 P;  2FFD C;  1YBK A;  2JWD A;  1VF5 B;  4BWN A;  2M5A A;  4C46 A;  3KXD A;  1SFC A;  3CCE P;  2OYH A;  1M7L A;  1ZV8 A;  4ASW A;  3UIA A;  3L70 J;  2O1J A;  3AEG C;  1SQB J;  3WMM 0;  3O8Z A;  1L2P A;  1L4A D;  1USE A;  2W6B A;  4ZKP A;  4IFF A;  3CCS P;  2Y9Z A;  1HJB A;  2I1J A;  3R4Y A;  3U1C A;  5AW0 B;  2FBW C;  3I5C A;  1AFO A;  1L4A A;  1SQV J;  1SQQ G;  3CXH H;  5BVZ A;  3AAE A;  4NPE A;  4PV1 B;  2R5B A;  1G1I A;  3CLQ A;  2N1T D;  3V2Q A;  1FDM A;  2A45 H;  4W80 A;  2NZ2 A;  3R2P A;  4LLH A;  2W83 C;  2BAS A;  2FXM A;  3A2A A;  4RKU J;  3AED C;  1Q2N A;  2N1T A;  4PV1 C;  5H2F H;  4H44 C;  3EFG A;  3L73 J;  1CI6 A;  1JCD A;  1N7S D;  2Q7C A;  2AEM A;  3AEC C;  1LW1 A;  3H1H E;  3ZDM A;  3AA1 A;  2O01 H;  2KXP A;  1M90 Q;  1OZH A;  1DEB A;  4U7J A;  1BGY J;  3HD7 A;  2AEF A;  2O3J A;  1N7S A;  1YJW P;  1MFZ A;  3BRT B;  2C9L Y;  3AAA A;  1GL2 D;  2ITA A;  1HF9 A;  1ZRT D;  1RE4 C;  3LK4 1;  3KZI H;  3L75 D;  2QEU A;  3C9I A;  3LIE A;  1T8Z A;  3PJS K;  1SLQ A;  1VDF A;  3GHG C;  3AE5 C;  3W67 A;  1ZME C;  2YKP A;  1GL2 A;  3AEA C;  3H1H G;  2HPC B;  4WBA A;  2J58 A;  4H13 D;  1AV1 A;  1YJ9 P;  3P7K A;  2KZ7 A;  2YXR B;  1R5S A;  1SQQ K;  4PD4 I;  3I56 P;  1IFN A;  3U1A A;  3HE5 A;  1FZF A;  2H89 C;  3PRJ A;  1GDT A;  1JY3 O;  1PGQ A;  1D7M A;  1HH0 A;  4IL6 E;  1SQP E;  4W7Z A;  1JMB A;  3H1K E;  2W8Z A;  4R4L A;  4U3F G;  1Y8A A;  3VOP A;  3D6Y A;  1NVO A;  2D2C B;  2ZAE B;  3H6P A;  1L0L D;  1RHZ B;  3VN0 A;  2Z5I A;  3KDP B;  5KAI H;  3TGU E;  1S2E A;  3VYI A;  5B5E E;  1JNM A;  3PHL A;  5GTI H;  3CX5 E;  3RL0 D;  1SQP G;  2D2C C;  3H1K G;  2BCC D;  2M8R A;  1CZQ A;  3E1R A;  1RF0 C;  4XFJ A;  4WY4 B;  1N73 B;  3L75 J;  3Q5R A;  1R5L A;  4OVN F;  2IBZ D;  2QJK B;  3TGU G;  3HE4 A;  1QGK B;  2Q3I A;  1WRG A;  1Y9B A;  1NKZ B;  3FWN A;  2OYI A;  3RK3 B;  5E79 H;  1GTW A;  4PD4 D;  2Y0C A;  1JUN A;  4WY4 C;  1N73 C;  1AVO A;  2PRR A;  4R4M A;  1H8A A;  1PGP A;  3M0D C;  1X79 B;  4C7R A;  3VMA A;  2B87 A;  1G2C B;  1S1C X;  2W6A A;  3Q1M A;  4BXL A;  3RK3 C;  2WPS A;  1M8O B;  3M06 A;  2ZVN B; 
#chains in the Genus database with same CATH homology
 3AAE A;  2PRR A;  1IZN A;  5DIK A;  3AAA A;  2JN8 A;  1P8C A;  5ADX K;  2CWQ A;  3AA0 A;  5DIP A;  3BEY A;  3D7I A;  3AA6 A;  3C1L A;  2PFX A;  1ME5 A;  2KZ7 A;  3LK4 1;  2Q0T A;  4AKR A;  1LW1 A;  2QEU A;  3AA1 A;  3LVY A;  3LK3 A;  3AA7 A;  2OYO A;  2KXP A;  2OUW A;  3LK2 A;  2IJC A;  1KNC A;  2ES9 A;  2AF7 A;  2O4D A;  2GMY A;  5AFU K;  1GU9 A;  1VKE A;  4G9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...