2PFXA

Crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
GMTKPKEPTALDLPMADPLPDETQKYFEICQEKLGMVPNVLKAYAFNVEKLNAFTAMYNDLMLGESQLSKLEREMIAVVVSSINKCFYCLVAHGAAVRQLSGDPQLGEMLVMNYRVAPLDARQRVMLDFAAKMTRASAEIEEADREVLRSHGFNDRDIWDIANVTGFFNMTNRVASATAMMPNAEYHGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of uncharacterized peroxidase-related protein (YP_614459.1) from Silicibacter sp. TM1040 at 1.70 A resolution
rcsb
source organism Silicibacter sp.
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2pfxA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2pfxA02
1KNCA 2OUWA 1GU9A 2AF7A 2QEUA 2Q0TA 1P8CA 2CWQA 3LVYA 2GMYA 2OYOA 2O4DA 3D7IA 3C1LA 5DIKA 5DIPA 4G9QA 2IJCA 2PFXA 1ME5A 1LW1A 3BEYA 2PRRA 1VKEA
chains in the Genus database with same CATH superfamily
1JMMA 3AEDC 1EDJA 4BRYB 2LR2A 1SQPJ 3E1RA 3II6A 5ADXK 3CCMP 1NHLA 1OW8A 5CJ4A 3F89A 1EZVI 3BCCE 1BCCE 3HE4B 5C39A 3CXHD 2YMKA 3NXSA 3CX5H 1M90Q 2N1TA 2AF7A 1L4AB 3HTKA 1KORA 4EOTA 3FGAD 2WT7A 1L0LE 4NPEA 3D7IA 1N86A 5AVVB 4WY4A 1T8ZA 3PP5A 2B88A 2W8ZA 2JN8A 1LTIC 3IFMA 2E74C 4U3FD 4L75A 1X8YA 1PGQA 4JF7A 1KB9I 3I55P 3H1KG 1BE3J 2AEFA 4C46A 4PV1D 1E79H 3B71A 4I7ZC 2KK7A 1FZBA 1EZVE 1YYCA 1ZRTD 2QM7A 1EDLA 3TGUJ 2KZJA 3BATA 1N7LA 3HE5A 4RO0A 1M57D 2N1TD 3V6IA 2WTYA 4AKRA 1RH5B 3WUVA 3ZDMA 1LWUA 4AQRD 1DIPA 1IFIA 3IN6A 3M9HA 4IFDK 1GK4A 3BRVB 2N9BA 1G2CA 1KC8Q 3M0DA 1FJKA 1KB9E 2YNYA 1SQVE 2YKPA 3BRTB 2E43A 3CX5I 4HB1A 2OGUA 3HUSC 5APVA 1PP9J 2DW3A 2ZT9D 2E75B 1HUCA 1CZQA 1KILE 3L70J 1NTZJ 1T3JA 2JKVA 5AW7B 3MTUE 2ITAA 3KHUA 2K37A 3O6QB 1IJDB 1VQ4P 1KQSO 5AW3B 1VF5D 3AEEC 4H0LC 1XTCC 2O01J 1JB0J 3HD7A 2ZT9C 3G9RA 4UB6H 1PGJA 2W6JH 3CX5E 3CCUP 2JP3A 2HPCB 4AYCA 3RK3E 2QJYC 4BWNA 1SQXE 1R8EA 2B89A 3A2AA 1FZEA 1L0NJ 2YO3A 1AQ5A 3CCRP 3AAEA 2CPBA 1SQBJ 1OXZA 5APXA 2V7QJ 3M0AA 3H1HG 3L71J 2JWDA 1VF5C 3TSIA 2XDJA 5APSA 4JPZB 1CW5A 1FDOA 2FFDC 3HD7D 2YKQA 3LW5J 3VMZA 1GU5A 1CI6A 2E5TA 3H1IE 2ES9A 4Y99B 3H1HD 2WQYC 2H7HA 3ABVC 4PV1B 1PPJD 1AFOA 1HVVA 1X79B 5KLVE 2HG5D 3L75E 2WSEJ 1J1EC 1FE6A 3CPWO 1W2EA 2PGDA 2KS1B 1NTKJ 3H6PA 2BEZF 2N1TB 1S5LX 3O8ZA 3KYQA 1K73Q 1X0TA 3HTKB 3NFQA 3K5BA 2WT7B 3HRNA 3HUSB 3OA7A 2PRRA 5CBOA 3L74J 1NAYA 2L5GB 2A06E 4K3AA 1S9KD 1X9VA 2IYOA 2QVAA 3QWOC 3WU2H 4D6TG 2XNXA 2K3RA 2NRGA 1NTZG 2ZYDA 1JY2O 2N9YB 2ZVOB 4IFFA 3V4QA 2HODA 5AVXB 5EFWB 3AE1C 2KOGA 5AW1B 1ZMEC 1JY3O 3V4WA 3H1LG 3HE5B 1DD3A 1OVUA 1SFCD 1SQQJ 1M1JC 3CWBJ 3KXDA 3FXDA 1J1DB 3H25A 2Q3EA 3RK2D 4UB6E 4D6TD 1E5WA 1HJBA 2C9LY 1NTMJ 3GMAA 4L74A 3S9OA 1VPCA 1RE4C 2QSIA 1G2CB 2FBWC 3CCVP 1SQPE 4TLFA 2AEJA 1P84D 3CCEP 3SFDC 1JCCA 3GF3A 3H1LD 1SFCC 4CPGA 5CCGC 3CMEP 2FYUD 2FFDB 2CWQA 1NU1J 2O3JA 3BCCG 1BCCG 4DT0A 5AVZB 1EQ7A 3LK41 5APTA 4N3YB 3FX0A 2I8DA 4AUWA 5BU5A 2P1JA 2V7QH 1DEEG 1W2BO 3VP9A 1N73C 1L0LG 2PAJA 1EXIA 3GW6A 3H32A 1BE3E 4LC1A 1OVRA 4BXLA 2VRSA 3EFFK 1U7MA 1L0LK 4YPCA 1JO5A 1BCCD 1YITP 3HD7B 2GUSA 1HGZA 3TGUE 3LW5H 1LGHB 5APQA 4U3FJ 4Y28J 1Q86Q 5AVWB 1L4AC 3AA1A 1EZVG 1EXJA 3Q5PA 2QJPB 1L0LD 3TNUA 3P32A 3L74G 3G6EP 2KZ7A 3N7NA 3SWFA 4PD4H 2WSEH 1KN7A 2RN0A 3RBZA 4G9QA 2ZAEB 5APUA 2E42A 3PJSK 1PZQA 1M1KQ 4HKZH 1RQUA 2IBZI 1YJWP 3L35A 4GT1A 1OW7A 1OVVA 3KZIE 1SQVG 1M1JB 1URQA 1PP9E 3SWKA 4C7NB 1FZCA 1AQTA 3M9BA 3USSA 1KILA 5CCHA 1JTHB 4NPDA 1SQVK 2B9BA 3L70E 3P8CD 3L73D 2J59M 4N78E 2FYZA 3GF7A 4OH8B 1JY2N 2G8YA 2OYHC 1VQ8P 1NVOA 2Q6QA 2P67A 1KB9D 4EI2A 1ZR2A 3AE6C 1KTMA 1SQVD 5KAIH 1NGMB 3F5HA 1JY3N 1WT6A 1VQNP 3RK2B 2SPZA 1RF1A 4DJGA 2FY8A 3U59A 2Y9ZA 2NPSA 1S4XA 1L0NE 1QVGO 4GIFA 3V2PA 1KFMA 2Z5HA 1N7SA 1ZXGA 2PFXA 5AW5B 3FWLA 2E75C 4W80A 1SQBE 1N73B 3WMM0 1KNCA 3L71E 3PRJA 4PD4I 4EDFA 1SQXG 1NO4A 1MUUA 2HODB 4XFJA 1P8CA 2OYIA 1VQLP 1LNQA 2BCCJ 2WITA 1SQXK 2D2CD 1KFNA 4GDOA 3RL0D 2P7JA 3CC4P 2QEUA 5DJTB 5CBNA 1BGYJ 3LIDA 2KZIA 3CX5D 2YMYA 1RF0C 3RK3D 1ZP0C 1MKMA 4ZMDA 2WPRA 1M56D 1YBKA 1N7SD 3TF5A 3V2QA 3H1IG 3CL3D 4PD4E 2IDBA 4H13D 2K9YA 1NTKE 1FDIA 5AW9B 5DIKA 1DH3A 3B8EB 2IFMA 5KLVG 5KLIB 2KYVA 2Y0DA 3L75G 3M91A 1QX8A 3L74E 4H44D 1HBWA 5KLVK 3OAKA 3H1JJ 2WVRA 5CMZA 2NZ2A 1VL2A 4Y99C 1VQPP 1T2KD 5AFUK 3H1KD 4H13C 3LIEA 3B5NA 5TISH 3H32B 4PV1C 2LXCB 4WY4D 2A06G 2OYHB 5KLVD 2IYPA 1LT1A 3SSUA 3GHGA 3S4RA 3Q2YA 3KPEA 1RE3A 5KAIE 2R3SA 3A7OA 2N1TC 1SQQE 3CWBE 1LTSC 1VQKP 3VYIA 2R32A 1A02F 1NTME 2QRXA 4WY4C 4RJTA 3U1AA 2XV5A 2KSEA 3Q3DA 3GLMA 1GTWA 1W5CE 3B5ND 3C9IA 5AW4B 3WUUA 3MHVA 2FXMA 1GL2A 2P58A 1H0TA 1FOSF 3VMAA 1SQPG 1NU1E 3AECC 1ME5A 1LTJA 2GUVA 1HWTC 2FYNB 3OW2O 2POHA 2BEQD 1SQPK 4B86A 1KILB 3AE3C 3EWKA 2OTJP 1HH0A 2Y0EA 1J1DC 1BGYG 1LWUC 4KJMA 1USDA 1LP1A 1QLED 2FYUJ 2D2CB 3WUTA 1SQPD 1USEA 3RL0B 1OZHA 3AE8C 4GKGA 1BSHA 4ASWA 1KD1Q 4R4MA 1FS0E 1BE3G 4U3FE 1NKNA 1GL2D 4NPFX 2QIWA 4U7JA 5KJ7A 3RK3B 1KQLA 2WSFJ 2C9NY 2O1KA 4ASVA 2JEEA 3TGUG 1N7SB 4EYYQ 2HLOA 2KNCB 2OTKE 4N6JA 1ZRTE 3NMDA 4H13B 5KKZB 3H1JG 1D7MA 3FXEA 1LT9A 2OYIB 5TISE 3V5BA 2I1KA 3PTZA 3L37A 4IFMA 1AVOA 4L73A 2Q5UA 3L72J 4H44B 2Y0CA 2AXCA 3HD7C 2OYOA 2IPPA 2H89C 3TGUD 2WSCJ 1U7JA 3A0HH 1DD4A 2IJCA 5GTIH 1IFDA 2G3AA 2R44A 1EDIA 3VN0A 1QVFO 2YIUC 2K88A 1FC2C 4WY4B 1Q2NA 2IZ0A 4I1LA 3G3ZA 2FXOA 2QJPC 1JUNA 1NOHA 1PP9G 1ZV8A 1KYOH 2RKLA 1SVFA 1AV1A 1PGOA 2KP8A 4ZNCA 3L70G 4L76A 5TJHA 1PGPA 3VMXA 5KAFH 3MUDA 5K5GB 2AXTE 1JM0A 3KZIH 2W90A 1NTZK 1LTBC 3LVYA 1VQ6P 2MJZA 5APWA 1YTZT 1LW1A 1PP9D 2ZYGA 3I5CA 3MP7B 1LWUB 5E79H 4W7ZA 2IBZG 3B5NB 4IL6E 2YXRB 2CPSA 3L70D 1NTZD 4N78D 1NYHA 2QG4A 1NJIQ 1L0NG 1CSBA 1HJ0A 1SQBG 2BCCE 3MIWA 2O01H 1HGVA 1IFMA 3L71G 2KIKA 3GHGB 1RQVA 2Z4EA 1L0NK 2O1JA 2KLUA 1KQFB 1OX3A 2H43A 1P84H 3NTNA 1SQBK 2WSSH 3RK2C 1BGYE 3AA7A 4JYBA 2RH0A 2W27A 1L0ND 4I6MC 1VQ7P 2ZYAA 3D70A 1H8AA 1SQBD 2MKVA 2IZ1A 1KYOI 3AA6A 3L71D 1OW6A 2M3BA 3TK1A 1Q90D 1GL2B 2W6BA 2WSFH 3AEAC 1VKEA 2ZJSE 1X22A 1BDDA 1IC2A 1IFJA 2J58A 3BCCD 1J2JB 3BVHA 1IK9A 1LTJB 1PPJE 1Y9BA 2XNDH 1H88A 1NTKG 1SLQA 2W83C 3H1JE 2YIUB 3CLQA 3A0HE 2B87A 1S2EA 5GTIE 1LP1B 1NTKK 1JMBA 4OGQD 1LTTC 3KQGA 1K9MQ 3RL0g 1KYOE 1VQMP 4PD4D 2WSCH 1OIPA 4DOJA 1S9KE 1NTKD 2KI7B 1OFCX 3CI9A 5KAFE 3H1KJ 4WWIA 1P84I 1FJPA 1H89A 1T6AA 1EZVD 5KLIC 2WPQA 2Z5IA 3CCQP 1CI6B 5DJUB 3VMYA 4OGQC 3AA0A 3L74D 4PJ0H 1ZOYC 1SQQG 3CWBG 2Y9YA 3CD6P 1IFNA 1LT9B 5E79E 2YKOA 2ZFCA 1NTMG 1SQQK 2QJKB 2OQQA 1NTMK 2H88C 3AE2C 1OMIA 2ZVNB 3MD0A 2IBZE 1SQQD 2M3EA 1P84E 3CWBD 3MZWB 3T97A 4HYTB 1GD2E 1NU1G 2GA1A 3M06A 3AE5C 1WRGA 1URQD 2A45H 2GM4A 2FYUE 4OWFA 1VQOP 1KILD 5CCHD 1NU1K 4XE5B 4O9BA 4LLHA 1GZLA 1PFIA 2WPSA 1ZLLA 1JNMA 1JY2P 5AW6B 2QM8A 1LTAC 1NU1D 1ZN5A 4M3LA 3IR9A 1IK7A 2Q7CA 1URQC 1AA0A 2JDIH 2FYNC 4WVZA 2XU6A 2LXBA 2E74D 3CXHH 1JY3P 4U3FG 1FZCC 2XZRA 1KILC 1ZR4A 5CCHC 3D6YA 5AW8B 3CCLP 5B5EH 1SQXD 1N8RQ 2R3CA 5GTHH 2NPSD 3QH9A 2KS1A 1EDKA 1FOSE 3E7KA 5AVTB 4HJGH 1GK6A 2E76B 2E5YA 2D2CC 3IF4A 3PHLA 2R5DA 4RESB 3E1IA 1FAVA 3HUSA 3AEBC 3RL0C 3L72E 2J5UA 2BASA 3H1HJ 4GOFA 1RF1C 2V4HA 1M8OB 3RK3C 2KB7P 3A3YB 4UB8H 2Q1KA 2QE7H 2UWJE 4OGQB 2NPSC 2I1JA 1RY3A 3Q5RA 1N7SC 2A45I 4PJ0E 1LTGC 3H1ID 1KZUB 5KKZC 1TU3F 3M9QA 3A0BH 2OYIC 1S5LH 3P8CE 3L73E 3L75D 4W7YA 3LK2A 4H44C 1NWQA 3IAOA 5BVZA 2B87B 3RGUA 1YHQP 1GU9A 2HYNA 3VP8A 2AEMA 1T2KC 1JEKA 3CXHI 3TNUB 1IFPA 5AVRB 3EQ2A 3BASA 1AVYA 2PP6A 2A06D 1G1JA 2FKWB 3L4FA 1YQ4C 2LKMA 4QMAA 4H0LD 2FFDA 2OTLP 1L2PA 1RHZB 2AXTH 2JWAA 1NAFA 5M1BA 5H2FH 4D6TJ 1DX7A 3P7KA 2BCCG 3JC22 4JYCA 2KXPA 1URQB 1JOCA 3Q1MA 4WB4A 3GG2A 4GOEA 1FZCB 3P8MC 4IL6H 3G4SP 3KDPB 3CXHE 3H1LJ 1YIJP 1SS1A 1VQ9P 2GMYA 3B5NC 2WWWA 1K05A 4DZOA 1U57A 5B5EE 1Z56A 1HF9A 5GTHE 1FDMA 3BEYA 3PH0A 4R4LA 3M0DC 1S3JA 2M0BA 2JR8A 3EFGA 2BCCD 1M7LA 3B4SA 3GHGC 1GDTA 2E74B 1RF1B 1RE3C 3CC2P 1A02J 3T97B 1Q81Q 2ZXXA 1BGYD 2NPSB 1AJYA 1PPJG 4UB8E 2KSJA 4WBAA 4I7ZB 2WMMA 1IZNA 1S1CX 3RBXA 3BCCJ 1BCCJ 1YJ9P 1FBMA 1N2DC 2K9JA 4A7PA 3C1LA 2P10A 2YO2A 3OJAB 1QGKB 2QEXP 2C0XA 4IOIH 3W68A 4C7RA 1M1JA 2WZ7A 1BE3D 4TT3H 1GL2C 3A0BE 3C8VA 3PLNA 1K04A 3ITKA 1L0LJ 4C7NA 3H1KE 1S5LE 1JTHA 2H8PD 2QA4P 1LTJC 1RE4A 1DEBA 1HTLC 1K8AQ 2WPVB 1EC5A 2M5AA 1KV4A 5KJ7D 3H1JD 1NKZB 5AVQB 4ZKPA 2Q0TA 3SFEC 4YTPC 1SFCA 4JQ0D 5B66H 5CCGA 1YI2P 5CHXA 5APYA 2P2UA 1S72P 1ZW0A 1KYOD 5AVYB 2JO1A 3N4XA 3L73J 2CK3H 5H2FE 1WMKA 5KJ7C 3AEFC 3CCSP 1N73A 1PV3A 1YTZI 5AW2B 1Q7YQ 4BRYA 5AVSB 1R5SA 3VTPC 4H0LB 1MFTA 1SQVJ 1QL2A 5AVUB 3R2PA 1BSNA 2ZT9B 3HE4A 3JCUH 1LT9C 2O4DA 2QJYB 1L4AA 3I56P 5CCGD 2FYUG 1SP4A 4I2LC 2QJKC 2L91A 3LK3A 4HH2A 4IL6X 2FYUK 2IX7C 2HR3A 2FXPA 3G71P 1G1IA 1VF5B 3AAAA 1UIIA 2IBZD 2IFNA 4YXDC 3AE9C 4K35A 2KUBA 1KQGB 1GW3A 1IO4A 1GU4A 1H0TB 2K1AA 4KT0J 3MUDC 1PL5A 1GMJA 3L36A 2Q9IA 4RKUJ 3H1HE 1SQXJ 1L4AD 2E76D 1JCDA 1QEXA 2KXPB 2M8RA 3Q5SA 1XTGB 3L72G 3V2RA 1Y8AA 5DIPA 1J1EB 2OYHA 2XKMA 3JSVC 2JJLA 4XA4A 4GODA 1FZFA 3SWYA 1FZGA 5B66E 3AE4C 5L8RJ 2E76C 2RMZA 4KHXA 4JBZA 3R4YA 1UIXA 2O01N 1R5LA 3A5TA 3FWNA 3V2NA 1Y47A 3L72D 3W67A 1T3UA 3H1IJ 3CC7P 1MFZA 3CMAP 3D71A 3L73G 5AW0B 2C0WA 3WU2E 2R5BA 4YXWH 1IZNB 5KLVJ 1YQ3C 3L75J 2K9JB 3O6QA 1NH4A 2Q3IA 2OUWA 4OVNF 1YJNP 2YXQB 2OARA 4ZKUA 4LGDE 3UIAA 1PIXA 3VOPA 3JCUE 1MZ9A 4EIJA 4D6TE 1GW4A 2A45G 1RF0A 2KLVA 2HPCA 1NTZE 5CJ0A 1MV8A 1FZAA 2M5AB 1KB9H 3D6ZA 1FU1A 2E75D 1VDFA 2ZXEB 3H1LE 1SFCB 1OWAA 1LJ2A 3MGNA 3AEGC 1VQ5P 1BDCA 1NTMD 3U1CA 4DCKA 5KTBA 3AE7C 2HFED 4Z1MH 2W6AA 3TYYA 3CCJP 5BU8B 1QL1A 1KMIZ 1Q82Q 2KNCA 4MN4C 3TDKA 3S1KA
chains in the Genus database with same CATH topology
1KNCA 2OUWA 1GU9A 2AF7A 2QEUA 2KZ7A 3LK3A 2Q0TA 1IZNA 2ES9A 3AA6A 1P8CA 2CWQA 3LVYA 4AKRA 5ADXK 2OYOA 2GMYA 2O4DA 3AA7A 3D7IA 3AAAA 3AAEA 3AA1A 3C1LA 3AA0A 5DIKA 5DIPA 4G9QA 3LK2A 5AFUK 3LK41 2IJCA 2JN8A 2PFXA 1ME5A 1LW1A 2KXPA 3BEYA 2PRRA 1VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNC A;  2OUW A;  1GU9 A;  2AF7 A;  2QEU A;  2Q0T A;  1P8C A;  2CWQ A;  3LVY A;  2GMY A;  2OYO A;  2O4D A;  3D7I A;  3C1L A;  5DIK A;  5DIP A;  4G9Q A;  2IJC A;  2PFX A;  1ME5 A;  1LW1 A;  3BEY A;  2PRR A;  1VKE A; 
#chains in the Genus database with same CATH topology
 1JMM A;  3AED C;  1EDJ A;  4BRY B;  2LR2 A;  1SQP J;  3E1R A;  3II6 A;  5ADX K;  3CCM P;  1NHL A;  1OW8 A;  5CJ4 A;  3F89 A;  1EZV I;  3BCC E;  1BCC E;  3HE4 B;  5C39 A;  3CXH D;  2YMK A;  3NXS A;  3CX5 H;  1M90 Q;  2N1T A;  2AF7 A;  1L4A B;  3HTK A;  1KOR A;  4EOT A;  3FGA D;  2WT7 A;  1L0L E;  4NPE A;  3D7I A;  1N86 A;  5AVV B;  4WY4 A;  1T8Z A;  3PP5 A;  2B88 A;  2W8Z A;  2JN8 A;  1LTI C;  3IFM A;  2E74 C;  4U3F D;  4L75 A;  1X8Y A;  1PGQ A;  4JF7 A;  1KB9 I;  3I55 P;  3H1K G;  1BE3 J;  2AEF A;  4C46 A;  4PV1 D;  1E79 H;  3B71 A;  4I7Z C;  2KK7 A;  1FZB A;  1EZV E;  1YYC A;  1ZRT D;  2QM7 A;  1EDL A;  3TGU J;  2KZJ A;  3BAT A;  1N7L A;  3HE5 A;  4RO0 A;  1M57 D;  2N1T D;  3V6I A;  2WTY A;  4AKR A;  1RH5 B;  3WUV A;  3ZDM A;  1LWU A;  4AQR D;  1DIP A;  1IFI A;  3IN6 A;  3M9H A;  4IFD K;  1GK4 A;  3BRV B;  2N9B A;  1G2C A;  1KC8 Q;  3M0D A;  1FJK A;  1KB9 E;  2YNY A;  1SQV E;  2YKP A;  3BRT B;  2E43 A;  3CX5 I;  4HB1 A;  2OGU A;  3HUS C;  5APV A;  1PP9 J;  2DW3 A;  2ZT9 D;  2E75 B;  1HUC A;  1CZQ A;  1KIL E;  3L70 J;  1NTZ J;  1T3J A;  2JKV A;  5AW7 B;  3MTU E;  2ITA A;  3KHU A;  2K37 A;  3O6Q B;  1IJD B;  1VQ4 P;  1KQS O;  5AW3 B;  1VF5 D;  3AEE C;  4H0L C;  1XTC C;  2O01 J;  1JB0 J;  3HD7 A;  2ZT9 C;  3G9R A;  4UB6 H;  1PGJ A;  2W6J H;  3CX5 E;  3CCU P;  2JP3 A;  2HPC B;  4AYC A;  3RK3 E;  2QJY C;  4BWN A;  1SQX E;  1R8E A;  2B89 A;  3A2A A;  1FZE A;  1L0N J;  2YO3 A;  1AQ5 A;  3CCR P;  3AAE A;  2CPB A;  1SQB J;  1OXZ A;  5APX A;  2V7Q J;  3M0A A;  3H1H G;  3L71 J;  2JWD A;  1VF5 C;  3TSI A;  2XDJ A;  5APS A;  4JPZ B;  1CW5 A;  1FDO A;  2FFD C;  3HD7 D;  2YKQ A;  3LW5 J;  3VMZ A;  1GU5 A;  1CI6 A;  2E5T A;  3H1I E;  2ES9 A;  4Y99 B;  3H1H D;  2WQY C;  2H7H A;  3ABV C;  4PV1 B;  1PPJ D;  1AFO A;  1HVV A;  1X79 B;  5KLV E;  2HG5 D;  3L75 E;  2WSE J;  1J1E C;  1FE6 A;  3CPW O;  1W2E A;  2PGD A;  2KS1 B;  1NTK J;  3H6P A;  2BEZ F;  2N1T B;  1S5L X;  3O8Z A;  3KYQ A;  1K73 Q;  1X0T A;  3HTK B;  3NFQ A;  3K5B A;  2WT7 B;  3HRN A;  3HUS B;  3OA7 A;  2PRR A;  5CBO A;  3L74 J;  1NAY A;  2L5G B;  2A06 E;  4K3A A;  1S9K D;  1X9V A;  2IYO A;  2QVA A;  3QWO C;  3WU2 H;  4D6T G;  2XNX A;  2K3R A;  2NRG A;  1NTZ G;  2ZYD A;  1JY2 O;  2N9Y B;  2ZVO B;  4IFF A;  3V4Q A;  2HOD A;  5AVX B;  5EFW B;  3AE1 C;  2KOG A;  5AW1 B;  1ZME C;  1JY3 O;  3V4W A;  3H1L G;  3HE5 B;  1DD3 A;  1OVU A;  1SFC D;  1SQQ J;  1M1J C;  3CWB J;  3KXD A;  3FXD A;  1J1D B;  3H25 A;  2Q3E A;  3RK2 D;  4UB6 E;  4D6T D;  1E5W A;  1HJB A;  2C9L Y;  1NTM J;  3GMA A;  4L74 A;  3S9O A;  1VPC A;  1RE4 C;  2QSI A;  1G2C B;  2FBW C;  3CCV P;  1SQP E;  4TLF A;  2AEJ A;  1P84 D;  3CCE P;  3SFD C;  1JCC A;  3GF3 A;  3H1L D;  1SFC C;  4CPG A;  5CCG C;  3CME P;  2FYU D;  2FFD B;  2CWQ A;  1NU1 J;  2O3J A;  3BCC G;  1BCC G;  4DT0 A;  5AVZ B;  1EQ7 A;  3LK4 1;  5APT A;  4N3Y B;  3FX0 A;  2I8D A;  4AUW A;  5BU5 A;  2P1J A;  2V7Q H;  1DEE G;  1W2B O;  3VP9 A;  1N73 C;  1L0L G;  2PAJ A;  1EXI A;  3GW6 A;  3H32 A;  1BE3 E;  4LC1 A;  1OVR A;  4BXL A;  2VRS A;  3EFF K;  1U7M A;  1L0L K;  4YPC A;  1JO5 A;  1BCC D;  1YIT P;  3HD7 B;  2GUS A;  1HGZ A;  3TGU E;  3LW5 H;  1LGH B;  5APQ A;  4U3F J;  4Y28 J;  1Q86 Q;  5AVW B;  1L4A C;  3AA1 A;  1EZV G;  1EXJ A;  3Q5P A;  2QJP B;  1L0L D;  3TNU A;  3P32 A;  3L74 G;  3G6E P;  2KZ7 A;  3N7N A;  3SWF A;  4PD4 H;  2WSE H;  1KN7 A;  2RN0 A;  3RBZ A;  4G9Q A;  2ZAE B;  5APU A;  2E42 A;  3PJS K;  1PZQ A;  1M1K Q;  4HKZ H;  1RQU A;  2IBZ I;  1YJW P;  3L35 A;  4GT1 A;  1OW7 A;  1OVV A;  3KZI E;  1SQV G;  1M1J B;  1URQ A;  1PP9 E;  3SWK A;  4C7N B;  1FZC A;  1AQT A;  3M9B A;  3USS A;  1KIL A;  5CCH A;  1JTH B;  4NPD A;  1SQV K;  2B9B A;  3L70 E;  3P8C D;  3L73 D;  2J59 M;  4N78 E;  2FYZ A;  3GF7 A;  4OH8 B;  1JY2 N;  2G8Y A;  2OYH C;  1VQ8 P;  1NVO A;  2Q6Q A;  2P67 A;  1KB9 D;  4EI2 A;  1ZR2 A;  3AE6 C;  1KTM A;  1SQV D;  5KAI H;  1NGM B;  3F5H A;  1JY3 N;  1WT6 A;  1VQN P;  3RK2 B;  2SPZ A;  1RF1 A;  4DJG A;  2FY8 A;  3U59 A;  2Y9Z A;  2NPS A;  1S4X A;  1L0N E;  1QVG O;  4GIF A;  3V2P A;  1KFM A;  2Z5H A;  1N7S A;  1ZXG A;  2PFX A;  5AW5 B;  3FWL A;  2E75 C;  4W80 A;  1SQB E;  1N73 B;  3WMM 0;  1KNC A;  3L71 E;  3PRJ A;  4PD4 I;  4EDF A;  1SQX G;  1NO4 A;  1MUU A;  2HOD B;  4XFJ A;  1P8C A;  2OYI A;  1VQL P;  1LNQ A;  2BCC J;  2WIT A;  1SQX K;  2D2C D;  1KFN A;  4GDO A;  3RL0 D;  2P7J A;  3CC4 P;  2QEU A;  5DJT B;  5CBN A;  1BGY J;  3LID A;  2KZI A;  3CX5 D;  2YMY A;  1RF0 C;  3RK3 D;  1ZP0 C;  1MKM A;  4ZMD A;  2WPR A;  1M56 D;  1YBK A;  1N7S D;  3TF5 A;  3V2Q A;  3H1I G;  3CL3 D;  4PD4 E;  2IDB A;  4H13 D;  2K9Y A;  1NTK E;  1FDI A;  5AW9 B;  5DIK A;  1DH3 A;  3B8E B;  2IFM A;  5KLV G;  5KLI B;  2KYV A;  2Y0D A;  3L75 G;  3M91 A;  1QX8 A;  3L74 E;  4H44 D;  1HBW A;  5KLV K;  3OAK A;  3H1J J;  2WVR A;  5CMZ A;  2NZ2 A;  1VL2 A;  4Y99 C;  1VQP P;  1T2K D;  5AFU K;  3H1K D;  4H13 C;  3LIE A;  3B5N A;  5TIS H;  3H32 B;  4PV1 C;  2LXC B;  4WY4 D;  2A06 G;  2OYH B;  5KLV D;  2IYP A;  1LT1 A;  3SSU A;  3GHG A;  3S4R A;  3Q2Y A;  3KPE A;  1RE3 A;  5KAI E;  2R3S A;  3A7O A;  2N1T C;  1SQQ E;  3CWB E;  1LTS C;  1VQK P;  3VYI A;  2R32 A;  1A02 F;  1NTM E;  2QRX A;  4WY4 C;  4RJT A;  3U1A A;  2XV5 A;  2KSE A;  3Q3D A;  3GLM A;  1GTW A;  1W5C E;  3B5N D;  3C9I A;  5AW4 B;  3WUU A;  3MHV A;  2FXM A;  1GL2 A;  2P58 A;  1H0T A;  1FOS F;  3VMA A;  1SQP G;  1NU1 E;  3AEC C;  1ME5 A;  1LTJ A;  2GUV A;  1HWT C;  2FYN B;  3OW2 O;  2POH A;  2BEQ D;  1SQP K;  4B86 A;  1KIL B;  3AE3 C;  3EWK A;  2OTJ P;  1HH0 A;  2Y0E A;  1J1D C;  1BGY G;  1LWU C;  4KJM A;  1USD A;  1LP1 A;  1QLE D;  2FYU J;  2D2C B;  3WUT A;  1SQP D;  1USE A;  3RL0 B;  1OZH A;  3AE8 C;  4GKG A;  1BSH A;  4ASW A;  1KD1 Q;  4R4M A;  1FS0 E;  1BE3 G;  4U3F E;  1NKN A;  1GL2 D;  4NPF X;  2QIW A;  4U7J A;  5KJ7 A;  3RK3 B;  1KQL A;  2WSF J;  2C9N Y;  2O1K A;  4ASV A;  2JEE A;  3TGU G;  1N7S B;  4EYY Q;  2HLO A;  2KNC B;  2OTK E;  4N6J A;  1ZRT E;  3NMD A;  4H13 B;  5KKZ B;  3H1J G;  1D7M A;  3FXE A;  1LT9 A;  2OYI B;  5TIS E;  3V5B A;  2I1K A;  3PTZ A;  3L37 A;  4IFM A;  1AVO A;  4L73 A;  2Q5U A;  3L72 J;  4H44 B;  2Y0C A;  2AXC A;  3HD7 C;  2OYO A;  2IPP A;  2H89 C;  3TGU D;  2WSC J;  1U7J A;  3A0H H;  1DD4 A;  2IJC A;  5GTI H;  1IFD A;  2G3A A;  2R44 A;  1EDI A;  3VN0 A;  1QVF O;  2YIU C;  2K88 A;  1FC2 C;  4WY4 B;  1Q2N A;  2IZ0 A;  4I1L A;  3G3Z A;  2FXO A;  2QJP C;  1JUN A;  1NOH A;  1PP9 G;  1ZV8 A;  1KYO H;  2RKL A;  1SVF A;  1AV1 A;  1PGO A;  2KP8 A;  4ZNC A;  3L70 G;  4L76 A;  5TJH A;  1PGP A;  3VMX A;  5KAF H;  3MUD A;  5K5G B;  2AXT E;  1JM0 A;  3KZI H;  2W90 A;  1NTZ K;  1LTB C;  3LVY A;  1VQ6 P;  2MJZ A;  5APW A;  1YTZ T;  1LW1 A;  1PP9 D;  2ZYG A;  3I5C A;  3MP7 B;  1LWU B;  5E79 H;  4W7Z A;  2IBZ G;  3B5N B;  4IL6 E;  2YXR B;  2CPS A;  3L70 D;  1NTZ D;  4N78 D;  1NYH A;  2QG4 A;  1NJI Q;  1L0N G;  1CSB A;  1HJ0 A;  1SQB G;  2BCC E;  3MIW A;  2O01 H;  1HGV A;  1IFM A;  3L71 G;  2KIK A;  3GHG B;  1RQV A;  2Z4E A;  1L0N K;  2O1J A;  2KLU A;  1KQF B;  1OX3 A;  2H43 A;  1P84 H;  3NTN A;  1SQB K;  2WSS H;  3RK2 C;  1BGY E;  3AA7 A;  4JYB A;  2RH0 A;  2W27 A;  1L0N D;  4I6M C;  1VQ7 P;  2ZYA A;  3D70 A;  1H8A A;  1SQB D;  2MKV A;  2IZ1 A;  1KYO I;  3AA6 A;  3L71 D;  1OW6 A;  2M3B A;  3TK1 A;  1Q90 D;  1GL2 B;  2W6B A;  2WSF H;  3AEA C;  1VKE A;  2ZJS E;  1X22 A;  1BDD A;  1IC2 A;  1IFJ A;  2J58 A;  3BCC D;  1J2J B;  3BVH A;  1IK9 A;  1LTJ B;  1PPJ E;  1Y9B A;  2XND H;  1H88 A;  1NTK G;  1SLQ A;  2W83 C;  3H1J E;  2YIU B;  3CLQ A;  3A0H E;  2B87 A;  1S2E A;  5GTI E;  1LP1 B;  1NTK K;  1JMB A;  4OGQ D;  1LTT C;  3KQG A;  1K9M Q;  3RL0 g;  1KYO E;  1VQM P;  4PD4 D;  2WSC H;  1OIP A;  4DOJ A;  1S9K E;  1NTK D;  2KI7 B;  1OFC X;  3CI9 A;  5KAF E;  3H1K J;  4WWI A;  1P84 I;  1FJP A;  1H89 A;  1T6A A;  1EZV D;  5KLI C;  2WPQ A;  2Z5I A;  3CCQ P;  1CI6 B;  5DJU B;  3VMY A;  4OGQ C;  3AA0 A;  3L74 D;  4PJ0 H;  1ZOY C;  1SQQ G;  3CWB G;  2Y9Y A;  3CD6 P;  1IFN A;  1LT9 B;  5E79 E;  2YKO A;  2ZFC A;  1NTM G;  1SQQ K;  2QJK B;  2OQQ A;  1NTM K;  2H88 C;  3AE2 C;  1OMI A;  2ZVN B;  3MD0 A;  2IBZ E;  1SQQ D;  2M3E A;  1P84 E;  3CWB D;  3MZW B;  3T97 A;  4HYT B;  1GD2 E;  1NU1 G;  2GA1 A;  3M06 A;  3AE5 C;  1WRG A;  1URQ D;  2A45 H;  2GM4 A;  2FYU E;  4OWF A;  1VQO P;  1KIL D;  5CCH D;  1NU1 K;  4XE5 B;  4O9B A;  4LLH A;  1GZL A;  1PFI A;  2WPS A;  1ZLL A;  1JNM A;  1JY2 P;  5AW6 B;  2QM8 A;  1LTA C;  1NU1 D;  1ZN5 A;  4M3L A;  3IR9 A;  1IK7 A;  2Q7C A;  1URQ C;  1AA0 A;  2JDI H;  2FYN C;  4WVZ A;  2XU6 A;  2LXB A;  2E74 D;  3CXH H;  1JY3 P;  4U3F G;  1FZC C;  2XZR A;  1KIL C;  1ZR4 A;  5CCH C;  3D6Y A;  5AW8 B;  3CCL P;  5B5E H;  1SQX D;  1N8R Q;  2R3C A;  5GTH H;  2NPS D;  3QH9 A;  2KS1 A;  1EDK A;  1FOS E;  3E7K A;  5AVT B;  4HJG H;  1GK6 A;  2E76 B;  2E5Y A;  2D2C C;  3IF4 A;  3PHL A;  2R5D A;  4RES B;  3E1I A;  1FAV A;  3HUS A;  3AEB C;  3RL0 C;  3L72 E;  2J5U A;  2BAS A;  3H1H J;  4GOF A;  1RF1 C;  2V4H A;  1M8O B;  3RK3 C;  2KB7 P;  3A3Y B;  4UB8 H;  2Q1K A;  2QE7 H;  2UWJ E;  4OGQ B;  2NPS C;  2I1J A;  1RY3 A;  3Q5R A;  1N7S C;  2A45 I;  4PJ0 E;  1LTG C;  3H1I D;  1KZU B;  5KKZ C;  1TU3 F;  3M9Q A;  3A0B H;  2OYI C;  1S5L H;  3P8C E;  3L73 E;  3L75 D;  4W7Y A;  3LK2 A;  4H44 C;  1NWQ A;  3IAO A;  5BVZ A;  2B87 B;  3RGU A;  1YHQ P;  1GU9 A;  2HYN A;  3VP8 A;  2AEM A;  1T2K C;  1JEK A;  3CXH I;  3TNU B;  1IFP A;  5AVR B;  3EQ2 A;  3BAS A;  1AVY A;  2PP6 A;  2A06 D;  1G1J A;  2FKW B;  3L4F A;  1YQ4 C;  2LKM A;  4QMA A;  4H0L D;  2FFD A;  2OTL P;  1L2P A;  1RHZ B;  2AXT H;  2JWA A;  1NAF A;  5M1B A;  5H2F H;  4D6T J;  1DX7 A;  3P7K A;  2BCC G;  3JC2 2;  4JYC A;  2KXP A;  1URQ B;  1JOC A;  3Q1M A;  4WB4 A;  3GG2 A;  4GOE A;  1FZC B;  3P8M C;  4IL6 H;  3G4S P;  3KDP B;  3CXH E;  3H1L J;  1YIJ P;  1SS1 A;  1VQ9 P;  2GMY A;  3B5N C;  2WWW A;  1K05 A;  4DZO A;  1U57 A;  5B5E E;  1Z56 A;  1HF9 A;  5GTH E;  1FDM A;  3BEY A;  3PH0 A;  4R4L A;  3M0D C;  1S3J A;  2M0B A;  2JR8 A;  3EFG A;  2BCC D;  1M7L A;  3B4S A;  3GHG C;  1GDT A;  2E74 B;  1RF1 B;  1RE3 C;  3CC2 P;  1A02 J;  3T97 B;  1Q81 Q;  2ZXX A;  1BGY D;  2NPS B;  1AJY A;  1PPJ G;  4UB8 E;  2KSJ A;  4WBA A;  4I7Z B;  2WMM A;  1IZN A;  1S1C X;  3RBX A;  3BCC J;  1BCC J;  1YJ9 P;  1FBM A;  1N2D C;  2K9J A;  4A7P A;  3C1L A;  2P10 A;  2YO2 A;  3OJA B;  1QGK B;  2QEX P;  2C0X A;  4IOI H;  3W68 A;  4C7R A;  1M1J A;  2WZ7 A;  1BE3 D;  4TT3 H;  1GL2 C;  3A0B E;  3C8V A;  3PLN A;  1K04 A;  3ITK A;  1L0L J;  4C7N A;  3H1K E;  1S5L E;  1JTH A;  2H8P D;  2QA4 P;  1LTJ C;  1RE4 A;  1DEB A;  1HTL C;  1K8A Q;  2WPV B;  1EC5 A;  2M5A A;  1KV4 A;  5KJ7 D;  3H1J D;  1NKZ B;  5AVQ B;  4ZKP A;  2Q0T A;  3SFE C;  4YTP C;  1SFC A;  4JQ0 D;  5B66 H;  5CCG A;  1YI2 P;  5CHX A;  5APY A;  2P2U A;  1S72 P;  1ZW0 A;  1KYO D;  5AVY B;  2JO1 A;  3N4X A;  3L73 J;  2CK3 H;  5H2F E;  1WMK A;  5KJ7 C;  3AEF C;  3CCS P;  1N73 A;  1PV3 A;  1YTZ I;  5AW2 B;  1Q7Y Q;  4BRY A;  5AVS B;  1R5S A;  3VTP C;  4H0L B;  1MFT A;  1SQV J;  1QL2 A;  5AVU B;  3R2P A;  1BSN A;  2ZT9 B;  3HE4 A;  3JCU H;  1LT9 C;  2O4D A;  2QJY B;  1L4A A;  3I56 P;  5CCG D;  2FYU G;  1SP4 A;  4I2L C;  2QJK C;  2L91 A;  3LK3 A;  4HH2 A;  4IL6 X;  2FYU K;  2IX7 C;  2HR3 A;  2FXP A;  3G71 P;  1G1I A;  1VF5 B;  3AAA A;  1UII A;  2IBZ D;  2IFN A;  4YXD C;  3AE9 C;  4K35 A;  2KUB A;  1KQG B;  1GW3 A;  1IO4 A;  1GU4 A;  1H0T B;  2K1A A;  4KT0 J;  3MUD C;  1PL5 A;  1GMJ A;  3L36 A;  2Q9I A;  4RKU J;  3H1H E;  1SQX J;  1L4A D;  2E76 D;  1JCD A;  1QEX A;  2KXP B;  2M8R A;  3Q5S A;  1XTG B;  3L72 G;  3V2R A;  1Y8A A;  5DIP A;  1J1E B;  2OYH A;  2XKM A;  3JSV C;  2JJL A;  4XA4 A;  4GOD A;  1FZF A;  3SWY A;  1FZG A;  5B66 E;  3AE4 C;  5L8R J;  2E76 C;  2RMZ A;  4KHX A;  4JBZ A;  3R4Y A;  1UIX A;  2O01 N;  1R5L A;  3A5T A;  3FWN A;  3V2N A;  1Y47 A;  3L72 D;  3W67 A;  1T3U A;  3H1I J;  3CC7 P;  1MFZ A;  3CMA P;  3D71 A;  3L73 G;  5AW0 B;  2C0W A;  3WU2 E;  2R5B A;  4YXW H;  1IZN B;  5KLV J;  1YQ3 C;  3L75 J;  2K9J B;  3O6Q A;  1NH4 A;  2Q3I A;  2OUW A;  4OVN F;  1YJN P;  2YXQ B;  2OAR A;  4ZKU A;  4LGD E;  3UIA A;  1PIX A;  3VOP A;  3JCU E;  1MZ9 A;  4EIJ A;  4D6T E;  1GW4 A;  2A45 G;  1RF0 A;  2KLV A;  2HPC A;  1NTZ E;  5CJ0 A;  1MV8 A;  1FZA A;  2M5A B;  1KB9 H;  3D6Z A;  1FU1 A;  2E75 D;  1VDF A;  2ZXE B;  3H1L E;  1SFC B;  1OWA A;  1LJ2 A;  3MGN A;  3AEG C;  1VQ5 P;  1BDC A;  1NTM D;  3U1C A;  4DCK A;  5KTB A;  3AE7 C;  2HFE D;  4Z1M H;  2W6A A;  3TYY A;  3CCJ P;  5BU8 B;  1QL1 A;  1KMI Z;  1Q82 Q;  2KNC A;  4MN4 C;  3TDK A;  3S1K A; 
#chains in the Genus database with same CATH homology
 1KNC A;  2OUW A;  1GU9 A;  2AF7 A;  2QEU A;  2KZ7 A;  3LK3 A;  2Q0T A;  1IZN A;  2ES9 A;  3AA6 A;  1P8C A;  2CWQ A;  3LVY A;  4AKR A;  5ADX K;  2OYO A;  2GMY A;  2O4D A;  3AA7 A;  3D7I A;  3AAA A;  3AAE A;  3AA1 A;  3C1L A;  3AA0 A;  5DIK A;  5DIP A;  4G9Q A;  3LK2 A;  5AFU K;  3LK4 1;  2IJC A;  2JN8 A;  2PFX A;  1ME5 A;  1LW1 A;  2KXP A;  3BEY A;  2PRR A;  1VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...