2PFXA

Crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
GMTKPKEPTALDLPMADPLPDETQKYFEICQEKLGMVPNVLKAYAFNVEKLNAFTAMYNDLMLGESQLSKLEREMIAVVVSSINKCFYCLVAHGAAVRQLSGDPQLGEMLVMNYRVAPLDARQRVMLDFAAKMTRASAEIEEADREVLRSHGFNDRDIWDIANVTGFFNMTNRVASATAMMPNAEYHGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized peroxidase-related protein
publication title Crystal structure of uncharacterized peroxidase-related protein (YP_614459.1) from Silicibacter sp. TM1040 at 1.70 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Oxidoreductase
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.810 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces AhpD-like 2pfxA01
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2pfxA02
1KNCA 2O4DA 4G9QA 5DIPA 1ME5A 3D7IA 2IJCA 2OYOA 3BEYA 1GU9A 3C1LA 2GMYA 2QEUA 1VKEA 2Q0TA 3LVYA 1LW1A 1P8CA 2OUWA 2PFXA 2CWQA 5DIKA 2PRRA 2AF7A
chains in the Genus database with same CATH superfamily
1FOSF 1QGKB 2FYUD 1LTJC 1NTMD 4PJ0H 2ZJSE 3H1LG 2JDIH 2YMYA 3P8CE 1ZV8A 2YNYA 2L91A 3F89A 3GF3A 3ZDMA 1LP1A 4H0LC 2K9JA 4HH2A 2E74D 5AVRB 2OTJP 3L72J 2W6BA 1RE3C 5H2FH 1PP9E 3L71J 1HH0A 1XTGB 1MV8A 2R5DA 3PTZA 1WT6A 1FZCC 1IZNA 2SPZA 4OH8B 3M9QA 3OJAB 3R4YA 1KB9I 3D7IA 2N1TB 5KLIB 1N7SA 5APYA 1KB9E 5M1BA 1N2DC 1RE3A 3D6YA 1U57A 3GLMA 1VF5B 5AVTB 1NOHA 1JO5A 3AE2C 1BE3G 3H1JJ 1VQKP 5KKZB 1JY3P 3H1HD 3HD7B 3HUSC 3JSVC 2OQQA 1VF5D 2P2UA 3CCVP 1T3JA 3CXHE 1H88A 3HE4A 3MP7B 2VRSA 5AW5B 3I55P 2AXTE 2A06D 4PD4I 3CX5H 3SWKA 3HD7D 5AFUK 3BATA 1N7LA 3RBZA 1TU3F 4AYCA 3L70D 3FXEA 1GL2C 2DW3A 3FWLA 1KQFB 1VQPP 1S3JA 3LIDA 1LWUA 2IJCA 3V4WA 2IBZI 3SWFA 4WY4A 4JBZA 2WQYC 3QWOC 1ZLLA 4PJ0E 5CMZA 1FZGA 3SWYA 1YYCA 5ADXK 1SQBG 1LTGC 1GL2A 1FZEA 1KQLA 1DEEG 4HYTB 1CI6A 5DIKA 1OMIA 3L36A 5KLVJ 1AA0A 3HTKA 1GU4A 4RO0A 1J1EB 4GDOA 5CCGA 3UIAA 5APXA 4XE5B 3L75D 4C7NA 2KS1B 3AEFC 1DD3A 2KXPB 2OYHC 2O4DA 1GK6A 1NTZD 3TDKA 4O9BA 1BDDA 3R2PA 1HJBA 4LLHA 1AFOA 5AVXB 1KYOH 2K37A 3G4SP 1QX8A 3BCCD 1GD2E 2V7QH 3CCRP 1PGOA 2HLOA 3Q2YA 3IAOA 1GW4A 1NJIQ 2OYHA 3CX5E 2KNCA 2HPCB 4YTPC 3BVHA 3EFGA 2BCCE 3TGUE 2Z5HA 2O01N 3JCUE 4JQ0D 2B88A 2BASA 1GK4A 2ZAEB 3WUUA 2K9YA 1PPJD 3MIWA 1FJKA 2YIUC 1SQBK 3G6EP 5AVQB 4IFMA 2CPBA 1GTWA 2C0WA 1OXZA 1JY3O 3TF5A 1M8OB 1SQPD 1YJNP 1G2CB 1LTTC 2Q9IA 3HRNA 3M0DC 2KZIA 3B5NA 1RF1B 1HTLC 1Z56A 1EZVI 1L0NG 3GHGA 3H1JG 2IZ1A 2R3SA 1H89A 2ZT9B 3EQ2A 1CZQA 3LVYA 1P84I 2MKVA 2YKOA 1BE3E 1NO4A 1MFTA 3NXSA 3M0DA 2ZT9D 1P84E 1QL2A 1SQVJ 4I7ZC 4ZKUA 1SQQE 3CCLP 5CBOA 2O01J 3A2AA 1VQ6P 1KYOE 3LW5H 3H1ID 4D6TD 1CSBA 1NTKJ 2AEFA 3CPWO 2M5AB 5AW4B 5AW1B 4BWNA 2ZXXA 4HJGH 5TJHA 4C46A 1NVOA 2A45I 4IFDK 3RK3C 1PP9G 3P8MC 1HF9A 5C39A 1JTHB 2CPSA 1M1JC 1BGYD 3AEGC 1N8RQ 5KJ7C 1FDMA 1LT9B 3MUDC 1PIXA 2FFDC 1Y8AA 2E5TA 1OWAA 4R4MA 3H1KE 1S9KE 2E76B 3HE5A 1LW1A 3ABVC 2QJKC 2CWQA 5AW0B 5AVSB 2ZVOB 1LGHB 2Y0CA 2LR2A 5CCHD 5AVYB 1L0NK 4N78D 3P7KA 2Y9YA 5AVVB 5APUA 3OA7A 4U3FJ 2OYIA 4PV1B 5CBNA 1L0LJ 1PGPA 2ZYGA 1KFMA 2NPSB 1SFCB 1L4AC 2E42A 3VMZA 3M06A 1SQXD 1URQC 2O1KA 2K1AA 4PV1D 2FY8A 3NMDA 3CWBE 1S72P 1NU1E 1MZ9A 1SFCD 4R4LA 1KILB 4DZOA 3Q5SA 1QEXA 1EDIA 2IBZG 1N73B 5CHXA 3BRTB 2YO2A 3M0AA 1USEA 1DH3A 1LJ2A 2JWAA 3U1CA 4BRYA 2JJLA 1IFPA 5APWA 3D6ZA 1YTZI 1OX3A 1J2JB 4BXLA 2H89C 2QM8A 4GIFA 2LXBA 2ZXEB 1X8YA 3L74D 2GUVA 3T97B 3L72E 1FC2C 5KAFH 1H8AA 4OWFA 3L71E 2FYNC 1LTJB 2WT7B 2AEJA 2B9BA 3Q5RA 3I5CA 2E75D 1KB9H 2KSJA 2WSCJ 2WPVB 2MJZA 3AEDC 3AA1A 2HODA 1FBMA 4H0LB 3RL0B 3USSA 5CCHA 2QRXA 3GF7A 3CL3D 3M9HA 1A02J 1YITP 4DJGA 5AW8B 3AE6C 3AE5C 1M7LA 1BCCJ 1W2EA 4H0LD 3RL0D 3KYQA 1X79B 2AXTH 3H1JE 2W27A 2NRGA 1SQVG 3KXDA 1MUUA 2R5BA 1FZCB 3P32A 1S4XA 3TSIA 4PD4H 4RKUJ 3BEYA 1D7MA 1NU1J 2WSFJ 1M1KQ 3CMEP 1RY3A 5CJ4A 2D2CD 3TGUG 1EDLA 4OGQD 5BVZA 5L8RJ 1KNCA 2FYUE 2W6AA 1AVYA 3W67A 1K8AQ 4EYYQ 1NKZB 3NTNA 3HUSB 3CCJP 2Y0EA 1EDKA 2J5UA 3B8EB 3C8VA 3BRVB 2H8PD 1N7SC 3O6QB 4I6MC 1FAVA 4L75A 3A7OA 3P8CD 2FXOA 2Q5UA 2N9YB 2IFNA 3Q1MA 2Q6QA 2QIWA 1JY2O 4DCKA 1EXIA 1VDFA 1OZHA 4Y99C 1AV1A 1RE4A 5KTBA 5KLVE 2N9BA 5KAFE 2JN8A 3AA7A 1PP9D 1EZVG 4NPEA 4LGDE 1KZUB 1XTCC 1P8CA 1QVFO 2LXCB 2WSEJ 1OVRA 2N1TD 1LWUC 3A5TA 1VL2A 3H1HE 3F5HA 1FU1A 2XNDH 4WY4C 1SQVK 1SQQG 1HVVA 3SSUA 4TLFA 3RBXA 2KI7B 4H44C 1VQ4P 2A06E 2O01H 3FWNA 3JC22 3NFQA 4PD4E 2E74C 4UB6E 2FYUJ 2E43A 5B66E 2RMZA 3JCUH 1NTMJ 2FKWB 2KUBA 2B87A 3CXHD 1GW3A 4AQRD 4AKRA 1FDOA 1HGZA 2IBZE 3L73D 3KQGA 2WITA 4Y28J 2FYZA 3RK2C 3WU2H 1JY3N 1WRGA 5CCGC 3AE8C 1YQ3C 2I1KA 1S5LE 1U7MA 3H1KG 4MN4C 1KN7A 3PLNA 1YQ4C 4L76A 3PJSK 1VF5C 2G8YA 1GZLA 2KLUA 1LTBC 2K88A 3V5BA 1IC2A 2XU6A 1L2PA 1BCCG 1R5SA 3H1HJ 1NTZE 2I1JA 4JPZB 2GM4A 1P84H 1SQQK 3PHLA 3CWBG 1NU1G 1E79H 4EI2A 1KFNA 1NYHA 4H13C 3L70J 4HKZH 1SQVE 1MKMA 1JMMA 3HD7A 3N7NA 4RESB 1FZBA 1M56D 2R44A 2QJYC 1NTKE 5K5GB 2XZRA 2A45H 1OW6A 1LNQA 2ZVNB 1UIXA 3H32B 5APTA 2WPSA 4G9QA 1KMIZ 3B5NC 4GOFA 3CX5D 4I7ZB 3L72G 3CMAP 3PH0A 2WMMA 3L71G 2BCCD 3S9OA 3TGUD 3GHGC 3AE9C 4XFJA 3WU2E 3PRJA 3H25A 1HJ0A 1J1EC 5KAIH 2JO1A 1SQPE 2Q3IA 1NAYA 1VQ9P 3IN6A 4B86A 1OIPA 1KORA 1HWTC 3V2QA 3H1LD 2OYOA 3RK3E 2IPPA 4DT0A 2KOGA 3L75J 3RK3B 3TNUB 1N86A 3FX0A 1FJPA 1DD4A 1M1JB 1NTZJ 3LK2A 2QVAA 3SFEC 1EZVE 1JB0J 3AA6A 4U3FE 2FFDB 2KS1A 1NU1K 1L0LE 3BCCJ 1H0TB 2WSFH 5KJ7D 3VP8A 2GA1A 2QJKB 3EWKA 5CJ0A 2WSSH 2ITAA 2FYUG 1S5LX 1ZRTE 1NTMG 1SLQA 3G71P 4D6TE 3H6PA 3Q3DA 1NWQA 2KB7P 1BE3D 1ZN5A 1FE6A 1AQTA 2J59M 3VMXA 2Z4EA 1L4AB 4GODA 4ASWA 1BSHA 1GDTA 1URQB 3AEAC 1YI2P 1KYOD 2M8RA 2QEUA 3TYYA 1WMKA 1ZP0C 1EXJA 1OW8A 2WTYA 1SQPJ 1URQD 2K3RA 1HBWA 2OYIC 5KLVG 1ZOYC 1E5WA 1YTZT 3CI9A 1NKNA 3V2PA 5KAIE 1GU5A 1KV4A 1VQ8P 3KPEA 2KLVA 2HR3A 1G2CA 2JEEA 2E76D 2WSEH 1JUNA 3M91A 3H1HG 3AAEA 4L73A 3H1KD 4QMAA 1SQBD 2YKPA 1S9KD 2C0XA 1RF1A 1X0TA 2BEQD 2IYPA 2A06G 4KHXA 2FYNB 2I8DA 4ZMDA 1BCCE 1JY2P 1USDA 2E5YA 1QL1A 1R5LA 3AE7C 2NZ2A 2FYUK 4EDFA 1Q86Q 3H1IJ 2HYNA 4D6TJ 3L37A 1NTMK 2NPSD 2FXMA 2QSIA 1G1IA 5TISE 1ZXGA 3AEBC 2WWWA 1FDIA 3CLQA 4N6JA 3W68A 2BEZF 3WMM0 5DIPA 1M57D 1KILD 2AXCA 5APQA 1Q90D 2LKMA 3CWBD 1Q82Q 4YXWH 1BGYJ 2M5AA 2RN0A 1LP1B 2K9JB 5CCHC 3L74E 1G1JA 5KLVK 1LTAC 3KZIH 3IFMA 4K35A 4W80A 2KIKA 3VOPA 1JTHA 4KT0J 3VTPC 3RGUA 1IZNB 4I2LC 3LK3A 1VQLP 3IR9A 4W7YA 4JYCA 1NTZG 3L72D 1T6AA 1T2KC 2XNXA 5EFWB 4Z1MH 1N7SB 2PP6A 3A3YB 3L71D 2FXPA 3WUTA 2XV5A 3BCCG 1SQXJ 1N7SD 3A0BH 2KZ7A 4ZKPA 1AVOA 4UB6H 1JM0A 1K9MQ 3CC2P 5B66H 3HE4B 2YXRB 3A0HE 5E79H 4EIJA 2ZYDA 1SFCA 1L0ND 1NTKG 1RH5B 3H1JD 3E7KA 1KTMA 1NTME 1ZR2A 1S1CX 2IDBA 1W2BO 1LWUB 3LIEA 2OGUA 1KILA 5AVUB 1PPJG 4WY4B 2Q7CA 1RE4C 1IK7A 1OVUA 2E75C 3N4XA 1S5LH 1Y9BA 2QEXP 4H44B 3CCQP 1N73A 3L74J 1SQPG 5AVZB 4UB8H 4WY4D 1J1DC 2OTLP 3V2NA 2CK3H 2E74B 1YJ9P 1GL2B 4H44D 2KK7A 2QA4P 2QJPC 1CI6B 3RL0C 3U59A 4GKGA 4U7JA 1SP4A 1OW7A 3KZIE 3K5BA 3HTKB 3IF4A 3WUVA 1GL2D 3T97A 4A7PA 3RL0g 2XDJA 4I1LA 1NTZK 3RK2B 2WT7A 1LTJA 4U3FG 1RF0C 4C7NB 2D2CC 5GTHH 1PZQA 4IL6E 2POHA 1L0LG 4OGQC 1S2EA 5KLVD 3RK2D 3KHUA 5CCGD 3B71A 1VQOP 1ZW0A 1GMJA 2RKLA 2W8ZA 3E1IA 2Q3EA 1KB9D 3H1IG 4D6TG 1L0NJ 1RF0A 1RHZB 3A0BE 1NTKK 3CXHI 3L70E 3VMAA 2H43A 1FZCA 3AECC 1QVGO 4NPFX 5E79E 2OYHB 2KNCB 4RJTA 5APVA 3CC4P 2A45G 1M90Q 2IX7C 4GT1A 3L73E 2HFED 1BGYG 1K05A 2Z5IA 1A02F 4PD4D 1Q7YQ 1VQMP 2P1JA 3G9RA 4W7ZA 3S1KA 3QH9A 1SQPK 2M3BA 4H13B 3TK1A 3HUSA 2IYOA 1RQVA 5AW3B 2IBZD 2N1TC 2QJYB 4UB8E 4H13D 5KLIC 3OW2O 4EOTA 2W90A 3O6QA 1PP9J 1HGVA 2R3CA 3L75E 3B5NB 1OFCX 3L35A 5KKZC 2O1JA 1LT1A 3HD7C 3C9IA 3S4RA 2YIUB 5H2FE 1L0LK 5DJTB 3GHGB 2WVRA 3G3ZA 1SQXG 2N1TA 4WWIA 3B5ND 4DOJA 1X9VA 5GTHE 2Q0TA 5AW7B 3MD0A 3BCCE 4IFFA 4TT3H 2P67A 3FXDA 1JCCA 1Q81Q 4YPCA 3PP5A 3GW6A 3FGAD 1VQNP 2C9NY 4JYBA 2RH0A 2H88C 2ZFCA 3L73J 1JEKA 1IJDB 2QM7A 1SQVD 3CX5I 3AEEC 2M0BA 3L74G 3II6A 5AVWB 1PPJE 3KDPB 2JWDA 1K73Q 2YKQA 4IL6X 1NTKD 2WPQA 2OTKE 1JCDA 1VQ7P 1AQ5A 3BASA 3LK41 1LTIC 2W83C 3H1LE 1IO4A 1EC5A 2UWJE 2WSCH 3CCUP 1FS0E 3CC7P 3HE5B 5AW6B 1T8ZA 1EQ7A 2AEMA 2YMKA 1FZFA 1U7JA 1YIJP 1SQXK 3RK3D 3L4FA 3C1LA 2HG5D 2OYIB 4ZNCA 2G3AA 1YJWP 3I56P 1FOSE 5BU5A 2KXPA 5TISH 5B5EH 4NPDA 4CPGA 1EZVD 2PGDA 2YO3A 4U3FD 1GU9A 5GTIH 3H1IE 4K3AA 2GUSA 3ITKA 4KJMA 1NH4A 3MGNA 1L0LD 1QLED 4IOIH 4OVNF 2KZJA 3V4QA 3EFFK 2PAJA 1P84D 1KYOI 4JF7A 1SQQD 1ZRTD 1KQGB 4WVZA 3GG2A 4ASVA 2C9LY 2HPCA 2BCCJ 3TGUJ 2L5GB 4BRYB 2PFXA 1BGYE 5APSA 1L4AD 2ES9A 4WB4A 3H32A 2W6JH 3CCMP 3H1LJ 1KC8Q 2KYVA 1RF1C 4N3YB 2GMYA 1VKEA 1MFZA 1IFMA 2JR8A 1BDCA 3U1AA 3AE3C 1R8EA 4AUWA 3D71A 2ZT9C 3MHVA 2OARA 2WZ7A 4N78E 2HODB 3AAAA 5DJUB 3M9BA 1SQBE 3VMYA 1SVFA 2WPRA 4YXDC 1YHQP 3CCSP 1PGQA 3TNUA 1OVVA 2P58A 4GOEA 4WBAA 3A0HH 3MZWB 1M1JA 1SQXE 1RQUA 5KJ7A 2JP3A 3CD6P 3L70G 1IFIA 1Y47A 1IK9A 3MUDA 1DX7A 1IFNA 2FFDA 1AJYA 4L74A 3Q5PA 1BE3J 1NHLA 1H0TA 1NAFA 3B4SA 1BSNA 5B5EE 1BCCD 2Y9ZA 2YXQB 3L73G 1ZMEC 1PGJA 1SQQJ 5GTIE 1KILE 2Q1KA 1T2KD 1DEBA 3OAKA 1NU1D 4HB1A 2QE7H 1LTSC 2V7QJ 3VYIA 1SS1A 2P10A 3MTUE 3AE1C 1HUCA 1UIIA 1LT9C 2FBWC 3VN0A 4M3LA 1JY2N 3V2RA 3V6IA 1NGMB 2E76C 1L4AA 2R32A 2O3JA 2Y0DA 1URQA 3GMAA 1EDJA 1VQ5P 2J58A 1X22A 1CW5A 2V4HA 5AW2B 3L75G 2M3EA 2AF7A 1JNMA 1LT9A 2E75B 2P7JA 4PV1C 1Q2NA 1IFDA 5BU8B 4IL6H 3H1KJ 1SQBJ 1T3UA 1VPCA 2IFMA 1JMBA 3E1RA 3VP9A 2NPSC 1SFCC 3D70A 2ZYAA 1J1DB 2PRRA 4LC1A 3AA0A 2QJPB 2B89A 1ME5A 1KILC 1W5CE 1YBKA 4Y99B 1IFJA 3CXHH 1N73C 2NPSA 1L0NE 3O8ZA 3SFDC 4XA4A 1JOCA 2D2CB 5AW9B 4OGQB 3CWBJ 1DIPA 2XKMA 2IZ0A 2JKVA 2B87B 2KP8A 3AE4C 1PFIA 1KD1Q 1K04A 1FZAA 2QG4A 2OUWA 2KSEA 2BCCG 1ZR4A 2H7HA 4C7RA 1PV3A 1KQSO 1PL5A 3CCEP 3LW5J
chains in the Genus database with same CATH topology
1KNCA 2O4DA 3LK2A 3LK41 2JN8A 4G9QA 5DIPA 1ME5A 3AAAA 3D7IA 3AA7A 3AAEA 2KZ7A 2IJCA 2OYOA 3AA6A 3BEYA 5ADXK 1GU9A 3C1LA 2GMYA 2QEUA 1VKEA 2Q0TA 3LVYA 1LW1A 4AKRA 1P8CA 2OUWA 2PFXA 2CWQA 5DIKA 5AFUK 2PRRA 1IZNA 2AF7A 3AA0A 2ES9A 2KXPA 3AA1A 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNC A;  2O4D A;  4G9Q A;  5DIP A;  1ME5 A;  3D7I A;  2IJC A;  2OYO A;  3BEY A;  1GU9 A;  3C1L A;  2GMY A;  2QEU A;  1VKE A;  2Q0T A;  3LVY A;  1LW1 A;  1P8C A;  2OUW A;  2PFX A;  2CWQ A;  5DIK A;  2PRR A;  2AF7 A; 
#chains in the Genus database with same CATH topology
 1FOS F;  1QGK B;  2FYU D;  1LTJ C;  1NTM D;  4PJ0 H;  2ZJS E;  3H1L G;  2JDI H;  2YMY A;  3P8C E;  1ZV8 A;  2YNY A;  2L91 A;  3F89 A;  3GF3 A;  3ZDM A;  1LP1 A;  4H0L C;  2K9J A;  4HH2 A;  2E74 D;  5AVR B;  2OTJ P;  3L72 J;  2W6B A;  1RE3 C;  5H2F H;  1PP9 E;  3L71 J;  1HH0 A;  1XTG B;  1MV8 A;  2R5D A;  3PTZ A;  1WT6 A;  1FZC C;  1IZN A;  2SPZ A;  4OH8 B;  3M9Q A;  3OJA B;  3R4Y A;  1KB9 I;  3D7I A;  2N1T B;  5KLI B;  1N7S A;  5APY A;  1KB9 E;  5M1B A;  1N2D C;  1RE3 A;  3D6Y A;  1U57 A;  3GLM A;  1VF5 B;  5AVT B;  1NOH A;  1JO5 A;  3AE2 C;  1BE3 G;  3H1J J;  1VQK P;  5KKZ B;  1JY3 P;  3H1H D;  3HD7 B;  3HUS C;  3JSV C;  2OQQ A;  1VF5 D;  2P2U A;  3CCV P;  1T3J A;  3CXH E;  1H88 A;  3HE4 A;  3MP7 B;  2VRS A;  5AW5 B;  3I55 P;  2AXT E;  2A06 D;  4PD4 I;  3CX5 H;  3SWK A;  3HD7 D;  5AFU K;  3BAT A;  1N7L A;  3RBZ A;  1TU3 F;  4AYC A;  3L70 D;  3FXE A;  1GL2 C;  2DW3 A;  3FWL A;  1KQF B;  1VQP P;  1S3J A;  3LID A;  1LWU A;  2IJC A;  3V4W A;  2IBZ I;  3SWF A;  4WY4 A;  4JBZ A;  2WQY C;  3QWO C;  1ZLL A;  4PJ0 E;  5CMZ A;  1FZG A;  3SWY A;  1YYC A;  5ADX K;  1SQB G;  1LTG C;  1GL2 A;  1FZE A;  1KQL A;  1DEE G;  4HYT B;  1CI6 A;  5DIK A;  1OMI A;  3L36 A;  5KLV J;  1AA0 A;  3HTK A;  1GU4 A;  4RO0 A;  1J1E B;  4GDO A;  5CCG A;  3UIA A;  5APX A;  4XE5 B;  3L75 D;  4C7N A;  2KS1 B;  3AEF C;  1DD3 A;  2KXP B;  2OYH C;  2O4D A;  1GK6 A;  1NTZ D;  3TDK A;  4O9B A;  1BDD A;  3R2P A;  1HJB A;  4LLH A;  1AFO A;  5AVX B;  1KYO H;  2K37 A;  3G4S P;  1QX8 A;  3BCC D;  1GD2 E;  2V7Q H;  3CCR P;  1PGO A;  2HLO A;  3Q2Y A;  3IAO A;  1GW4 A;  1NJI Q;  2OYH A;  3CX5 E;  2KNC A;  2HPC B;  4YTP C;  3BVH A;  3EFG A;  2BCC E;  3TGU E;  2Z5H A;  2O01 N;  3JCU E;  4JQ0 D;  2B88 A;  2BAS A;  1GK4 A;  2ZAE B;  3WUU A;  2K9Y A;  1PPJ D;  3MIW A;  1FJK A;  2YIU C;  1SQB K;  3G6E P;  5AVQ B;  4IFM A;  2CPB A;  1GTW A;  2C0W A;  1OXZ A;  1JY3 O;  3TF5 A;  1M8O B;  1SQP D;  1YJN P;  1G2C B;  1LTT C;  2Q9I A;  3HRN A;  3M0D C;  2KZI A;  3B5N A;  1RF1 B;  1HTL C;  1Z56 A;  1EZV I;  1L0N G;  3GHG A;  3H1J G;  2IZ1 A;  2R3S A;  1H89 A;  2ZT9 B;  3EQ2 A;  1CZQ A;  3LVY A;  1P84 I;  2MKV A;  2YKO A;  1BE3 E;  1NO4 A;  1MFT A;  3NXS A;  3M0D A;  2ZT9 D;  1P84 E;  1QL2 A;  1SQV J;  4I7Z C;  4ZKU A;  1SQQ E;  3CCL P;  5CBO A;  2O01 J;  3A2A A;  1VQ6 P;  1KYO E;  3LW5 H;  3H1I D;  4D6T D;  1CSB A;  1NTK J;  2AEF A;  3CPW O;  2M5A B;  5AW4 B;  5AW1 B;  4BWN A;  2ZXX A;  4HJG H;  5TJH A;  4C46 A;  1NVO A;  2A45 I;  4IFD K;  3RK3 C;  1PP9 G;  3P8M C;  1HF9 A;  5C39 A;  1JTH B;  2CPS A;  1M1J C;  1BGY D;  3AEG C;  1N8R Q;  5KJ7 C;  1FDM A;  1LT9 B;  3MUD C;  1PIX A;  2FFD C;  1Y8A A;  2E5T A;  1OWA A;  4R4M A;  3H1K E;  1S9K E;  2E76 B;  3HE5 A;  1LW1 A;  3ABV C;  2QJK C;  2CWQ A;  5AW0 B;  5AVS B;  2ZVO B;  1LGH B;  2Y0C A;  2LR2 A;  5CCH D;  5AVY B;  1L0N K;  4N78 D;  3P7K A;  2Y9Y A;  5AVV B;  5APU A;  3OA7 A;  4U3F J;  2OYI A;  4PV1 B;  5CBN A;  1L0L J;  1PGP A;  2ZYG A;  1KFM A;  2NPS B;  1SFC B;  1L4A C;  2E42 A;  3VMZ A;  3M06 A;  1SQX D;  1URQ C;  2O1K A;  2K1A A;  4PV1 D;  2FY8 A;  3NMD A;  3CWB E;  1S72 P;  1NU1 E;  1MZ9 A;  1SFC D;  4R4L A;  1KIL B;  4DZO A;  3Q5S A;  1QEX A;  1EDI A;  2IBZ G;  1N73 B;  5CHX A;  3BRT B;  2YO2 A;  3M0A A;  1USE A;  1DH3 A;  1LJ2 A;  2JWA A;  3U1C A;  4BRY A;  2JJL A;  1IFP A;  5APW A;  3D6Z A;  1YTZ I;  1OX3 A;  1J2J B;  4BXL A;  2H89 C;  2QM8 A;  4GIF A;  2LXB A;  2ZXE B;  1X8Y A;  3L74 D;  2GUV A;  3T97 B;  3L72 E;  1FC2 C;  5KAF H;  1H8A A;  4OWF A;  3L71 E;  2FYN C;  1LTJ B;  2WT7 B;  2AEJ A;  2B9B A;  3Q5R A;  3I5C A;  2E75 D;  1KB9 H;  2KSJ A;  2WSC J;  2WPV B;  2MJZ A;  3AED C;  3AA1 A;  2HOD A;  1FBM A;  4H0L B;  3RL0 B;  3USS A;  5CCH A;  2QRX A;  3GF7 A;  3CL3 D;  3M9H A;  1A02 J;  1YIT P;  4DJG A;  5AW8 B;  3AE6 C;  3AE5 C;  1M7L A;  1BCC J;  1W2E A;  4H0L D;  3RL0 D;  3KYQ A;  1X79 B;  2AXT H;  3H1J E;  2W27 A;  2NRG A;  1SQV G;  3KXD A;  1MUU A;  2R5B A;  1FZC B;  3P32 A;  1S4X A;  3TSI A;  4PD4 H;  4RKU J;  3BEY A;  1D7M A;  1NU1 J;  2WSF J;  1M1K Q;  3CME P;  1RY3 A;  5CJ4 A;  2D2C D;  3TGU G;  1EDL A;  4OGQ D;  5BVZ A;  5L8R J;  1KNC A;  2FYU E;  2W6A A;  1AVY A;  3W67 A;  1K8A Q;  4EYY Q;  1NKZ B;  3NTN A;  3HUS B;  3CCJ P;  2Y0E A;  1EDK A;  2J5U A;  3B8E B;  3C8V A;  3BRV B;  2H8P D;  1N7S C;  3O6Q B;  4I6M C;  1FAV A;  4L75 A;  3A7O A;  3P8C D;  2FXO A;  2Q5U A;  2N9Y B;  2IFN A;  3Q1M A;  2Q6Q A;  2QIW A;  1JY2 O;  4DCK A;  1EXI A;  1VDF A;  1OZH A;  4Y99 C;  1AV1 A;  1RE4 A;  5KTB A;  5KLV E;  2N9B A;  5KAF E;  2JN8 A;  3AA7 A;  1PP9 D;  1EZV G;  4NPE A;  4LGD E;  1KZU B;  1XTC C;  1P8C A;  1QVF O;  2LXC B;  2WSE J;  1OVR A;  2N1T D;  1LWU C;  3A5T A;  1VL2 A;  3H1H E;  3F5H A;  1FU1 A;  2XND H;  4WY4 C;  1SQV K;  1SQQ G;  1HVV A;  3SSU A;  4TLF A;  3RBX A;  2KI7 B;  4H44 C;  1VQ4 P;  2A06 E;  2O01 H;  3FWN A;  3JC2 2;  3NFQ A;  4PD4 E;  2E74 C;  4UB6 E;  2FYU J;  2E43 A;  5B66 E;  2RMZ A;  3JCU H;  1NTM J;  2FKW B;  2KUB A;  2B87 A;  3CXH D;  1GW3 A;  4AQR D;  4AKR A;  1FDO A;  1HGZ A;  2IBZ E;  3L73 D;  3KQG A;  2WIT A;  4Y28 J;  2FYZ A;  3RK2 C;  3WU2 H;  1JY3 N;  1WRG A;  5CCG C;  3AE8 C;  1YQ3 C;  2I1K A;  1S5L E;  1U7M A;  3H1K G;  4MN4 C;  1KN7 A;  3PLN A;  1YQ4 C;  4L76 A;  3PJS K;  1VF5 C;  2G8Y A;  1GZL A;  2KLU A;  1LTB C;  2K88 A;  3V5B A;  1IC2 A;  2XU6 A;  1L2P A;  1BCC G;  1R5S A;  3H1H J;  1NTZ E;  2I1J A;  4JPZ B;  2GM4 A;  1P84 H;  1SQQ K;  3PHL A;  3CWB G;  1NU1 G;  1E79 H;  4EI2 A;  1KFN A;  1NYH A;  4H13 C;  3L70 J;  4HKZ H;  1SQV E;  1MKM A;  1JMM A;  3HD7 A;  3N7N A;  4RES B;  1FZB A;  1M56 D;  2R44 A;  2QJY C;  1NTK E;  5K5G B;  2XZR A;  2A45 H;  1OW6 A;  1LNQ A;  2ZVN B;  1UIX A;  3H32 B;  5APT A;  2WPS A;  4G9Q A;  1KMI Z;  3B5N C;  4GOF A;  3CX5 D;  4I7Z B;  3L72 G;  3CMA P;  3PH0 A;  2WMM A;  3L71 G;  2BCC D;  3S9O A;  3TGU D;  3GHG C;  3AE9 C;  4XFJ A;  3WU2 E;  3PRJ A;  3H25 A;  1HJ0 A;  1J1E C;  5KAI H;  2JO1 A;  1SQP E;  2Q3I A;  1NAY A;  1VQ9 P;  3IN6 A;  4B86 A;  1OIP A;  1KOR A;  1HWT C;  3V2Q A;  3H1L D;  2OYO A;  3RK3 E;  2IPP A;  4DT0 A;  2KOG A;  3L75 J;  3RK3 B;  3TNU B;  1N86 A;  3FX0 A;  1FJP A;  1DD4 A;  1M1J B;  1NTZ J;  3LK2 A;  2QVA A;  3SFE C;  1EZV E;  1JB0 J;  3AA6 A;  4U3F E;  2FFD B;  2KS1 A;  1NU1 K;  1L0L E;  3BCC J;  1H0T B;  2WSF H;  5KJ7 D;  3VP8 A;  2GA1 A;  2QJK B;  3EWK A;  5CJ0 A;  2WSS H;  2ITA A;  2FYU G;  1S5L X;  1ZRT E;  1NTM G;  1SLQ A;  3G71 P;  4D6T E;  3H6P A;  3Q3D A;  1NWQ A;  2KB7 P;  1BE3 D;  1ZN5 A;  1FE6 A;  1AQT A;  2J59 M;  3VMX A;  2Z4E A;  1L4A B;  4GOD A;  4ASW A;  1BSH A;  1GDT A;  1URQ B;  3AEA C;  1YI2 P;  1KYO D;  2M8R A;  2QEU A;  3TYY A;  1WMK A;  1ZP0 C;  1EXJ A;  1OW8 A;  2WTY A;  1SQP J;  1URQ D;  2K3R A;  1HBW A;  2OYI C;  5KLV G;  1ZOY C;  1E5W A;  1YTZ T;  3CI9 A;  1NKN A;  3V2P A;  5KAI E;  1GU5 A;  1KV4 A;  1VQ8 P;  3KPE A;  2KLV A;  2HR3 A;  1G2C A;  2JEE A;  2E76 D;  2WSE H;  1JUN A;  3M91 A;  3H1H G;  3AAE A;  4L73 A;  3H1K D;  4QMA A;  1SQB D;  2YKP A;  1S9K D;  2C0X A;  1RF1 A;  1X0T A;  2BEQ D;  2IYP A;  2A06 G;  4KHX A;  2FYN B;  2I8D A;  4ZMD A;  1BCC E;  1JY2 P;  1USD A;  2E5Y A;  1QL1 A;  1R5L A;  3AE7 C;  2NZ2 A;  2FYU K;  4EDF A;  1Q86 Q;  3H1I J;  2HYN A;  4D6T J;  3L37 A;  1NTM K;  2NPS D;  2FXM A;  2QSI A;  1G1I A;  5TIS E;  1ZXG A;  3AEB C;  2WWW A;  1FDI A;  3CLQ A;  4N6J A;  3W68 A;  2BEZ F;  3WMM 0;  5DIP A;  1M57 D;  1KIL D;  2AXC A;  5APQ A;  1Q90 D;  2LKM A;  3CWB D;  1Q82 Q;  4YXW H;  1BGY J;  2M5A A;  2RN0 A;  1LP1 B;  2K9J B;  5CCH C;  3L74 E;  1G1J A;  5KLV K;  1LTA C;  3KZI H;  3IFM A;  4K35 A;  4W80 A;  2KIK A;  3VOP A;  1JTH A;  4KT0 J;  3VTP C;  3RGU A;  1IZN B;  4I2L C;  3LK3 A;  1VQL P;  3IR9 A;  4W7Y A;  4JYC A;  1NTZ G;  3L72 D;  1T6A A;  1T2K C;  2XNX A;  5EFW B;  4Z1M H;  1N7S B;  2PP6 A;  3A3Y B;  3L71 D;  2FXP A;  3WUT A;  2XV5 A;  3BCC G;  1SQX J;  1N7S D;  3A0B H;  2KZ7 A;  4ZKP A;  1AVO A;  4UB6 H;  1JM0 A;  1K9M Q;  3CC2 P;  5B66 H;  3HE4 B;  2YXR B;  3A0H E;  5E79 H;  4EIJ A;  2ZYD A;  1SFC A;  1L0N D;  1NTK G;  1RH5 B;  3H1J D;  3E7K A;  1KTM A;  1NTM E;  1ZR2 A;  1S1C X;  2IDB A;  1W2B O;  1LWU B;  3LIE A;  2OGU A;  1KIL A;  5AVU B;  1PPJ G;  4WY4 B;  2Q7C A;  1RE4 C;  1IK7 A;  1OVU A;  2E75 C;  3N4X A;  1S5L H;  1Y9B A;  2QEX P;  4H44 B;  3CCQ P;  1N73 A;  3L74 J;  1SQP G;  5AVZ B;  4UB8 H;  4WY4 D;  1J1D C;  2OTL P;  3V2N A;  2CK3 H;  2E74 B;  1YJ9 P;  1GL2 B;  4H44 D;  2KK7 A;  2QA4 P;  2QJP C;  1CI6 B;  3RL0 C;  3U59 A;  4GKG A;  4U7J A;  1SP4 A;  1OW7 A;  3KZI E;  3K5B A;  3HTK B;  3IF4 A;  3WUV A;  1GL2 D;  3T97 A;  4A7P A;  3RL0 g;  2XDJ A;  4I1L A;  1NTZ K;  3RK2 B;  2WT7 A;  1LTJ A;  4U3F G;  1RF0 C;  4C7N B;  2D2C C;  5GTH H;  1PZQ A;  4IL6 E;  2POH A;  1L0L G;  4OGQ C;  1S2E A;  5KLV D;  3RK2 D;  3KHU A;  5CCG D;  3B71 A;  1VQO P;  1ZW0 A;  1GMJ A;  2RKL A;  2W8Z A;  3E1I A;  2Q3E A;  1KB9 D;  3H1I G;  4D6T G;  1L0N J;  1RF0 A;  1RHZ B;  3A0B E;  1NTK K;  3CXH I;  3L70 E;  3VMA A;  2H43 A;  1FZC A;  3AEC C;  1QVG O;  4NPF X;  5E79 E;  2OYH B;  2KNC B;  4RJT A;  5APV A;  3CC4 P;  2A45 G;  1M90 Q;  2IX7 C;  4GT1 A;  3L73 E;  2HFE D;  1BGY G;  1K05 A;  2Z5I A;  1A02 F;  4PD4 D;  1Q7Y Q;  1VQM P;  2P1J A;  3G9R A;  4W7Z A;  3S1K A;  3QH9 A;  1SQP K;  2M3B A;  4H13 B;  3TK1 A;  3HUS A;  2IYO A;  1RQV A;  5AW3 B;  2IBZ D;  2N1T C;  2QJY B;  4UB8 E;  4H13 D;  5KLI C;  3OW2 O;  4EOT A;  2W90 A;  3O6Q A;  1PP9 J;  1HGV A;  2R3C A;  3L75 E;  3B5N B;  1OFC X;  3L35 A;  5KKZ C;  2O1J A;  1LT1 A;  3HD7 C;  3C9I A;  3S4R A;  2YIU B;  5H2F E;  1L0L K;  5DJT B;  3GHG B;  2WVR A;  3G3Z A;  1SQX G;  2N1T A;  4WWI A;  3B5N D;  4DOJ A;  1X9V A;  5GTH E;  2Q0T A;  5AW7 B;  3MD0 A;  3BCC E;  4IFF A;  4TT3 H;  2P67 A;  3FXD A;  1JCC A;  1Q81 Q;  4YPC A;  3PP5 A;  3GW6 A;  3FGA D;  1VQN P;  2C9N Y;  4JYB A;  2RH0 A;  2H88 C;  2ZFC A;  3L73 J;  1JEK A;  1IJD B;  2QM7 A;  1SQV D;  3CX5 I;  3AEE C;  2M0B A;  3L74 G;  3II6 A;  5AVW B;  1PPJ E;  3KDP B;  2JWD A;  1K73 Q;  2YKQ A;  4IL6 X;  1NTK D;  2WPQ A;  2OTK E;  1JCD A;  1VQ7 P;  1AQ5 A;  3BAS A;  3LK4 1;  1LTI C;  2W83 C;  3H1L E;  1IO4 A;  1EC5 A;  2UWJ E;  2WSC H;  3CCU P;  1FS0 E;  3CC7 P;  3HE5 B;  5AW6 B;  1T8Z A;  1EQ7 A;  2AEM A;  2YMK A;  1FZF A;  1U7J A;  1YIJ P;  1SQX K;  3RK3 D;  3L4F A;  3C1L A;  2HG5 D;  2OYI B;  4ZNC A;  2G3A A;  1YJW P;  3I56 P;  1FOS E;  5BU5 A;  2KXP A;  5TIS H;  5B5E H;  4NPD A;  4CPG A;  1EZV D;  2PGD A;  2YO3 A;  4U3F D;  1GU9 A;  5GTI H;  3H1I E;  4K3A A;  2GUS A;  3ITK A;  4KJM A;  1NH4 A;  3MGN A;  1L0L D;  1QLE D;  4IOI H;  4OVN F;  2KZJ A;  3V4Q A;  3EFF K;  2PAJ A;  1P84 D;  1KYO I;  4JF7 A;  1SQQ D;  1ZRT D;  1KQG B;  4WVZ A;  3GG2 A;  4ASV A;  2C9L Y;  2HPC A;  2BCC J;  3TGU J;  2L5G B;  4BRY B;  2PFX A;  1BGY E;  5APS A;  1L4A D;  2ES9 A;  4WB4 A;  3H32 A;  2W6J H;  3CCM P;  3H1L J;  1KC8 Q;  2KYV A;  1RF1 C;  4N3Y B;  2GMY A;  1VKE A;  1MFZ A;  1IFM A;  2JR8 A;  1BDC A;  3U1A A;  3AE3 C;  1R8E A;  4AUW A;  3D71 A;  2ZT9 C;  3MHV A;  2OAR A;  2WZ7 A;  4N78 E;  2HOD B;  3AAA A;  5DJU B;  3M9B A;  1SQB E;  3VMY A;  1SVF A;  2WPR A;  4YXD C;  1YHQ P;  3CCS P;  1PGQ A;  3TNU A;  1OVV A;  2P58 A;  4GOE A;  4WBA A;  3A0H H;  3MZW B;  1M1J A;  1SQX E;  1RQU A;  5KJ7 A;  2JP3 A;  3CD6 P;  3L70 G;  1IFI A;  1Y47 A;  1IK9 A;  3MUD A;  1DX7 A;  1IFN A;  2FFD A;  1AJY A;  4L74 A;  3Q5P A;  1BE3 J;  1NHL A;  1H0T A;  1NAF A;  3B4S A;  1BSN A;  5B5E E;  1BCC D;  2Y9Z A;  2YXQ B;  3L73 G;  1ZME C;  1PGJ A;  1SQQ J;  5GTI E;  1KIL E;  2Q1K A;  1T2K D;  1DEB A;  3OAK A;  1NU1 D;  4HB1 A;  2QE7 H;  1LTS C;  2V7Q J;  3VYI A;  1SS1 A;  2P10 A;  3MTU E;  3AE1 C;  1HUC A;  1UII A;  1LT9 C;  2FBW C;  3VN0 A;  4M3L A;  1JY2 N;  3V2R A;  3V6I A;  1NGM B;  2E76 C;  1L4A A;  2R32 A;  2O3J A;  2Y0D A;  1URQ A;  3GMA A;  1EDJ A;  1VQ5 P;  2J58 A;  1X22 A;  1CW5 A;  2V4H A;  5AW2 B;  3L75 G;  2M3E A;  2AF7 A;  1JNM A;  1LT9 A;  2E75 B;  2P7J A;  4PV1 C;  1Q2N A;  1IFD A;  5BU8 B;  4IL6 H;  3H1K J;  1SQB J;  1T3U A;  1VPC A;  2IFM A;  1JMB A;  3E1R A;  3VP9 A;  2NPS C;  1SFC C;  3D70 A;  2ZYA A;  1J1D B;  2PRR A;  4LC1 A;  3AA0 A;  2QJP B;  2B89 A;  1ME5 A;  1KIL C;  1W5C E;  1YBK A;  4Y99 B;  1IFJ A;  3CXH H;  1N73 C;  2NPS A;  1L0N E;  3O8Z A;  3SFD C;  4XA4 A;  1JOC A;  2D2C B;  5AW9 B;  4OGQ B;  3CWB J;  1DIP A;  2XKM A;  2IZ0 A;  2JKV A;  2B87 B;  2KP8 A;  3AE4 C;  1PFI A;  1KD1 Q;  1K04 A;  1FZA A;  2QG4 A;  2OUW A;  2KSE A;  2BCC G;  1ZR4 A;  2H7H A;  4C7R A;  1PV3 A;  1KQS O;  1PL5 A;  3CCE P;  3LW5 J; 
#chains in the Genus database with same CATH homology
 1KNC A;  2O4D A;  3LK2 A;  3LK4 1;  2JN8 A;  4G9Q A;  5DIP A;  1ME5 A;  3AAA A;  3D7I A;  3AA7 A;  3AAE A;  2KZ7 A;  2IJC A;  2OYO A;  3AA6 A;  3BEY A;  5ADX K;  1GU9 A;  3C1L A;  2GMY A;  2QEU A;  1VKE A;  2Q0T A;  3LVY A;  1LW1 A;  4AKR A;  1P8C A;  2OUW A;  2PFX A;  2CWQ A;  5DIK A;  5AFU K;  2PRR A;  1IZN A;  2AF7 A;  3AA0 A;  2ES9 A;  2KXP A;  3AA1 A;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...