1H3LA

N-terminal fragment of sigr from streptomyces coelicolor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
STAERSARFERDALEFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure of the Anti-Sigma Factor-Binding Domain of the Disulfide-Stress Regulated Sigma Factor Sigma(R) from Streptomyces Coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
molecule keywords RNA POLYMERASE SIGMA FACTOR
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1h3lA00
3ZHZA 2EGHA 3T0YA 4KP7A 1RP3A 1Q0LA 4NQWA 2O7GA 1MW3A 3ANNA 3AUAA 3RASA 3UCQA 1JG9A 2JCYA 3WQQA 5JO0A 4RCVA 3ZHYA 4ZQFA 2Y1CA 5JMWA 1MW0A 1T1SA 2Y1GA 2JCXA 1MVYA 3IIEA 3AU9A 5JBIA 1ONPA 3CZLA 3R0IA 3A14A 1K5HA 1MW2A 4ZQEA 4AICA 5JAZA 3ANLA 2Y1EA 1MW1A 1OR7A 2JD2A 3CZGA 1ONOA 1ZS2A 5JNLA 3AU8A 5DULA 4Y6RA 3ZHXA 4FLSA 4Y67A 1H3LA 3CZEA 2JD1A 1JGIA 3WQRA 5JMPA 2C82A 1R0KA 3A06A 4AYSA 1S46A 4FLOA 4A03A 4CXFA 2MAPA 4ZN6A 4ZQHA 5JC1A 2Y1FA 3UERA 1ONNA 1Q0HA 4Y6PA 3ZI0A 2Y1DA 1T1RA 2JD0A 4FLRA 2MAOA 3UEQA 1G5AA 4GAEA 1Q0QA 4Y6SA 1SC5A 3ANMA 4OOEA 3CZKA 2JCVA 4OOFA 3WQSB 4ZQGA 1JVSA 1R0LA 4FLQA 2WPGA 4LUPA
chains in the Genus database with same CATH superfamily
4XN1A 3ZHZA 3Q43A 2EGHA 2R72A 3T0YA 5HLTA 3FUHA 3FUIA 4XN4A 4AR1A 3FUKA 4KP7A 1RP3A 2DQ6A 4ARFA 1Q0LA 4NQWA 2FFLA 4PW4A 3B37A 3B7TA 1MW3A 2O7GA 2HPOA 3ANNA 3AUAA 3RASA 3UCQA 1JG9A 2PL5A 3B7SA 4GAAA 4XMVA 1GW6A 2JCYA 3WQQA 4ZQTA 2XPYA 4RCVA 3B3BA 4XO5A 5JO0A 3RC8A 3ZHYA 4ZQFA 2Y1CA 3FH7A 2VLAA 5JMWA 1MW0A 1T1SA 4QPEA 3FUJA 2Y1GA 2JCXA 3QJXA 4XMUA 4QUOA 1MVYA 3IIEA 4XNBA 4ZW3A 2XPZA 3FUFA 2RJIA 3AU9A 2VJ8A 5JBIA 4XN5A 1ONPA 3B34A 3CZLA 4ZX5A 3FU3A 3FTXA 3A14A 3R0IA 3FUMA 4BKXA 1K5HA 1MW2A 3EBIA 4QIRA 4ZQEA 4L2LA 4AICA 5BPPA 5JAZA 2WZFA 3ANLA 3CHSA 3HW2A 2Y1EA 1MW1A 3U9WA 1OR7A 3FU0A 4ZX6A 3B7RL 4AR8A 2JD2A 3CZGA 4XN2A 1HS6A 1ONOA 1ZS2A 3CXBA 3AU8A 3FTSA 4K5PA 5JNLA 5DULA 4QHPA 4XO3A 1H19A 4Y6RA 4R5XA 2R59A 3ZHXA 4J3BA 5FWQA 3B2XA 4XN8A 4CXFA 3EBHA 3FTVA 4XMXA 4FLSA 4Y67A 4K5NA 1H3LA 3T8VA 3FTWA 4XN9A 1X3ZA 3CZEA 4XNDA 5AENA 3FH5A 5HNHA 5HNFA 2PUSA 2QVWA 2JD1A 1JGIA 3WQRA 5JMPA 4R5VA 3RC3A 2C82A 4ZX3A 1R0KA 4AR9A 3A06A 3FULA 4AYSA 4PVBA 1S46A 4FLOA 3FTZA 4K5OA 4R7LA 4QMEA 2C5ZA 4Q4IA 3PUUA 4RVBA 2QJ1A 4XMWA 4A03A 3FTYA 3FUNA 3FUDA 3CIAA 2R70A 3JSZA 2JV7A 4X2UA 4MKTA 2MAPA 3B7UX 4ZN6A 4ZQHA 5DLLA 5JC1A 2Y1FA 3UERA 4DPRA 1ONNA 3EBGA 4ZX4A 1Q0HA 3CHPA 1SG7A 2A7OA 3Q44A 4Y6PA 4K5MA 2ZXGA 4XN7A 2Y1DA 3VVMA 3ZI0A 2PGGA 2WZGA 3FU5A 4R5TA 1T1RA 2JD0A 4FLRA 4JNDA 4XNAA 4ZW7A 2MAOA 4MS6A 2HPTA 2DQMA 1SQMA 4Q4EA 3UEQA 3FH8A 4ZW8A 1G5AA 4GAEA 3CHRA 1Q0QA 2B61A 4Y6SA 4K5LA 4XMTA 4XMZA 3CHOA 1SC5A 4ZW5A 2GTQA 2XQ0A 3ANMA 3VVLA 4OOEA 3CZKA 2JCVA 4OOFA 3WQSB 3FTUA 4XO4A 4RSYA 5EV7A 4ZQGA 1JVSA 3JT1A 5DYFA 1X3WA 3FU6A 3B2PA 3CHQA 4ZW6A 1R0LA 4FLQA 2WPGA 4FCAA 3KEDA 3FHEA 4LUPA 3FUEA 4PU2A
chains in the Genus database with same CATH topology
4XN1A 3ZHZA 3Q43A 2EGHA 2R72A 3T0YA 5HLTA 3FUHA 3FUIA 4XN4A 4AR1A 3FUKA 4KP7A 1RP3A 2DQ6A 4ARFA 1Q0LA 4NQWA 2FFLA 4PW4A 3B37A 3B7TA 1MW3A 2O7GA 2HPOA 3ANNA 3AUAA 3RASA 3UCQA 1JG9A 2PL5A 3B7SA 4GAAA 4XMVA 1GW6A 2JCYA 3WQQA 4ZQTA 2XPYA 4RCVA 3B3BA 4XO5A 5JO0A 3RC8A 3ZHYA 4ZQFA 2Y1CA 3FH7A 2VLAA 5JMWA 1MW0A 1T1SA 4QPEA 3FUJA 2Y1GA 2JCXA 3QJXA 4XMUA 4QUOA 1MVYA 3IIEA 4XNBA 4ZW3A 2XPZA 3FUFA 2RJIA 3AU9A 2VJ8A 5JBIA 4XN5A 1ONPA 3B34A 3CZLA 4ZX5A 3FU3A 3FTXA 3A14A 3R0IA 3FUMA 4BKXA 1K5HA 1MW2A 3EBIA 4QIRA 4ZQEA 4L2LA 4AICA 5BPPA 5JAZA 2WZFA 3ANLA 3CHSA 2Y1EA 1MW1A 3U9WA 1OR7A 3FU0A 4ZX6A 3B7RL 4AR8A 2JD2A 3CZGA 4XN2A 1HS6A 1ONOA 1ZS2A 3FTSA 3AU8A 4K5PA 5JNLA 5DULA 4QHPA 4XO3A 1H19A 4Y6RA 4R5XA 2R59A 3ZHXA 4J3BA 5FWQA 3B2XA 4XN8A 4CXFA 3EBHA 3FTVA 4XMXA 4FLSA 4Y67A 4K5NA 1H3LA 3T8VA 3FTWA 4XN9A 1X3ZA 3CZEA 4XNDA 5AENA 3FH5A 5HNHA 5HNFA 2PUSA 2QVWA 2JD1A 1JGIA 3WQRA 5JMPA 4R5VA 3RC3A 2C82A 4ZX3A 1R0KA 4AR9A 3A06A 3FULA 4AYSA 4PVBA 1S46A 4FLOA 3FTZA 4K5OA 4R7LA 4QMEA 2C5ZA 4Q4IA 3PUUA 4RVBA 2QJ1A 4XMWA 4A03A 3FTYA 3FUNA 3FUDA 3CIAA 2R70A 3JSZA 2JV7A 4X2UA 4MKTA 2MAPA 3B7UX 4ZN6A 4ZQHA 5DLLA 5JC1A 2Y1FA 3UERA 4DPRA 1ONNA 3EBGA 4ZX4A 1Q0HA 3CHPA 1SG7A 2A7OA 3Q44A 4Y6PA 4K5MA 2ZXGA 4XN7A 2Y1DA 3VVMA 3ZI0A 2PGGA 2WZGA 3FU5A 4R5TA 1T1RA 2JD0A 4FLRA 4JNDA 4XNAA 4ZW7A 2MAOA 4MS6A 2HPTA 2DQMA 1SQMA 4Q4EA 3UEQA 3FH8A 4ZW8A 1G5AA 4GAEA 3CHRA 1Q0QA 2B61A 4Y6SA 4K5LA 4XMTA 4XMZA 3CHOA 1SC5A 4ZW5A 2GTQA 2XQ0A 3ANMA 3VVLA 4OOEA 3CZKA 2JCVA 4OOFA 3WQSB 3FTUA 4XO4A 4RSYA 5EV7A 4ZQGA 1JVSA 3JT1A 5DYFA 1X3WA 3FU6A 3B2PA 3CHQA 4ZW6A 1R0LA 4FLQA 2WPGA 4FCAA 3KEDA 3FHEA 4LUPA 3FUEA 4PU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHZ A;  2EGH A;  3T0Y A;  4KP7 A;  1RP3 A;  1Q0L A;  4NQW A;  2O7G A;  1MW3 A;  3ANN A;  3AUA A;  3RAS A;  3UCQ A;  1JG9 A;  2JCY A;  3WQQ A;  5JO0 A;  4RCV A;  3ZHY A;  4ZQF A;  2Y1C A;  5JMW A;  1MW0 A;  1T1S A;  2Y1G A;  2JCX A;  1MVY A;  3IIE A;  3AU9 A;  5JBI A;  1ONP A;  3CZL A;  3R0I A;  3A14 A;  1K5H A;  1MW2 A;  4ZQE A;  4AIC A;  5JAZ A;  3ANL A;  2Y1E A;  1MW1 A;  1OR7 A;  2JD2 A;  3CZG A;  1ONO A;  1ZS2 A;  5JNL A;  3AU8 A;  5DUL A;  4Y6R A;  3ZHX A;  4FLS A;  4Y67 A;  1H3L A;  3CZE A;  2JD1 A;  1JGI A;  3WQR A;  5JMP A;  2C82 A;  1R0K A;  3A06 A;  4AYS A;  1S46 A;  4FLO A;  4A03 A;  4CXF A;  2MAP A;  4ZN6 A;  4ZQH A;  5JC1 A;  2Y1F A;  3UER A;  1ONN A;  1Q0H A;  4Y6P A;  3ZI0 A;  2Y1D A;  1T1R A;  2JD0 A;  4FLR A;  2MAO A;  3UEQ A;  1G5A A;  4GAE A;  1Q0Q A;  4Y6S A;  1SC5 A;  3ANM A;  4OOE A;  3CZK A;  2JCV A;  4OOF A;  3WQS B;  4ZQG A;  1JVS A;  1R0L A;  4FLQ A;  2WPG A;  4LUP A; 
#chains in the Genus database with same CATH topology
 4XN1 A;  3ZHZ A;  3Q43 A;  2EGH A;  2R72 A;  3T0Y A;  5HLT A;  3FUH A;  3FUI A;  4XN4 A;  4AR1 A;  3FUK A;  4KP7 A;  1RP3 A;  2DQ6 A;  4ARF A;  1Q0L A;  4NQW A;  2FFL A;  4PW4 A;  3B37 A;  3B7T A;  1MW3 A;  2O7G A;  2HPO A;  3ANN A;  3AUA A;  3RAS A;  3UCQ A;  1JG9 A;  2PL5 A;  3B7S A;  4GAA A;  4XMV A;  1GW6 A;  2JCY A;  3WQQ A;  4ZQT A;  2XPY A;  4RCV A;  3B3B A;  4XO5 A;  5JO0 A;  3RC8 A;  3ZHY A;  4ZQF A;  2Y1C A;  3FH7 A;  2VLA A;  5JMW A;  1MW0 A;  1T1S A;  4QPE A;  3FUJ A;  2Y1G A;  2JCX A;  3QJX A;  4XMU A;  4QUO A;  1MVY A;  3IIE A;  4XNB A;  4ZW3 A;  2XPZ A;  3FUF A;  2RJI A;  3AU9 A;  2VJ8 A;  5JBI A;  4XN5 A;  1ONP A;  3B34 A;  3CZL A;  4ZX5 A;  3FU3 A;  3FTX A;  3A14 A;  3R0I A;  3FUM A;  4BKX A;  1K5H A;  1MW2 A;  3EBI A;  4QIR A;  4ZQE A;  4L2L A;  4AIC A;  5BPP A;  5JAZ A;  2WZF A;  3ANL A;  3CHS A;  3HW2 A;  2Y1E A;  1MW1 A;  3U9W A;  1OR7 A;  3FU0 A;  4ZX6 A;  3B7R L;  4AR8 A;  2JD2 A;  3CZG A;  4XN2 A;  1HS6 A;  1ONO A;  1ZS2 A;  3CXB A;  3AU8 A;  3FTS A;  4K5P A;  5JNL A;  5DUL A;  4QHP A;  4XO3 A;  1H19 A;  4Y6R A;  4R5X A;  2R59 A;  3ZHX A;  4J3B A;  5FWQ A;  3B2X A;  4XN8 A;  4CXF A;  3EBH A;  3FTV A;  4XMX A;  4FLS A;  4Y67 A;  4K5N A;  1H3L A;  3T8V A;  3FTW A;  4XN9 A;  1X3Z A;  3CZE A;  4XND A;  5AEN A;  3FH5 A;  5HNH A;  5HNF A;  2PUS A;  2QVW A;  2JD1 A;  1JGI A;  3WQR A;  5JMP A;  4R5V A;  3RC3 A;  2C82 A;  4ZX3 A;  1R0K A;  4AR9 A;  3A06 A;  3FUL A;  4AYS A;  4PVB A;  1S46 A;  4FLO A;  3FTZ A;  4K5O A;  4R7L A;  4QME A;  2C5Z A;  4Q4I A;  3PUU A;  4RVB A;  2QJ1 A;  4XMW A;  4A03 A;  3FTY A;  3FUN A;  3FUD A;  3CIA A;  2R70 A;  3JSZ A;  2JV7 A;  4X2U A;  4MKT A;  2MAP A;  3B7U X;  4ZN6 A;  4ZQH A;  5DLL A;  5JC1 A;  2Y1F A;  3UER A;  4DPR A;  1ONN A;  3EBG A;  4ZX4 A;  1Q0H A;  3CHP A;  1SG7 A;  2A7O A;  3Q44 A;  4Y6P A;  4K5M A;  2ZXG A;  4XN7 A;  2Y1D A;  3VVM A;  3ZI0 A;  2PGG A;  2WZG A;  3FU5 A;  4R5T A;  1T1R A;  2JD0 A;  4FLR A;  4JND A;  4XNA A;  4ZW7 A;  2MAO A;  4MS6 A;  2HPT A;  2DQM A;  1SQM A;  4Q4E A;  3UEQ A;  3FH8 A;  4ZW8 A;  1G5A A;  4GAE A;  3CHR A;  1Q0Q A;  2B61 A;  4Y6S A;  4K5L A;  4XMT A;  4XMZ A;  3CHO A;  1SC5 A;  4ZW5 A;  2GTQ A;  2XQ0 A;  3ANM A;  3VVL A;  4OOE A;  3CZK A;  2JCV A;  4OOF A;  3WQS B;  3FTU A;  4XO4 A;  4RSY A;  5EV7 A;  4ZQG A;  1JVS A;  3JT1 A;  5DYF A;  1X3W A;  3FU6 A;  3B2P A;  3CHQ A;  4ZW6 A;  1R0L A;  4FLQ A;  2WPG A;  4FCA A;  3KED A;  3FHE A;  4LUP A;  3FUE A;  4PU2 A; 
#chains in the Genus database with same CATH homology
 4XN1 A;  3ZHZ A;  3Q43 A;  2EGH A;  2R72 A;  3T0Y A;  5HLT A;  3FUH A;  3FUI A;  4XN4 A;  4AR1 A;  3FUK A;  4KP7 A;  1RP3 A;  2DQ6 A;  4ARF A;  1Q0L A;  4NQW A;  2FFL A;  4PW4 A;  3B37 A;  3B7T A;  1MW3 A;  2O7G A;  2HPO A;  3ANN A;  3AUA A;  3RAS A;  3UCQ A;  1JG9 A;  2PL5 A;  3B7S A;  4GAA A;  4XMV A;  1GW6 A;  2JCY A;  3WQQ A;  4ZQT A;  2XPY A;  4RCV A;  3B3B A;  4XO5 A;  5JO0 A;  3RC8 A;  3ZHY A;  4ZQF A;  2Y1C A;  3FH7 A;  2VLA A;  5JMW A;  1MW0 A;  1T1S A;  4QPE A;  3FUJ A;  2Y1G A;  2JCX A;  3QJX A;  4XMU A;  4QUO A;  1MVY A;  3IIE A;  4XNB A;  4ZW3 A;  2XPZ A;  3FUF A;  2RJI A;  3AU9 A;  2VJ8 A;  5JBI A;  4XN5 A;  1ONP A;  3B34 A;  3CZL A;  4ZX5 A;  3FU3 A;  3FTX A;  3A14 A;  3R0I A;  3FUM A;  4BKX A;  1K5H A;  1MW2 A;  3EBI A;  4QIR A;  4ZQE A;  4L2L A;  4AIC A;  5BPP A;  5JAZ A;  2WZF A;  3ANL A;  3CHS A;  2Y1E A;  1MW1 A;  3U9W A;  1OR7 A;  3FU0 A;  4ZX6 A;  3B7R L;  4AR8 A;  2JD2 A;  3CZG A;  4XN2 A;  1HS6 A;  1ONO A;  1ZS2 A;  3FTS A;  3AU8 A;  4K5P A;  5JNL A;  5DUL A;  4QHP A;  4XO3 A;  1H19 A;  4Y6R A;  4R5X A;  2R59 A;  3ZHX A;  4J3B A;  5FWQ A;  3B2X A;  4XN8 A;  4CXF A;  3EBH A;  3FTV A;  4XMX A;  4FLS A;  4Y67 A;  4K5N A;  1H3L A;  3T8V A;  3FTW A;  4XN9 A;  1X3Z A;  3CZE A;  4XND A;  5AEN A;  3FH5 A;  5HNH A;  5HNF A;  2PUS A;  2QVW A;  2JD1 A;  1JGI A;  3WQR A;  5JMP A;  4R5V A;  3RC3 A;  2C82 A;  4ZX3 A;  1R0K A;  4AR9 A;  3A06 A;  3FUL A;  4AYS A;  4PVB A;  1S46 A;  4FLO A;  3FTZ A;  4K5O A;  4R7L A;  4QME A;  2C5Z A;  4Q4I A;  3PUU A;  4RVB A;  2QJ1 A;  4XMW A;  4A03 A;  3FTY A;  3FUN A;  3FUD A;  3CIA A;  2R70 A;  3JSZ A;  2JV7 A;  4X2U A;  4MKT A;  2MAP A;  3B7U X;  4ZN6 A;  4ZQH A;  5DLL A;  5JC1 A;  2Y1F A;  3UER A;  4DPR A;  1ONN A;  3EBG A;  4ZX4 A;  1Q0H A;  3CHP A;  1SG7 A;  2A7O A;  3Q44 A;  4Y6P A;  4K5M A;  2ZXG A;  4XN7 A;  2Y1D A;  3VVM A;  3ZI0 A;  2PGG A;  2WZG A;  3FU5 A;  4R5T A;  1T1R A;  2JD0 A;  4FLR A;  4JND A;  4XNA A;  4ZW7 A;  2MAO A;  4MS6 A;  2HPT A;  2DQM A;  1SQM A;  4Q4E A;  3UEQ A;  3FH8 A;  4ZW8 A;  1G5A A;  4GAE A;  3CHR A;  1Q0Q A;  2B61 A;  4Y6S A;  4K5L A;  4XMT A;  4XMZ A;  3CHO A;  1SC5 A;  4ZW5 A;  2GTQ A;  2XQ0 A;  3ANM A;  3VVL A;  4OOE A;  3CZK A;  2JCV A;  4OOF A;  3WQS B;  3FTU A;  4XO4 A;  4RSY A;  5EV7 A;  4ZQG A;  1JVS A;  3JT1 A;  5DYF A;  1X3W A;  3FU6 A;  3B2P A;  3CHQ A;  4ZW6 A;  1R0L A;  4FLQ A;  2WPG A;  4FCA A;  3KED A;  3FHE A;  4LUP A;  3FUE A;  4PU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...