1H3LA

N-terminal fragment of sigr from streptomyces coelicolor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
STAERSARFERDALEFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure of the Anti-Sigma Factor-Binding Domain of the Disulfide-Stress Regulated Sigma Factor Sigma(R) from Streptomyces Coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
molecule keywords RNA POLYMERASE SIGMA FACTOR
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1h3lA00
2MAOA 3ANLA 3IIEA 3UERA 2C82A 2Y1GA 1Q0LA 4OOEA 4Y6RA 1ONOA 1MVYA 4LUPA 1MW1A 1R0KA 2JCVA 4FLOA 1K5HA 3WQSB 1Q0HA 4Y6PA 4ZQEA 2JD2A 3A14A 3ANNA 4RCVA 5JAZA 2Y1DA 3R0IA 1JG9A 2JD0A 2Y1CA 3ZHYA 4FLQA 3RASA 3ZHXA 2JCXA 1ONPA 2JCYA 4AICA 1Q0QA 1SC5A 3T0YA 3ZHZA 5JMWA 4NQWA 2WPGA 3ZI0A 2Y1FA 2O7GA 3CZEA 5JNLA 1H3LA 2JD1A 3UCQA 3CZKA 1MW2A 4ZN6A 3AU9A 1ONNA 1T1SA 1MW3A 1ZS2A 4KP7A 3WQRA 1RP3A 1OR7A 3CZLA 4ZQGA 3AU8A 4A03A 3WQQA 2MAPA 4Y67A 4ZQFA 4AYSA 1S46A 1MW0A 4GAEA 5DULA 3CZGA 5JMPA 1T1RA 3ANMA 4FLSA 5JO0A 4FLRA 1R0LA 3A06A 2EGHA 1JGIA 5JC1A 4OOFA 4CXFA 1G5AA 3AUAA 1JVSA 5JBIA 4Y6SA 3UEQA 2Y1EA 4ZQHA
chains in the Genus database with same CATH superfamily
2MAOA 3B7UX 3ANLA 3FULA 1H19A 3IIEA 4XO3A 4QHPA 4K5OA 2FFLA 4ZW3A 4R5XA 3UERA 2XPZA 2C82A 2WZGA 3QJXA 2Y1GA 1HS6A 2WZFA 4X2UA 4XN1A 4K5PA 3FTUA 1Q0LA 4Q4IA 5HNHA 4ZW5A 3FTWA 4OOEA 4Y6RA 2DQ6A 5HLTA 1ONOA 1MVYA 4MS6A 2XPYA 4RVBA 4XNAA 3EBHA 4BKXA 4LUPA 4XN4A 4ARFA 1MW1A 1R0KA 2JCVA 3FUHA 3VVMA 4FLOA 1K5HA 3WQSB 3FUNA 4K5MA 1Q0HA 4QIRA 2R70A 3FU3A 4Y6PA 5AENA 4ZQEA 2JD2A 4K5LA 4PVBA 3A14A 3ANNA 4RCVA 4R7LA 5JAZA 4L2LA 2Y1DA 4ZQTA 2DQMA 3VVLA 3R0IA 3FUFA 4XMXA 1JG9A 2JD0A 2Y1CA 4ZW6A 4XN9A 3FU5A 3ZHYA 4XNDA 4ZX3A 4FLQA 3FUMA 2HPOA 4MKTA 3RASA 3RC3A 3ZHXA 4AR1A 4GAAA 3U9WA 3CIAA 3KEDA 5DLLA 2JCXA 1ONPA 3B34A 2JCYA 4QUOA 2PGGA 3EBIA 2QJ1A 4ZX5A 3FTYA 4AR8A 4AICA 2VJ8A 2R59A 1Q0QA 3CHPA 1SC5A 4XO5A 4ZX6A 2HPTA 3T0YA 4XMVA 3ZHZA 5JMWA 3B2XA 4NQWA 4XNBA 2R72A 2WPGA 4XN8A 3ZI0A 2B61A 3CHQA 4PU2A 2VLAA 3T8VA 2Y1FA 2O7GA 3FH5A 4K5NA 2ZXGA 1X3ZA 3B3BA 3CZEA 4PW4A 5JNLA 2PL5A 4XO4A 1H3LA 4RSYA 3FHEA 1SQMA 3FUEA 3B2PA 3RC8A 3FH8A 2JD1A 3CHOA 2PUSA 4XN7A 3B7TA 4XMUA 3UCQA 3FUDA 2A7OA 3CZKA 4Q4EA 5DYFA 4XN2A 1MW2A 4XN5A 4ZN6A 3FUIA 3FUKA 2RJIA 3PUUA 3Q44A 4JNDA 3B37A 3FH7A 3AU9A 1ONNA 2QVWA 4FCAA 1T1SA 4ZW7A 1MW3A 1ZS2A 3FTSA 4KP7A 4QPEA 3WQRA 1RP3A 1OR7A 1SG7A 3CZLA 3JSZA 4ZQGA 4DPRA 3AU8A 4A03A 3WQQA 2MAPA 4Y67A 4R5TA 3HW2A 3B7SA 2GTQA 4ZQFA 4AYSA 3CHRA 1S46A 3FU0A 1MW0A 4XMZA 4GAEA 4XMTA 3CHSA 5DULA 3CZGA 3B7RL 3FU6A 5JMPA 4R5VA 1T1RA 3ANMA 4FLSA 3EBGA 3FTVA 5JO0A 4FLRA 3CXBA 1GW6A 2XQ0A 1R0LA 3A06A 3Q43A 2EGHA 3FTZA 1JGIA 4ZX4A 5JC1A 2C5ZA 4OOFA 1X3WA 4XMWA 5BPPA 5FWQA 5HNFA 4ZW8A 4CXFA 1G5AA 3AUAA 4AR9A 4QMEA 3JT1A 4J3BA 1JVSA 3FTXA 3FUJA 5JBIA 4Y6SA 5EV7A 3UEQA 2Y1EA 4ZQHA 2JV7A
chains in the Genus database with same CATH topology
2MAOA 3B7UX 3ANLA 3FULA 1H19A 3IIEA 4XO3A 4QHPA 4K5OA 2FFLA 4ZW3A 4R5XA 3UERA 2XPZA 2C82A 2WZGA 3QJXA 2Y1GA 1HS6A 2WZFA 4X2UA 4XN1A 4K5PA 3FTUA 1Q0LA 4Q4IA 5HNHA 4ZW5A 3FTWA 4OOEA 4Y6RA 2DQ6A 5HLTA 1ONOA 1MVYA 4MS6A 2XPYA 4RVBA 4XNAA 3EBHA 4BKXA 4LUPA 4XN4A 4ARFA 1MW1A 1R0KA 2JCVA 3FUHA 3VVMA 4FLOA 1K5HA 3WQSB 3FUNA 4K5MA 1Q0HA 4QIRA 2R70A 3FU3A 4Y6PA 5AENA 4ZQEA 2JD2A 4K5LA 4PVBA 3A14A 3ANNA 4RCVA 4R7LA 5JAZA 4L2LA 2Y1DA 4ZQTA 2DQMA 3VVLA 3R0IA 3FUFA 4XMXA 1JG9A 2JD0A 2Y1CA 4ZW6A 4XN9A 3FU5A 3ZHYA 4XNDA 4ZX3A 4FLQA 3FUMA 2HPOA 4MKTA 3RASA 3RC3A 3ZHXA 4AR1A 4GAAA 3U9WA 3CIAA 3KEDA 5DLLA 2JCXA 1ONPA 3B34A 2JCYA 4QUOA 2PGGA 3EBIA 2QJ1A 4ZX5A 3FTYA 4AR8A 4AICA 2VJ8A 2R59A 1Q0QA 3CHPA 1SC5A 4XO5A 4ZX6A 2HPTA 3T0YA 4XMVA 3ZHZA 5JMWA 3B2XA 4NQWA 4XNBA 2R72A 2WPGA 4XN8A 3ZI0A 2B61A 3CHQA 4PU2A 2VLAA 3T8VA 2Y1FA 2O7GA 3FH5A 4K5NA 2ZXGA 1X3ZA 3B3BA 3CZEA 4PW4A 5JNLA 2PL5A 4XO4A 1H3LA 4RSYA 3FHEA 1SQMA 3FUEA 3B2PA 3RC8A 3FH8A 2JD1A 3CHOA 2PUSA 4XN7A 3B7TA 4XMUA 3UCQA 3FUDA 2A7OA 3CZKA 4Q4EA 5DYFA 4XN2A 1MW2A 4XN5A 4ZN6A 3FUIA 3FUKA 2RJIA 3PUUA 3Q44A 4JNDA 3B37A 3FH7A 3AU9A 1ONNA 2QVWA 4FCAA 1T1SA 4ZW7A 1MW3A 1ZS2A 3FTSA 4KP7A 4QPEA 3WQRA 1RP3A 1OR7A 1SG7A 3CZLA 3JSZA 4ZQGA 4DPRA 3AU8A 4A03A 3WQQA 2MAPA 4Y67A 4R5TA 3B7SA 2GTQA 4ZQFA 4AYSA 3CHRA 1S46A 3FU0A 1MW0A 4XMZA 4GAEA 4XMTA 3CHSA 5DULA 3CZGA 3B7RL 3FU6A 5JMPA 4R5VA 1T1RA 3ANMA 4FLSA 3EBGA 3FTVA 5JO0A 4FLRA 1GW6A 2XQ0A 1R0LA 3A06A 3Q43A 2EGHA 3FTZA 1JGIA 4ZX4A 5JC1A 2C5ZA 4OOFA 1X3WA 4XMWA 5BPPA 5FWQA 5HNFA 4ZW8A 4CXFA 1G5AA 3AUAA 4AR9A 4QMEA 3JT1A 4J3BA 1JVSA 3FTXA 3FUJA 5JBIA 4Y6SA 5EV7A 3UEQA 2Y1EA 4ZQHA 2JV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAO A;  3ANL A;  3IIE A;  3UER A;  2C82 A;  2Y1G A;  1Q0L A;  4OOE A;  4Y6R A;  1ONO A;  1MVY A;  4LUP A;  1MW1 A;  1R0K A;  2JCV A;  4FLO A;  1K5H A;  3WQS B;  1Q0H A;  4Y6P A;  4ZQE A;  2JD2 A;  3A14 A;  3ANN A;  4RCV A;  5JAZ A;  2Y1D A;  3R0I A;  1JG9 A;  2JD0 A;  2Y1C A;  3ZHY A;  4FLQ A;  3RAS A;  3ZHX A;  2JCX A;  1ONP A;  2JCY A;  4AIC A;  1Q0Q A;  1SC5 A;  3T0Y A;  3ZHZ A;  5JMW A;  4NQW A;  2WPG A;  3ZI0 A;  2Y1F A;  2O7G A;  3CZE A;  5JNL A;  1H3L A;  2JD1 A;  3UCQ A;  3CZK A;  1MW2 A;  4ZN6 A;  3AU9 A;  1ONN A;  1T1S A;  1MW3 A;  1ZS2 A;  4KP7 A;  3WQR A;  1RP3 A;  1OR7 A;  3CZL A;  4ZQG A;  3AU8 A;  4A03 A;  3WQQ A;  2MAP A;  4Y67 A;  4ZQF A;  4AYS A;  1S46 A;  1MW0 A;  4GAE A;  5DUL A;  3CZG A;  5JMP A;  1T1R A;  3ANM A;  4FLS A;  5JO0 A;  4FLR A;  1R0L A;  3A06 A;  2EGH A;  1JGI A;  5JC1 A;  4OOF A;  4CXF A;  1G5A A;  3AUA A;  1JVS A;  5JBI A;  4Y6S A;  3UEQ A;  2Y1E A;  4ZQH A; 
#chains in the Genus database with same CATH topology
 2MAO A;  3B7U X;  3ANL A;  3FUL A;  1H19 A;  3IIE A;  4XO3 A;  4QHP A;  4K5O A;  2FFL A;  4ZW3 A;  4R5X A;  3UER A;  2XPZ A;  2C82 A;  2WZG A;  3QJX A;  2Y1G A;  1HS6 A;  2WZF A;  4X2U A;  4XN1 A;  4K5P A;  3FTU A;  1Q0L A;  4Q4I A;  5HNH A;  4ZW5 A;  3FTW A;  4OOE A;  4Y6R A;  2DQ6 A;  5HLT A;  1ONO A;  1MVY A;  4MS6 A;  2XPY A;  4RVB A;  4XNA A;  3EBH A;  4BKX A;  4LUP A;  4XN4 A;  4ARF A;  1MW1 A;  1R0K A;  2JCV A;  3FUH A;  3VVM A;  4FLO A;  1K5H A;  3WQS B;  3FUN A;  4K5M A;  1Q0H A;  4QIR A;  2R70 A;  3FU3 A;  4Y6P A;  5AEN A;  4ZQE A;  2JD2 A;  4K5L A;  4PVB A;  3A14 A;  3ANN A;  4RCV A;  4R7L A;  5JAZ A;  4L2L A;  2Y1D A;  4ZQT A;  2DQM A;  3VVL A;  3R0I A;  3FUF A;  4XMX A;  1JG9 A;  2JD0 A;  2Y1C A;  4ZW6 A;  4XN9 A;  3FU5 A;  3ZHY A;  4XND A;  4ZX3 A;  4FLQ A;  3FUM A;  2HPO A;  4MKT A;  3RAS A;  3RC3 A;  3ZHX A;  4AR1 A;  4GAA A;  3U9W A;  3CIA A;  3KED A;  5DLL A;  2JCX A;  1ONP A;  3B34 A;  2JCY A;  4QUO A;  2PGG A;  3EBI A;  2QJ1 A;  4ZX5 A;  3FTY A;  4AR8 A;  4AIC A;  2VJ8 A;  2R59 A;  1Q0Q A;  3CHP A;  1SC5 A;  4XO5 A;  4ZX6 A;  2HPT A;  3T0Y A;  4XMV A;  3ZHZ A;  5JMW A;  3B2X A;  4NQW A;  4XNB A;  2R72 A;  2WPG A;  4XN8 A;  3ZI0 A;  2B61 A;  3CHQ A;  4PU2 A;  2VLA A;  3T8V A;  2Y1F A;  2O7G A;  3FH5 A;  4K5N A;  2ZXG A;  1X3Z A;  3B3B A;  3CZE A;  4PW4 A;  5JNL A;  2PL5 A;  4XO4 A;  1H3L A;  4RSY A;  3FHE A;  1SQM A;  3FUE A;  3B2P A;  3RC8 A;  3FH8 A;  2JD1 A;  3CHO A;  2PUS A;  4XN7 A;  3B7T A;  4XMU A;  3UCQ A;  3FUD A;  2A7O A;  3CZK A;  4Q4E A;  5DYF A;  4XN2 A;  1MW2 A;  4XN5 A;  4ZN6 A;  3FUI A;  3FUK A;  2RJI A;  3PUU A;  3Q44 A;  4JND A;  3B37 A;  3FH7 A;  3AU9 A;  1ONN A;  2QVW A;  4FCA A;  1T1S A;  4ZW7 A;  1MW3 A;  1ZS2 A;  3FTS A;  4KP7 A;  4QPE A;  3WQR A;  1RP3 A;  1OR7 A;  1SG7 A;  3CZL A;  3JSZ A;  4ZQG A;  4DPR A;  3AU8 A;  4A03 A;  3WQQ A;  2MAP A;  4Y67 A;  4R5T A;  3HW2 A;  3B7S A;  2GTQ A;  4ZQF A;  4AYS A;  3CHR A;  1S46 A;  3FU0 A;  1MW0 A;  4XMZ A;  4GAE A;  4XMT A;  3CHS A;  5DUL A;  3CZG A;  3B7R L;  3FU6 A;  5JMP A;  4R5V A;  1T1R A;  3ANM A;  4FLS A;  3EBG A;  3FTV A;  5JO0 A;  4FLR A;  3CXB A;  1GW6 A;  2XQ0 A;  1R0L A;  3A06 A;  3Q43 A;  2EGH A;  3FTZ A;  1JGI A;  4ZX4 A;  5JC1 A;  2C5Z A;  4OOF A;  1X3W A;  4XMW A;  5BPP A;  5FWQ A;  5HNF A;  4ZW8 A;  4CXF A;  1G5A A;  3AUA A;  4AR9 A;  4QME A;  3JT1 A;  4J3B A;  1JVS A;  3FTX A;  3FUJ A;  5JBI A;  4Y6S A;  5EV7 A;  3UEQ A;  2Y1E A;  4ZQH A;  2JV7 A; 
#chains in the Genus database with same CATH homology
 2MAO A;  3B7U X;  3ANL A;  3FUL A;  1H19 A;  3IIE A;  4XO3 A;  4QHP A;  4K5O A;  2FFL A;  4ZW3 A;  4R5X A;  3UER A;  2XPZ A;  2C82 A;  2WZG A;  3QJX A;  2Y1G A;  1HS6 A;  2WZF A;  4X2U A;  4XN1 A;  4K5P A;  3FTU A;  1Q0L A;  4Q4I A;  5HNH A;  4ZW5 A;  3FTW A;  4OOE A;  4Y6R A;  2DQ6 A;  5HLT A;  1ONO A;  1MVY A;  4MS6 A;  2XPY A;  4RVB A;  4XNA A;  3EBH A;  4BKX A;  4LUP A;  4XN4 A;  4ARF A;  1MW1 A;  1R0K A;  2JCV A;  3FUH A;  3VVM A;  4FLO A;  1K5H A;  3WQS B;  3FUN A;  4K5M A;  1Q0H A;  4QIR A;  2R70 A;  3FU3 A;  4Y6P A;  5AEN A;  4ZQE A;  2JD2 A;  4K5L A;  4PVB A;  3A14 A;  3ANN A;  4RCV A;  4R7L A;  5JAZ A;  4L2L A;  2Y1D A;  4ZQT A;  2DQM A;  3VVL A;  3R0I A;  3FUF A;  4XMX A;  1JG9 A;  2JD0 A;  2Y1C A;  4ZW6 A;  4XN9 A;  3FU5 A;  3ZHY A;  4XND A;  4ZX3 A;  4FLQ A;  3FUM A;  2HPO A;  4MKT A;  3RAS A;  3RC3 A;  3ZHX A;  4AR1 A;  4GAA A;  3U9W A;  3CIA A;  3KED A;  5DLL A;  2JCX A;  1ONP A;  3B34 A;  2JCY A;  4QUO A;  2PGG A;  3EBI A;  2QJ1 A;  4ZX5 A;  3FTY A;  4AR8 A;  4AIC A;  2VJ8 A;  2R59 A;  1Q0Q A;  3CHP A;  1SC5 A;  4XO5 A;  4ZX6 A;  2HPT A;  3T0Y A;  4XMV A;  3ZHZ A;  5JMW A;  3B2X A;  4NQW A;  4XNB A;  2R72 A;  2WPG A;  4XN8 A;  3ZI0 A;  2B61 A;  3CHQ A;  4PU2 A;  2VLA A;  3T8V A;  2Y1F A;  2O7G A;  3FH5 A;  4K5N A;  2ZXG A;  1X3Z A;  3B3B A;  3CZE A;  4PW4 A;  5JNL A;  2PL5 A;  4XO4 A;  1H3L A;  4RSY A;  3FHE A;  1SQM A;  3FUE A;  3B2P A;  3RC8 A;  3FH8 A;  2JD1 A;  3CHO A;  2PUS A;  4XN7 A;  3B7T A;  4XMU A;  3UCQ A;  3FUD A;  2A7O A;  3CZK A;  4Q4E A;  5DYF A;  4XN2 A;  1MW2 A;  4XN5 A;  4ZN6 A;  3FUI A;  3FUK A;  2RJI A;  3PUU A;  3Q44 A;  4JND A;  3B37 A;  3FH7 A;  3AU9 A;  1ONN A;  2QVW A;  4FCA A;  1T1S A;  4ZW7 A;  1MW3 A;  1ZS2 A;  3FTS A;  4KP7 A;  4QPE A;  3WQR A;  1RP3 A;  1OR7 A;  1SG7 A;  3CZL A;  3JSZ A;  4ZQG A;  4DPR A;  3AU8 A;  4A03 A;  3WQQ A;  2MAP A;  4Y67 A;  4R5T A;  3B7S A;  2GTQ A;  4ZQF A;  4AYS A;  3CHR A;  1S46 A;  3FU0 A;  1MW0 A;  4XMZ A;  4GAE A;  4XMT A;  3CHS A;  5DUL A;  3CZG A;  3B7R L;  3FU6 A;  5JMP A;  4R5V A;  1T1R A;  3ANM A;  4FLS A;  3EBG A;  3FTV A;  5JO0 A;  4FLR A;  1GW6 A;  2XQ0 A;  1R0L A;  3A06 A;  3Q43 A;  2EGH A;  3FTZ A;  1JGI A;  4ZX4 A;  5JC1 A;  2C5Z A;  4OOF A;  1X3W A;  4XMW A;  5BPP A;  5FWQ A;  5HNF A;  4ZW8 A;  4CXF A;  1G5A A;  3AUA A;  4AR9 A;  4QME A;  3JT1 A;  4J3B A;  1JVS A;  3FTX A;  3FUJ A;  5JBI A;  4Y6S A;  5EV7 A;  3UEQ A;  2Y1E A;  4ZQH A;  2JV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...