4ZQEA

Crystal structure of dox-p reductoisomerase in complex with magnesium
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
407
structure length
400
Chain Sequence
TLQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
total genus 139
structure length 400
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqeA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqeA01
2DC1A 3BAZA 2OFPA 4OH1A 4YVFA 1RJWA 3T4EA 3HUDA 1JTVA 4PLYA 2NQTA 4PG6A 1VKNA 4BGEA 5IAAA 3EUWA 1I30A 2I6TA 3GZNB 1HDXA 4BNXA 4DBVO 2GN8A 1BXGB 2SCUA 3CMCO 3FBTA 1UUFA 4I5FA 4K6CA 4KQXA 3TPCA 1HTBA 2ZB3A 3RKUA 3GPDG 4OAQA 4IJKA 5HM8A 2QX7A 1K6XA 2E82A 1E7MA 1X14A 2PD6A 3JTMA 5JMWA 1SC6A 5F5NA 3ZN2A 1XG5A 5IZCA 2FPPA 3F5SA 1BW9A 1BXZA 2AG8A 3GAFA 1O9BA 3U49A 3LYLA 1E77A 4PZEA 4U7WA 5U9CA 4PZCA 1IYZA 1QSGA 4WUVA 3OBBA 5LDGA 4M8SA 4D7AA 1PGQA 4ALNA 2GCGA 5A05A 2P4QA 1PJCA 1ZS2A 1EK6A 3JQ6A 4K26A 1SZJG 2PY6A 2C82A 2GZ2A 4H7PA 2I65A 3GHHA 1NQOA 3I5MA 1ENYA 2PFGA 3KEOA 3AUAA 4E6PA 2X9VA 3BMQA 3KM0A 2B5VA 4R68A 4N7RA 2Y0CA 1EEHA 2AEMA 2FPIA 3N74A 4BMSA 1ADBA 1WZIA 3ETEA 2PD3A 3CPSA 4J4BA 3UN1A 4BMNA 3Q0EA 3ZNQA 4RPKA 4O5OA 3PP8A 4PN3A 1T2AA 1PZFA 2AHRA 2DT5A 3DMTA 1VJTA 3GK3A 1YL6A 5K6AA 3SX2A 3F3SA 3HN7A 4BGUA 6ADHA 1ISIA 4EUFA 2RIRA 4MP8A 1D1TA 2JFFA 4DVJA 3F1LA 4J43A 1JVSA 1OAAA 4BO9A 4RPHA 1F12A 1ZCJA 3JQCA 1O89A 4CM9A 2X9GA 2FR0A 1HDYA 4TZTA 3ROKA 5CG1A 3PYMA 3CSDA 1QR6A 5DNAA 4NJMB 4BKPA 3K92A 3NGLA 2EGGA 1SNYA 3DMYA 1B2LA 4MINA 2C54A 1NPTO 3D3WB 1TB4A 3FN4A 5C5IA 3E8XA 4QEDA 3OETA 4MVJP 1PZHA 1T4DA 1LJ8A 3DBLB 4TWRA 4WEOA 3BXXA 5HTOA 5IJZA 2I76A 1XA0A 3A1NA 4CMKA 5IG2A 2IRWA 3AM3A 3WQSB 3MJEA 3WQQA 3ANLA 1A7AA 4BNTA 4IY1A 3LC1O 3O4RA 4YR9A 1LI4A 3AOEA 4BOYA 5H82A 2R00A 2CF5A 3OJ0A 4L4XA 5AXDA 2WD8A 4B8ZA 3D4NA 4YTEA 4RDIA 4CLRB 1V3TA 3L0DA 2J3KA 3PPIA 4OJNA 3GEGA 5FF9A 3IS3A 4J9VA 4Z3DA 4L73A 4TZKA 3DB2A 4E5MA 1MXHA 3GAZA 5KVCA 4MVJD 5L9AA 5JBIA 4QQRA 5AXCA 2QZZA 4XRRA 9LDBA 4BB5A 1JW9B 1R6DA 5A3JA 1H3LA 2PKQP 3HZZA 1R0SA 3VPXA 1HKUA 2BI8A 1CJCA 3VDQA 4YYZA 2OUIA 1K6JA 3O9ZA 3JQBC 4F3YA 3BHJA 2LDBA 3K73O 5A04A 3RFVA 4NI5A 3INGA 3TRIA 1VE9A 2UVDA 1PJTA 4KDFA 1P0CA 3ZCXA 2G1UA 2D2IA 1HXHA 3AUSA 3GG9A 3BTOA 2IZZA 3H3FA 4FDAA 3KB6A 3E48A 5L4SA 2UAGA 4MVJF 1DIBA 4B7XA 4BMVA 3AY3A 3WBFA 1KY5A 3NKLA 3ZWOA 1BHSA 1Q7CA 3AJRA 1JU9A 3LK7A 2X8LA 1LLQA 2CNBA 3HFSA 2CF6A 4IS2A 1PIWA 3BMCB 3PJEA 2IE0A 3HQ4O 1QV6A 2ZTVA 1YBMA 1YJQA 4K9DA 4JCOA 3WSWA 5CEFA 1L7EA 3EDMA 3QLJA 3EW7A 3TZQA 1KEPA 1M76A 1H6DA 3NTRA 4U5QA 4KMSA 4W9NA 5BR7A 3IUPA 1FK8A 3I3OA 3H9UA 3IOYA 5BT9A 5AVOA 4MVJE 3AW9A 1OOEA 3L77A 2FRDA 4AJKA 1E6EA 3WLEA 4KWHA 2QZ9A 3GZNA 4ZICA 4CM8B 4J0FA 1BXGA 2IZ0A 3H2ZA 3FNEA 2VHVA 4DLLA 4NBTA 2GO1A 1NFFA 1R4MB 3WICA 3VH1A 1KS9A 2YHUA 3N7UA 2O2SA 3F4BA 3MJVA 2OMEA 4E0BA 1CDOA 2VOJA 2DFVA 3L6DA 3OFSA 4UVIA 1JWBB 2DBQA 1MW2A 3G3EA 1LRLA 3HDJA 3NT4A 4FFMA 3OA2A 2PD4A 3WGIA 1ISHA 3CIFA 1LC3A 3GQVA 2QQ5A 4FIZA 4S3MA 4IBOA 1MFZA 2GN4A 5C37A 3PQFA 2C7GA 4WCFB 2O3TA 1WMBA 1P31A 1HT0A 1Y1PA 2JAHA 4ZQEA 1UZLA 1C0LA 3IJRA 3IMFA 2NM0A 3FHLA 4XB2A 4HFRA 1G1AA 3GA0A 1I3NA 1GR0A 1LU9A 3I9NA 3GVCA 3HB4X 5IDXA 1S46A 2MAOA 2NVUB 3BYZA 4BNHA 1PTJA 1M67A 1X0XA 2ZYAA 3LT0A 4AJIA 3G0OA 3JQFA 4GGOA 1QXSA 5EQFA 5H81A 2J3JA 4BKUA 2X86A 3DR3A 4IZIA 4IIVA 1Q1NA 2VWGA 1M2WA 3U62A 3NJ8A 5KKCA 4URFA 4DQUA 3PLNA 5ITVA 2PGDA 1SEVA 2QYTA 5JAQA 4PFJA 3X2EA 3H7AA 2GGSA 1ARZA 3ETGA 2DBRA 3LLSA 4O0LA 2J5QA 1KERA 4WLUA 2HK9A 3HDHA 2W2KB 3ONEA 4I9HA 4TRJA 5TNXA 2JCXA 3PYLA 2X5OA 2FR8A 1HE3A 1Y8QB 4BNNA 2DM6A 2Q1WA 5LCXA 4OHUA 4RVFA 4HWKA 1NWCA 3PDUA 2IXBA 4JP3A 5F1OA 4U8GA 4IQGA 4NBWA 3SXPA 4IXTA 3PFWO 3DZJA 2EG9A 3SJUA 1GQQA 1WW8A 4B3JA 3OIFA 4NJMA 1VKOA 5J23A 1NQAO 3UCXA 4FC6A 6LDHA 2CDBA 4XGIA 3WXBA 3VDRA 1ZH8A 4GWGA 4YBZA 4FJ0A 3RQSA 3D3WA 4ALLA 1PJ3A 5THKA 3WYEA 3DBLA 1H9AA 1QYXA 4WJZA 3ZZNA 3V2HA 3I4CA 3Q2IA 4XYEA 1HZZA 3RI3A 1EBUA 4Z6KA 2I9PA 4JROA 3STHA 1OI7A 4NFYA 2ZKLA 4CMGA 2NWQA 1LRKA 3ZU2A 4R01A 4NK5A 4RLSA 1XELA 3HWRA 4BGVA 1YB4A 4CLRA 5I7EA 1Z6ZA 3S2GA 4MVJA 2ET6A 2X9NA 4XA8A 1DIHA 3K96A 2Q50A 3ONFA 3HHPA 3DDNA 2CDCA 2PR2A 2QRLA 4BIIA 5I9LA 3W8FA 3ZWYA 1J0XO 3K5PA 5I9NA 1DXYA 3BHMA 1BDMA 1EZ4A 2VUSA 1BDBA 1EVIA 1B14A 3RBVA 2O4CA 1WDLA 1ULSA 2HU2A 1NR7A 2O23A 2C2YA 2NSDA 4PRKA 3RVDA 5C7OO 5IN5A 1Z82A 3EZLA 4AYSA 1MC4A 3DOOA 4J1QA 4I9UA 3RSHA 1IY8A 2GSDA 1EE9A 3G79A 4MVJM 1D8AA 3BIOA 1MFPA 1H6CA 4NDNE 3UH1A 1ZXBA 3V1YA 3UW3A 1GTMA 4HBGA 2VT2A 4PG5A 1YDEA 1EVJA 3HG7A 3UCQA 5L3ZA 3CH6A 3GLQA 4ALJA 2ZTMA 1LLUA 3KRTA 4XQ9A 2B83A 4II2A 4D44A 5JAIA 1WP4A 3G17A 4B7UA 1ENPA 2HLPA 3WFJA 1DRUA 1P1KA 2NVBA 1ISJA 1R0KA 1I2CA 3S2EA 2YYYA 2FMUA 4II3A 3TFQA 2JD0A 1NASA 2B4RO 3FPLA 5GMOA 3PZRA 3WFIA 1B3BA 1Y6JA 2P5UA 3BMCA 2Q1UA 4Y6SA 3I23A 4CQMB 3WGQA 1U8FO 4GMGA 3DL2A 5AOVA 5B1YA 1VSUA 4CMIB 3S1LA 4ITUA 4BUCA 3WMXA 4CQMD 2Y1CA 1PL7A 1LLCA 3PGXA 3PHJA 4RLHA 3H6KA 3E5MA 4M86A 1B7GO 5EESA 4WCDA 2X0JA 2OZPA 4R69A 4TKLA 2B5WA 3RUDA 5KJ1A 1HYHA 1NHWA 2FP4A 1WAMA 5DCWA 5U4QA 4CQLB 1NNUA 1Z73A 4E30A 4CM4B 5TQVA 1P33A 3EC7A 4NG5A 3R3JA 5L53A 2PV7A 4CM8A 1Y5RA 1NBOA 3DBVO 4MP3A 1EMDA 3NT2A 3CE6A 4Q9NA 1R4MA 2I67A 1KEWA 4RVGA 5A9SB 2OBYA 3ITKA 1Z45A 1PJLA 3JQ8B 5IZ4A 3AUTA 2AG5A 3NTOA 1U4SA 1IHYA 1KVQA 3JQAB 4A0SA 1GPJA 3I52A 4Q3CA 1L1FA 5BNTA 4RL6A 3ZV4A 5A3VA 2VT3A 3WWZA 3ZDFA 1FXSA 2H1SA 3JQAD 2AMFA 4WPGA 1WVGA 4YJHB 3WOHA 5F1PA 1FDVA 4AJPA 4C4OA 3GF4A 4MVJI 2G76A 2DPHA 5EINA 3ZV6A 4CV0A 2VZ0A 4EGFA 3SBOA 3MCVA 2D3TA 3FCOA 4NU6A 5A06A 4ND3A 2DFDA 5JCJD 1DFGA 1ZKMA 3WGHA 5FI3A 4NHEA 1LDBA 2NVUA 2IZ1A 3VZQA 1ZK4A 5G2OA 2BGLA 5B4VA 3KYBA 4PIVA 3WGOA 1Q0QA 5COAA 2HMUA 3JSAA 5JDIA 3ASUA 3KSUA 2VZ9A 3S2IA 5KVVA 2EP7A 2QG4A 4KTTE 1NAHA 2FR1A 2X58A 3B20A 1BVRA 3E6AA 4H3VA 3C8MA 2MAPA 1B26A 1HYEA 5ER9A 3E5RA 4J7XA 5CEEA 3I83A 1RYDA 1HYGA 3AM5A 2W2KA 3NRCA 1LXCA 4Q39A 5JPIA 1P1JA 4WGGA 1GZ6A 2D1YA 2NU7A 1Y8QA 4CODB 5CFZA 2BFAA 1ADFA 4QX6A 3UAGA 1Q0LA 1B0AA 3ZHZA 3OECA 1H0KA 1F17A 3BMNB 3LT2A 1E7RA 1DC3A 3QE3A 4JNKA 2GRAA 2HMTA 2POQX 3VPGA 3ZWXA 1RM3A 3ONDA 3GVIA 1IZ9A 4LGVA 3W8DA 4A73A 3LF2A 4ZQBA 2JJYA 4ZD6A 1U3TA 3U4DA 2ZTUA 1CQJA 1HDCA 4YAKA 2AA3A 1EFLA 3HDQA 3U3XA 4WNIA 1YL7A 1I5RA 3F1KA 3QJ5A 2VYVD 4L74A 4OIMA 4AL4A 5KWEA 2HO5A 5GZ6A 3RIHA 4MKRA 1GUZA 2OP1A 3VTZA 1V3VA 4NQZA 3UCEA 1Q7BA 4IUYA 3RC7A 3EZYA 4RVDA 3UFXA 5JO9A 3KOUA 4MOWA 3ROMA 3RUIA 4E2WA 1A4UA 1LSSA 3RD5A 4XGNA 3TZKA 1T2EA 3ZWVA 4LCJA 4MPDA 4CL8A 5BSFA 3IQDB 1QRRA 5F3RA 1NFRA 3V8BA 5JW6A 4I8XA 4R1SA 4KUHA 5DP2A 1XQ1A 1JKFA 1UP6A 4J4HA 1LX6A 4EJ6A 1PEDA 3L6OO 1VL0A 3EK2A 2QRKA 4YRAA 4GSLA 4ZVVA 4BGIA 1FDUA 5CDGA 4ONEA 4J7CA 3DAGA 3TQHA 5L7TA 1UDCA 3LC2O 1DHRA 1GADO 2J5RA 1U1IA 4DC1A 4LCEA 1SMKA 4YT2A 1HL3A 5DN9A 5KJ6A 1XSEA 5T8KC 5G0SA 4IPTA 2R2GA 4LUPA 1G0OA 4BS9A 1W0CA 4WCFC 4BNGA 3GFGA 3I9LA 1HSZA 3CUKA 4H15A 4CMEC 3FWZA 2GZ1A 3GN1A 4ZJUA 1N92A 1TEHA 1TXGA 4N18A 4ZQHA 3L4BC 4CXFA 1PL8A 3LU1A 3V5NA 2ZB7A 2FSSA 3UUWA 3X2FA 1I32A 3TJRA 4IJWA 1HE5A 3KO8A 1P1IA 3GHYA 5C7IO 5MGBA 1GY8A 4EZBA 4BQRA 4LISA 2I99A 3RJ5A 2NNLD 4PLZA 4NZ9A 1T2DA 3HADA 2VOEA 3RUEA 2VRCD 1YONA 4EUHA 1UH5A 4QO7A 2E37A 2QW8A 1DJNA 4L9RA 1K0UA 1KYQA 4FS3A 4EDFA 1O6ZA 2NU6A 4CQMA 1PJSA 2P2SA 2X5JO 4D0RA 1YQDA 4CMIA 4DWVA 3SVTA 1IB6A 3EVTA 2Q46A 4FLRA 3UOGA 2VN8A 3VPHA 2P5YA 5CDYA 5JLAA 2AQIA 4D79A 1QYDA 1WXDA 1DC4A 1SCUA 5JO0A 2O2YA 4M1QA 5FI5A 4CQLA 4E5KA 4CM4A 4TQGA 4X54A 1UXHA 3EMKA 4R1UA 4I08A 1F0YA 2EKQA 4BO0A 2RH4A 4BQPA 4YAIA 5ICSA 3DOCA 5ENVA 1U7TA 1I0ZA 4D46A 1N7GA 5CDSA 3P2OA 3L07A 1EVYA 5A9SA 3AOGA 4M54A 3ASVA 1QYWA 3JQ8A 1GEEA 1B8UA 3RASA 2I66A 3JQAA 1QLHA 3ZHYA 4MKXA 4BV9A 2CVQA 2F1KA 3AI3A 4CR8A 4OXKA 4F6CA 1YRLA 3W6ZA 4ND4A 4YJHA 4IDBA 3RUCA 3JYNA 1R16A 2YV2A 4NBRA 1YOVB 4DIOA 5JCJA 1KY4A 1M6WA 1RM5A 5IDQA 1QYVA 4K1LA 2BHLA 1NWHA 1SAYA 3C1OA 3D3EA 2NVWA 3JQDA 1B16A 4DIBA 1LNQA 2O3SA 3H5AA 3ULKA 5JAMA 1XEAA 5IXYA 4TVBA 5L95A 4FFOA 1LC0A 4EW6A 3ZW9A 1JAYA 1PGNA 3KSZO 2HJRA 3WX0A 3DQPA 4R3NA 4YQZA 3U9LA 2VTDA 2DUUA 2PGJA 1C0IA 2AQHA 2VHWA 1DDOA 3JQBA 1V9LA 1UP7A 2BF7A 3JCZA 1I36A 5DZSA 3QWAA 4BKRA 3AI2A 4GGPA 4YA6A 1Z74A 2ZK7A 1I3KA 3M2PA 3PIIA 4YEDA 3DHNA 3T0YA 4CV1A 4ZQGA 1KIFA 1RM0A 3F46A 3RJ9A 3D64A 5DCYA 1U7HA 3H9GA 3ADPA 1XU9A 4KWIA 1B15A 3RFXA 2IYOA 1TT5B 3DHYA 2JCYA 4JBIA 3DONA 3C3XA 1W73A 1EUZA 2B69A 4FFLA 4AJLA 4XWYA 1FJHA 3BMNA 2CZCA 1MLDA 3IAHA 4Y6PA 3ZI0A 4IDGA 1A27A 4GKBA 3PI7A 4BO1A 3TSCA 1PGJA 4BVAA 1MG0A 5U1PA 1Q0HA 1YH3A 3GPIA 1YB5A 3DXFA 3OICA 2EWMA 3G1UA 4DRYA 1GYQA 1I24A 2BMAA 3RUAA 1NVTA 3DZFA 2Y1GA 1UXJA 1ENOA 1BWSA 3RC9A 4CM6A 4WOJA 4E2XA 4RGBA 1H9BA 2HDHA 3ZW8A 1ZK0A 4CL3A 3HJAA 3MTGA 2JHFA 1OR7A 2J3IA 1R4NB 2HSDA 4XGKA 3UICA 2NADA 2E4AA 1MA0A 2I5PO 1PQWA 2FWMX 5CPBA 4ZRNA 4ZGWA 1G0NA 1T1RA 5AXAA 4IJVA 1GL3A 4XQCA 4L4SA 4CLOB 1OBFO 2YHIB 1AHHA 3GGGA 4AFNA 4QFDA 1E1KA 4E21A 1ZMOA 2JHGA 4G2NA 2PK3A 4L0QA 1JVBA 3SC4A 3VKVA 3K8ZA 3KYCB 2Q49A 1DAOA 3FNFA 5JDCC 5CAEA 1CEQA 4YB8A 1GFSA 4DMMA 3I9MA 3CZRA 4RPGA 4JQCA 2H6EA 4BV8A 3PLRA 2F00A 1E3WB 3KUXA 4IGFA 3LF1A 3RROA 3C7DB 3V2UA 3WTCA 3AK4A 3OQBA 1BG6A 1C0PA 1FMCA 5G0WA 3VOSA 4CM5A 2ZQYA 4CUZA 3GNQA 2HMSA 5BQFA 4OM8A 1YKFA 3WGYA 3CXRA 3GEMA 1T24A 2CD9A 4DLAA 2G82A 1QYCA 3M1LA 3LSYA 4W4TA 3ZWNA 3RBXA 1ZO8A 2EKLA 4FGWA 1E1NA 4ZU3A 3TL2A 4E32A 1CETA 3DFUA 2X7HA 1RYEA 4BKOA 3ZHBA 1JKIA 3DZKA 4OKNA 5A02A 4BNMA 2WE7A 1ADCA 3ON5A 4HKTA 2FHSA 5B4TA 9LDTA 3P2YA 3QSGA 1YDWA 3ZU5A 3RU7A 2Q4EA 3NDRA 1X1EA 2P68A 1WDKA 2PH5A 3TF5A 1GU7A 5ENDA 5G4KB 5BSEA 1KEUA 1JN0A 3FNGA 4AJ1A 3WDSA 5AQ1A 4W99A 4TKMA 3VPFA 4UEOA 2A94A 2Q1TA 2HQ1A 3S8MA 4ZN6A 3Q3CA 4CMJA 5K0ZA 5CP8A 2AEJA 1ISMA 2P9CA 2VWQA 2EHDA 3B1JA 1JLLA 3DBRB 5T67A 3TZHA 3D4OA 4OSOA 2BFOA 5T57A 3PJGA 4B4VA 1V3UA 3JQ7B 3MJSA 2JCVA 1WPQA 1I3MA 3P19A 2C29D 2IEDA 4RO0A 1MXFA 5B37A 3KHUA 2GR9A 1EQ2A 1LQTA 1OMOA 1G5AA 1W4ZA 4G5HA 1RWBA 4R54A 4ZHSA 4UUNA 3GFBA 3JD4A 1Z75A 4MIYA 5JNLA 3VC7A 4CMHA 1JKJA 3U5TA 1U2DA 3TDKA 2O48X 1KC1A 2Q45A 5THQA 1N8KA 2VTEA 3EY4A 4BO4A 2O7QA 3ROPA 3IIEA 4ND1A 3QRWA 4EEZA 4BNJA 1QG6A 1MV8A 2RHCA 4WECA 5DULA 2O4UX 2IYPA 2HUNA 3WWYA 5KTKA 1P74A 1YJ8A 4CM3A 1ULUA 4NIMA 4UUMA 3H5RA 4QSMA 4DBZA 4CUJA 2RHRA 4J91A 4TRMA 3ICPA 4GH5A 3KZVA 4E2YA 4Y98A 3RU9A 4MVJG 5KJFA 3PZBA 1KVRA 3Q11A 2CDAA 2UUPA 1HDGO 3L9XA 2YY7A 3W8EA 4FJ2A 3RUHA 3BTVA 4O1MA 2PKRA 4HFMA 1U3WA 1YE3A 3D5QA 3NDJA 4J2HA 4OYRA 3ANMA 1Z7BA 1TT5A 4YRBA 2QHXA 5EMHA 1EBFA 2AQKA 3OMLA 5COQA 1KC3A 1JDJA 3UGKA 5A4DA 1PL6A 3IP1A 1P1RA 3QP9A 4UULA 1EDOA 2FPGA 5IDYA 4IMPA 1I3LA 1ZK2A 4DC0A 1FDWA 5TT1A 2B37A 2CMDA 4B7CA 3H9QA 2BD0A 1XU7A 1ZJZA 2FN7A 1MB4A 3D5TA 1GEGA 2Q3EA 4HV4A 4BNYA 4AICA 1UJMA 1EUDA 3HSKA 1DLIA 4FD3A 1ID1A 4R51A 4Z0PA 2ZIZA 2LDXA 3JQGB 1NAIA 1S7CA 5EQDA 5G0TA 3WG9A 4XRGA 5BSGA 2CVZA 3D0OA 2W2LD 3BTUA 4DYDA 1YQGA 4FFPA 2PZLA 2UYYA 4TSKA 4C7KA 1LA2A 1R4NA 3KLPX 3PXXA 4P4NA 4QT0A 5AYVA 4IIUA 5ICMA 1NX6A 1F06A 4WK6A 1Y5MA 1DC6A 2XOXA 5KCZA 1HLDA 3GGOA 3GMDA 3RCBA 3WB9A 3INTA 4IDEA 1MP0A 4CLOA 1PWXA 3SLGA 1E5LA 3GDOA 2YHIA 3G1TA 2X0IA 2OL4A 2ZB4A 4DUPA 5KVQA 1H5QA 2J3HA 5JC8A 5DOVA 3COSA 3Q9NA 1E3SA 2E49A 4BKQA 1NPDA 4KUGA 5GZ1A 5ILOA 1PJ4A 3KYCA 5AXBA 4IDDA 4DQXA 1K2WA 1FDSA 2WPGA 3RUFA 4ND5A 4B8WA 4B3HA 4CJXA 1WMAA 4TROA 5DDIP 1HEUA 5HS6A 1ISFA 1LUAA 4Z3KA 5L40A 2GN9A 5FEUA 1E3WA 3OP4A 1M66A 4CM1A 3GGPA 3SJ7A 4MDHA 3ZU3A 1QORA 2NQ8A 3E9MA 2PH3A 3L9WA 4CV2A 1TLTA 1SB9A 4IJUA 3TZCA 3DFZA 3HN2A 1C1XB 2PZMA 3GRKA 3B1KA 3RC1A 4XQEA 1IUKA 3QY9A 5JC1A 3WTBA 5HRUA 1P45A 4PGFA 1D7OA 2HK7A 4Z9XA 4MJLA 4LMRA 1GQ2A 2D0IA 4PG7A 3KETA 1E3JA 1F8FA 4I1IA 2GNAA 3ENKA 4KTVE 1SC5A 7MDHA 3OHSX 4XIYA 1HETA 4LRSB 4BO5A 1Y9AA 3ORFA 3IKVA 2B4TO 5I8WA 3DC2A 1I10A 4UVEA 1X0VA 1P0FA 2D5CA 3NT5A 4NJOA 1GZ3A 4R5HA 3GUCA 7ADHA 3WNVA 2Q4BA 4DXHA 2W98A 1VRWA 5G4KA 2DTEA 4W82A 3PQEA 4JX8A 3Q9UA 4GVLA 2GUGA 2GN6A 2EV9A 4QO8A 1NHGA 2OORA 2YFHA 3IC5A 4O59O 3FR7A 3IUSA 4G65A 3RFTA 4FN4A 4BB6A 1ZZEA 2Q1SA 3TFOA 3DBRA 3IJPA 2YW9A 3PRJA 4Z9FA 1AXGA 3SLKA 4ZQFA 1GV0A 4YPOA 4LRTB 3DAPA 3JQ7A 1MGOA 1D4FA 3I1JA 4D43A 3H5NA 4DL9A 5BSHA 3QHAA 3T7EA 5DP1A 1W8DA 2ZYGA 2PWZA 2XF8A 4CUKA 2O3UA 3P7MA 2P9GA 1DEHA 5JE8A 2ZCUA 2PZKA 4UVGA 5TJHA 1BXKA 3VH4A 4XDZA 2HRZA 1C3VA 1HRDA 1SEPA 3WNQA 2NU9A 1O95A 2WYUA 4LK3A 1HWYA 4JP2A 2GF2A 4LSWA 3UVEA 3JD2A 2VQ3A 3MEQA 1N7HA 2UV8A 5T8KA 1H94A 3QVOA 4YJFB 4AJJA 4YDRA 3JV7A 4WCFA 5HWSA 4GSKA 1LDEA 4A27A 4CMEA 3G49A 4ESOA 1CWUA 3JD1A 4CPDA 2BLLA 1A71A 4OL9A 4AJ2A 1LSJA 1R15A 3KBOA 3L4BA 4AJNA 1GQYA 3VH2A 1X1TA 3MTJA 4RPJA 4O6VA 2VRBA 1UZMA 1F8GA 2OO5A 3ZNPA 1JG9A 1ZSVA 2IODA 3NAQA 4BO3A 3AUUA 4JJIA 5TGDA 4XJTA 2X5KO 3NX4A 1PS9A 3GVHA 3Q1LA 2EW2A 2BGKA 5FWNA 2Y05A 4EUEA 3V2GA 1KVTA 3ZWCA 1YS4A 3UF0A 4L76A 4A10A 1R12A 2TMGA 1YWGO 1NVMB 2W2LA 2AE1A 4UEJA 4E12A 3JQGA 3GNSA 2PNFA 1K6IA 1GZ4A 1UR5A 5DOZA 3QWBA 4YAGA 5JY6A 3BHIA 3BMOB 5JCXA 3A9WA 4KOAA 1ZXLA 2YFQA 4YCAA 3OEWA 4GX0A 5TRTA 3CZMA 3TZ6A 2EXXA 4TRRA 4R1TA 2WD7B 1D3AA 1I8TA 3FRJA 2XPCA 3PGJA 4WLOA 2NTNA 2Y1DA 4EJMA 1ZNQO 4UVHA 1ZFNA 5IDWA 2ZQZA 5DCUA 1LQUA 4ALMA 4AG3A 2X22A 1GUFA 1IE3A 4D3SA 1ZMTA 2PLAA 1PGPA 4K6FA 2X1HA 4YJDA 1ZW1A 2CUKA 5JAZA 3LQFA 1GYPA 2NTJA 4FCCA 5GZ3A 2D5AA 1LDNA 1NXQA 1C14A 4U6QA 3OH8A 5TSDA 3DO5A 2DTXA 2H5LA 4OXNA 1QV7A 1ONNA 1C1DB 4BHTA 2NU8A 2DLDA 4Q3BA 5KJCA 1XR3A 2H63A 3LVFO 4NK4A 5IFLA 1A9YA 1E7YA 1N2SA 4XKJA 3MWEB 3U4CA 4NFHA 3ST7A 3F6YA 2B35A 1DLJA 1UXGA 1KVSA 2D4AA 4QFCA 2VWHA 1MG5A 3AI1A 1C1XA 2P91A 4I5EA 4HADA 1GAEO 4BNWA 1CYDA 1T2CA 1PJ2A 3ZWWA 3DTYA 3WGZA 4J1SA 3FF4A 4OGWA 2NACA 2I3AA 3ROQA 1XLTA 1UDAA 5L4LA 3FD8A 4LN1A 5A5FA 1XQ6A 2Q2VA 3RC2A 3IDSA 1I2ZA 4W7HA 1PJBA 4N5LA 3SEFA 1AUPA 4RF5A 1U5CA 3RAJA 1LSOA 1O8CA 2YJZA 3UCFA 4PRLA 5I7VA 3FNHA 3NGXA 4EEXA 3W6UA 3DBHB 2HK8A 3AY7A 4HNHA 4G81A 5F21A 4YJGB 2V7PA 4FLQA 3LT4A 4BNZA 1PS8A 1WDMA 3FI9A 4I9NA 2ILTA 2O3RA 1ADGA 2YDXA 1P1FA 5L7WA 1R0LA 1R66A 1DSSG 5CPFA 1V0JA 1ZSYA 2ZYDA 2QYSA 3GC6A 4BO8A 1ISGA 1UP4A 1PU2A 4PLTA 3QA9A 4WEQA 1ZEJA 2NUAA 5JY1A 1L7DA 1W6UA 4DPMA 1G6KA 3ZV3A 1IL0A 1YBVA 2Q2WA 3DOJA 3A06A 3GH3A 2VYND 3PHHA 4P8RA 4Y8VA 5COBA 3HDYA 1RKXA 3H9EO 3CZKA 3GZ4A 3GOHA 1H6BA 4LVCA 2O50A 4FSHA 2Y1FA 1AHIA 1VC2A 5DBIA 4E5PA 2AW5A 1DIRA 1I2BA 3WBBA 1JAXA 4GVXA 3QVTA 5JXWA 5CEJA 1CIVA 1HF3A 3S2FA 4GI2A 3WQRA 4RF2A 4AJOA 4FGSA 5F1KA 3PEFA 4ZRMA 2IEBA 2FOIA 3W4KA 4J9UE 2J6IA 5BNIA 1EUCA 1Q7GA 3DEYX 1NYTA 2O3JA 5DF1A 3WMWA 4YJFA 2WDZA 4YRDA 2Z1MA 1PJQA 1QLJA 4IDAA 1NQTA 2Z1NA 5JDCA 3FWNA 3UERA 1EK5A 1OC4A 3LT1A 1P3DA 1T1SA 4XYBA 3QW2A 3QV1A 4WASA 3RWBA 3ZWPA 2VWPA 3H3JA 5FFFA 5BNFA 3N58A 4OSPA 3OJEA 1GCOA 4XD2A 4OKIA 3AU8A 4OQZA 2Z95A 3L6EA 3WYBA 4DA9A 2RBEA 4FLOA 2Y67A 1HLPA 4EYEA 1H2BA 1Y81A 3D1LA 3PQDA 4RVHA 5EJ2A 1HE4A 4RCVA 1ZJYA 1J49A 5EPOA 4RF3A 3C85A 2JKVA 4YXFA 3R0IA 1XGKA 2EW8A 3HNPA 1BSVA 1U3UA 1X7DA 4OOFA 1EE2A 3MWDB 4K28A 3QIVA 4I5DA 5F5LA 1PZGA 3AU9A 3DTTA 1IPEA 2WM3A 3PIDA 1N1GA 2Y0EA 1LBEA 2HAEA 1DO8A 2E6UX 1P44A 2X23A 1V8BA 1ML3A 4RDHA 4DPKA 3I9OA 3O8QB 1XYGA 3BMOA 5JYDA 2WYWA 1E1LA 4C7JA 4A26A 2HRBA 5I7FA 1Y8RB 5G0VA 4E5YA 2WYVA 5T64A 3TNLA 4GLOA 2WD7A 3GT0A 2VYVA 3OIGA 2R6JA 1KOLA 4YT8A 3VPSA 3D7LA 4UREA 4BNUA 1P1HA 5ADHA 3OQ6A 4CLHA 2VCYA 5TLSA 3CTMA 3WJ7A 1EFKA 2A35A 2G5CA 3QQPA 4AJ4A 4W6ZA 1Z7EA 2UDPA 4WOKA 3ZWBA 4OQYA 4TMFA 3KXDA 5I9MA 1HDZA 3F9IA 3EVNA 4FC7A 3EHEA 2X6TA 4L8VA 2X0RA 3W4IA 3M1AA 5HS4A 3SC6A 1C1DA 2B4QA 1GD1O 3PHLA 2EIHA 5CDTA 1U3VA 4J1NA 1WLYA 3JQ9C 4UUOA 5LDHA 4Q3AA 4F6LA 1LTHR 2BI7A 2BELA 2DAPA 1A5ZA 1SO8A 1SPXA 3R3SA 4XYMA 1PX0A 1R37A 1NQ5A 3OM9A 4M49A 4WNCA 1PR9A 3ETDA 1KVUA 2HJSA 4N5MA 4BO2A 3F5QA 2BFMA 3KV3O 3A28A 1HDRA 3KVOA 4P4LA 3VZSA 3W4JA 1ORRA 4A03A 1J4AA 3PJFA 2FSVA 1ONPA 3UXYA 3F47A 4D45A 4P22A 3B1FA 4NBVA 2HKIA 2ZTLA 1LRJA 5EIOA 5IXSA 2Q99A 4AVYA 4XR9A 3WSVA 2HMVA 5B4UA 4D3FA 1UXKA 1GPDG 4R3WA 1DRVA 1DRWA 4NQWA 3I6QA 3H9JA 4WKGA 4E13A 1RP3A 3C7AA 3OJLA 4JJGA 5A5EA 4UEKA 1E7SA 4IQ0A 1JQBA 1YXMA 3U4HA 4CR7A 3QVSA 4MKZA 2NLOA 3DBHA 4I5GA 4ALIA 2VRCA 3BZUA 4E2ZA 2DQ4A 4ILKA 2YDYA 4YJGA 3O03A 2W8ZA 3LZ6A 4FBGA 1LDYA 1B8PA 3K2EA 3OJFA 4LMPA 1BVUA 4FFRA 4DYVA 5IZCC 5FYDA 3CEAA 1A4IA 3ZNOA 1N9GB 1UAGA 4BNLA 4IGEA 4XQGA 3PWSA 3Q6IA 3GG2A 1H2HA 4JIGA 1HZJA 2JFGA 4J7UA 4MP6A 3WGTA 2BGMA 2VYNA 4CLDA 4HUJA 2RH8A 1TVEA 1IZ0A 3MJCA 4NU5A 4RVSA 1IHXA 2YV3A 3K30A 1Y7TA 3W1VA 4B4UA 2DUWA 3ABIA 4HX5A 4INAA 2AQ8A 3A14A 2NV6A 3BA1A 1VI2A 2XXBA 2A4KA 5C3MA 1QMGA 1FDTA 1F14A 4J2OA 4R9SA 2OHXA 1AN9A 1ZSNA 1K5HA 4RPLA 5T5QA 1D1SA 3OIDA 4MIOA 4NR0A 3JQEA 4R16A 4P38A 3EGOA 4D41A 5HA5A 4WLNA 3TWOA 3HE3A 5KIAA 3MOIA 1X7HA 2A92A 4AJEA 1SOWA 4M55A 1Y9EA 4RV9A 4B4OA 2RAFA 4U6SA 3DMTC 3FTPA 5K6AC 3U09A 1AE1A 1SBYA 2WTBA 1YQXA 4NPCA 1KETA 4GKVA 1YOVA 3IL2A 4YAJA 3OJOA 4CLEA 3OQ1A 2C2XA 3F4LA 4XJSA 2NTVA 4XYLA 1GCUA 2EERA 4TRNA 3ZNNA 1DIGA 3RKRA 3C7CB 4FLSA 2G0TA 5A9TA 1KEVA 4ID9A 5A03A 1HDOA 1UXIA 2BH9A 3R1IA 4RZIA 4HFJA 5G4LA 1DOHA 4NFSA 2V6MA 2FY8A 3PJDA 4J49A 1LLDA 5GY7A 1J6UA 3VZPA 2JD2A 3E9QA 3R6DA 4CMCA 4YAEA 1U5AA 4MVJH 4FW8A 4PG8A 4HFNA 2WEKA 1VM6A 1TI7A 3NDIA 4A2CA 2EEZA 2W90A 4J3FA 3JD0A 1BRMA 3JD3A 1OFGA 2YQ4A 4DTIA 1YO6A 3QVWA 1DAPA 2X0NA 1V35A 3AOEC 5MDHA 3NTQA 3GVXA 2IXAA 2R00C 3PWZA 5HBRA 4TVOA 3VVBA 1I01A 5C7LO 3ENNA 2ZCVA 1GV1A 3ADOA 3P5SA 3O8QA 4PLHA 4D3DA 4UUPA 3QWHA 3VHRA 1IPFA 1LDGA 2C5EA 3L4SO 1Y8RA 3FBGA 1E3EA 3O38A 4E5NA 3E1KA 3VZRA 3MZ0A 3GMSA 1DIAA 4A5OA 4XEHA 2Z5LA 3KTDA 1RM4A 3VTFA 3VKUA 1H6AA 4MO2A 1E1MA 4GX2A 1ONOA 5CHEA 4KQWA 4R4JA 2CVOA 5L4NA 1YVEI 2VHYA 4QECA 1NR1A 3GR6A 3ZWAA 2Y93A 1WZEA 4N54A 2JD1A 4XB1A 4E33A 1YB1A 3DZGA 3QVXA 3C24A 1DFIA 2PGLA 2WWRA 2H9IA 4MIEA 3WJAA 4BNFA 5L51A 2Y0DA 2GD1O 2BRUA 4GAEA 3FTNA 4DLBA 2DBVO 1VSVA 2ZJ1A 1ZVMA 2EP5A 5KKAA 2Y68A 3CKYA 4GLLA 4CM7A 4DGSA 2B0JA 5B12A 4JK3A 4XR4A 4GL4A 5I8ZA 4CLXA 3E03A 2Q2QA 4IQ8A 4R41A 3E18A 3PHIA 4J1TA 5TC4A 5EN4A 1OZAA 2OGUA 3TOZA 2AEFA 2GLXA 3DWFA 3GN2A 3H4VA 4JJFA 1MVYA 1B3RA 4FR5A 1A72A 1U28A 2PZJA 1E92A 2DBZA 3MJ4A 2V6BA 1A7KA 1DB3A 3U4IA 4Z9YA 4YT5A 5TJ9A 1TT7A 3UEQA 2E48A 1XHLA 2GERA 4WLVA 2C59A 4W9NC 4XZ3A 5H83A 2D8AA 2CFCA 4N5NA 4DREA 5A1TA 1PGOA 2I3GA 4RORA 3NEPX 1XIVA 1I33A 3FR8A 3IKTA 3PK0A 5LC1A 3E82A 1YBAA 1PQUA 4IINA 5JYEA 4YQYA 5ITWA 3FPCA 3KLMX 4GX5A 4J90A 1A9ZA 2EJWA 3DZHA 1K3TA 3KYDB 1PWZA 2DU8A 1DFHA 3VVCA 1UDBA 4J4TA 3K31A 2JL1A 4BNKA 1WNTA 1O0SA 5DT9A 4Y67A 3NV9A 4FPXA 3OSUA 1N9GA 4BNIA 4M89A 3PWKA 4M87A 3PHGA 2A9FA 3I9KA 1HSOA 1JA9A 4FFNA 1IULA 4B79A 3CMMA 4E31A 1P77A 4IDCA 3AY6A 2VHXA 4IM7A 3WYCA 2Y1OA 4GMFA 3CZEA 1E6WA 2J5KA 5KOIA 1NTOA 2O3QA 4W7IA 1ZBQA 4CR6A 3AFNA 2C20A 3AFMA 3MOGA 1E5QA 1SOVA 2QRJA 1UAYA 3H8VA 4R9RA 5K9ZA 3JYLA 1EVZA 4PZDA 4WLFA 4F45A 4D0SA 1VPDA 4PG4A 3KEQA 4J6FA 2VUTA 4RVUA 4EITA 3QWFA 1T26A 2OP0A 2PTGA 5TT0A 4EI2A 3JQFC 4BO7A 2DTDA 4XYGA 3ZV5A 1PQPA 1GYRA 4Y9DA 1OC2A 3K9QO 4NNJA 2G17A 3WIEA 1GUYA 1M6HA 3H2SA 3WR5A 2YQ5A 2ZB8A 1CERA 1DC5A 1WWKA 5I7SA 3ZHXA 1E7QA 4PVCA 2FZWA 4L75A 4NH4A 1K89A 1LSUA 3KSDO 4JLWA 2Y66A 1AGNA 3LC7O 2OXIA 8ADHA 3CINA 2CSUA 2P9EA 1JWAB 2JFHA 4PLCA 4JBGA 3JYQA 3TOXA 1NVGA 2BFPA 1BGVA 3Q2KA 2HCTA 3GNTA 2W4QA 1DBVO 5EL0A 2O7SA 1ZK1A 1H93A 1MW3A 4OOEA 4DPLA 4P4GA 1O5IA 3UKOA 1AXEA 3T4XA 3ICCA 2FZEA 3FSRA 3RBZA 4H16A 1J5PA 3GUYA 4AJHA 1ZEMA 4Q3EA 1VJ1A 3WS7A 8LDHA 1XDWA 1PR3A 1X13A 2AXQA 2VNAA 4OXYA 3VAZA 4E3ZA 1YL5A 4PLFA 3PFFA 4HY3A 3DAFA 1E0DA 4LVUA 1VL6A 1XWFA 2RCYA 4IDFA 2TMDA 2EF1A 4U0KA 2DKNA 1HE2A 4QUKA 4S1VA 1GDHA 1VLLA 4JGBA 1Q2XA 2JAPA 4XIJA 4J0EA 1T25A 1VL8A 3GY0A 3JYPA 4J16A 5ER6A 2YZ7A 2QIOA 1T4BA 4DMLA 3S55A 4HXYA 1ZK3A 4IS3A 4YWJA 5T6BA 1VJ0A 4U0JA 1BW9B 3IP3A 3EAGA 3A4VA 1NP3A 3OA0A 4O63O 5JSFA 2EKPA 3QWIA 4R5MA 4ND2A 4EJ0A 4NMHA 3K2BA 4UVDA 3GDFA 3I6IA 1E3IA 4DQVA 2J8ZA 5A9RA 3MJTA 3ANNA 1C0KA 5CDUA 4D42A 4Z0TA 2ZJ0A 2AE2A 4CMAA 3BMQB 4CMBA 1U9JA 4LW8A 3DHEA 1V6AA 5KJEA 3I9JA 1BTOA 4Q3DA 2GZ3A 4IZHA 4R1NA 4RF4A 5CG2A 1XCBA 2OBNA 1E3LA 4WE3A 4CV3A 1N1EA 4EBFA 4PLVA 1E6UA 1IOLA 3OF2A 1M75A 5L7YA 4B3IA 3TL3A 1B8VA 1DJQA 1UZNA 5IN4A 2WE8A 1DPGA 1U4OA 2HMWA 1BMDA 3CZLA 1ENZA 3LDHA 4GQAA 1QP8A 3CZGA 2YV1A 5TS3A 5TF4A 3WLFA 3C1AA 2XAAA 1JGIA 4OO3A 2C0CA 3NUGA 3ZH2A 4BO6A 3EYWA 3AWDA 5KVSA 5EERA 2D59A 4DIFA 1U2GA 3GVPA 3PVZA 3GDGA 4FOOA 4ZA2A 4HP8A 3BTSA 4RZHA 4FQ8A 4PLGA 1NPYA 2EGHA 5JMPA 2EJVA 4CM9D 3WIDA 1S6YA 1E7WA 2YUTA 4B4WA 2GYYA 4BNVA 4YACA 1YGYA 2V6FA 3C1TA 5ES3A 1O94A 2B36A 3JYOA 4FOSA 2C5AA 1X15A 4GX1A 3KYDA 4PCVA 4WLEA 1X7GA 3M2TA 4KZPA 4GWKA 3D4PA 2Y99A 5TX7A 3ZWMA 4LSMA 1T2FA 3UHAA 4QXMA 1QKIA 4JN6B 3ITDA 2P4HX 4PLWA 4Y6RA 2BKAA 1NM5A 2C7VA 3NJ4A 4E4YA 4PLPA 1MW0A 3I4FA 4FJ1A 2WMDA 3GEDA 3H65A 4BL5A 2ZATA 5G0UA 2X4GA 3VH3A 4JBHA 2IDZA 3AM4A 5L45A 4A7PA 2VHZA 2O7GA 1PZEA 2VUUA 3NYWA 2XXJA 4UAGA 3HB5X 3U0BA 3ZGYA 2GPTA 2CY0A 3K6JA 3HFGA 1KBZA 3GRPA 1MW1A 2GDZA 2GASA 2V65A 1TA4A 5JDIC 1PSDA 2UUOA 1EQUA 3OEYA 2V6GA 2WJPA 3LLVA 3PTZA 3B6ZA 2VZ8A 1NFQA 1CRWG 4L4RA 3V1UA 5DBGA 1ZIDA 3M6IA 4HNGA 3TN7A 3B70A 4JXKA 4XCVA 4GBJA 4RQUA 2PKQO 3T7CA 1MX3A 4KP7A 5DBFA 5KNLA 1PS0A 4F46A 5JFOA 4XX0A 1EDZA 3PDJA 4RJTA 3JQ9A 1MC5A 4YT4A 1DHTA 1MUUA 3V1TC 5IF3A 2Y1EA 4NBUA 2PA3A 1RPNA 3INRA 1FF9A 1N5DA 1ZUD1 3PYXA 4OMUA 4PVDA 5ILGA 4QTZA 3DZBA 1U8XX 3DZIA 1P9LA 1SB8A 4IXWA 4FB5A 4GPD1 2DPGA 1CQIA 1CF2O 1LDMA 4Z0HO 4XDYA 4ALKA 4ROSA 4RQTA 2OOSA 1XKQA 3ZU4A 4Q3NA 1LEHA 2DVMA 4KDEA 2C07A 5JS6A 4IMRA 3WGGA 3E9NA 2WSBA 4KUEA 3O26A 5TIIA 2VNSA
chains in the Genus database with same CATH superfamily
2DC1A 3BAZA 3KT3A 4HVAA 4YUZA 1CUUA 3OT1A 4QDKA 4WA7A 4F4HA 1JTVA 1GRNA 2CB0A 2F43B 2NQTA 2ZT7A 3FAZA 1T91A 2DJIA 4IGKA 4OHCA 5IAAA 1VKNA 5KNBA 4E4RA 1I30A 1HDXA 5JD5A 1T8WA 3C4VA 1JBEA 4I5FA 4KQXA 4M8LA 1SCDA 4K6CA 4N76A 2IKQA 3MPUA 2FOLA 4CXMA 3CO0S 1QKKA 2XVAA 1E7MA 1T5SA 5JMWA 3ZN2A 1ZLXA 3UAVA 4WXMA 5IZCA 2FPPA 4KGVA 4QAJA 3F5SA 3DEIA 1BXZA 2K6GA 1TM7E 3GAFA 4HDOB 3U4GA 2X2OA 1DTWB 4HI0E 1IYZA 2QTCA 3DMRA 2ODBA 4AJ9A 1MQ9A 2W8BB 5DXAA 3OWXA 4KO8A 1M8GA 4EX6A 4G09A 2GCGA 4H9GA 3EQZA 5A05A 1Z8DA 4UXIA 1PJCA 5I7OA 3RYCA 4LQ4A 1FRNA 1H69A 1HOTA 1NRIA 3JQ6A 1I2DA 4K26A 5LLDA 1SZJG 4GNKA 1SVWA 2A9JA 3Q3IA 3QYAA 2C82A 3K05A 2F7SA 1R4ZA 1J70A 3B6KA 4X24A 5HJ2A 2AYYA 3KEOA 1ENYA 4TMWA 3R7FA 1SULA 5D86A 5SICE 1P9OA 1CUZA 1TAQA 4N7RA 1PJZA 4JA0A 1VJ5A 4D3XA 4DLTA 5FHQA 1UT8A 3WAJA 3PD1A 4JC5A 1EEHA 2R5WA 1DTSA 2FPIA 2Q29A 5LKAA 1KKUA 3ED5A 4BMSA 1WZIA 2VDKB 4MB2A 4AAYA 1C3LA 2KJQA 3LX4A 5JPCA 1PWEA 2F3TA 2GHQA 3Q0EA 2VNJA 3WGNA 1P19A 3PP8A 3JAWB 4PN3A 1VGQA 3BIFA 2ZWMA 1T2AA 3B34A 1CS0B 5LBIA 3AETB 1P7ZA 3HJNA 1E2QA 3ZOKA 2KI5A 3MUEA 3DMTA 1VJTA 3A11A 1E5XA 1H4VB 3VR5D 2EDCA 1A8UA 4UJ3A 1HFKA 4YDSA 3W05A 2PN1A 3PFIA 4FNAA 3TLMA 4GOMD 2QVBA 3OE1A 1ISIA 1NSFA 4JU9A 2PEYA 4HQLA 1HOXA 4OHZA 3TZEA 4BEBA 1ABEA 4ZK6A 2ST1A 5LQAA 1NBIA 4DVJA 1C8VB 4J43A 1E8DA 1GLGA 1GOTA 1ZCJA 3AR5A 3CLUC 3DJFA 3JQCA 1NLUA 4GFDA 1UDRA 3FOWA 3IR6A 5FBZA 3UQYS 3M4NA 1HDYA 2Y4NA 4H4EA 4TZTA 4DDVA 1YQTA 2AKYA 2FWRA 2R2AA 3CSDA 3MT7A 1OLUB 3V8QA 3QKIA 1E2UA 4HB2A 5DNAA 5HRAA 4O2BB 3P2MA 2OEPA 3C3CA 1NP6A 3BWCA 2XWBF 1B2LA 4YAWA 1VHJA 3UK7A 3FRIA 3MMXA 4EA8A 1NPTO 1XFAA 3T94A 4DCJA 1FMJA 4YRZA 3P0RA 4MH0R 3E8XA 5C5IA 1RAEA 5WRFA 4TWRA 2W6JD 1XXHB 1LJ8A 3CVOA 1VFPA 2RGWA 3WQHA 1U02A 2F9FA 2A58A 2PJUA 4PXSA 4MAMA 1XA0A 2GYVA 3LM8A 4PYLA 4F3CA 2AFIA 2W58A 3KT6A 1A7AA 1YRQA 3IIIA 5A2GA 4IY1A 1PR6A 4YR9A 1FFWA 5CLFA 2CCKA 4JEHA 4N7BA 4P53A 1YHNA 2QPAA 3BICA 3SBDA 5CYGA 2W6PA 1M83A 4C0AC 2KX7A 1L1QA 3NHPA 2WD8A 3QPWA 5KQPA 4AX4A 4GI7A 1OXTA 2AKEA 2OCLA 3SQWA 2XCRB 5TDHA 2GPAA 4MUNA 3GEGA 4UHFA 5K4AA 3TQRA 3UATA 2WUGA 4EO9A 2XQIA 1TC1A 2WMOB 4GNRA 1TJYA 4MGHA 5EIWA 5SV2A 4BMPB 1RWPA 3CTPA 3Q6NA 3LUAA 3I6MA 4QQRA 1ETUA 1R0CA 3DV0A 4WZAE 4GOJA 4BB5A 2R4QA 3DWEX 5IAOA 3TGLA 3N0WA 4NHOA 1JEQA 2QENA 2WM9B 4BUJA 1R0SA 4TUYB 4ZAGA 2B8JA 4QELA 3E9RA 3L7NA 4NZNA 3GPBA 1GUAA 5EG5A 1Q84A 3R7AA 3K73O 1TYZA 1BKDR 3N87A 3QOWA 2I2WA 4NI5A 4GW3A 3E4CA 2YFKA 1I1HA 2UVDA 1YQ9A 3PPVA 2XW6A 1RJEA 3ZCXA 3AVWA 1RSZA 2D2IA 1DKLA 2QSUA 3ZE6A 2PWBA 2FRVA 5KUTA 3R9XB 1JG2A 3H3FA 4OU4A 4PYIA 2VJOA 2HJ9A 1G2PA 1DELA 2HD4A 2YXPX 1KH2A 4CU2A 4F60A 1VSTA 1Y7LA 3J7TA 4NV3A 5K51A 3SFZA 3TGWA 1QBKC 4JLAA 1XNHA 2AFHA 5LR6A 3FB4A 3FTUA 3AY3A 4I1OA 4M2LA 3Q7SA 4L6AA 3SSMA 1JL3A 2QVCA 4UCXA 1F1JA 3K2QA 3OPNA 4TN5A 3ZWOA 2II6A 4AUNA 1XXHE 1L5SA 2XUPA 3AJRA 3ZDCA 2YIDA 1VDZA 3IQWA 2C2KA 2X8LA 3PC8A 2CF6A 4IS2A 4V3BA 4TT3D 3U4AA 3H97A 4FGLA 4UMVA 2IE0A 3HQ4O 2ZTVA 1JJFA 3BX1A 3TCXB 4K9DA 1SUBA 1K92A 4K46A 3WK7A 4QHPA 5KBYA 3HL0A 4M60A 3A3PA 2RK4A 4IIXA 1M76A 1QWOA 2D5BA 1G2QA 3FNBA 5DNCA 2C04A 5KI6A 5JCZA 4HAXA 1UMCB 1B76A 1ZC3A 2CXQA 3H9UA 5LZ7A 3AKZA 2FP4B 4MVJE 3PQ2A 2OXRA 2PH1A 3IOMA 5FCDA 3TD6A 2JFOA 1E6EA 3IEPA 1T10A 3EPKA 2R86A 3B2QA 4Z54A 3GZNA 3NDBB 1ZESA 4GLFA 3GLHA 4UCWA 4XGQA 2CJXA 4YV0A 9GPBA 2GZMA 1WZ2A 2ISQA 2JIZD 2VHVA 4NBTA 2GO1A 4DLLA 3VTKA 1R4MB 1AGXA 2QJFA 2PBZA 2J4FA 2LGJA 2H4JA 2OMEA 5LZ2A 1CDOA 5J2TF 2PL3A 4RXMA 2DG2A 3OFSA 4FHFA 5CTAA 3G3EA 3WYNA 3QHQA 3WGIA 1G6Q1 1ISHA 3KOMA 1NNEA 2AVNA 2C00A 3GXOA 1O95D 4ZU1X 3Q41A 3PQFA 1C3OB 2C7GA 2WAOA 3QEJA 3KZOA 2G08A 1WMBA 1Y98A 4ZI3A 5KMGA 4ZKEA 1JG7A 1QO0A 3X2SA 1W4RA 4ZQEA 1C0LA 4DYHA 3EXG2 2EF0A 3SBXA 2CHUA 1YF3A 1GAWA 1XZQA 3SKYA 4EZIA 1SXJD 2CEAA 4UMEA 3K9LA 2AGVA 3QVLA 4NZPA 3GIDA 1Z4QA 1J22A 2P6RA 3EGCA 3P0JA 4WBNB 1GZVA 2V97A 1NRWA 4GC5A 1PTJA 3OQNA 1X0XA 1DDGA 2W2MA 2ZYAA 3C3MA 3JQFA 5BP7A 2PGNA 4GGOA 3LX8A 4WN3A 5HF5A 2DY1A 1R27A 5EQFA 1OXMA 2NAFA 3UUEA 1QBGA 4EMTA 3Q3GE 2INGX 3FIJA 3LOUA 5ALVA 4IZIA 1US8A 1GTRA 2I2DA 2ZIXA 2VWGA 1ZIOA 1WSAA 3DVQX 1A04A 4NE9A 2YFYA 5JADA 4DG8A 5KKCA 2JIDA 2UXCB 2C42A 1SG9A 3PLNA 4JSTA 5EJ8A 2ZZMA 3X2EA 1FMFA 4XN2A 5F2EA 3H7AA 2YIJA 4EHIA 4A15A 1LS1A 4KJXA 3EG9A 1XDZA 4XYBA 4JODA 2RD2A 1DNPA 3HVIA 4WZBE 1X7YB 4D6XA 5HVNA 1YZQA 2NU7B 1HE3A 2FQ1A 2H2DA 3GEBA 2Q1WA 1FNDA 4OHUA 4RVFA 1N2OA 1XZBA 4OQ4A 1DQYA 4XD7A 1IG3A 2IXBA 4HGYA 5JYCA 1OWLA 1C3JA 1P4SA 4IQGA 4NBWA 4MYTA 4IFIA 5EXXA 3FCYA 1MNAA 3O31A 3VRHA 2EG9A 5CLIA 3R7WB 2ZFUA 1J2JA 1D6NA 2WFLA 5IKPA 3L0OA 2NYAA 3ZDXB 4CEIA 1VKOA 1X39A 1XZAA 3V97A 4KYUA 3EF0A 1PEYA 1XEFA 2CDBA 2ZROA 4GM4A 2XDYA 4EAAA 3VDRA 1ZH8A 5CB6A 4YBZA 5EVCA 4UXJA 3V8MA 3UBTA 3AGPA 3AT1A 4ALLA 4MJ3A 4M0LA 5IJ0A 1WEHA 3ME5A 3WYEA 3P2EA 1EFRA 3DBLA 3MS2A 4EKGA 1L3CA 4WJZA 5A3RA 3V2HA 1NLMA 3U48A 2J0QA 3I4CA 4OQEA 2H2FA 3C6QA 3P96A 3Q2IA 5DHAA 1MAVA 3CX8A 4R0VA 3ZCQA 2C7RA 1Z5WA 3MF4A 3HFJA 3HRHA 4Z6KA 3SMVA 1SIBE 2N3ZA 4CEJA 4K86A 1E3MA 1X8JA 1TCUA 2GVNA 1D9XA 5DHUA 5DLEA 3U13A 2QJRA 2TS1A 4FE7A 2NWQA 1LRKA 3BZWA 4NVRA 3ZU2A 5I9BA 4BNDB 2QTVB 4R01A 2AK3A 1PKXA 4KC0A 4WKPA 3RADC 4OGKA 1MH9A 4HC4A 5K3FB 3B89A 2O0JA 3SOPA 1X1DA 2ET6A 2X9NA 1DIHA 3K96A 2GJAA 1RZRD 3CNNA 2ODWA 5BRAA 3JATA 2WABA 3FWPA 5AJXA 5ELXA 2RI1A 2R6CA 3K5PA 3NC4A 1GN8A 4UASA 2XVZA 4KR0A 5I9NA 1BDMA 3MRXA 3ENZA 1UPXA 3FZGA 5M7EA 1AHPA 3U44B 3TD2A 3W04A 2IYUA 1JHXA 4JHLA 4B3GA 2XCTB 1ZC4A 5EEHA 4EUNA 3VR6D 2PSDA 3RSZA 3TDMA 1UBTS 2HHLA 4M98A 3G7NA 3B2NA 2F4VB 1IY8A 1E8NA 1G9SA 2GSDA 4UC0A 3W78A 3WLAA 3ZLBA 4B3XA 3F4KA 1IQRA 4ZJYA 1H6CA 3JQQA 3QV2A 1ZXBA 3UH1A 4K9OA 3NW9A 1GTMA 4HBGA 2WKRA 4M0KA 1YDEA 3AVVA 3HG7A 1JTEA 2ZRAA 1ZGAA 4O1IA 4RJIA 5JAIA 2B83A 4C0LA 1RI4A 2JB9A 1WOYA 1ZVJA 2JLRA 3G17A 1QE0A 3TTYA 2O57A 1MIOB 4ZO8A 2HLPA 3JR7A 3WFJA 4GICA 4LY6A 3Q0IA 4Z49A 5HR5A 3Q88A 4D57A 2QU8A 4IEFB 4FDUA 4MVXA 3MCZA 4KG7A 3UJHA 4R1MA 1TJ4A 5GADl 3R4CA 1KFEB 4UCFA 3UK6A 1NASA 1G7SA 5IC4A 3AKCA 4AKHA 1CDZA 4M7PA 2OYCA 1FNNA 1TKRA 3DXYA 4R0MA 5J2TA 3COJA 2VSXA 2P5UA 4U9HS 3OCJA 1D4AA 3C45A 3B3FA 3EWSA 4KODA 4TQAA 1T5IA 1COWD 4UAVA 5FWQA 4QUDA 4AMGA 4CQMB 1NYRA 1N34B 5A0TA 5B1YA 1JS1X 1Q77A 5KTTA 4YRMA 1KMNA 2HLDD 5IAEA 1CUAA 4L8FA 2H2GA 4LHZA 5H16A 4BUCA 7MHTA 4HLUC 3ILXA 3LA8A 3QF7A 2H31A 5EESA 5CVUA 4WNYA 3PHCA 4IR7A 4AKTA 2X0JA 1E2NA 3KD2A 1SCUB 4IG9A 5U4QA 4MS1B 1YMUA 3CIOA 4KEAA 3RHFA 1ZNXA 5TQVA 1P33A 3HRIA 4CM4B 5B64A 5A5VA 2W4MA 4EGQA 3FDIA 5ALLA 4HSEA 1MQ8B 4CM8A 1PL0A 2O1XA 3AEQA 3MN1A 3NBKA 4MWBA 1SVMA 3UWDA 4BVLA 1JI3A 2ZYSA 1NQXA 3G5TA 4KQGA 2L42A 4ZDJA 3L3BA 4RKFA 4O8CA 1XJWA 5EKSA 1HURA 1BCRA 1DWPA 1N2GA 3RS2A 1PJLA 1L5LA 3AL2A 1LBSA 1L5YA 3AUTA 3FDZA 4HH3C 1IHYA 1KVQA 4FSXA 4KRXA 5THXA 3TR0A 3SZGA 4DM3A 1BMFD 1L1FA 3SF8A 421PA 2C77A 4BQEA 4MO9A 2VT3A 3HXKA 1ZA2A 2QNBA 3ZDFA 3ENWA 4FBMA 1T3GA 2CL0X 3PEVA 3JQAD 4KACA 4WPGA 4IDNA 1ECCA 1Z3IX 5F1PA 2ZTHA 4QOHA 1NOKA 1YCHA 1Z47A 2MMCA 1CNFA 1VOTA 5AR1A 3HDVA 3RTAA 4CV0A 4KXLA 1GT91 2F3UA 2VZ0A 4KXYA 1C9DB 2ZRIA 3KV1A 4H7KA 2PMKA 2X9LA 3UG7A 5JNVA 2CXRA 3DV2A 5EJGA 2YIMA 4PC2A 3NV7A 2OLEA 5HE8A 1OXXK 5A06A 6REQB 1DOAA 3L6BA 2CNLA 3WGHA 1SHUX 3IULA 4FTWA 1IFXA 3THRA 2M6SA 4NHEA 1PNOA 2NVUA 3IRUA 1D2EA 1P5RA 5B4VA 3LUHA 5G40A 1OXBB 4PIVA 1Z2CA 1L4YA 1VP9A 2WOOA 1Q0QA 1JH8A 1XP5A 2ZT6A 3DFIA 1N5LA 4DEXA 4D9FA 4UTVA 3ASUA 5BUZA 1VG9B 1GPWB 4C03A 1KZ6A 3S2IA 1BFDA 5DTEA 2GXSA 3N2GB 3NHLA 4NMLA 2X58A 3B20A 3NYRA 1KZ7B 3E6AA 1SUIA 1UINA 2MAPA 2Y9MB 4HWSA 2DR3A 4WK4B 5JRZA 3IO5A 4GP7A 1W6RA 4PGAA 4Q39A 5JPIA 5B3JA 4KVGA 2PUGA 4OXRA 1P1JA 2D4HA 1KK2A 2YZ2A 2PXCA 1GU0A 1GZ6A 2D1YA 3OLCX 5CRIA 3F90A 4CODB 5CFZA 4Z4GA 1IB0A 2L2QA 5JASA 1JFLA 3P8ZA 2QLFA 3PFKA 4D3YA 1VIYA 1LX7A 3OECA 1H0KA 1YASA 3OC6A 3CWZA 4DUZB 5E2BA 2HMTA 5T6MA 1WX1A 2WTNA 5EHNA 3FETA 2C4UA 4H7FA 3GVIA 4P54A 4P35A 1U3TA 4ND8A 3MRSA 4Q5IA 2HN9A 1HDCA 4YAKA 1W36B 1QZUA 5LUAA 2AA3A 3AHFA 4FGKA 4JSRA 1PT7A 1ZM3A 4WNIA 1XMJA 1YL7A 3UWKA 2ODEA 5EHZA 5EZ5A 1RWMA 3MGBA 3N2ZB 2HO4A 2VLBA 3QJ5A 3BBPA 3NWJA 4CTNA 4L74A 1ZRHA 1Q2UA 3TCNA 1RKUA 2HO5A 2OAP1 4IXMA 5GZ6A 2Q27A 2ZYTX 1PG2A 3VTZA 3NBXX 3K71B 3UCEA 1Q7BA 3AB3A 3OX1A 4IUYA 3RC7A 3FH0A 1JNYA 4RVDA 5DNUA 4HYYA 1UCFA 3HBAA 1A4UA 1MO6A 1T2EA 3PL1A 4LCJA 4CL8A 3IQGX 3OZSA 2FLKA 4CCWA 1NVEA 1QRRA 5F3RA 5ALMA 4MKFA 4I8XA 1Z36A 4K88A 5B7PA 2ZYRA 5HKKD 1NXWA 5DP2A 5E4TA 2ZUFA 4P4TA 1SQ6A 2GEUA 3WB2A 3E1GA 2I6SA 4UM7A 4EJ6A 3N76A 4RSHA 1VL0A 5KNDD 2QRKA 4JI0B 4FQ5A 1J2EA 4NEGA 4RE5A 4YRAA 2PMFA 4BGIA 4XDHA 3KQWA 4BCBA 5HRCA 2QL6A 1O95C 3Q7EA 3O3NB 5CVCA 4FFLA 2W2NA 4DC1A 3HJTA 4YMUA 1SMKA 2K2WA 3QXGA 1Y7HA 2G7MC 4Q15A 4A6DA 5KJ6A 1XHFA 4OI1A 5G0SA 4IDHA 1G0OA 1W0CA 2A86A 3UB2A 3GFGA 5DLDA 5AENA 1CB7A 3I9LA 3A6KA 4XN8A 2NP7A 4CMEC 2I2BA 3NHYA 4I0WB 1F8XA 2GZ1A 4RQAA 2NZYA 2Z2YA 2QGFA 3N28A 1AUQA 5EP2A 3OIVA 4N3GA 3WGVA 4Q9JA 3GN1A 2ZJ8A 5BW4A 1BX1A 2D06A 3KEMA 4N18A 4YONB 1U7ZA 2J46A 3MTIA 3RRYA 3L4BC 4K81B 4RGYA 3IUYA 1PL8A 5E1MA 4L85A 4KAJA 3V5NA 3CLKA 2FSSA 3X2FA 5ALZA 1IOVA 1Y9JA 3U3OA 3TX6A 4C88A 2OG1A 3DE5X 3CY6A 3GHYA 2RIPA 4IIYA 2XF2A 4U8HA 2XMGA 3L0ZA 2XGGA 5LJLA 2I03A 3RJTA 2PL1A 3I05A 1YD7A 4LISA 2GBFA 1A5BB 1FYVA 2I99A 4HCJA 1EFPA 2GQ0A 4ML3A 3RJ5A 3TD9A 1N6KA 3KP1A 4AYWA 1T2DA 3R0ZA 3RUEA 1GGNA 2EEPA 4Q05A 1UH5A 4QO7A 3UMBA 5BPPA 2YN0A 4KV7A 5FWYB 1E62A 2B7CA 2AV6A 2H1VA 1RQ2A 4FS3A 2QSJA 2HQRA 4L9RA 4S1PA 621PA 1U3CA 2X5JO 1OZHA 3FOZA 1KMQA 1UKZA 3K0CC 2KBEA 1MB2A 5EE5B 4RTMA 3EFBA 4FLRA 4X84A 3UOGA 4DV1B 2VN8A 2NV2B 4PYNA 3I28A 4IHJF 2AQIA 4MR8B 1XTQA 4X93A 3AR6A 4NBNA 2O2YA 2E4YA 2OQIA 2DHRA 1NUHA 3LXUX 4OVKA 5KSPA 3A32A 3H1BA 5AKHA 4WZZA 4EHNA 1UIMA 3MCUA 2JDID 1F0YA 4I08A 3TL6A 2CV2A 1MJGM 1V4VA 3CF2A 4FP9A 1C3XA 1XZHA 4QNMA 3PKJA 1P91A 1VL2A 3Q9LA 4N5IX 4V0SA 3W2GA 1KGDA 4XLZA 4XN7A 1DKOA 3RM3A 4F3RA 5JOQA 2FN3A 2AI3A 3FPFA 5ALQA 1B8UA 3D6JA 3CH4B 5BWNA 1QLHA 1O54A 1XRNA 3H99A 1JT2A 2V7VA 4UUBA 5ALFA 4BV9A 3BQ9A 3KQYA 5HJ5A 3PDIA 3L1HA 5J47A 1GGHA 1VI6A 2Q28A 4F6CA 1R6AA 4EQ6A 3W6ZA 1DMRA 1TQ6A 5IJ9A 4YJHA 4IDBA 3P9RA 3OLXA 3RUCA 1UC8A 4M9CA 5LUBA 3C87A 1G41A 3KKOA 1YOVB 3L8GA 2ZBRA 4WN9A 1KY4A 3NNSA 3X1WA 1M6WA 4D1YA 5IDQA 4JR0A 1AN0A 5F35A 2QEQA 2WAXA 2ZRDA 4K1LA 3QI2A 3IPRA 2J9GA 2Y77A 4MEAA 4PM4A 2W2QA 2B3TA 3D3EA 1B16A 4RVNA 4UU8A 2O3SA 2YBEA 5GJWC 5IXYA 2Z5FA 5CR9A 2PCLA 1HTTA 4LBZA 4JI6B 2BZ1A 4RQBA 4D4JA 4UBOA 4MWTA 3SN6A 2YQZA 2M1ZA 4ZEMA 3HBLA 3UEOA 1VSQA 3WX0A 1Z18A 1KO1A 5DNVA 2D00A 4DV5B 2DFLA 3NWBA 1IG0A 2ODNA 2P9FA 2RBKA 2RGRA 1FYEA 3VHQA 1UP7A 2ZTSA 3JCZA 1I36A 3K16A 3KJHA 4CNBA 1AQYA 3THOA 4IV0A 1UBEA 1L7RA 5JR3A 1L7QA 1E2GA 1YR3A 4FD2A 1GPBA 3QELA 3M2PA 4A4DA 3PIIA 3Q3EA 3C7TA 2FJ0A 2VDOB 4IOKA 5EXSA 4ZQGA 1II8A 2KWIA 3F46A 2OLJA 4GQBA 5EIBD 3M4YA 5AKYA 2GEJA 3T9FA 3V4OA 1A1VA 1UFRA 4KQFA 5DBEX 3DXXA 2R70A 2IYOA 4JP1A 4OMDA 4YP6A 2B1RA 2ZRHA 2RHJA 3C3XA 3SD7A 4P34A 4RZSA 5AW9A 2P2LA 2RFLA 4AJLA 2HDWA 2G9ZA 5HQ3B 4CTMA 2CZCA 4FE4A 3CN7A 521PA 4IFBA 1Y1QA 2RHWA 3ZI0A 3DYBA 3IAHA 4IDGA 2HU5A 1A27A 3ND8A 1Q50A 2IDJA 4TN1A 1V1RB 1UBNA 3HBNA 5YASA 4GI1A 3JWJA 3MXTA 5LA6A 1YH3A 1XYYA 4LE2A 4FYYA 4JI1B 4C08A 2X2PA 1HBJA 4DE5A 1Z0KA 1MVLA 3G1UA 3F6PA 2CXUA 3OOYA 5LYYA 3RUAA 1N2CB 5TQ2A 1NVTA 3DZFA 1DO0A 2X0KA 4YRPA 2HA6A 1II9A 3R5FA 4CE6A 2XI4A 4JB8A 3QJYA 5JXJA 2BHTA 2W6OA 5LQUA 2HDHA 3WYFA 2VJDA 3PR3A 2RHGB 3WI7A 3U2QA 5KWIA 2C8LA 2XODA 4ZJZA 1TEZA 1N9ZA 1PVDA 1O03A 1PZXA 2FW8A 3DJYA 1ONSA 2O06A 4Q1EA 5C5CA 3MGAA 1HMPA 1FFAA 3P32A 2QXUA 3D0RA 1G1MA 1Y9ZA 3DFKA 1W4BA 2VPYA 4AQDA 5CPBA 2RH5A 3DCIA 1YZNA 4ZGWA 5BYAA 1OU0A 4IICA 5C4IA 1KWGA 1PLJA 2ORIA 3X1DA 1F38A 1N7JA 1AF7A 4L4SA 4YHHB 3B7TA 3IO3A 1LPNA 1V16A 1VDMA 3FM9A 2WJ6A 4ZOLF 3GGGA 3KKKA 4AFNA 2GKGA 1IQ0A 1NLZA 3CZ9A 4E21A 4DV7B 4OEHA 2A67A 1OV6A 3RLFA 1MMFB 4EM6A 3TSAA 5LOVF 3TLJA 3OKAA 4RVOA 2J3LA 4YRKA 2WWGA 1S1CA 3SWWA 1T2NA 1WMEA 2ZUTA 2XZOA 1EXDA 3C98A 5FLXA 2F1OA 5CAEA 1V2HE 2QVWA 1CRZA 3ZR4B 2GD6A 1I2AA 3FPAA 3T41A 4DMMA 3BKWA 1GJRA 1XCPA 3I9MA 1PBTA 3CZRA 4JQCA 1NLFA 2ARKA 2H6EA 2PYZA 4TS3A 4BV8A 4CHTA 2F00A 1HLGA 1D0SA 4JU8A 1EGMB 4IHJA 3AO0B 5ALSA 2ZIWB 3LKVA 4IGFA 5ALXA 3ADDA 4TWZA 3GLFA 1CY0A 3OCYA 4YLEA 1JFRA 3C7DB 4G1UC 1CDEA 4JUFA 1BG6A 4D8TA 2BHNA 2QYOA 4WA8A 4A0FA 3TSWA 1TUBA 4K03A 4FXOA 4CIAA 4P33A 4C3OB 1TAGA 1U0FA 3KG2A 3GNQA 3IR5A 4BVFA 1BWQA 4WERA 1YKFA 3WRWA 5EWJB 5CT5A 3ZX5A 4I4LA 3WGYA 1QP4A 4D26A 1YQQA 2AR7A 3TLCA 1T24A 3M1IA 4OHVA 2G82A 1QYCA 3OZFA 4QREA 1R8JA 2QSZA 2PZGA 4NSNA 3ZWNA 1DXHA 5KAMA 4FGWA 4K5LA 1VRVA 4ZU3A 1LK0A 9ATCA 3EFOA 2BEUB 2M6KA 3ZHBA 1JKIA 1CUCA 2V5AA 3F5MA 3UENA 1DEXA 4QUOA 4LECA 1ADCA 1JHYA 3DMGA 1LK5A 3MTDA 1GQFA 3G88A 3VSCA 3O2JA 5CK5A 5BW8A 5AM3A 1U04A 5AM2A 2UYOA 2BSAA 3HMQA 3NDRA 1R50A 4IYRA 3RU7A 3ZU5A 2CK3D 1WDKA 2IDKA 1NBHA 2AC4A 1KEUA 2O0MA 3FNGA 5IVPA 1PYOA 3UTCA 5AQ1A 1M1YB 5K3BA 2Z6AA 2OLKA 5AOCA 3IQZA 4D5GA 4WVFA 4TTIA 1Z0UA 2CLEB 1YVUA 3G0GA 1KGSA 4YECA 3K1AB 4CMJA 3Q3CA 3OY7A 4US1R 4TLLB 2AEJA 1ISMA 1F2TB 1J06A 1CVIA 4QBTA 3K9GA 4AMBA 1URPA 3L6CA 2ADOA 1VPEA 3D4OA 4PAMA 2NT3A 2VYQA 4AW9A 2BFOA 3QX3A 3D8UA 1AH2A 1PW5A 4WXHA 4QUEA 3TOSA 3PJGA 4IIJA 5LB2A 1YTUA 4I1YA 4MV8A 2VATA 3P19A 2C29D 5IKXA 5LQSA 1RTKA 4N0QA 3CV3A 4EJSC 3TB6A 2P78A 2P6MA 5K8TA 4RGQA 1LQTA 1OMOA 2I1QA 4BN0A 1TYEB 4R54A 4PGGA 2CZQA 4HTFB 3UW1A 3HACA 4WJLA 1NF2A 3GFBA 4H7DA 4Q1AA 1SU7A 1IXKA 4NATA 4TMZA 4CMHA 1JKJA 1A0OA 1QH1B 3MS4A 3TDKA 1KARA 1AQLA 3CLSD 2WAYA 5JBQA 3EWNA 3DMDA 5THQA 4MMYB 5BV0A 5KOHB 2VTEA 3CVJA 2QL9A 5K3OA 2HNKA 3IIEA 3QRWA 1HEIA 4BNJA 3DT9A 5DULA 3WOVA 2O4UX 4QRIA 5JSYA 2HUNA 1IN4A 1QCZA 4JDUA 5KTKA 4W5NA 5EMJA 1PD1A 5IVDA 4KNWA 3SEAA 1VGRA 3SNHA 1ULUA 4NIMA 1CR4A 2C8JA 4QSMA 2H4HA 3ZWDA 1V3QE 4MJXA 3OQIA 5T3UA 4AXBA 4J91A 3QLUC 2ZJ2A 1DRKA 2WLTA 1ICIA 4GH5A 5HCUA 3IE1A 1MENA 1OH6A 1FQJA 1C7EA 3RU9A 4OBEA 1KVRA 1KFKB 5C52B 1GUDA 4MCJA 1PYGA 4PPNA 2G77B 4MDEA 3E9EA 3PGMA 2FEPA 1B1AA 3DWGA 1YE3A 3EEFA 1X9GA 3T8YA 3ZU6A 4ZDKA 4PBTA 3ANMA 3BXGA 1XPOA 4YRBA 5BSRA 1G5QA 2QHXA 3VXKA 1U5BB 4X71A 1UM9B 2AQKA 2Z83A 3QEKA 5D85A 3R09A 4Y2TA 5FNVB 1Z2PX 4MQ6A 1PL6A 3VR5A 3TOCA 3QP9A 2RMKA 3QEMA 2FPGA 1N0HA 2C0QA 4IMPA 2JGDB 3G82C 4TWIA 3WP1B 5JJKA 1MTOA 4ZOLA 1FDWA 4KV9A 1TPZA 5E7JA 2ZUVA 2BD0A 2XNHA 2DR2A 1Y42X 5L6MB 3HJRA 5LOVA 3JVDA 3B9RA 3EGXA 4HDCA 2Q9CA 3OE7A 1UJMA 1EP2B 3HSKA 4KQMA 5DXJA 3VX3A 1DLIA 2Q0XA 3PQ8A 2UYCA 1G20E 1NNI1 4HLUA 4CG1A 4XRGA 4TZ6A 5H5JA 1NDQA 1VE7A 1BU8A 4LJAA 1MOQA 3H75A 1SBHA 2PHZA 4PQGA 4TT8A 5FH9A 5JVDA 2VTBB 2HRDA 2UYQA 3KXLA 1JZQA 1KP3A 2ZBQA 5HGXA 3HEMA 4AP5A 1E1DA 1KJIA 3IJEB 4CKBA 4DR5B 1DAHA 3CNLA 2PZLA 2UYYA 3LA6A 4TSKA 1HY3A 1Y3IA 3ITNA 3PXXA 3QVMA 5BQ3A 3WHPA 4QT0A 3FTZA 1OGYA 2IBSA 5AW1A 2BYTA 3B7RL 2W6JA 5KHAA 5TR9A 2Q5HA 1N25A 1TMKA 3QUTA 3V33A 4TWBA 3QPAA 1Y5MA 3MJFA 1DC6A 1SD5A 4YRNA 3T0FA 2FCRA 1HLDA 4RJ2A 4MI1A 2HWYA 4HYTA 5ES4B 2VHEA 2CJYA 1PR5A 2AOUB 3L04A 3TI7A 3BRWA 1PFGA 3OQPA 4ZCIA 1JB1A 3LLUA 2YHIA 3NS7A 4Q66C 2A5LA 4DUPA 2WKSA 2OCAA 3SHTA 2C7BA 2J3HA 2KHZA 4I55B 4KI7A 2G80A 2KMLA 2QGZA 3ZYCA 4KUGA 2IITA 4NESA 1G5RA 2MCFA 2Z2KA 2I6GA 2W71A 3QF4A 5ILOA 3T3DA 1M2NA 2WYIA 5I4CA 4B8WA 2WKQA 1WMAA 4TROA 3ZVRA 1HEUA 5CCDA 1NW4A 4RULA 1CEYA 2H65A 1LUAA 1NBMA 2NUPB 1LW7A 3UNXA 4Z3KA 1E3WA 3CJTA 1TJ3A 2NNWB 5DI9A 1K5DA 3GGPA 1ZYUA 5EJMA 5B1DA 5EIHA 3F7TA 2NQ8A 1Z4OA 4OK6A 2PH3A 3L9WA 4JQYA 4ZARA 4JLJA 4DJFC 1SB9A 4YCSA 1S2DA 2PJZA 3GOQA 4Z4CA 4YBRA 4JLOA 1U7DA 1MJHA 4OQQA 1P4GA 4PHTA 3L8ZA 1PAUA 2PZMA 3GRKA 3W9SA 1I13A 3P4YA 3GA5A 1T36A 1UC5B 1RVDA 5D5PA 2GCNA 3QY9A 2AIRA 3S2SA 3GRAA 2E18A 1P45A 2HSGA 4FDTA 3SKVA 2Z8YA 1OLXB 2IYFA 3F96A 4MLDA 5C2JB 3KJZA 1A7JA 3KOOA 5DI3A 1SK8A 3U0VA 5HKBA 4GDFA 2GPSA 2GAAA 2IEZA 2N1MA 1R88A 2XUIA 3EVDA 4LTDA 4F4JA 1WQ4A 3TVYA 5ECYA 1R10A 1MF7A 3NKVA 2LE0A 4I1IA 1MAAA 5DWVA 3F5FA 4EA9A 3AIKA 3JAKB 4YDHB 1FFCA 4F5WA 4F4CA 1CBUA 4LRSB 3TECE 3EFEA 3LQRA 4TYQA 4ESEA 4IMIB 3P45A 1R0BA 1WUYA 4XIIA 2XGJA 4R7LA 3IKMB 1OD6A 4HGPA 2XZLA 5J4VA 3T7TA 4LV8B 4D0NA 4HX2A 1YR7A 1JG6A 1CT9A 2DJ5A 1P7VA 2JGEA 4OREX 4A5SA 1TCVA 3GUCA 3KSBC 3IESA 4DXHA 4DCSA 4KPUA 3GLGA 2O05A 3FPHA 5G4KA 4R7TA 3RSCA 2UUBB 2L17A 1KAGA 3HNRA 4O4JB 3GCGA 3QVJA 3RNLA 2GUGA 3DDCA 2EV9A 2AZTA 1OKKD 3ZHRA 5DNWA 2Q3DA 4BRUA 2WQZA 3HVKA 4O59O 3LD9A 1FJGB 2HT1A 3VNRA 2GVDC 5FXMA 5LL6P 1PF7E 1RT9A 3FFBA 3F5DA 4FFBB 5AKIA 3FFAA 3E61A 2BMJA 3GO4A 3OEEA 3OU7A 5CH5A 3R3HA 1AXGA 4I50F 3VYTB 4JLPA 2O8EA 2ECOA 2JK0A 2X15A 3V4ZA 2ORYA 1KDRA 4NQRA 1V8OA 3CNBA 4OQDA 4ZTUB 1EFTA 2OCIA 3T7EA 1KAQA 3HL4A 4TWJA 5DP1A 5EJ5A 2V8OA 5A3SA 4BCDA 1EAYA 1TGVA 1CR6A 3P7MA 4J0IA 5TPWA 1HO3A 4DDMA 2PQ2A 5IAJA 4E15A 5DW0A 3KNZA 2PZKA 3CF4G 1QIEA 1RU3A 3LCMA 1ULZA 1T9KA 3LQ2A 4ZFNA 1C3VA 2IVFA 4RKYA 4EPRA 3T5TA 3WNQA 5K0GA 1O95A 3I72A 1HWYA 4G0UA 1KAEA 1Q16A 5E7MA 3T5CA 2W6ZA 3K6RA 1SG6A 3JD2A 3LY5A 4G85A 4PTYA 4OHRA 1BS1A 5D2CA 2VP0A 4IZOA 5HQTA 5HXAA 3QVOA 4HO1X 5K3CA 1PSWA 3JV7A 5HWSA 3PC7A 4DARA 1KRWA 2FUG6 3QH4A 3L0YA 2MSKA 1W581 2W43A 4IIEA 5M2QA 2ZJYA 3IALA 1XJCA 4WK2B 3QA3E 2WNIA 4CMEA 4FZVA 1KYZA 1FA9A 1WHTA 4Q02A 4ZXFA 2JASA 1CWUA 2IXFA 3X1ZA 1VRCA 4EGSA 5CLJA 1NJ2A 4AJ2A 4DY4A 1MJFA 4TYYA 1LSJA 4CDGA 4LF9B 1NJFA 3AUFA 4YQEA 3R7BA 3FVWA 1AS2A 1NUSA 1R15A 3KBOA 3L4BA 5HKOA 4RTNA 4S1OA 5CJPA 3PQ3A 4RPJA 4XIGS 4JNDA 3TW8B 5KC9A 1SCJA 1UZMA 4CG2A 1JHVA 4CIYA 3ZNPA 1OIXA 4LDZA 5FLKA 4HH1A 2PRZA 3ESYA 3PFNA 4XARA 3CPEA 1PT6A 3NIDB 3NI2A 1OFTA 3AUUA 3G0HA 2V55B 3BL6A 5TGDA 3SZLA 2ZIVB 3NX4A 1AY0A 2FG5A 5I7AA 3V1KA 5AHKA 5EMNA 1UWVA 1YBHA 4KITB 2IUTA 1V8FA 2VF2A 3WL4A 4FMPA 4NCJA 1ESDA 1YS4A 2CJWA 1W85A 1GPNA 1IATA 2X3YA 3GRUA 2XMDA 3GRYA 2FW6A 4LS3A 1NW5A 1UDXA 1YFLA 2LCQA 1G64A 3ZD8A 3K0CA 1UJ6A 1NVVQ 4M22A 1A2BA 1IZ8A 2AE1A 2Y92A 2ZWPA 4U7FA 4XVQA 4Z0NA 3THXA 4L8WB 5LP6C 1A1SA 1GG5A 1GZ4A 2VSFA 2ILVA 5FAXA 1UEXC 4C43A 4YAGA 4ENWA 4U2FA 3R9IA 4LOKA 1LCIA 2A5JA 2X7XA 2DWOA 4KOAA 1ZXLA 1RYNA 3L0PA 2P65A 3OEWA 1ECBA 2QRZA 4FUTA 2RBGA 4Z4IA 4P6VF 2DSNA 4DDTA 4MUJA 3CF4A 4KPFC 3HP1A 3Q7TA 4H7IA 4CDRA 4BX9A 2QQEA 1LPAB 3DEZA 3NH9A 1I8TA 2EJCA 4DHEA 1IHUA 4X5OA 1MW9X 5CBPA 1Z6XA 3GI1A 1SQ0A 2IU3A 1DCFA 3PGJA 4Q7JB 1KYXA 2VEDA 3L8FA 4C6HA 4RIGA 5A71A 3OFND 4D25A 3PICA 4JGIA 1RZUA 2ERXA 4UVHA 1ZFNA 1N1MA 2ZQZA 1JZTA 1LQUA 2IBMA 4AG3A 5BT8A 2FN8A 1GKYA 2G1KA 2J32A 5EWLA 1ZMTA 1REQA 1VBNA 1NDUA 3CF0A 3T9EA 1GYPA 2QPTA 2P77A 2WUEA 4GT1A 1HT2E 4Y1RB 4NXMB 3JYHA 4TYPA 5CB0A 1NXQA 2PYIA 4F93B 2ZU0C 2ZJ7A 3OH8A 5FA5A 4BP3A 2WINI 1Z8FA 2IF0A 3DO5A 1NTRA 1V47A 1VXRA 2BVNA 2DTXA 2IIBA 1BCSA 1C1DB 3EDQA 3KT8A 4R9UC 5AI4A 4EYOA 2Z2XA 2I3BA 2DLDA 5KJCA 1JSXA 4DABA 2QLMA 2H63A 2RJNA 3GLIB 4WKCA 3LVFO 3OTHA 4NK4A 4AMYA 5KHLB 2H4YA 2P7HA 1JALA 3E81A 1X70A 3DBIA 4DSTA 1OXKB 3AHEA 3TM4A 3F2IA 1WJGA 4YAUA 4A1OA 1KI6B 1BGXT 3VR6A 4EYGA 1ONBA 3QFSA 2FN9A 2LBPA 4A9AA 3VOTA 4Z9AA 3I5AA 2BGGA 1K66A 3LUPA 1GAEO 1JP7A 2ENUA 1CYDA 1T2CA 2ZIAA 5I51A 1MH1A 4HUQA 4QVKA 1GG9A 1JEJA