4ZQEA

Crystal structure of dox-p reductoisomerase in complex with magnesium
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
407
structure length
400
Chain Sequence
TLQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 139
structure length 400
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqeA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqeA01
2HMVA 3U62A 3UAGA 5IXYA 2ZTMA 5EESA 2FRDA 4A27A 3H2SA 1HXHA 3DFZA 3WICA 4NU5A 1U4SA 1MXFA 2PH3A 4NR0A 4BV8A 5IDWA 3U5TA 5CG1A 1LBEA 3CKYA 4XZ3A 3KETA 3CZEA 1TVEA 1E7SA 1ISGA 3NTRA 4KOAA 4B4VA 4CV3A 2DT5A 1P1RA 2FWMX 5H83A 3DWFA 3G3EA 4DGSA 4E33A 1DRVA 3DMYA 3PRJA 3UW3A 4KDFA 1U3WA 2DC1A 5G4KB 1CDOA 4XJTA 5A3VA 1LC3A 3DBVO 3OM9A 1X7GA 4ND4A 1WAMA 4ALLA 2I6TA 3B6ZA 4CLRA 4L0QA 3H3JA 1U3UA 1X1EA 4CMIA 2J5RA 4PG4A 3IUPA 5F5LA 4RVHA 1ISMA 3Q1LA 5U9CA 1DFIA 1I3MA 4CJXA 1GUYA 3K9QO 3CTMA 3I6QA 1PJ2A 1R66A 3GHYA 5ICSA 5EERA 1SB8A 2XOXA 4HY3A 3RKRA 4A5OA 3BMOA 2IZZA 3E9MA 1FDSA 2W4QA 1FMCA 1B16A 1ZXBA 2C29D 4WCFB 4ZHSA 4DQXA 2VHXA 3QHAA 4ALMA 2VZ9A 2EF1A 3BHJA 1D8AA 4JBHA 2GR9A 4OHUA 4RF2A 3TSCA 1DIBA 2C2XA 3BMQB 2B83A 4YJHA 1IL0A 3U4HA 4JJFA 4AFNA 5ITVA 1O5IA 5TLSA 1WZIA 1D3AA 4W82A 4BNYA 1GUZA 2WE8A 1JTVA 3FSRA 3KV3O 2YDXA 3PJGA 4CL3A 2XXJA 3AUUA 1A7KA 4FR5A 3K8ZA 3UF0A 1W0CA 4HXYA 4BGEA 4M49A 4BKOA 2QW8A 5TQVA 1XWFA 3E9NA 4DA9A 1Z7EA 2NLOA 4AJNA 4C4OA 3ICCA 3K6JA 2X4GA 3R1IA 4EEXA 4FD3A 1EUCA 2NTJA 2RH8A 3PPIA 4QUKA 4K6CA 4P8RA 4BGIA 4PZDA 2O3TA 4DIBA 4J1SA 4FFMA 3ROPA 3TZKA 1TT7A 1EUZA 3EAGA 4NBWA 1RM3A 5AYVA 1PWZA 2HMSA 2GYYA 5TT1A 1T2DA 2YHUA 4AJ2A 5JLAA 3OMLA 2O3JA 2WE7A 4RQTA 5G0SA 1LI4A 3L4BA 4XYGA 3DZGA 1E3WA 1K6JA 1NFRA 4FGSA 5DCWA 5I7VA 2CDCA 1PX0A 3PHIA 4IY1A 4YBZA 1KVSA 1HLDA 1ZO8A 1BG6A 3TQHA 3A1NA 4PLYA 4F6LA 3OECA 1X13A 4UVEA 2JCYA 2VRCA 4R1TA 2BELA 4II2A 1MFPA 4BNTA 4ND5A 2BGKA 4MOWA 3ST7A 4DXHA 3GY0A 3PEFA 5EQDA 3PJFA 3KYDA 2J8ZA 4J43A 3JSAA 1UXGA 8LDHA 1HYHA 2W2LA 1HRDA 2O7SA 2VNAA 3HDJA 3ULKA 3VPHA 3RBZA 4XR9A 3DOCA 4CLDA 3PWSA 1EVYA 4FFNA 1UR5A 4ZA2A 2NU6A 4HFJA 5K6AA 4BVAA 4EJ6A 4U5QA 1HDXA 1ISJA 5EQFA 1ENZA 3JQ7B 3A06A 4GL4A 2NUAA 4BL5A 5TGDA 4KTVE 1T26A 5L7YA 5L4NA 3DZHA 4J2OA 2VRCD 2ZYGA 4O0LA 5MGBA 4J4TA 3E5RA 4IGEA 5G0WA 4M87A 3E5MA 4K6FA 4A03A 4OM8A 1KEPA 1F8FA 3VZPA 1DIGA 3BTUA 4ZQFA 4LUPA 3UEQA 4M55A 4GLLA 4NQZA 1E1LA 1H2HA 3WG9A 4BNZA 1AUPA 5HRUA 4OSPA 1G6KA 4YEDA 3L4SO 4ONEA 2A4KA 3WOHA 3FBGA 4YTEA 3GDFA 3I3OA 1XCBA 3EGOA 2DBZA 2Q49A 1EVIA 3CIFA 2V7PA 2VZ8A 1XU7A 1YKFA 4MIYA 4GX2A 4UEOA 4AJLA 2C59A 2GN6A 4AJEA 3D5QA 1Y9AA 1LLCA 1YL6A 2R2GA 4CLRB 2BHLA 3I4CA 1E1NA 4ZVVA 1EBUA 4PVCA 3ZV3A 2YJZA 1E7YA 1ONOA 3EVNA 4HWKA 4CR8A 5ICMA 1E7WA 1EE2A 5JAZA 2XXBA 1ONPA 1BHSA 4I9UA 4IMPA 3OJ0A 4E12A 4B8WA 4BB5A 3BMOB 5MDHA 5CDUA 4ND3A 4MDHA 1U3TA 5L3ZA 2HO5A 5C5IA 4H3VA 1SEPA 3ADPA 3HB5X 3G17A 3DHEA 4BO9A 3GVPA 1P44A 1I01A 3U4CA 1UXHA 2RCYA 3BYZA 3ICPA 3RWBA 3VVBA 5KJFA 1J49A 4CQLB 1MC5A 1RM0A 5TIIA 2JCXA 4XRGA 2NWQA 1ZSVA 2IXAA 1C14A 4AJ4A 1DBVO 1RWBA 4CMAA 4FC6A 1LTHR 3D7LA 4BHTA 5IG2A 3F4LA 4LVUA 4OQZA 1EK5A 3HWRA 4ESOA 4RVFA 1GQ2A 2OFPA 1J0XO 4Z9FA 3KXDA 3WWYA 2O2YA 1N5DA 3Q3CA 1PJTA 3GN1A 5IF3A 5DBFA 2EW8A 4CMCA 4L76A 4FFPA 1FJHA 2BRUA 1JKIA 4TROA 3WYBA 3U4IA 2YW9A 1Z82A 2J3JA 1PTJA 4MVJH 5TJHA 2OGUA 4CUZA 1ADGA 3K92A 4NNJA 1E3WB 5HBRA 2CSUA 1I2ZA 2X9VA 4Z9YA 2D3TA 9LDBA 1ARZA 1K89A 3MJVA 4R01A 5F5NA 1EZ4A 2DUWA 5KJ1A 1MGOA 3AM5A 1UP4A 2E49A 2VOJA 2ZJ0A 3RASA 2O3SA 4OOFA 3PVZA 4IS3A 2D1YA 3FNGA 4FLOA 4XR4A 1GYQA 5JY1A 2POQX 1ZKMA 1M66A 2FSSA 2JFFA 3F47A 4ID9A 2C7GA 3VZSA 4DMLA 3FWZA 5A9TA 1XELA 3GG2A 4CV0A 4JGBA 4EGFA 3BIOA 3GGPA 3AI3A 3F5QA 3TPCA 6ADHA 4J0FA 1MFZA 4JP3A 4P4NA 3CEAA 1DC5A 2P9GA 3ADOA 4DQVA 3LF1A 4CLOA 1PSDA 3PHLA 4LK3A 2NVBA 3H5RA 4MVJP 4I1IA 1B0AA 3H9GA 4YB8A 4B4WA 4LRTB 1OC4A 2ZK7A 4WE3A 3W8FA 4NBVA 3DOJA 3PDJA 4MVJM 1Y5MA 3ROQA 5L40A 2AMFA 3B1JA 4EUHA 2O4CA 4NFHA 4CM8A 1O8CA 4YAIA 1N7GA 5A03A 1UP7A 5A04A 2BFAA 5KOIA 1G0NA 3AUTA 4GKBA 4RZIA 4NJMA 1ZH8A 2YV1A 4EYEA 3M2TA 4FC7A 3MCVA 3QWBA 1TXGA 4WEQA 5IZCC 3IMFA 4BV9A 4U0JA 4MPDA 3P7MA 1EEHA 2WJPA 4JROA 2CNBA 5THQA 2Q2QA 1BW9B 4QO7A 5TRTA 4ZICA 2HJRA 3ZI0A 1V8BA 1YL7A 2YDYA 3SX2A 3B20A 4L4SA 5ER6A 1EQUA 3DZKA 4ZQBA 4LCEA 5I9NA 5IDQA 4HADA 1NASA 4E5NA 4KQWA 3CZRA 5HWSA 2TMGA 3KYCB 3WNQA 3BA1A 4WOKA 3S2FA 3W8EA 3AM3A 5L4SA 4FN4A 3ETGA 4XQCA 1PGJA 4XIYA 2IEBA 3GZ4A 1T4BA 3CMCO 3AUSA 4GX5A 1KETA 3QE3A 3S1LA 4D42A 4W7IA 2Q2WA 3ZCXA 4BQRA 5KVCA 3HHPA 4IM7A 3OEYA 1Y8QA 5A05A 3GA0A 1DDOA 3ROKA 2UVDA 1AE1A 2JKVA 4W9NA 3JYLA 3DAFA 3JQEA 3M1AA 4RJTA 1KBZA 4UVGA 1EE9A 4RVDA 5KVQA 4BNVA 1UDBA 5B4TA 4WLUA 4AYSA 4WUVA 3ZNQA 1VL8A 2O3RA 3SXPA 1NPYA 5BSGA 1T24A 1Q0LA 3FNHA 1LDGA 4Z0HO 3T7EA 2ZB4A 5JY6A 4CM5A 2NM0A 3QVXA 4GGOA 5DULA 4IUYA 1A4UA 1R16A 1B26A 1OOEA 4GMFA 3SBOA 4B3JA 5CFZA 2JHGA 3UCQA 4E5KA 5FFFA 4A73A 2NSDA 3MOIA 3I52A 1F17A 4MKZA 3GK3A 2Q1TA 1XKQA 3HSKA 4RVGA 1B7GO 2VUUA 2Q2VA 1B3BA 1QV7A 3LSYA 3WBFA 4D7AA 3KOUA 1KIFA 4PN3A 2A35A 1R4MB 2EV9A 1NR1A 2DVMA 2R00C 3KZVA 5T67A 1YRLA 1JAYA 2AQHA 5JCJA 1D7OA 3LDHA 4FS3A 3HADA 5JC1A 2GPTA 1F06A 4EW6A 3STHA 1PGPA 2VYVA 5DOZA 2ZIZA 1U2DA 1ORRA 4AJIA 3FTPA 1YE3A 3Q6IA 2VWPA 4J7UA 1HE3A 5HS4A 3TN7A 5JAMA 2GNAA 3EY4A 2J5KA 3TNLA 4EZBA 2WDZA 4JJGA 4XYLA 5T6BA 4GKVA 5TJ9A 3VPXA 4HBGA 2BKAA 1O6ZA 1SNYA 4DWVA 1SC5A 3QWIA 1K6XA 3RKUA 1Q7BA 2FP4A 1N7HA 3HB4X 1EVZA 1HE4A 4CQMA 1HETA 1K3TA 4JX8A 5ILOA 2CVQA 2B69A 1R4NA 1HYGA 3PHJA 4OQYA 4PLVA 2QQ5A 4OYRA 2VRBA 4HX5A 1JAXA 4XGNA 3Q2KA 1RP3A 3B70A 4PLWA 2AG8A 1DFGA 3GVIA 3W6ZA 4QQRA 1TT5A 2RIRA 3L77A 1EVJA 1E7QA 2PWZA 3K2EA 3KSUA 3C85A 3VPGA 3L4BC 4N5MA 2PZKA 4A0SA 4E4YA 5EINA 3H65A 3ENKA 4TKMA 3PJEA 4YRAA 3LT2A 2VYNA 2NACA 3OQ1A 4I5GA 4LRSB 4R5MA 1BVUA 3RQSA 4CMEC 4XDZA 4ZRMA 5DN9A 4J90A 2Y1EA 3MJEA 2P9CA 1N8KA 1E3LA 3JYPA 1GCUA 2UUOA 3ZZNA 4NQWA 2ZYAA 2OUIA 1O94A 5B12A 3D3WB 1HE5A 1HTBA 4Q3EA 1PQWA 1LX6A 1BW9A 4J7CA 1MLDA 4A7PA 3JQ9A 3U0BA 4BKQA 1ISHA 2DQ4A 1PJLA 4N18A 4XGIA 4CM1A 3OEWA 3VKUA 3O4RA 4NPCA 3RC2A 2HRZA 1XDWA 1YXMA 2PGLA 1DAPA 2ZYDA 2ILTA 1P9LA 3PWKA 3OIFA 5G2OA 5L51A 5T8KC 2Y66A 1BSVA 1Y5RA 4WASA 3RAJA 1SB9A 4CLOB 3AU9A 4D45A 3IKTA 4OXKA 4Z3KA 1PZHA 3DBHA 1VKOA 4G2NA 4YYZA 1A5ZA 4WCDA 4N5NA 4JIGA 1C0PA 2JAPA 5FYDA 4YJGA 1WXDA 1GYRA 1V3UA 1SCUA 1LEHA 2FZEA 4UUOA 1PWXA 4WNCA 1X7HA 4NG5A 3WFIA 4AJHA 3ZWBA 4JP2A 3PYMA 4U8GA 4LSWA 4B79A 1Z7BA 2PZMA 4F46A 1QKIA 5EL0A 4XB2A 1PJ4A 1KYQA 1M76A 4E21A 2O50A 1XIVA 3QWAA 5BSFA 1P45A 1SAYA 1FDWA 1ZK0A 1HKUA 1P77A 1Z73A 2RH4A 1UZMA 5FEUA 3W1VA 2EG9A 1I8TA 2HCTA 4W99A 1KC1A 2EWMA 2HQ1A 2QG4A 3OETA 2H1SA 3GEMA 4NFSA 2PR2A 3FNFA 4WLVA 2DAPA 3DQPA 4PVDA 4Z0PA 1H93A 1C0LA 1RYDA 4DLAA 5AXCA 4NI5A 1WDKA 4MVJI 5LDGA 3QVOA 1PJ3A 2R6JA 4J2HA 2QZZA 1CETA 1T25A 4R1UA 4IJUA 3PI7A 4GLOA 1DSSG 4XYMA 2DTDA 4N5LA 7MDHA 4O59O 3EHEA 3IJRA 4RPGA 2WD7A 3ZWMA 1BXKA 1V35A 3IAHA 4LISA 2HK9A 3QRWA 2CY0A 4RZHA 2R00A 4CM7A 3WTBA 3SLGA 5DF1A 3GUYA 3TL2A 3JQAD 4W4TA 5LC1A 3OP4A 1BWSA 3PGJA 3FTNA 4FJ1A 4OJNA 5ER9A 4BNFA 4G65A 1E6UA 3TF5A 4JBGA 4ZD6A 1HDZA 1HSOA 1OMOA 2AHRA 2Q1SA 5L7TA 1QV6A 3NDJA 4BGUA 2PH5A 3GHHA 2YFHA 3HFSA 1TEHA 3TZCA 3WQSB 4E13A 1GFSA 1W6UA 3OBBA 3G1UA 3WGQA 1DXYA 1NYTA 4A2CA 5A5FA 2HMTA 3HDHA 4PG6A 5IZ4A 1PS8A 5JNLA 4CR7A 4TKLA 1G5AA 2VWHA 4CLXA 1S7CA 3DBRB 5B37A 4OKNA 2JAHA 3MOGA 3RD5A 1ZSNA 3D5TA 3NJ8A 4QTZA 3WMWA 3ZW8A 4BO3A 1GEEA 1VC2A 3AY7A 3RC1A 2FR1A 3P5SA 3DHYA 5KJEA 3UOGA 9LDTA 3AY6A 3CE6A 3LZ6A 1X0VA 4YJDA 3EW7A 3C7DB 3GR6A 4WOJA 3TFQA 4NFYA 2G5CA 1OC2A 2J6IA 3H3FA 2YQ5A 3WGIA 4XYEA 4J1TA 5GY7A 1MG5A 2VN8A 4FOOA 2GN8A 3V1UA 1PEDA 5LCXA 1AXGA 4HP8A 1E77A 1A9YA 3IC5A 5I8ZA 2G76A 1T1SA 1YH3A 1U1IA 3U9LA 4R9RA 5BNIA 3BAZA 4J3FA 3JQ9C 3W4KA 5JYEA 4W7HA 4BO6A 3AU8A 5ES3A 1JW9B 3MJTA 4IXTA 2FPGA 1DLJA 3EC7A 1LC0A 4U6SA 3WGGA 4A26A 4F6CA 1P0CA 4MIOA 4BKUA 1QYCA 5CEEA 1O95A 4CM4B 5CEFA 3N74A 3ASUA 3LQFA 2EERA 3JQ6A 4E2WA 2VNSA 1VI2A 2H6EA 1BDBA 4L9RA 1ZIDA 4OAQA 3VOSA 3C7CB 1HEUA 3HFGA 3GVXA 3RU7A 2BFMA 1GV1A 4L4XA 4QFCA 3I6IA 2OBNA 1NX6A 1KC3A 4YT8A 4OMUA 1YGYA 4RO0A 2HMUA 1X14A 1R0SA 3WIDA 3CXRA 2JD0A 1FDTA 2HDHA 2G82A 4ND2A 5KJ6A 2DPHA 4C7JA 4Z0TA 1C1XA 2WYVA 4J0EA 3V1YA 3AWDA 4UEJA 5BT9A 5IN4A 5IZCA 3ZWVA 5DBIA 5I7EA 3AFMA 1IE3A 2QIOA 2RHRA 2OMEA 4KWIA 4YAEA 4RQUA 1T2EA 2PZJA 3AJRA 1ENYA 3JQFC 1L1FA 4Y6SA 3OIGA 5A9SA 3KVOA 1JLLA 4TSKA 3BTSA 4TQGA 2E48A 3CZGA 2VTDA 4KUHA 1L7EA 3K2BA 1VJ1A 3W6UA 3I23A 1BXZA 2OHXA 4CMBA 5I7FA 3WGZA 3QWFA 2O7QA 2QZ9A 3K96A 2GD1O 4F3YA 3BMQA 3GAFA 4YJHB 2X6TA 1OBFO 3AM4A 4XX0A 3OHSX 1ZBQA 4R16A 3GT0A 1AGNA 3ABIA 2NTNA 1MX3A 4NIMA 3A4VA 2AEMA 4OO3A 2B4QA 2QHXA 2O48X 3OQ6A 5C3MA 3L6EA 3I9OA 1DHRA 4JXKA 3JD2A 2P2SA 2NU8A 5A3JA 1ADBA 3QWHA 4PLPA 5HTOA 3GF4A 4J91A 4UAGA 4X54A 1DLIA 1VLLA 1LDYA 2BLLA 3Q9UA 1E5QA 1D1SA 3KBOA 2WSBA 5EPOA 3W4JA 3S2EA 1MB4A 1JVBA 3IL2A 3KSDO 4FQ8A 3D1LA 3EZLA 4J9UE 3ETEA 2AE2A 4J16A 3WS7A 1OFGA 3QVTA 2PNFA 4ALJA 1VKNA 1NQOA 4NK5A 4Y98A 3GMDA 4FOSA 3LK7A 4E31A 1AHIA 3JQAB 5KJCA 5HA5A 1A71A 2HU2A 2OP1A 3GH3A 3OJLA 1EFLA 2X86A 1ENOA 5TSDA 2GLXA 3FN4A 1BDMA 4XWYA 2OBYA 2GASA 2C0CA 1MP0A 2MAOA 5U1PA 1LRKA 5B1YA 1PL6A 4B7UA 4GAEA 2MAPA 1UUFA 4UEKA 3DXFA 4ROSA 1HSZA 2HMWA 2JD1A 4UREA 1MG0A 1BMDA 2HAEA 2B0JA 2HK7A 2NQTA 3GEGA 2FR8A 1UAGA 1CWUA 2JCVA 4UVIA 3ZWNA 3Q11A 1PZGA 3JQ8A 1P31A 3GGGA 4J4BA 3OF2A 3RFTA 1WLYA 4WNIA 5JMWA 1KVQA 4P4GA 3AUAA 2O23A 3GNQA 1HE2A 3RUDA 2LDBA 1X0XA 4PLHA 4NBRA 3HG7A 1Q7CA 4CM4A 1TLTA 2QRKA 3PQDA 5B4UA 3NKLA 1QLHA 4AL4A 4BGVA 5BQFA 2Y67A 4DMMA 1GTMA 3DBRA 3G1TA 4YQYA 4OGWA 5GZ3A 3CSDA 3FRJA 3AK4A 3ON5A 5F1OA 4CMGA 2CD9A 2OORA 2RAFA 2Q3EA 3RI3A 2HSDA 3JQGA 4H15A 2Q99A 4UULA 1Y8RB 3LLVA 2D5CA 3OJEA 3FPLA 1XYGA 4J6FA 3H5AA 1GZ4A 2W90A 4RGBA 1SMKA 2FSVA 5DBGA 4FIZA 3FNEA 2CZCA 3ONDA 2P4QA 1N9GB 2WPGA 4TRRA 3GFGA 3SEFA 3WSWA 4EJ0A 4O6VA 3HDQA 3WNVA 1JWBB 2BF7A 5GMOA 1HL3A 1N1EA 1QSGA 5DOVA 3F9IA 3RBXA 3NDIA 3NTQA 4PG7A 4TRJA 5T5QA 1DRWA 5TNXA 5JC8A 1YL5A 3C1OA 5JPIA 1ZSYA 4E2ZA 1SO8A 2E6UX 3OIDA 2IEDA 2EJWA 3GDOA 5EIOA 4Q3BA 1YDEA 1LA2A 2PKRA 3NGLA 4QEDA 3AW9A 3NAQA 4I5FA 4ND1A 1DHTA 2FR0A 4TZTA 3C1AA 4DTIA 1GADO 1T2AA 1KEWA 2ZATA 5JBIA 3BMNB 5A06A 4RPKA 1CYDA 1X15A 3VTFA 2XPCA 1GL3A 4CQLA 2PD6A 3BTVA 1O0SA 4IIUA 4P38A 3GZNA 1RM5A 4H7PA 4IDEA 1ZMOA 1GCOA 3T0YA 3N58A 3I4FA 3TJRA 2ZB8A 2GERA 1H9BA 1G1AA 4FW8A 5IN5A 1JKFA 2EEZA 1ZW1A 2FN7A 3PHHA 4Q39A 1C1DB 4E6PA 4YR9A 4D79A 3PP8A 4W6ZA 1NVMB 1PJCA 5BNTA 4KZPA 4D3SA 4Y6RA 4RLHA 3OA0A 4HNHA 4R3NA 1KVRA 1LLQA 4RVUA 3UICA 1N92A 3FR7A 2X0IA 4GSKA 4YAGA 3EZYA 3ZW9A 3GN2A 1GDHA 2CUKA 3WYEA 1HYEA 3WGHA 2DU8A 1W8DA 3K73O 2CDBA 3KTDA 3CUKA 3O8QB 4RDIA 2UDPA 4BO4A 5TS3A 3I9MA 3MTJA 4WLFA 3NTOA 1LLDA 2PY6A 1IUKA 4J4HA 4D0RA 1MW3A 4D44A 2WYUA 3V2UA 1W4ZA 1U8FO 2WMDA 3GG9A 2I3GA 5BSEA 4I9NA 2Z5LA 5H82A 1B8PA 4CMIB 2I99A 1BRMA 3L6DA 2Y0CA 2RBEA 2VHZA 3JTMA 2D5AA 3MWEB 3ONEA 5IDYA 4BKPA 4Z6KA 1E0DA 2PKQP 4EEZA 3JQCA 4LN1A 2AEJA 1JVSA 3IUSA 3RUEA 5JE8A 4FFRA 3TL3A 3V8BA 1IULA 4DBZA 3INGA 1A9ZA 3JYNA 4DC0A 5L9AA 1GV0A 2NADA 4Y6PA 1E6WA 3K5PA 1U3VA 2GUGA 3ZV4A 1DC3A 1IHXA 2GCGA 1VL6A 2BI8A 1L7DA 3NRCA 1JGIA 1H0KA 2JL1A 4JN6B 1I3LA 5K0ZA 4XCVA 2NU7A 3WJAA 1ZMTA 4R5HA 2X23A 4Q9NA 3WXBA 4DYVA 3C3XA 1YB5A 1H6CA 5F21A 3JQAA 2Z1MA 3ZWAA 2X22A 4ITUA 4IZHA 5J23A 2WWRA 3FI9A 3KLMX 1PGQA 2CMDA 3ANMA 4PZEA 3JQGB 4CMJA 1DPGA 2JHFA 3BHMA 4CXFA 2GF2A 4NJMB 4MP6A 1MVYA 4GPD1 3ZWPA 4R4JA 4AJ1A 1PJBA 5JCJD 2B4TO 3OA2A 6LDHA 2PD3A 1PU2A 4Q3NA 4E2YA 5ITWA 2X0RA 1Z45A 2IXBA 3OICA 4WK6A 2YV3A 3ANNA 4ZRNA 3WIEA 3PYLA 1H94A 2BI7A 4YCAA 1LDNA 1ZXLA 3IP1A 4B7CA 2JJYA 1YB1A 4JBIA 5F3RA 4RORA 3D0OA 1UAYA 3V2HA 3DTTA 2YHIA 3RFVA 1IZ0A 1YJQA 2Q50A 4XYBA 4YJFB 4FJ2A 4GWKA 4KWHA 4OXNA 3KYCA 3TZQA 5CDYA 3LT4A 1UXKA 4YAJA 4HNGA 3HN2A 2X9GA 3ORFA 5C7LO 1Z75A 3KYDB 3JV7A 5TX7A 2CFCA 3C24A 4Q3DA 3BMNA 1A4IA 2VT3A 3NYWA 2D59A 2H63A 2DTEA 3LC2O 3DONA 2GZ1A 1CQIA 1QYVA 4PRLA 3GZNB 4BNKA 1GPJA 1QYDA 1LJ8A 2DLDA 5T57A 3UVEA 2VWGA 2QX7A 3R6DA 2A92A 3AI1A 5THKA 2YQ4A 1AXEA 2VUSA 4GMGA 4IDCA 5JS6A 2ZQYA 1I2CA 2PLAA 3PQEA 4XA8A 1GZ6A 4M86A 1BVRA 1IHYA 1XLTA 3P2OA 3FD8A 3WMXA 1KEVA 2Q4BA 5H81A 3H9EO 1UZLA 3WLEA 1QR6A 3X2FA 3AOEA 1KVUA 2AQIA 1Y7TA 4KP7A 5JXWA 1B8VA 2EGHA 1VRWA 3SC4A 2AQ8A 4FJ0A 5JSFA 1AN9A 4B3HA 4P4LA 1YONA 3D64A 4HKTA 1U4OA 4IZIA 2NQ8A 3DFUA 1YDWA 2WYWA 1Y9EA 4BIIA 5JMPA 1NQTA 1U5AA 4BO0A 4BO5A 2I76A 3RC9A 1Q0HA 4HV4A 1EFKA 1XHLA 4BNMA 3F6YA 1E7RA 1VL0A 4ALIA 2Y1DA 1WDLA 3F3SA 1ZK2A 1QG6A 3KO8A 4R3WA 3QVSA 2Q45A 1U8XX 2X58A 1I32A 2QRJA 4JQCA 3SJ7A 3H9JA 1MXHA 2EKPA 3VDQA 3VTZA 2Q46A 3GLQA 1XEAA 3WQQA 4EBFA 2YYYA 3Q9NA 3H9QA 5DP2A 4GI2A 3JYOA 3RFXA 1B15A 3CH6A 1JG9A 4U7WA 4IDFA 4YACA 2AXQA 4S3MA 2I9PA 2BD0A 3FHLA 4N7RA 3ITDA 3U49A 4CMHA 4KUGA 1B14A 3DOOA 5KCZA 3PZRA 1ZUD1 2Y0DA 4E3ZA 2ZB3A 1TB4A 3TOXA 3U3XA 4B8ZA 5JO0A 4AJKA 5IAAA 4FFOA 4XB1A 3E9QA 5KIAA 1WZEA 1MC4A 4BMNA 4DRYA 4E30A 2OP0A 1B3RA 4MP3A 2Y1FA 2FPIA 4RPJA 1G0OA 3DEYX 3B1FA 1JN0A 1GQQA 3VH1A 3DMTA 3K30A 2GDZA 2CF5A 4WKGA 5A02A 1SEVA 5CDSA 3OSUA 2VHWA 1S46A 2BFPA 3GUCA 2PGJA 4JJIA 2JFHA 4DYDA 1EMDA 1HWYA 2VTEA 3D4NA 4QFDA 4YT4A 3D4PA 3KEQA 1C0KA 1NWCA 4BO8A 4QX6A 2V6FA 3DBLA 4C7KA 1X7DA 5JDCA 2Y1OA 1JU9A 4AJOA 4MVJA 2PV7A 4YJFA 3UXYA 4GQAA 1DOHA 2UAGA 4XIJA 4AJJA 1O9BA 2VUTA 3PIDA 1EDZA 1ULSA 2IE0A 1E3EA 3LC1O 4DBVO 5TT0A 1NWHA 5AXDA 2XF8A 1ONNA 1U7TA 4LGVA 4MJLA 3CINA 4BNWA 1P1IA 5ENVA 1B8UA 4ZN6A 3U09A 1H3LA 3ASVA 1P1FA 5JYDA 3HQ4O 3S2GA 2Q4EA 3COSA 3RJ9A 3MWDB 1QYXA 4OXYA 4R1NA 4UUNA 4L8VA 3UFXA 1XQ6A 4EDFA 1I33A 5I8WA 3O26A 3VAZA 2DFVA 5L4LA 1ID1A 2VHVA 3WX0A 4R9SA 4WPGA 4P22A 2O2SA 3PTZA 1C3VA 1YO6A 3ANLA 2A94A 3F1KA 4BUCA 3DTYA 3ZHBA 1VJ0A 1VPDA 3ETDA 4ALNA 4BNHA 4J1NA 3WBBA 1T2CA 4DQUA 4EI2A 4BMVA 3JQBA 4FPXA 2YFQA 4BS9A 2IRWA 3NT4A 4PGFA 4DREA 1ULUA 2FZWA 4H16A 4JNKA 4XEHA 1MW0A 1Q7GA 4ALKA 2YHIB 5JDIA 1NAIA 4B7XA 4GGPA 2EKQA 5JW6A 2J3IA 3B1KA 5CAEA 3L07A 4IDAA 3ZV5A 1KEUA 2ZB7A 4I5DA 4IQ0A 2HJSA 4D41A 1VM6A 3BXXA 2B37A 1RM4A 1QYWA 2OO5A 3EUWA 2JD2A 1ZS2A 3ZWCA 2E37A 1P1KA 2OXIA 4ZQHA 5G0UA 4G81A 2X0NA 1UDCA 1VSVA 1WDMA 1WW8A 1VE9A 4TMFA 2F00A 3C8MA 4NJOA 4PLZA 2AA3A 5JAIA 4I08A 2QYTA 3G0OA 3INTA 5FI5A 4GX0A 1W73A 4MKRA 3LT1A 3V2GA 1IYZA 1GU7A 1WVGA 1AHHA 3D4OA 4JCOA 5AVOA 4O63O 1XSEA 1QRRA 1DEHA 4MP8A 2O3QA 3QIVA 1VJTA 4PIVA 3RJ5A 4R51A 3C7AA 1IZ9A 1SC6A 3LU1A 3M2PA 1HDRA 4K9DA 1N2SA 5K6AC 4QSMA 1YBVA 1E3SA 2I66A 3FWNA 3NGXA 1M67A 1WNTA 2GRAA 7ADHA 4IGFA 4XQEA 2HKIA 3IS3A 3LT0A 2J3HA 4GSLA 2DBRA 3KSZO 3ZNNA 4TWRA 1Q0QA 1EQ2A 1PR3A 1Q1NA 1K5HA 2GN9A 3A28A 3AOGA 2B5WA 3ZWWA 2VOEA 1SBYA 2D8AA 1R12A 3ZWOA 3OQBA 4DPKA 1JA9A 3WDSA 1LSOA 4WEOA 2PGDA 4CODB 1GPDG 4PLTA 3SVTA 1LXCA 3V1TC 3DC2A 1YQGA 3EDMA 3L9WA 4Q3CA 1LRJA 4YT2A 4QO8A 3KHUA 5L7WA 5T8KA 5JCXA 3N7UA 1N1GA 1NHGA 5AQ1A 1I36A 1DIRA 4DLLA 5IFLA 4LVCA 2RHCA 4MVJE 3DDNA 1GAEO 1SOWA 3GDGA 1ZJZA 3L6OO 4K26A 5FF9A 3WJ7A 5I7SA 2Y99A 4FSHA 3ZH2A 4QECA 2FOIA 1X1TA 2V6GA 4WLNA 1KVTA 4Y8VA 4ZQEA 4JLWA 4YDRA 2C5AA 3RSHA 1IPFA 3RC7A 4D3FA 3WGOA 4LW8A 3HZZA 1NAHA 1WWKA 1Y6JA 2DM6A 3RUHA 4U6QA 1A7AA 1J5PA 1I2BA 3Q0EA 1ML3A 1RPNA 5JAQA 1FDVA 3AY3A 2WTBA 3I1JA 3RVDA 3ZWXA 1LSUA 4ZU3A 3PJDA 1NQAO 1MV8A 1S6YA 2E4AA 3LF2A 4GH5A 3ZNPA 4BO7A 1H6DA 4PG8A 3F4BA 3WGTA 1ZEJA 5KWEA 3E8XA 5COAA 2J5QA 4DC1A 3TDKA 1ZCJA 3F46A 1PGNA 3DR3A 1TA4A 4E32A 1QLJA 3DL2A 1UDAA 4CQMB 4S1VA 4I9HA 2I67A 5I9MA 4YA6A 2ZKLA 4M54A 1XQ1A 4U0KA 4MVJD 5A5EA 2VYVD 2I65A 1HDGO 4IJWA 4MIEA 1TT5B 1NR7A 5A9SB 4GWGA 1QXSA 2AQKA 3DBLB 1IY8A 1LUAA 1NBOA 3MTGA 4CQMD 3UERA 5HS6A 3H7AA 3L0DA 1H2BA 5FWNA 2ZTUA 4II3A 1PIWA 4OSOA 4PLCA 2WM3A 1HZZA 4TVBA 3LYLA 4AJPA 1DIAA 1K2WA 2C5EA 4LSMA 3UKOA 5KKCA 4B4OA 4FBGA 1XA0A 2CVZA 3DZJA 3ZGYA 2AG5A 2C7VA 4NHEA 4KDEA 3V5NA 1XG5A 2G0TA 4OH1A 2X1HA 4KUEA 1RKXA 4E0BA 1ISFA 3FCOA 2NVWA 2B5VA 3D3WA 3RU9A 4BQPA 1Y1PA 3H9UA 3F5SA 1VSUA 3ZWYA 2IYOA 3HDYA 4ZQGA 3WSVA 4IXWA 4L75A 1I10A 4YPOA 2EKLA 2Q1UA 3QLJA 2JFGA 4QXMA 5U4QA 4J9VA 2DBQA 5TF4A 1V9LA 1GR0A 1XR3A 1GQYA 4UVDA 5KVSA 1K0UA 1LNQA 1CEQA 1F8GA 2QRLA 2DBVO 4TRMA 2ZJ1A 3PLNA 1OAAA 1JWAB 2D2IA 3ZU2A 3GRKA 4HFMA 1NM5A 3TRIA 4BMSA 3HE3A 1LRLA 1KY5A 3KLPX 3LVFO 4K28A 3K31A 2VZ0A 2UV8A 4BNUA 4CMEA 2SCUA 3PYXA 3GC6A 4DPMA 1EK6A 3AOEC 3GMSA 3I9LA 5F1KA 3GRPA 1NQ5A 2EGGA 4KTTE 3UCXA 4ILKA 5L53A 4RCVA 2XAAA 1KY4A 4PZCA 2ZCUA 5CDTA 1HDYA 3OJOA 4RDHA 1GY8A 1YQDA 1F12A 3SJUA 4CM9D 1NP3A 4NH4A 3ZHXA 1NPDA 4MVJF 2FMUA 5T64A 2BFOA 3GNSA 5DCUA 3DB2A 4UUMA 1CQJA 5K9ZA 3NUGA 2G17A 1BGVA 1MW1A 2I3AA 4M8SA 1NTOA 4BKRA 3P19A 4R69A 1YOVA 1YB4A 1YS4A 1PGOA 3F1LA 2E82A 1H5QA 3H6KA 4UUPA 3LC7O 4RF3A 4BNNA 5GZ1A 2VYND 1P1JA 4RVSA 1PQPA 3UCEA 4IDGA 3JCZA 4E5YA 3GOHA 3CZLA 3OJFA 3WR5A 3KYBA 1M6WA 3MJCA 5CPBA 1F0YA 5C7IO 4IS2A 2NTVA 5A9RA 4K1LA 8ADHA 1M2WA 1KS9A 5FI3A 1UP6A 4OKIA 2VHYA 1M6HA 1ZEMA 1JQBA 2GZ3A 4D0SA 1PL8A 2Y0EA 2A9FA 2YV2A 3M1LA 3R3SA 3I5MA 1LDEA 2IZ0A 4GBJA 1WP4A 4CMKA 3DZFA 3I9KA 5A1TA 2V65A 2ZTVA 3O9ZA 3IJPA 1T1RA 1FF9A 1ZVMA 3QSGA 3CZMA 2OZPA 1DB3A 4NZ9A 1U9JA 2VCYA 1V0JA 1YBMA 5KNLA 3FR8A 3E1KA 4GVXA 1NFFA 5C37A 1Y8RA 2ZQZA 3VC7A 4W9NC 2EIHA 3JQFA 2EHDA 4L73A 4XQGA 3I9NA 3L9XA 3VZQA 1PZFA 1ZK3A 3W4IA 4NBTA 1I5RA 3ZHYA 1UJMA 4RL6A 1PS0A 2Y05A 1PL7A 1UH5A 3ITKA 4M1QA 2V6BA 2CDAA 2W98A 5LDHA 1LQTA 5EJ2A 4XGKA 3DO5A 3VH3A 1ADCA 2YY7A 3VDRA 1DIHA 5JFOA 1U5CA 4R68A 3IOYA 1E1KA 3BZUA 4RF5A 1I30A 1GEGA 3NJ4A 1KERA 1GYPA 1WPQA 2BMAA 3O38A 1CJCA 2H9IA 1FXSA 1JDJA 4RF4A 4BO2A 5ENDA 1E3JA 3QJ5A 2NNLD 3VZRA 3IQDB 3C1TA 4FLRA 2IYPA 2LDXA 2EXXA 4EUFA 2IZ1A 3PFWO 3E82A 1LSJA 3QVWA 3KUXA 4O1MA 4CL8A 1MUUA 2WD8A 2X0JA 1MA0A 4XKJA 5G0TA 2J3KA 1DAOA 2HLPA 4WCFC 3HNPA 1YWGO 5DP1A 3ZHZA 4JK3A 1E3IA 4UVHA 3NX4A 1Q2XA 3KB6A 5L95A 1NVTA 4PG5A 2P5UA 4IMRA 4WLEA 1I0ZA 3JD4A 2QYSA 3G79A 1NFQA 4NDNE 1YQXA 3NT2A 2CVOA 4J49A 2W2LD 1Y81A 4AG3A 4CLHA 1LU9A 3FPCA 1I3KA 5EMHA 3VHRA 4CM8B 4CLEA 4XRRA 2TMDA 1FDUA 4AVYA 3MJ4A 1R15A 3T4EA 4CR6A 1C1XB 2X8LA 1E7MA 3TWOA 1DO8A 1E92A 3PWZA 1OR7A 1O89A 4MVJG 4D3DA 4Q3AA 2NVUB 4LCJA 5IXSA 2YZ7A 4WLOA 1B2LA 5CHEA 3EYWA 1YOVB 2GO1A 3LLSA 3TFOA 3HN7A 1QORA 4CM9A 1ADFA 1EDOA 1SOVA 1NNUA 1R6DA 1DFHA 4DIFA 2AEFA 3GAZA 1EUDA 3UN1A 3S8MA 2P5YA 4R1SA 2B4RO 2X7HA 2VQ3A 1HDOA 2VWQA 5G4LA 1WMBA 1R0KA 3DZIA 1E1MA 3SLKA 2BGLA 4IINA 1MW2A 1HDCA 1PJQA 3S2IA 2D4AA 1DJQA 2NV6A 2GZ2A 2Y1GA 1BXGA 1BTOA 1J4AA 3RUCA 3WWZA 3WGYA 5KKAA 3FBTA 1Y8QB 1R37A 3BMCA 1H6BA 2B35A 1DC6A 4CV1A 2O4UX 1M75A 4KMSA 4D43A 2PTGA 2DUUA 1CERA 1PJSA 4MINA 4CM6A 3E48A 3DZBA 4LMRA 3ROMA 5BSHA 1PR9A 3INRA 2ET6A 3VH4A 1U2GA 1ZK1A 4RLSA 2UUPA 1HT0A 4DIOA 4CUJA 3A14A 3PLRA 1HZJA 4Y9DA 4CV2A 2HK8A 3JQBC 3MJSA 2GSDA 3O03A 1UXIA 1E6EA 3R0IA 4Y67A 3IP3A 1NVGA 3GNTA 5ADHA 3UGKA 2Z1NA 5DCYA 1T4DA 4D46A 3JYQA 1R4MA 4MO2A 4AICA 2OL4A 4G5HA 4BNGA 1P3DA 3AFNA 3H5NA 5CDGA 4J1QA 4BNJA 4INAA 5HM8A 3HUDA 3IKVA 1NHWA 3TZ6A 1UXJA 1FK8A 1TI7A 2I5PO 4YT5A 3VH2A 2P9EA 1U7HA 3RUAA 5DT9A 2BGMA 1LSSA 3JD1A 4E5MA 5AXBA 1P74A 1ZZEA 1GUFA 3RIHA 1Z74A 3H8VA 5TC4A 1SZJG 3T4XA 4ZGWA 4B4UA 4YWJA 3EMKA 1ZNQO 5DDIP 3GFBA 4DVJA 1UZNA 2D0IA 4N54A 4IJKA 3X2EA 1OI7A 3W8DA 3WTCA 3IDSA 3RBVA 1LDBA 2X5JO 4CM3A 1A72A 1R4NB 2FY8A 1A27A 1QP8A 1U28A 2P91A 4NK4A 1DRUA 3VPFA 4IBOA 5CG2A 3UHAA 3ENNA 2C07A 5BR7A 1GZ3A 4BB6A 5IDXA 3I9JA 3QQPA 3RUFA 3UCFA 3H4VA 2P68A 4FDAA 1P1HA 2CF6A 3ZU5A 5G4KA 1RJWA 3ZU3A 4NBUA 3VPSA 3DMTC 3PHGA 2VT2A 4MKXA 4IQGA 3BHIA 3EK2A 2W2KA 3RUIA 1N9GA 2O7GA 2NVUA 3E6AA 4IJVA 2EP5A 4R41A 1IB6A 3WB9A 4XD2A 2PFGA 2PD4A 5B4VA 4L74A 2Y1CA 1P33A 1XGKA 4ZJUA 3UUWA 4E2XA 3Q2IA 3CPSA 4FFLA 1LDMA 2V6MA 1DC4A 4M89A 3U4DA 4BNIA 3NEPX 4PLGA 3S55A 2C20A 2Y93A 4R54A 1D1TA 4HFRA 4DUPA 4WCFA 4YRDA 2PA3A 4TRNA 3DBHB 5GZ6A 4FLSA 4DPLA 3NT5A 2IODA 4OIMA 4EJMA 1ZJYA 1OZAA 4FGWA 4BNXA 1ISIA 4YJGB 2EJVA 1V6AA 3QW2A 2BH9A 1WMAA 2HRBA 4B3IA 3WQRA 1XU9A 1EBFA 3FF4A 4XJSA 4FB5A 1I3NA 2GGSA 2X5OA 2C2YA 2X5KO 1H9AA 4DLBA 5IJZA 4XQ9A 4OOEA 3ZV6A 2EP7A 4A10A 5CEJA 5COBA 4Z9XA 2X9NA 1C1DA 4CPDA 1PQUA 3ZU4A 4KQXA 3RROA 1ZFNA 4HFNA 1HLPA 3PQFA 4WGGA 3I83A 5A4DA 1QMGA 2G1UA 3ONFA 4FCCA 2C82A 3ZN2A 4YRBA 2P4HX 3QA9A 1RYEA 2DFDA 3DAPA 3OFSA 4J7XA 3GVHA 2EW2A 3JD0A 1Z6ZA 3SC6A 3KRTA 4FLQA 1T2FA 2YUTA 3H2ZA 3GPDG 4CUKA 3AI2A 3PIIA 4EUEA 3CZKA 5G0VA 3O8QA 1YBAA 3GVCA 4YXFA 4IDDA 3TOZA 4E5PA 2ZTLA 3A9WA 4YVFA 3JQ8B 2DPGA 4EITA 4YQZA 3QY9A 5JO9A 3NV9A 5JDIC 1YVEI 4NU6A 3T7CA 3ZDFA 4XDYA 4GX1A 2NU9A 5KVVA 1PS9A 2HUNA 2UYYA 2PZLA 2WEKA 5BNFA 2WD7B 3PFFA 4DL9A 1YJ8A 1BXGB 4RPLA 4RPHA 4I5EA 1J6UA 1H6AA 3E03A 4HUJA 5COQA 3R3JA 4PLFA 2FPPA 3VVCA 3JD3A 4TZKA 3BMCB 3DHNA 3NDRA 4RV9A 4F45A 3PXXA 5ILGA 3TZHA 3WFJA 3PK0A 3E18A 4IIVA 3MZ0A 3PDUA 1NPTO 2DTXA 3ZNOA 4LMPA 4WJZA 3QP9A 3WYCA 1IPEA 1IOLA 2FHSA 1DJNA 5DNAA 3BTOA 2W8ZA 5EN4A 4L4RA 2OOSA 3UH1A 3P2YA 1SPXA 5KTKA 3GEDA 3JQ7A 1CF2O 2PK3A 5CPFA 3PZBA 5CP8A 3IIEA 3MEQA 4IQ8A 1PZEA 4I8XA 2H5LA 5I9LA 5DZSA 2B36A 3OH8A 3HJAA 1F14A 3KM0A 2O3UA 3D3EA 4NMHA 4BO1A 4IPTA 3G49A 4PFJA 1NXQA 2F1KA 1C0IA 2IDZA 1CRWG 4PCVA 5AOVA 4PRKA 4GVLA 3VKVA 2PKQO 4YAKA 1R0LA 3GQVA 4BOYA 1E5LA 4BNLA 4O5OA 2AE1A 4WECA 1HF3A 3RCBA 1K6IA 3JQDA 1JKJA 1GD1O 4TVOA 3DAGA 2DKNA 2GN4A 1CIVA 3GPIA 4OL9A 1I24A 2ZCVA 5C7OO 3EVTA 4IDBA 1P0FA 2W2KB 4URFA 3KEOA 2Y68A 5F1PA 3WLFA 2AW5A 1V3TA 3CMMA 2Z95A 3GGOA 1ZK4A 5L45A 1KOLA 2Q1WA 4Z3DA 2C54A 3PGXA 5JDCC 3QV1A 5AXAA 1D4FA 3M6IA 4QT0A 1ENPA 1V3VA 1LLUA 1LQUA
chains in the Genus database with same CATH superfamily
1W49A 1R5NA 3PFBA 1GQOA 1NR5A 1ZN8A 4G9BA 4WHMA 5T4FA 2B21A 1BX3A 4YCNA 1V5WA 3OF3A 2VVTA 4NU5A 3QMMA 1MXFA 1XZ8A 2WNHA 1Y3DE 1LBEA 2BF4A 4JA0A 2YN0A 4HEJA 4M37A 3ZY2A 2FNAA 5C7YA 2LPMA 1RQ7A 2IEIA 1ZL2A 2PBFA 3M49A 4K6MA 4XZ3A 2PCJA 1TVEA 1ISGA 1G2OA 2BR5A 3NTRA 3FZQA 4IG9A 4KOAA 4AS2A 3PVSA 5EZ6B 1P1RA 2FWMX 2ACVA 2FG6C 4INPA 4E33A 3DMYA 3H2YA 1C9DB 3UW3A 5SYMA 3OIWA 2DC1A 4G0ZA 3CRMA 4EPRA 3PF9A 4O4JF 5LIPA 2C61A 1GHTA 1W25A 3G0BA 3B7SA 3EODA 3QELB 3K0FA 3HXLA 1ODSA 5C51B 3IBFA 4S1OA 5EUMA 1I7QB 1E2EA 1GTL1 5ABPA 4WY2A 1QYIA 4CLRA 1SXJA 4EKDA 2GCEA 4GP6A 1NBMA 1U3UA 3G1WA 3IHTA 3A4LA 2J59A 1A5AB 3H2GA 2JLXA 2UVPA 3NIBA 5F5LA 1ISMA 3JVVA 5BVGB 1URPA 1QGUB 4EB6B 4C0HA 3EF1A 3ED5A 1PJ2A 1R66A 1P4HA 5EPUA 1N8NA 2B34A 2RHGB 5ERYA 1IATA 2F67A 4GNRA 3E8MA 3WFZA 2QEQA 1ZYUA 2VFAA 3GLFA 5AKZA 1ZCZA 2PQ0A 2IZZA 2QYHA 4NCXA 2OCAA 2W4QA 1ZXBA 3EMVA 2QUZA 3QPWA 4IUBS 4EHLA 4EK9A 3B3AA 1FSFA 1K4KA 1L5NA 2E9SA 2VZ9A 4JXJA 1JIXA 1D8AA 1JQDA 4TMKA 3TSCA 5CVUA 1DIBA 4J0HA 3WKDA 3JALB 2DOKA 5IM5A 4JJFA 4F91B 5JTUA 3BS4A 5LZ7A 1H3FA 1O95C 1M6VB 2FZ5A 1I14A 4G86A 4BNYA 5JQGB 5TLSA 3FSRA 1JTVA 3KTFA 2PZFA 1ZM3A 4NABA 4U7PB 1M0WA 2K87A 2XXJA 2YVUA 3ZIUA 1ABEA 3AUUA 1A7KA 1GTSA 1KFEB 2PQ6A 3EEIA 3OWOA 1J20A 4DM3A 3K0CC 2VDRB 4ND8B 4GQIA 1XWFA 4HDKB 5TQVA 3THSA 3ORRA 2NLOA 1RLIA 1D7AA 5EMJA 2ADMA 3D2BA 1SQ5A 4TKVA 2H1CA 3HNRA 1THTA 3COPA 2FKNA 4D9FA 3PPIA 4KQ6A 4QUKA 3ZI4A 2BGIA 4P8RA 1OWNA 1SC9A 4PZDA 4B1FA 3ROPA 4XVHA 3SE7A 1T5TA 4DIBA 4QJ3A 3L0BA 1AQLA 4GI3A 3THXB 1UWCA 1NSTA 3L1KA 4NBWA 3OPXA 1PFQA 1RM3A 2FX3A 3C3YA 4NMXB 5AYVA 3X43A 1H1TA 2HMSA 2GYYA 4W5WA 4BX3A 2YHUA 5ALQA 3GLHE 5FTKA 1QOZA 2WE7A 5JSHA 3AHFA 3CCCA 2ZBFA 5LB2A 1UADA 3TQSA 1K6JA 4UU1A 4DGQA 5I7VA 1HX7A 2BFCA 4YFVA 2IY7A 3P0EA 5A4IS 1XEWY 4JWTA 1PZXA 4O02B 1ZO8A 1A8PA 1K66A 3C5VA 3L02A 4JR2A 5EQTA 3TQHA 3OE7D 2GPSA 4F6LA 5IULC 3G6WA 3ZE8A 2JHCA 2RGYA 3F2IA 3KE9A 5KCMA 4ZJPA 1UEIA 1US8A 4II2A 4ND5A 2BFDB 3RABA 3VTKA 3MT9A 2CKDA 5FPYA 1C4OA 4BMZA 2CWWA 2FH5B 1YK0A 4C03A 5EZYF 2JVKA 3SYMA 2O7RA 4HL6A 2J8ZA 3NBUA 1H19A 2J0UB 4AUKA 1ZH4A 2D8MA 1RRPA 4IMIB 4L6IA 2AN4A 4EKEA 2XIQA 1I6WA 3O8LA 4GOJA 1TM2A 3ULKA 4MW0A 3KEDA 2I6XA 4MQ5A 4TX1A 5JQGF 1ONSA 4JYPA 4J0DA 2ICAA 2NUTB 1X3SA 3KZCA 1ECGA 1DAEA 3H2HA 1F1BA 3DR5A 4PYIA 1R50A 5ALTA 2JV7A 4ZA2A 3T1OA 5K6AA 4Q3OA 1PG0A 4OB8A 1TW3A 4Y9RA 3BE6A 1E69A 5EXSA 4BFYA 1ZY2A 3I9V1 1ZR2A 1SBHA 1UKYA 3C48A 3ET5A 3MGKA 5TGDA 3DE2X 3NEAA 5IKXA 2C3PA 4HBZA 4O0LA 5MGBA 1YS7A 2FW8A 3E5RA 4J4TA 1MNAA 3ABOB 4MVWA 4DTCA 4F2WA 1IK4A 5G0WA 4ZC1A 4DHWA 4OM8A 3RNOA 1OASA 3OO1A 2W00A 4P7KA 3HKBA 3M34A 4NV1A 4UE6A 5EE1A 5GP1A 3VZPA 4EB0A 4ZQFA 5EUBA 4LUPA 3UEQA 1KEZA 1JWLA 3WG9A 1TADA 3AUFA 4AZVA 2IOFA 1J8MF 1NBHA 1QAOA 3NBYC 4HMOA 3L4SO 1RCUA 2VH2A 5K3AA 1CZUA 2A4KA 3QFFA 2WIFA 3FBGA 4YTEA 1X39A 1IDN1 5B3LA 3FOZA 3EGOA 1VPWA 2Q49A 5JSZB 4G0PA 2V7PA 1XU7A 5T4BA 1VBFA 2OFXA 2JZCA 4K03A 1FLAA 2CJFA 5J2TB 2C8KA 2P9FA 1V5EA 1C9YA 4CLRB 4RTNA 3H75A 3PSHA 4ME6A 4AMYA 2VDKB 1OX5A 421PA 2G7MC 1SZPA 4ZVVA 5KYXB 3U44A 5BWOA 5EZYB 1H8HD 1NL3A 2CXRA 1QRSA 3EVNA 2DWQA 4DLVA 4B34A 4EB6A 4HRXA 3TZLA 1OFTA 1EE2A 3LX4A 1UAAA 3WWDA 5D5QA 4Q34A 2OK7A 4IMPA 4E12A 3PQ2A 3T5AA 2RGUA 1BA3A 4AG5A 5FPTA 4OI2A 2ASEA 4ND3A 3GFPA 3CVXA 5CRIA 1NVKA 4TKUA 4DV6B 3HA5A 2FYTA 5AVJA 4HNVA 3HB5X 3WL3A 4EZEA 3DHEA 1O9GA 3BB1A 4B76A 2WFAA 1I01A 3CWCA 3HYLA 1RRVA 1YQEA 3HP4A 2QVCA 3QPBA 3H4IA 1MC5A 2WJ6A 2Z08A 3K9WA 4HZGA 4CMAA 1C14A 1JT9A 1RWNA 5GONB 3R7WA 4FC6A 1I6MA 4N3AA 2BR3A 1Z2EA 1G5TA 4DLYA 4L15A 4EHAA 3CZQA 3G88A 3EISA 4G0XA 4YP7A 4EPVA 2B30A 5IG2A 2PKYX 4BN0A 2DT8A 3RNLA 4ESOA 2O8NA 1SKYE 2VL7A 4RVFA 4F21A 5LWQA 1NULA 2NP6A 3FU5A 3AJ9A 3KXDA 4L9SA 4Z9FA 4ETIA 1EGAA 1E59A 2AW3A 3COVA 3OIVA 1IXRC 2HHAA 4L76A 3U7HB 3E27A 4FFPA 4AZ0A 1AXRA 5BUZA 2BRUA 1BX0A 1JKIA 2P11A 5P8WA 2YW9A 3GLHA 2HJVA 1NVVR 4N3GA 4RFLA 3IKLA 3BA6A 4D82A 5DM2A 5AI4A 1JPJA 3KDSE 4YLYA 1E9BA 1Z7YA 3LA8A 3TTTA 4CDMA 4YCBA 3GEIA 3O73A 2JGKA 5IMSA 3ZXYA 4YN3A 4HYQA 3R9XA 1T5IA 4W63A 1H3EA 1RWWA 1N2ZA 1O58A 4RCYA 5A3SA 1ARZA 2HBRA 3TE7A 2WG1A 4R01A 1EZ4A 2IS1A 4ZI7B 2J7PD 5D2CA 3OZEA 3W2FA 2VXBA 4U7GA 4UARA 1JAHA 2VJKA 2DPYA 2BFDA 4A5SA 2VOJA 4C2BA 1ZN2A 2O3SA 2C9ZA 3D0KA 5E1DA 1L7RA 1Z4JA 4V2IA 1VLJA 2GX6A 1G64A 4QDUA 4FB4A 4MW9A 5IBCA 3LO5A 3TAHA 5JY1A 2ZRKA 3WDMA 3F47A 1AQYA 4L0CA 1T10A 1MH1A 2OO5C 2HO4A 4KO1S 4EY5A 4I1PA 1X7XB 3OFJA 3W5HA 1GN8A 4JB3A 4YCSA 1NF9A 3F6SA 3VUFA 1H2YA 5LP6B 1WBJB 3GGPA 4GMKA 5HMLA 4NTZA 1Z83A 4MW5A 4KVAA 3LGAA 4K5MA 3LVQE 5BUSA 3FROA 1VJGA 5ALSA 2BCEA 1MFZA 5C31A 4B32A 4TZ6A 3C3AA 3FTCA 3L40A 1V9CA 2IPXA 4NZOA 1RR6A 1TGVA 2ZJ2A 2JHPA 3A1DA 2YHBA 4FMCF 4IF6A 1PSDA 3MJDA 5FO1A 1MX1A 3SJZA 2QMEA 1WM1A 1TMGE 4Z86A 3NMUF 2CWDA 1GPBA 1YZVA 4I1IA 5DO9A 4WXRA 2XA2A 1MAUA 3NM4A 4DSTA 4Q16A 1XPUA 5CM2Z 1EFUA 2RMKA 4LRTB 1OC4A 1EGQA 4FGLA 2CEAA 1BQEA 1WSWA 4JLMA 2G80A 2DQYA 3QBVA 1UIRA 3QM1A 3L7CA 3TZHA 2ZWPA 4JI0B 3WA7A 3HDTA 4GSYA 4MYSA 2WKWA 3AHJA 4LNHA 2AMFA 3FRIA 3RWMB 4EUHA 1UPFA 1UODA 2ZDQA 4CM8A 5K3EA 1PHPA 1N7GA 2CJXA 2O7NA 1UP7A 3FAZA 4ECAA 5A04A 2WU4A 4LF6B 3AUTA 1FRFS 2FA9A 4NJMA 2O06A 2VQ6A 4LKRA 5FBHA 4B0PA 1YAHA 2X0EA 1Z35A 3QWBA 5KNCD 2A57A 2PRZA 1JSXA 1QANA 2EVWX 2O7VA 2MCFA 1AU9A 4PZZA 3QYFA 2WJPA 4JROA 4JYMA 4RD2A 4WNAB 4C5AA 1GSAA 3LXUX 4ZICA 1DE0A 4IV0A 3JATA 4MHTA 3AMVA 2H0AA 5H9VA 3SX2A 3TBKA 1L7OA 2IPMA 1EVQA 5AKKA 3SMQA 2H2FA 2YJ3A 4HEA1 4ZQBA 2QVXX 3ZEIA 5I9NA 1XZHA 3U6BA 4HADA 1VKHA 2ZLBA 1NXOA 1KGDA 3NWEA 1GNLA 2QM7A 5AJHA 3W5JA 5CFOA 3CZRA 1RXIA 1TM1E 5HIKA 1QR2A 3PFCA 3KYCB 4EKYA 3WNQA 3S2FA 3W8EA 2QRQA 2YJ6A 1ZGGA 2QSYA 4IFEA 1KAHA 2HGZA 3ETGA 3I6YA 3GJZA 3IHLA 3K9FC 3FOFC 1EDEA 1CUVA 1VHQA 3MRVA 3KUKA 2IEBA 3TR6A 5F9MA 2LGJA 5ALLA 3QOYA 1EK0A 3FCUB 1MB0A 2OB2A 4GX5A 5J5VA 3O83A 2IOFK 3QE3A 2QRVB 4OF4A 4W7IA 2PN1A 4XLTA 4D9CA 2GCIA 4X41A 3PX7A 1R88A 3DPSA 3HHPA 4ZT3A 5KYUB 5F3WB 4ZDKA 3T9CA 1AB6A 3AWIA 5ECYA 4M98A 2UVDA 1O5OA 1KAQA 1P9RA 2I4LA 4YMTA 1E0AA 2JKVA 2PT5A 4EUSA 3M1AA 3Q7QA 1EE9A 2QLLA 4BNVA 1NUTA 5B4TA 3LBHA 4C05A 3TX6A 4YNBA 3MMSA 5F98A 4MWOA 4TQAA 1VL8A 4YJ3B 2V8OA 3X1ZA 2PQ2A 1FA9A 3CT4A 3RS4A 1T36B 1NPYA 3AF3A 3SXPA 4BDSA 5KC8A 5BSGA 4KN9S 1T24A 1RLTA 3TQIA 3FNHA 1MTOA 1GZUA 1O3YA 4L27A 3CZPA 4EF6A 3BK7A 5JY6A 3QNWA 4PTLA 2QKYA 4PU2A 2GBFA 4FFBA 4KFRA 1CX9B 1XD9A 5DULA 3IP7A 3GLHB 1A4UA 1R16A 1B26A 5I01A 5K05A 1I5OA 1YUMA 1J21A 2YRXA 2KJQA 3PGKA 4KDCA 4E5KA 1BEEA 5F4BA 1Z26A 1Z63A 4YLGA 2I4MA 4W5JA 2GETA 5AI9A 5A5VA 2E6KA 5I48A 4WTOA 2DPXA 4MKZA 1GCGA 5LJIA 3AXSA 4L22A 1Z4NA 4CI9A 4NJEA 3LSYA 4H35A 1ZM4A 3WBFA 3ZE0B 2A35A 5H80A 2DVMA 1YD7A 3DE6X 3L84A 3DLCA 4YRMA 2H2AA 4RMJA 2CNWD 5JCJA 1WMDA 1J8VA 4YAFA 5E6UB 5B6PA 1AQJA 4Q9HA 1WW2A 2F8LA 1F06A 1V7ZA 4HDSB 4B31A 3C15C 1GQRA 3ZI7A 5JCOC 1ECFA 5DOZA 2ZIZA 3HY3A 1ORRA 3H83A 4NARA 1KE1A 2GXQA 1SHUX 4HAYA 3FTPA 3O8NA 3ZGZA 3Q6IA 4J7UA 1HE3A 5FWXB 1EM6A 4XMTA 1RXUA 2CMKA 4J76A 2QX8A 3EY4A 3BORA 4BMOB 3UXEA 4JJGA 4XYLA 3E7XA 3Q3GE 2ARKA 2O2ZA 5TJ9A 1W5FA 5EJIA 2WSSD 4DJFC 3K0AB 1YZYA 1O6ZA 1SNYA 4OB7A 1IDOA 2CXXA 1E1RA 3IOEA 4Y9SA 1IONA 3CLSC 3QWIA 2IWHA 3ZXXA 4EI9A 3IOBA 3K53A 1Q7BA 1R5JA 3RKUA 2R1ZA 2ZE6A 4IHJB 1QIFA 4NVRA 3E22B 4CQMA 4CEHA 4B2PA 3D2AA 4JX8A 4IQFA 1YJXA 1KSJA 2B69A 3E61A 4N03A 6GPBA 1OXSC 1OREA 3LNCA 1A76A 2IZ5A 4XGNA 3UO8B 4PLWA 4XMVA 1AUOA 2AG8A 4KO2S 4QWWA 2RIRA 2FOLA 3C3WA 2QPLA 1ZOIA 2PWZA 4UOEA 3KSUA 1ODCA 3C85A 4P54A 1KARA 4B9EA 2J09A 5EUCA 1R8SA 2C5LA 2WJWA 2DULA 1VKJA 3RLFA 3PJEA 4PXAA 3LT2A 2RSLA 2VYNA 4LRSB 4I5GA 1CUAA 1UM8A 1E1QD 4ZOLA 3RQSA 3UBMA 4Q7LA 1Z4IA 1EFPA 2R97A 3MJEA 4ZV4A 2B4KA 1GCUA 1RRGA 2UUOA 4TVKA 4X7PA 5KTMA 4B87A 1RJ9B 2ZVPX 4UNNA 4Y2JA 3A6FA 1X1SA 2WA2A 1OJ7A 3W9SA 3WNCA 4YDHB 4Q3EA 1L5LA 1BW9A 4OATA 2QRHA 1XZEA 1VCOA 1WS6A 4MR9B 4BKQA 1GNPA 1PJLA 5FJJA 4ZVQA 4CM1A 4S0XA 3B38A 3LCUA 5F2OA 3VKUA 1RI5A 4ED9A 4ND6A 5AW9A 1Q1GA 2ATIA 4DBLC 4TYMA 4UKDA 3GRZA 1YXMA 5JALA 3N2EA 3ZE2B 1CR2A 2QJFA 4ZOLF 4UPDA 3PWKA 4I4IA 5I4KA 5L51A 2IA5A 3CVOA 5ULLA 1MF7A 1SB9A 4C78A 3DF9A 1UK6A 3BRSA 1IXKA 2QROA 1BJTA 2HRCA 1R8QA 3AEXA 2IXEA 4OP3A 1VKOA 4QYMA 4N5NA 3TW8A 2IUTA 1C0PA 5ECDA 2WSMA 1SU8A 2JAPA 1F6DA 2OAGA 1WXDA 3NALA 1GYRA 3P9NA 1V3UA 3P0FA 2J3EA 3PYMA 3JAMA 1RAFA 1WCXA 4IG4A 3UMVA 4DHEA 4TVSA 3QW4B 5DGCA 2OKGA 2PZMA 2P8JA 2HN9A 4F46A 3Q3HA 1C3LA 2D06A 3R7NA 3V8MA 1QKIA 4EW1A 4QM7A 1OTYA 3AYZB 3KUUA 4PWZA 3WK7A 1KYQA 1ZRSA 5EHNA 3CR8A 2JGEA 2OQVA 3NDBB 1P45A 5EE9A 1SAYA 1FDWA 4Q7EA 3W6OA 3VPBA 3JZFA 1HKUA 4U8HA 1DCKA 1QCZA 2BSQA 2HMAA 4C14A 2EG9A 4FFBB 1KC1A 2EWMA 3NATA 3GLIE 2QG4A 5GVSA 1Z0IA 2BZSA 1ZUWA 2H1SA 2ZIXB 2QM8A 4L95C 2WZCA 3TW0A 2WJYA 1MB9A 1N2GA 3FOWA 4NFSA 3WLSA 1T0JB 3DQPA 1VCIA 1W0JD 1QBGA 3N0WA 5E6RB 3MT8A 2FEOA 3Q5DA 3C3EA 2VPTA 3D8UA 5AXCA 1VI6A 3S70A 3L8GA 4UBIA 3GEEA 3RRJA 5HMMA 4J2HA 3CJTA 4ZXFA 4I3HA 1P81A 5M29A 2FF5A 3PUUA 4HDMA 4R1UA 1ZC4A 2H52A 4EX6A 1DSSG 4JOCA 3UTDA 3AG6A 1G7TA 3GA7A 4LF8B 2FG5A 4DWWA 2DTDA 1BFDA 3VYSB 3G2PA 1R8YA 4KBGA 4DXAA 1IU9A 3LW7A 4O59O 3EHEA 3IJRA 3OHMA 1IN6A 4HDNB 4EY8A 3NONA 1BXKA 3A25A 2XZLA 1E3DA 3VHXB 4MAFA 2CY0A 2WAOA 4X00A 4RKEA 2OV3A 1ETHA 1TCBA 3FCCA 1T6NA 5DF1A 1S0UA 5BV1A 3FB4A 2JARA 4RJKA 1F20A 4GI1A 5LC1A 4FJ1A 4OJNA 3S0JA 3RAFC 1TQ4A 2FN9A 2PVPA 3NDPA 3B2PA 3EASA 4Q7MB 1HDZA 1OMOA 3X3HA 1W4RA 4ZANA 1T3TA 2PE5A 2Q1SA 1S8FA 3LHFA 1Z0FA 2NU8B 3BWCA 5LLTA 5ALPA 4JMPA 4H31A 3A36A 3WQSB 4KITB 4REQA 3TLCA 3OBBA 3BERA 3G1UA 3FH5A 1B1CA 3Q9LA 4IHJA 1ORHA 1NYTA 3DD5A 5HTKA 1QIIA 5FULA 1F3OA 1Y42X 4N0PA 3HDHA 4FMDF 2HI0A 4LRXA 4PG6A 4UEWA 1V5GA 3HBAA 4A0HA 2Z83A 2DX7A 2W4MA 1I9CA 3EPJA 4HSGA 1ZISA 2E4ZA 2FI1A 1VYHA 4CCAA 1Z3IX 2ZZNA 1XQWA 5EYPB 3WRVA 2XMQA 1UK9A 2QDXA 5HFNA 3DMNA 1XCJA 5B37A 2F4VB 3MOGA 1TVMA 4NOMA 3A0UA 2AEEA 5FTJA 1Q0UA 3FWKA 2PKEA 3DLBA 2J4FA 4X84A 3H0EA 1TK3A 1GEEA 1AK1A 1W4CA 2QP3A 3EGDB 5ALZA 3PDIA 3AY7A 2VG8A 4J6EA 3ISTA 3IUJA 4KQMA 1UC8A 3ROXA 2PUDA 5BQ5A 4IP0A 4WAUA 2IDKA 2V6IA 1PNQA 1DO0A 1NF8A 1ZIXA 3CE6A 3AIOA 4MUNA 5K8JB 3C7DB 3LMKA 2IHBA 3X1KA 1OC2A 3H3FA 3UAWA 2YQ5A 3F67A 1BMFD 2CT8A 1AKMA 4QWMA 2DUJA 1KMMA 1O4WA 4ZYVA 3BE5A 3U37A 5EKSA 1WUYA 4LDPA 4A6PA 2VN8A 4CDNA 2YNMD 3ID6C 3U17A 3V1UA 2XYGA 3MM4A 1KRHA 4K9MA 2WLSA 2Z30A 4D1YA 4ENTA 5K4GA 1YA6A 2JBWA 2G76A 3SSAA 1FRZA 4N5IX 4XWTA 4DA8A 1YH3A 3QUQA 1HMYA 3H0CA 2CLLB 4R9RA 1F8XA 3V8VA 1WG8A 2BTOA 4H6PA 3JQ9C 3FHCB 1Y4ZA 3B3QA 2YMLA 2E4YA 4LXQA 3MB5A 1RU3A 2FPGA 1DLJA 3BJMA 3KB8A 4Z51A 4U6SA 3WGGA 1E4EB 4D99A 2W6CX 3V8EA 4DUYB 4DG8A 1QYCA 1V48A 3W2IA 2BGRA 3RYFA 1K7YA 2AJTA 3DO6A 1BRTA 1NOIA 4E1AA 3ND7A 3BKXA 4RY2A 1BDBA 3MJFA 3CURA 1C3OA 5FHRA 4QDJA 5LOVA 1HEUA 1RFLA 1RIFA 1XRQA 2O2GA 2C3YA 3A9CA 3HFGA 5FA8A 2HWUA 3IKJA 2HZ7A 3MXTA 1W44A 1NX6A 4YMHA 1UFRA 3BKWA 1OAOA 3HCWA 4YT8A 2E5LB 2G77B 2B6HA 2BJVA 1X14A 1K6MA 4G85A 4M0MA 4CNQA 1R0SA 2G36A 4L5AA 4YDSA 1FDTA 2HDHA 3TL6A 4F2PA 5BRJA 2G82A 3M81A 1OX4A 4ND2A 5KJ6A 5E7MA 5G02A 2Q5CA 5P21A 5DWDA 1TF7A 4YRIA 5DNCA 2ISSD 1KZ9A 4UEJA 5BT9A 1V41E 3EXFA 3TIFA 1GGHA 1YZFA 3GLIA 2D1SA 3P9QA 3T5PA 3AFMA 5AUNB 2QIOA 1UM9A 5FUVA 3L7OA 3B1VA 4WL0A 4KWIA 1T2EA 1L8AA 2PZJA 1HQDA 2UVPB 3AJRA 1S3GA 4FVTA 3ZDEA 4BRSA 2F1HA 1KI6B 4L50A 2ZPUA 3UK7A 4PX2A 3N59A 5EXTA 1Q14A 1UT5A 5CMLA 4KAXA 3VR3D 2WFZA 1MT0A 2PTHA 4RK0A 1N6PA 4DIKA 4PGGA 5BR8B 2ZI4A 4LBYA 5JBQA 4KPFC 5EVJA 5CCDA 3K2BA 3VC1A 2OHXA 3DQQA 5F1YA 1B0ZA 4BAGA 3P0RA 1N2CA 3LDAA 1DBSA 2VAXA 4JEUA 4PSDA 3J81k 1SXQA 4NYJQ 2WF6A 1IB0A 3RF7A 4LXIA 3K96A 4Q1EA 5KDOA 3BMQA 3K35A 3CWZA 3G0DA 4QC2A 5LZ2A 2WOOA 3A6GA 1CZLA 2QLNA 4J0CA 5E2AA 1PAUA 1Z0SA 1ZBQA 2VI5A 4R16A 5MF6A 1AGNA 5A4JA 4C7OA 2NTNA 4A6EA 4DQDA 3OBIA 2AEMA 3L8EA 2O1EA 2VAWA 3U48A 1P7CA 3EBPA 2AX4A 3C97A 3OZFA 1W94A 5C3MA 2AN1A 1SG7A 1OWMA 3E2IA 3UXMA 2GAIA 2W2MA 3DM5A 3GFOA 3NHSA 2ORVA 1H3NA 2NU8A 3VYRB 3WB0A 3ZX4A 2DMRA 4DSOA 2R6ZA 5LXTF 3CR7A 3QWHA 5ADWA 4AECA 1ZI8A 3EOAI 2A67A 2G9RA 2I3ZA 1LDYA 2PNJA 1Y3HA 1Z4QA 4W1QA 1ZM9A 1E5QA 1D2MA 1Z13A 2UYCA 2WSBA 1ZIPA 5EPOA 3W4JA 4J94A 4WZAA 3S2EA 1JVBA 2I87A 3OKCA 3LCCA 5A71A 4J9UE 3DZCA 3N2KA 3QVTA 4FOSA 1XA4A 3K05A 3JQAB 4RZUA 4HYEA 4U1RA 5IRCD 2OP1A 3OJLA 2IXDA 3RHTA 1EXVA 4MQUA 1OJLA 3AZOA 3PDIB 5TSDA 5K8TA 4GZMA 1P5ZB 5EWJA 2YVAA 4TYNA 4KHPB 3EARA 1EAYA 1Y9JA 2FUG6 5HF8A 2MAOA 1F51E 5U1PA 3MUFA 2PX8A 3MUNA 1GGVA 4LFCB 4PYRA 4GAEA 3RYIA 1SIOA 1E1RD 1Y3CE 2HMWA 3EJWA 3GMIA 2HAEA 4QA9A 4F9TA 2HK7A 2WKQA 4FKZA 1AMUA 2B82A 1LS1A 4N3BA 3OCXA 5FLEX 4KLNA 1NUUA 1G8GA 4DOMA 3NV7A 3DYBA 4FCTA 4RZ3A 2HADA 2ZS8A 4WOBA 3UW1A 2C8JA 3NPAA 1PZGA 5IT5A 3JQ8A 2QJRA 4PINA 4D2IA 2YKGA 3V6LA 3I64A 3C39A 3ND9A 1BS9A 3RFTA 1WLYA 1ESDA 3X1YA 1QHNA 4PAWA 1DWUA 1TEZA 5REQB 3ZCTA 1GGMA 2B61A 2IBMA 2O23A 3MA0A 3FZGA 3WA6A 2X8WA 3EQ7A 5I7UA 3IPXA 3HG7A 3TGPA 5AT1A 5FQOA 1A50B 2XUOA 2GUWA 1TLTA 2RK4A 3V7FA 1V7PC 4EY6A 5BQFA 1MVNA 2VXYA 5HZGA 3G1TA 1KDVA 2GPYA 3I0MA 2AOWA 4KMRA 4I6JA 4BU0A 4KKXB 3KJGA 3R75A 1WZUA 3L7JA 3ZE6A 5DYTA 5HKAA 1YQQA 4FHDA 2Q3EA 1T0UA 2IP2A 1T9BA 3QLTA 4A2QA 3E3AA 4A15A 2HH9A 3PE3A 3OJEA 3H5AA 5KHOC 1GZ4A 3FFAA 2W90A 1AMNA 3KT8A 1F5SA 3NIWA 4R0VA 3QMWA 3ONDA 3WZ2A 3P97A 5EMKA 4RTPA 3B7UX 1E2BA 4QOHA 4RW0A 3UAOA 2WPGA 4CKBA 5CNMA 2FPWA 3SEFA 1UM9B 2A30A 2P35A 1T6YA 3JZIA 2XB2A 1JWBB 1N9KA 2BF7A 5GMOA 4RKRA 5DOVA 4QYIA 3NDIA 1G20B 1E1CA 3G5UA 2VPPA 5CGQB 3LW8A 1T34A 1FZTA 4M38A 3TSZA 1NRJB 1OKKA 2XODA 4BLSA 4HNTA 2IEDA 4CG2A 1PF7E 3L0OA 1EXNA 1N2CB 2X1MA 3ZIAD 5CCEA 2O5CA 3AL3A 4XEUA 4DDTA 5LA6B 4G4IA 4MSUA 5FEMA 3NAQA 3OT1A 3MWYW 2FE4A 4I5FA 1I4DD 2DKOA 2FR0A 4TZTA 4BC1A 3C1AA 3Q7EA 5DJ5A 1VG1A 1T5OA 4JUBA 1JU3A 2ZATA 1C4XA 4ZTBA 5JBIA 3GT7A 5L3VA 4TN5A 3RFFA 4RQAA 1DMRA 1UFVA 1NURA 2BZGA 2PQMA 2GEBA 1KOFA 3DF7A 3GV0A 3HCCA 5BN1A 4S24A 4CQLA 3F73A 1CUHA 3CA8A 3JQPA 4IIUA 3BK1A 2JGLA 1U8ZA 4MYDA 1RM5A 1V7QA 3T0YA 3CF0A 5LNK6 4KBFA 1HK7A 5IMBA 1S02A 1CXZA 1TVKA 3EPRA 2ZB8A 3ITEA 3ICWA 3QKSA 4YGYA 1AS0A 1H9BA 5DYIA 4X1KB 1EDBA 1KI1A 3FFBA 2PVSA 2GDJA 4Q39A 4DMCA 4E6PA 4NOKA 3IULA 2KPOA 2NZWA 5FLXA 1K4YA 2ZRPA 1P1CA 3GDHA 1U8CB 3U7FB 3L1JA 4KZPA 4PNHA 1HLFA 1POWA 2BCJQ 1IVSA 3UICA 2FQQA 2GHRA 4R3NA 3TCXB 1F4LA 2AC2A 4JXZA 1YSCA 4GSKA 1Y98A 2JJ8A 4XIGS 3UB2A 4KEAA 3HKDB 3NRBA 1DO2A 1TRKA 1HMPA 2GPBA 2KBFA 3OCJA 3OD1A 1W8DA 4GUDA 4GYKA 4FMBB 5D51S 5F73A 2GJKA 3KTDA 3CUKA 3O8QB 3DEZA 4PHFA 4AR1A 2UDPA 3JW8A 1E5DA 3O9MA 3HK2A 5TS3A 1QTNA 2BPOA 2OC4A 4DCTA 1G4UR 1ODJA 3HBMA 3VSEA 4UCFA 2IV2X 4OFBA 1JG4A 1GITA 1I6LA 3R74A 3V4PB 2XMRA 3W7AA 3N2GA 1KPGA 1O94D 4JLKA 3EOBI 3VNRA 1W4ZA 1AV7A 1U8FO 4NOLA 1UMBB 4I50F 3LYHA 2QLTA 4W6QA 1PK8A 5BSEA 3GJ8A 4Z5XA 4ABTA 2ZXGA 2WTUA 4X92A 1QGDA 2C2KA 2Z5LA 3N05A 2W48A 3RYIB 4CMIB 3IQXA 4N6OA 1XTUA 2QG6A 2OK8A 2Y0CA 1CUYA 3JTMA 1XDDA 2D5AA 2A33A 3FJOA 3GUHA 3LKZA 4RVOA 1NBWB 2RONA 2ZJFA 2XV1A 3CY6A 3STXA 1JKMA 4Z6KA 4L2LA 3K9NA 3FRHA 2QAJA 4EEZA 4LN1A 3JR7A 2ZGVA 2HX1A 2JLRA 2P2YA 5F52A 4L1KA 4LJRA 4LZWA 4I50A 3TLMA 3SPXA 2XQKA 4HGNA 3CGWA 1K5GA 3H42B 1SUCA 1YF3A 2PAFA 3MILA 2ATCA 4O4LA 3EIQA 4JUAA 1J39A 1GV0A 5ALOA 5D6OA 3VKWA 1SXPA 4AWAA 2UUCB 1YVPA 4HPXB 2LIPA 5GV7A 1IHXA 2XOKA 2YN2A 5J2UF 2BI8A 4MAMA 4R05A 4X8HA 1JIKA 4M7PA 2ZXFA 3WADA 3FLMA 1IM5A 2AG0A 4Q5IA 4IILA 2FGJA 3WJAA 1D1QA 4WK4B 2C3OA 2FDCA 4I9FA 3AIKA 4LI0A 2I4TA 4JQZA 3C3XA 1YB5A 2GAFA 4HAVA 5F21A 4JJ8A 2Z1MA 1IK6A 4IZHA 1CP2A 4NBSA 3UK0A 3NAGA 3F71A 3JRWA 2WA1A 4M6WB 3MWDA 5JNRA 2CMDA 3RW9A 3JQGB 4RZXA 3BMXA 1DPGA 3BHMA 1A9XA 4DA0A 2GF2A 2PS3A 4NJMB 4ER5A 1MVYA 2V9ZA 1EWQA 1IMOA 3LUDA 1DQPA 1U31A 4DRZA 5JCJD 4F9FA 3KZOA 4UU0A 5LZ5A 2IF0A 1H1LA 6LDHA 2PD3A 2I7CA 1K4MA 1FTYA 1PU2A 2Y76A 2N47A 1Z45A 2X0RA 2FP3A 3LP8A 1MPXA 4IKPA 2VH5R 1YMVA 2QP4A 3OICA 3QOXA 3TG2A 1NJSA 4KQKA 4TLMB 2YV3A 4DLTA 3A9UA 4O4HB 3CLSD 3AXTA 2E2WA 2BI7A 1A3CA 1LDNA 1HZZC 3IP1A 5A3RA 1NJ2A 5LUAA 4JBIA 3TLKA 1E1CB 2QYOA 3DOIA 4EIWA 5JCZA 1JL3A 1BH6A 2B1JA 1IZ0A 4QDKA 4YJFB 2A5DA 1QHYA 4EGAA 1JFFA 3KYCA 5AW5A 4GEKA 5IK2D 2QIPA 1GTG1 3PX2A 4FYIA 4YAJA 4CN9A 4ISBA 4RU1A 1V1RB 3BB4A 4Q1VA 5CUQA 3KYDB 3LLUA 1KY3A 2IQIA 5DX1A 1MIOA 3ADCA 1N77A 3WIOA 1K8YB 1RZ3A 1E9SA 3BMNA 4P5EA 1L7XA 1MU0A 1PNVA 2KW5A 3D59A 2M9MA 2OV4A 4JU8A 1DAIA 4GP9A 4BRZA 3ZD8A 1J0EA 3WLNA 1QYVA 4PRLA 4RBNA 4AKGA 4BFVA 3S28A 3P9RA 1S7GA 2XQIA 3ZZUA 2DQSA 4LJSA 5T57A 2D0DA 3SIPA 5FTWA 3T5BA 3KLOA 1JILA 3AV0B 2A92A 4Q9KA 5THKA 2H5JA 2HEGA 3WL6A 5AM2A 5HF5A 4ZCPA 1VZ2A 1T36A 5IAJA 4TYWA 1GILA 4GMGA 2CLIB 3EE6A 4XO5A 4NYIR 4OM7A 1JH8A 3MNFA 2IIVA 2HNKA 3ZCSA 3A6HA 4ZT7A 1AF7A 1QE3A 1BVRA 1IHYA 3ELYA 3P2OA 3PV0A 4R9NA 3PLAE 1AKVA 2Q4BA 2CNNA 3H9EO 3PICA 4E3WA 1QR6A 3GCGA 1Y7TA 4LOKA 2O8BB 5KS2A 2RGWA 2AQ8A 5AM1A 4TTQA 2VT6A 2A1TR 3AIMA 5C46F 1WV1A 3U7QB 5AMXA 5HGXA 3LUHA 2HYDA 2FSUA 5T7BA 1AH2A 5LZ8A 4RHXA 1CB0A 1N0WA 3DFUA 1AKNA 1KS2A 3LBNA 2WYWA 3CKLA 4ZWNA 4B2LA 3I04A 1L7NA 3OEHD 2XAUA 4BIIA 1GT6A 1U1FA 1XXHA 3ZCRA 1UPBA 2G67A 1PP4A 2AWNA 3BOSA 5BQ3A 2KI5A 3D0RA 3BH7A 3AVPA 3DNFA 3O31A 1GPMA 5ESRA 3S29A 3U3DA 4HV4A 1U9YA 1KZ7B 3DPUA 3T9BA 1E9FA 1P2GA 4Q4HA 4BNMA 5JADA 4TV8B 2PXCA 4PR0A 2Q5EA 2RHTA 1YTUA 1L7QA 3QVSA 4JL6A 2V3VA 1H22A 1MN6A 3SWWA 4KYVA 3K2QA 1CU1A 4KN5A 4NV0A 3RRYA 2CZGA 5DWQA 2HXYA 3SGLA 4QASA 2C7BA 2I4RA 3SJ7A 1B76A 5KO2A 3CW9A 5F76A 2G4VA 1J9EA 4D4GA 2Q46A 3ZBQA 2IYXA 3QVKA 3EIEA 4XSGA 3WQQA 3UC9A 4WBNA 3CRQA 1KQ3A 4QBGB 1P9OA 1QB8A 4Q15A 4GI2A 4EJ2A 2K6GA 2V97A 4WKCA 1WR8A 2QN3A 3N2IA 3IT3A 1R0CA 5TMDA 4IDFA 4BVEA 3FDZA 7YASA 2BIFA 2O8DB 4FNAA 2J9GA 4EJSA 3FGZA 4RFVA 2JI4A 2VKQA 3T5CA 1EFRD 1CBUA 3DOOA 4Y6OA 5EFOA 3PZRA 1LJLA 1ZUD1 2Y0DA 4OHCA 2ONJA 3KYJB 3V9AA 1II8A 2A0XA 4EKGA 2X40A 1WPXA 3GLGB 4Z8YA 4KAJA 3THYA 3HKEB 2JIPA 4CT5A 3MLAA 3IKMB 1KSHA 1S2IA 1YK1A 1YR3A 2J5XA 1YKGA 3TH5A 1CS4C 1DP4A 3F6RA 3OI7A 4XNBA 1OZHA 2GK3A 2YW2A 4HTFB 4MP3A 4Y1RA 2H4HA 1JR3E 4M9QA 1D2GA 4RPJA 5KNBA 1RZVA 3B1FA 4K5OA 1ECLA 2QRPA 4WKGA 3PC4A 1H1LB 2C88A 2QTWB 4DE5A 5CDSA 1S46A 3CF4A 5EP3A 2Q0XA 2BFPA 1KAOA 2MTBA 1K08A 2PGJA 3HYNA 4HLUC 4JJIA 3TIGA 4D80A 5AIAA 5B53A 4DYDA 2BBOA 1HWYA 5BYJA 3ZQ6A 4JV5B 4KH1A 4Q3LA 3LQ1A 4BO8A 3FUVA 2QBYA 1THZA 2V6FA 3L0YA 1HG1A 4ZAGA 5BT8A 3E9DA 3BRWA 1RHRA 3FDXA 4BVHA 2O52A 2BMFA 3LBIA 1CY7A 4M22A 1XHFA 2ZAIA 3QX9A 4YJFA 1KQNA 3RVLA 3RTBA 4TM8A 4ZVMA 1P6UA 4XIJA 1RYFA 4HG2A 2VUTA 4AF7A 4CTNA 4ZEXA 1IQRA 1BEZA 3RVQA 1UT6A 3LC1O 2WJJA 3QXXA 1V1RA 4KLRA 2NUAB 5KMGB 5AXDA 3BFPA 3F3MA 1ONNA 2ERYA 5BSUA 3L0CA 2WHXA 1GL9B 1QCCA 4WK2B 4ZQTA 1V71A 4Q3KA 1KQOA 5SV2A 4LNUA 3D3NA 5FL3A 2ZT7A 3ZJ5A 3GP5A 3AHCA 4LX8A 2AR9A 4KI0A 3ZJYA 3SQOA 1FY2A 3NNNA 3COSA 3RJ9A 4L08A 4R1NA 3RREA 4CFZA 4H7FA 4UUNA 1UMDA 4O3MA 2DLCX 2DG2A 4EDFA 1ULZA 3NHBA 5FFMA 3VAZA 2R72A 2DFVA 2XCRB 1FJGB 4MKTA 3I8OA 1FUKA 5K2OA 3D6UA 3PKIA 1WJGA 1ISSA 1WD7A 1ZVJA 2J4CA 4QXPA 1YO6A 2A94A 3ANLA 4MUBA 4BUCA 3O8OA 4MGEA 1VPDA 1G98A 3ETDA 2O0JA 1QGED 4IMJB 4Q37A 4J1NA 5DTMA 3HU3A 4J8PA 3SC3A 1NOJA 2JIBA 3WBBA 4BNHA 1L7VC 3CUUA 4BMVA 5IHPA