4ZQEA

Crystal structure of dox-p reductoisomerase in complex with magnesium
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
407
structure length
400
Chain Sequence
TLQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 139
structure length 400
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqeA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqeA01
4D42A 2I9PA 4YVFA 3ZWPA 1G1AA 4WUVA 3B6ZA 2DBZA 3JQ8B 2DBVO 1E3JA 3DOCA 2ZB3A 1F17A 3RUFA 3SLKA 4DYVA 2DUWA 3CIFA 1CQJA 3TZQA 4Y6PA 4GLOA 4J7UA 4D7AA 2X0IA 1Y1PA 2TMGA 1PR3A 1YQGA 4M87A 4CMJA 1J4AA 1J5PA 4XGNA 5KTKA 4OYRA 3H7AA 1K6XA 3HSKA 2HUNA 4R9RA 1GUYA 3FNFA 1BXZA 2DM6A 1VJ0A 1Y5MA 1U3UA 3RQSA 4OQZA 4NK5A 4W9NC 4J9UE 2R00A 4FJ1A 3ZHBA 2ZATA 1M67A 4TSKA 4EGFA 4RVHA 3COSA 2RHRA 5COQA 4BNHA 3FD8A 3PGXA 4AJLA 2GLXA 3GZNB 1XLTA 2HSDA 5JE8A 3ZZNA 2Q3EA 3TSCA 1CEQA 4CLHA 4IGFA 1MW3A 2VZ0A 2JJYA 5C3MA 2OP0A 1ZO8A 2OUIA 1E7MA 1CWUA 4XYGA 3HFSA 1WMAA 3GDOA 2J3IA 2Q1SA 5G0WA 3UCXA 2GASA 4LSMA 2Q4EA 3GN2A 3MJSA 3JV7A 4R1UA 4UEJA 4KUHA 1LI4A 2WE8A 4LRTB 2J3KA 3U4CA 5TQVA 1N9GA 1DIHA 3V2UA 2JFGA 4AVYA 2W2LD 2PFGA 3LYLA 5I8ZA 2OGUA 1BXKA 5K6AC 5B4VA 2VRCD 1EK5A 4J7XA 5CG2A 4Z9FA 2WM3A 2ZCUA 4QECA 2HDHA 4CR6A 2IEBA 3R0IA 1IUKA 2F00A 4JP2A 2OBYA 3HNPA 2FSSA 2Q46A 2ZJ1A 2HRBA 3OQ6A 1DC5A 4GX2A 3BMNA 5DF1A 2CDAA 2BI7A 2O2YA 4YJGB 1P74A 2FR0A 4TZKA 3JQ6A 4EI2A 4JBGA 4EDFA 2B4RO 2G1UA 3KSZO 1ZEMA 2ZTVA 4B8WA 1NTOA 1NXQA 1B2LA 5T8KA 2VUUA 3MTGA 3QSGA 3LLSA 4J4HA 1LX6A 2PGJA 3ETDA 3PI7A 3ZU5A 2WD8A 1LC0A 3EUWA 3U9LA 1ONNA 1Y8QB 3PHJA 1PZGA 1DIBA 5KNLA 1LU9A 5JY1A 3GPDG 1DEHA 1IHYA 4DMMA 4WOJA 4II2A 1ZW1A 4R5MA 2X0NA 3SLGA 1XQ1A 2NTJA 2DFDA 3AK4A 3TZHA 2UVDA 3GLQA 2VOEA 3R3SA 4ALIA 3IP1A 3A1NA 3RFTA 1YL6A 4TRRA 1KVTA 4BMSA 2SCUA 3TDKA 3RC1A 3NT2A 1PJBA 1U28A 4U6SA 2W90A 1U3WA 1DFIA 5DCYA 4JJIA 3RFVA 4CJXA 2HRZA 2PH5A 1XKQA 4NBVA 3SJUA 1MGOA 4RJTA 1O9BA 1R0KA 3HDHA 1KIFA 2CF6A 5G0TA 4W9NA 1U9JA 2XF8A 4ALJA 5CEEA 1D1SA 4ZD6A 4E31A 5C5IA 4LUPA 4WNIA 5TJ9A 1SNYA 2D3TA 4HKTA 4IY1A 4DIFA 3BMCB 3B1JA 1BXGA 4JIGA 4J4TA 4FLSA 2J6IA 1GCOA 2O3RA 2DQ4A 3E9MA 1ORRA 3MCVA 4IUYA 1PQUA 1XHLA 3S1LA 5C7OO 3C7AA 4HBGA 3C3XA 1L7EA 4CM7A 4G5HA 4W7HA 3PZRA 2EGGA 4TRNA 2O3QA 3GK3A 1DDOA 2VWGA 1GZ4A 3HN2A 3VH2A 4FQ8A 1R0LA 3CZKA 2GRAA 2AMFA 3BMQB 1Y9EA 1FJHA 4W99A 4NBTA 1E6WA 1YB5A 1HE3A 4I9HA 1LSUA 2JD0A 1LSSA 3ZWVA 3DONA 1I3NA 4YT5A 1I2ZA 2VHXA 2GR9A 1DC6A 5B4UA 4PLVA 1GFSA 3BHJA 4J3FA 4CM3A 3DR3A 1XEAA 4IDEA 1RP3A 5JMPA 3OEWA 1R12A 1H6AA 4NQWA 3KO8A 3AUSA 1P44A 2FY8A 2X0JA 2DBQA 2O3TA 1XIVA 1XWFA 3GGOA 3UCEA 4L9RA 4E21A 1HDCA 4FB5A 1EVIA 1R16A 4BO3A 4QQRA 4XR4A 1SEVA 3K9QO 3VC7A 3DHYA 3IQDB 3RVDA 2D5AA 2HJRA 3SBOA 2Z95A 5JDCC 2EV9A 3GR6A 4FR5A 2PZMA 5DOZA 2Y1EA 3I9KA 4NBUA 1I3MA 3P19A 1NBOA 3ROKA 3DBHA 3W8FA 4JX8A 5TX7A 2H6EA 4L73A 4PLTA 3ICCA 1RWBA 1S6YA 1PL6A 1J6UA 2O50A 3EC7A 3KLMX 4OAQA 1Q7GA 4M86A 5G0SA 1HDYA 3H9JA 1DRWA 3HE3A 2QIOA 3NTOA 4MVJM 4AYSA 1EE9A 1X1TA 2PY6A 4HWKA 1UDBA 4PZDA 3RUEA 1LRKA 4CPDA 5ITVA 3D3WA 4O63O 2EXXA 4KQXA 5JBIA 4CQMA 3DMTC 1ONPA 3AU9A 2BHLA 1OAAA 4XJTA 5TRTA 4YAGA 4IDAA 3TN7A 1YVEI 2I3GA 4FLRA 7ADHA 4WJZA 3E9QA 3G79A 4TVOA 2EKQA 3WSWA 4L0QA 1IB6A 4BNZA 2AQHA 3BTOA 4GSKA 1DC4A 4E5PA 2ZKLA 4L4XA 4OXYA 3WB9A 4NJMA 4PN3A 1B3RA 2NNLD 3QWFA 1P45A 3A14A 1QLJA 4W82A 1VRWA 1I24A 1HLDA 3AM3A 3H5AA 3V2GA 3EAGA 3G17A 1LUAA 3TFQA 3I9NA 3NV9A 1YH3A 1E5LA 2AEFA 1P1HA 5TS3A 4YR9A 1NAIA 1ZVMA 3B70A 3AUTA 4O59O 1R66A 1PGQA 1TLTA 4XEHA 5LCXA 1V9LA 3B1FA 1EQ2A 3RI3A 2JCXA 4MVJA 3QY9A 4A27A 2B5VA 4C7JA 2AW5A 3UHAA 1E77A 5HM8A 3JYNA 3PHLA 1G0NA 4ALLA 3ZH2A 2AEMA 2XXJA 4KWHA 3LSYA 1TA4A 1MG0A 2NSDA 4TVBA 2W2LA 4L74A 1XU7A 2FSVA 4U0KA 3EZYA 1AXGA 4DIOA 3M6IA 4QFDA 1E1MA 3H8VA 4I08A 4Y9DA 3I4CA 3KEQA 2HO5A 3ZHYA 3C1OA 5JS6A 2IXBA 3RUAA 5JXWA 4NHEA 1QR6A 1PX0A 2I5PO 1I2CA 1B16A 1PEDA 3AFNA 5KJ6A 3RKUA 3AOEA 1B8PA 1E3EA 5EJ2A 5CDSA 3D5TA 4A73A 4RV9A 1ENPA 2ZK7A 3CXRA 4GI2A 1KS9A 4RPHA 4O1MA 3I4FA 4BNVA 4BQPA 3QVXA 4LISA 3P5SA 2GGSA 4ZRNA 1QORA 3K2EA 5IG2A 5G0UA 3W4IA 1C0KA 1E7WA 5KIAA 4YRBA 8LDHA 1YE3A 4XQ9A 2GN8A 3PJGA 1PGJA 4DREA 1ISGA 3UAGA 4DUPA 1OOEA 1X7HA 4E5KA 5C7LO 1FDUA 2JCYA 1CERA 3SX2A 4CMBA 3EZLA 3JQ7A 1WWKA 3Q9UA 3KV3O 1E1NA 3UKOA 3NTRA 3VZPA 1HDXA 3NDRA 1NFRA 1E92A 1OI7A 4MP6A 3JQ7B 1KVUA 3ZW9A 2RAFA 3GNQA 3ONFA 3WNVA 4YJGA 4Z9XA 3CPSA 3GVPA 4ZRMA 1W4ZA 4B4VA 1LDNA 2Y1GA 1WNTA 1N1EA 2GERA 3RC7A 1TI7A 3GG2A 4BKPA 4S3MA 5GY7A 3WGGA 1E7RA 3DBLB 5G2OA 5BNTA 2QG4A 4YA6A 3OJOA 4DQUA 5I7EA 2GN9A 1PJLA 3HDQA 1OR7A 1PGNA 3KYCA 4WLUA 2UAGA 5IZCA 1HSZA 1MX3A 3H9UA 3LC1O 4UREA 5IFLA 4FJ2A 5B4TA 1M6HA 2EEZA 3BIOA 4R16A 4G65A 1LBEA 4L4RA 4HV4A 4BO1A 5JNLA 1GV1A 4RORA 3INRA 2G76A 3S2IA 2VN8A 4IS2A 2JD2A 1L7DA 4KUEA 2O3JA 3H4VA 4BO8A 2YQ4A 1H2BA 4XYEA 2BMAA 3GA0A 3GAZA 3LF2A 4E33A 2GZ3A 3AY6A 5A05A 4RPGA 1EVJA 3TOXA 5HS4A 2GN4A 2VT3A 2JAHA 3CZGA 1DBVO 1LDEA 5B12A 3PVZA 5L7WA 2W2KB 4FD3A 1ZKMA 2BF7A 2ZTUA 2DTXA 4YT2A 3M2PA 3SEFA 2O7SA 2Y1FA 3GVHA 3DEYX 3DBHB 4BO7A 5IF3A 3EVNA 4KDFA 1SB9A 4HNGA 4CM9A 2J5RA 3JQ9A 2GO1A 1E3WB 2OL4A 3JQGA 3KXDA 3QW2A 4GX0A 1HE5A 1PS8A 5EQFA 1DAOA 1XELA 3VH3A 1PTJA 4EEZA 5AQ1A 1U4OA 2J8ZA 1ULUA 1EUZA 2VYVD 2WPGA 2EGHA 2Y0EA 3QVWA 3QVTA 1Z82A 1GCUA 1LXCA 1T4DA 3AM5A 3MJTA 1HZZA 4WK6A 4XDZA 5LDGA 2VHYA 2X9NA 1NAHA 1T2DA 3BTUA 5JAMA 4MKZA 2Y1DA 4E2ZA 1DHTA 3KYBA 4QX6A 1SOVA 5F3RA 1E7QA 2YV3A 3ZWBA 3WGYA 4FFMA 5A9SB 1V8BA 2C5AA 3ZCXA 1Q1NA 4R1TA 5JYEA 1E3IA 2C82A 5JLAA 5L95A 5FI5A 1JGIA 1EDOA 1E3SA 2O3SA 5AXDA 2CY0A 3TJRA 1X1EA 3F47A 1BXGB 2AA3A 2ZTLA 1PJ4A 4YRAA 5ER6A 3ZWAA 3PHGA 2YZ7A 1CRWG 5ITWA 3JQFC 4PLGA 4UEKA 2JD1A 3L4BA 3L77A 4BB5A 2R00C 3LU1A 2LDBA 3PIIA 4NMHA 3WMWA 4YWJA 1ZK4A 3GHYA 4CMIA 2VHWA 4R41A 3PJDA 4A2CA 5A02A 3JQ8A 5AXAA 2X8LA 4NU6A 1GL3A 3W1VA 4DQXA 1R4MA 3ST7A 5DBFA 2QRJA 1VLLA 1R4MB 4B4WA 4CLOA 5IZCC 4AJPA 4PG5A 4Q3DA 1EVZA 3QVSA 4I5EA 4WEOA 4CUKA 5I7VA 5TLSA 3PPIA 3TPCA 4GQAA 4DLAA 1TXGA 2B69A 3PWZA 1K6IA 5JDCA 3E03A 4QT0A 1JQBA 1IY8A 1ADGA 4PRLA 1OC2A 4A7PA 2DKNA 3RAJA 4BNWA 1P1JA 9LDBA 3OA0A 1EE2A 1UUFA 3K2BA 4Z0TA 3DTYA 3D4OA 4XKJA 3NDIA 5AXBA 4RPJA 2YHIB 4R51A 1X0XA 1AHIA 1ZCJA 4XDYA 4CV0A 3PWSA 4MO2A 4A26A 1ADBA 3JQAB 4L4SA 3KETA 4WE3A 3EY4A 4NBRA 1M75A 3JQAA 5IAAA 3Q2KA 3VTZA 3FSRA 4CUJA 3FPCA 4JROA 5U9CA 3BHIA 5I9NA 3DMTA 4GGPA 5A3VA 5HS6A 4DTIA 2FRDA 2X86A 2E49A 4J90A 2H5LA 4NI5A 1DFGA 2VWQA 2FOIA 1I32A 1N9GB 1F14A 3DC2A 1G5AA 3L0DA 3NUGA 4PLZA 4ILKA 1DIRA 2PD4A 1QMGA 2PNFA 3ZWXA 4R1SA 2ZYGA 4PGFA 4RPKA 3WS7A 2I76A 4MIOA 2X5JO 1DAPA 2G5CA 3IAHA 1DJNA 4UVIA 4XB1A 4ZQBA 1ZK0A 2DFVA 2IZ1A 4F3YA 5BSEA 4B4UA 4IDDA 1QYXA 4OSOA 4XJSA 3E8XA 4ZU3A 1CIVA 1U4SA 3WTBA 1CYDA 1R4NA 5T5QA 3ZWOA 1YB1A 4XZ3A 1TVEA 1MC4A 3GH3A 4E5NA 3I6IA 4YXFA 2W98A 3DZIA 3GQVA 4D0RA 1P0CA 3FBTA 4NH4A 1B8UA 3B1KA 3U4DA 3GRKA 3WJAA 1NFFA 3OJLA 4AJKA 4MKXA 1SBYA 1C1XB 1A9YA 3VTFA 3F4LA 2BI8A 3TOZA 1FDSA 5JAIA 4XYLA 3VVCA 1NQOA 3L9XA 5COBA 1ZZEA 2X22A 3W6UA 1V3VA 1GUZA 1A9ZA 1RKXA 4XD2A 1KEWA 4YQZA 3MWDB 4BVAA 5JYDA 1NFQA 2V6MA 3SJ7A 2FZEA 3ZNQA 3A28A 1U3TA 2CSUA 4ZQEA 4RLSA 3OICA 4FFRA 3FTNA 1NHWA 2WTBA 1WAMA 3FWZA 4CM4A 1K2WA 2Y05A 3RUIA 3TWOA 1XA0A 4PLYA 5JC1A 2A35A 3GGPA 1I0ZA 4ZHSA 2NU9A 4TQGA 3JYOA 2Q2QA 1DJQA 3WQRA 3DOOA 1F0YA 5JMWA 2D59A 5I9MA 3WICA 1U5AA 3D1LA 1IOLA 4RO0A 4BHTA 2W4QA 3EK2A 5IDQA 3KEOA 1KVQA 4MVJE 4U0JA 1LTHR 4YDRA 2C5EA 4ZQHA 3KB6A 1C1DA 4GX1A 4BNNA 2PTGA 2GUGA 3WQQA 3JD0A 4DMLA 2C20A 1U3VA 4BMVA 1KERA 3DZBA 3QHAA 1PGPA 1PIWA 2ZCVA 1HYEA 4GAEA 2CDCA 5DNAA 4DGSA 5BSGA 1PU2A 4RF4A 4Q9NA 4EYEA 1V6AA 4RQTA 3U4HA 1I8TA 4OXNA 4TROA 2HK9A 4YJDA 2EERA 1YQXA 1GEGA 4Q3CA 2ZQZA 3A9WA 2PR2A 4MPDA 5JCJA 4RZHA 3T4EA 1ZSYA 3JQBA 1LDGA 2PGLA 5L7YA 3PEFA 2A9FA 6LDHA 3I52A 4NG5A 1TT5B 5ILGA 5ILOA 1Z7BA 4QUKA 3GEDA 1GTMA 3PK0A 4J6FA 3KYCB 3JQGB 2VRBA 1EZ4A 4CMCA 1QLHA 3KBOA 4MVJD 2B35A 2I65A 3IMFA 4XQEA 2X9GA 3I6QA 4CLDA 3H5NA 1DOHA 3WMXA 3ENKA 2V6BA 3GAFA 3E18A 2B83A 4BNIA 3DZJA 3WGQA 7MDHA 3CUKA 2CVQA 5EMHA 1ZEJA 3QE3A 1W8DA 3OMLA 4E2XA 1SEPA 4WNCA 3VPGA 3PXXA 4ALNA 1SB8A 3DBRB 3AOEC 3OQ1A 4N5NA 1JG9A 5A06A 1Q7BA 4HFMA 1RM5A 2JAPA 2PKQP 4NFHA 1JW9B 1HLPA 1KVSA 2FR1A 4LSWA 4AJ4A 1GD1O 5T67A 2I66A 3GZ4A 3ZNOA 1NX6A 2HLPA 5GZ6A 4U7WA 2WSBA 4CV1A 1MW2A 4BGEA 3IC5A 4HFRA 2ZQYA 4JK3A 2DBRA 1QG6A 1PSDA 4CM6A 1D3AA 1VSUA 4R69A 4CQLA 1JAYA 2ZJ0A 2ZYAA 5EINA 4DPLA 3U0BA 2HMWA 3NTQA 5EL0A 1ZSVA 4J0EA 4FLOA 3QV1A 2NU8A 3TFOA 5KKCA 4MOWA 2DU8A 4MIEA 4B7CA 1YWGO 3DOJA 2TMDA 4BO5A 3VPSA 2IZZA 4LN1A 1OC4A 4NFSA 1KC3A 1YL7A 2DUUA 2QQ5A 1Y8RB 4BKQA 1HE4A 1DXYA 4XGKA 4CM1A 3MJCA 1XR3A 4NR0A 1GR0A 2HKIA 1RYEA 4Y98A 1XGKA 4P38A 4YAEA 1YBAA 5JFOA 3S2FA 5JC8A 4M89A 3PP8A 1KY5A 3QVOA 1SAYA 5A9RA 3FTPA 5B37A 4UVGA 2B4TO 5JDIC 3QWIA 5ENDA 1FDTA 2PD6A 3RKRA 5CEJA 3WX0A 5I7FA 3GPIA 1CDOA 3CINA 2WYUA 1EK6A 1PZFA 3DDNA 3ROMA 4OHUA 3GFGA 4QTZA 4GVXA 5KJFA 3UEQA 1LRLA 1K0UA 2BFOA 3HWRA 1V35A 4D44A 4CMHA 1U7HA 3H9EO 2O2SA 2V6GA 3IUSA 5L9AA 2O4UX 5A03A 4HFJA 4CV2A 1Z73A 2AHRA 2J5KA 1FDWA 4QO8A 3ZWNA 3FF4A 3WWZA 1VKOA 1LLUA 2VQ3A 1WZIA 1H9BA 3ASVA 3IKVA 4W4TA 3FHLA 1NPYA 3T0YA 1PZHA 2NVWA 4DC0A 4JBHA 3PHIA 3WLEA 3BMQA 4GBJA 4FLQA 4N54A 1AHHA 4JBIA 5COAA 2D8AA 3WGZA 2UUPA 4NQZA 2AXQA 4XB2A 3SC4A 5L4LA 4RVDA 3NJ8A 2PK3A 1H93A 1NHGA 1EEHA 4I8XA 1HSOA 3ZNPA 1WDLA 1U2DA 1YXMA 5H81A 1JWAB 2HMSA 3UGKA 2FPIA 1R6DA 3O8QA 1U8FO 1NR7A 1YDEA 4CM8A 3JYQA 1A7AA 2OZPA 1X13A 3CZEA 2AQIA 4IMRA 1G0OA 3FR8A 4OGWA 2BFAA 5FYDA 5CEFA 1Y6JA 4WLVA 1QSGA 3GMSA 5EPOA 5CDTA 1LA2A 2CNBA 3K8ZA 4AJNA 4DBVO 3JQFA 3D64A 1HRDA 1VJ1A 3DZKA 5KOIA 1Y8QA 4BV9A 1VC2A 4R4JA 3Q11A 2Q49A 4NK4A 3AW9A 4R68A 3GOHA 3UCFA 2GN6A 2B37A 3ROPA 5THKA 1Q7CA 4R3WA 2YYYA 4MP3A 4CL3A 1T26A 3WLFA 1Q0QA 3IL2A 3FR7A 4IZHA 4B7XA 4JN6B 1GUFA 4DXHA 4F45A 3OECA 4RCVA 4Z3KA 1BW9A 3AU8A 3P2YA 4EZBA 1UDAA 3IJRA 3DTTA 3I3OA 3O26A 3L6DA 1ZNQO 2PZKA 3LC7O 3DAPA 4F6CA 2WEKA 4ZVVA 4OOEA 3TZKA 1QKIA 1UDCA 4FW8A 1L1FA 2O7QA 2Z5LA 4BO9A 4E12A 1X15A 5A9SA 4D43A 1UZMA 1KETA 5FFFA 3WDSA 4GWKA 1M6WA 2HMUA 1B0AA 1V3UA 1BDBA 1I3KA 4R9SA 4YACA 4WECA 3W4KA 3F5QA 2Y67A 4DLBA 2AG5A 4D41A 3DFZA 4XIYA 4OKIA 1E0DA 2P68A 4J49A 1CF2O 4IINA 4GVLA 1H3LA 2W8ZA 3RU7A 1BRMA 4PZCA 3QA9A 1RYDA 4J4BA 3VVBA 2BD0A 4EUHA 3LT4A 2C59A 2X4GA 2WD7A 1PZEA 5DCWA 1LJ8A 2RH4A 2OFPA 1ZXBA 4IQ8A 2Y0DA 4GKBA 4FOOA 2GSDA 4JQCA 3S55A 2NLOA 2PKRA 1LLQA 1WLYA 3GF4A 4D3DA 1VL8A 4BNLA 3DXFA 4BO0A 2GZ1A 3IDSA 3VH4A 2QHXA 3GG9A 5TT1A 1QYCA 5KVSA 3OSUA 5A5EA 4OO3A 4AICA 1UXGA 5L40A 4CUZA 1MA0A 2VHVA 4XR9A 3GEMA 2GPTA 3WBFA 4KP7A 1BSVA 1ADFA 1B26A 2F1KA 4P4LA 3VZRA 4OIMA 1ENOA 1DPGA 4Z9YA 1E7SA 2YFHA 4UULA 3WGIA 1Q0HA 1MLDA 2Y93A 4OMUA 4JCOA 3STHA 2XAAA 4BO2A 1ID1A 4B79A 1PL8A 4E30A 1KC1A 4ZGWA 5H82A 4DL9A 1GADO 3HJAA 5A9TA 1PS9A 1X7GA 5IDWA 1ISHA 4CODB 1TB4A 1PJ2A 4HNHA 3EYWA 2NM0A 2DC1A 4KDEA 4FN4A 1T2CA 3DMYA 4N7RA 1T2FA 3CMCO 4BIIA 4IJUA 5TJHA 4YTEA 1E1LA 1H5QA 2PZLA 1A4IA 2QYTA 3Q0EA 1GV0A 3D0OA 3DBVO 3CMMA 3P2OA 2QRLA 3GHHA 1ENZA 1HDOA 5KJEA 3HN7A 4FDAA 5TC4A 2EJWA 2VWHA 3I1JA 2DLDA 2QRKA 4M55A 4BS9A 3TNLA 4GGOA 1NM5A 4PLFA 1OFGA 1IL0A 3WIDA 4BQRA 4NJOA 1B15A 3ZV5A 1EFKA 3GUCA 4DPMA 5L53A 1KEPA 1ISIA 3RC2A 3W8EA 4IQ0A 1LRJA 1PL7A 3HB4X 2VHZA 1GYQA 3OHSX 2PGDA 3FI9A 5GZ1A 5JSFA 1MW0A 3AWDA 2ZB8A 3WR5A 4AG3A 4JXKA 3PYLA 3EDMA 3RCBA 4H15A 4L76A 3H5RA 4TWRA 3ZNNA 1AXEA 3NX4A 5EERA 1ZUD1 2IODA 1DHRA 2OO5A 1F12A 5IXSA 2QYSA 3DZGA 5CP8A 3WQSB 3KOUA 1V0JA 4Q3AA 1IZ0A 1DB3A 3MJEA 5BR7A 1ZMTA 5K9ZA 2XXBA 3O9ZA 4PLWA 3I5MA 1UAYA 3OETA 4GX5A 1B14A 4E32A 5T6BA 1TT5A 3UOGA 4FC7A 4CLOB 3BAZA 1NQ5A 1P77A 4I9UA 2Q1WA 4WLEA 1NVMB 3E5MA 3D5QA 3Q1LA 3DAFA 3DL2A 1HETA 1IE3A 1VE9A 3P7MA 3QJ5A 4IXWA 4RLHA 4CM4B 3NAQA 1H94A 1GZ3A 3WGOA 3EHEA 3GDFA 3L6EA 4K1LA 3K5PA 1C0LA 1KEUA 3PWKA 2DTDA 1HDGO 5DCUA 3OA2A 1DLJA 2BGLA 2YHIA 4NNJA 6ADHA 1LDBA 4PVDA 4LW8A 3HHPA 4JGBA 2JL1A 1CQIA 2NU6A 3NYWA 4TKLA 3H3JA 1FXSA 2Q1TA 3HDJA 5A1TA 1VI2A 3DZFA 2YW9A 1NPTO 3FRJA 4IJWA 1F06A 1W6UA 2QZZA 4N18A 4MIYA 1WXDA 2VNAA 2P2SA 2VYND 4BNJA 1JVSA 2J5QA 3VPHA 4TRJA 3C24A 3F1LA 3FNEA 3INGA 1HYGA 1LDMA 5G4KA 3WXBA 3G49A 3DHNA 3V8BA 4BKOA 1QP8A 4BB6A 1NQTA 3R6DA 3IS3A 3OJFA 3X2EA 1I01A 3O4RA 5L3ZA 4IDGA 3SC6A 3ETEA 2FN7A 1ZMOA 2FPPA 2Z1NA 3DB2A 3RWBA 4XX0A 4G81A 1IPEA 2B36A 4MKRA 3F9IA 4AJOA 1LEHA 4FFLA 1RPNA 1YRLA 4PRKA 4WLFA 1AGNA 1SMKA 3V2HA 1GY8A 2NVUA 4FFNA 3T4XA 4AJJA 1YB4A 3WG9A 3ZWCA 1RM3A 1JKFA 5HWSA 3GY0A 1QYWA 1NPDA 4M1QA 4BNKA 2O48X 4IPTA 4YCAA 4A0SA 3AUUA 1QV7A 5T8KC 5HTOA 4BO4A 2C07A 1GZ6A 4FSHA 1BW9B 3LT0A 4GKVA 5BT9A 1AUPA 2NQ8A 3O38A 2B4QA 3DFUA 4HUJA 5DP2A 3RJ5A 4UUPA 4BNMA 3QWBA 4ESOA 4E5YA 5DOVA 4EJ0A 3PFFA 1GQ2A 1N2SA 2Y0CA 2JHFA 3JD2A 3OFSA 3VKVA 5MGBA 5I7SA 3N74A 1MUUA 2VYVA 3ENNA 1YDWA 4CQMD 4MVJH 1E6EA 4U5QA 5TGDA 3W4JA 4RF5A 2YDYA 4QXMA 3ONEA 2Y66A 1S7CA 4DPKA 4ITUA 5JCJD 3S2EA 3FBGA 4R3NA 4ONEA 1UXKA 1XYGA 1HYHA 2NWQA 3HG7A 1P31A 2GZ2A 3F4BA 4E6PA 1TT7A 2Q45A 1GDHA 1R15A 4J0FA 2EIHA 4EITA 1WMBA 2P9GA 2ZB4A 3JSAA 1MFPA 4W7IA 2ZB7A 2CUKA 4CLXA 3LT2A 1C0IA 5KVQA 3PLRA 1GQYA 4AJEA 3KHUA 4PG8A 2C7GA 5I9LA 2C7VA 5CG1A 1P0FA 4BGUA 3CZLA 1C1DB 2YDXA 1VKNA 4DC1A 3UCQA 2P9CA 5ENVA 3WGTA 5TSDA 1I2BA 4J1QA 4CMAA 3PQDA 4DRYA 2VUTA 5L4NA 2CZCA 2YJZA 3ZWWA 2EW2A 2P5UA 1NQAO 5K0ZA 3MOIA 5KJ1A 1MXFA 2JCVA 2EG9A 4ALKA 1YONA 1ZK3A 2HU2A 2OHXA 5FEUA 1UZNA 4IIVA 3RBZA 4AL4A 1ZSNA 4J1TA 2D2IA 4EJ6A 4FS3A 3ADOA 1EDZA 1JVBA 2POQX 2IXAA 1JTVA 3PZBA 1I5RA 2NADA 3M2TA 1V3TA 4WGGA 5EN4A 5BNFA 1EMDA 3T7CA 3TRIA 4CR7A 4GMGA 4IJVA 3U3XA 3RBXA 1WZEA 4CMIB 1LDYA 2DTEA 1Y81A 3WYBA 3CEAA 4E2WA 3H3FA 3JQDA 1K6JA 4JJGA 3PHHA 3UXYA 3RUCA 1EFLA 2D5CA 1CETA 4U6QA 4JJFA 3PYMA 4C7KA 4WLNA 5JO9A 4BL5A 5CPFA 4BNGA 2FP4A 1GAEO 4H3VA 3E6AA 3ZGYA 5CAEA 4FBGA 4J43A 3X2FA 4IMPA 1LC3A 2CD9A 4FPXA 1PWXA 3OP4A 5AVOA 3CKYA 3R1IA 2PZJA 3VZQA 2NU7A 2WMDA 3FNHA 1PS0A 1BMDA 1HEUA 1A5ZA 2WYWA 4YJFB 3AJRA 4XQCA 2NQTA 2NUAA 5DN9A 5T64A 5C7IO 3LDHA 3F46A 2GF2A 2VCYA 3H9GA 3PQFA 3QP9A 1PWZA 3D3WB 1XG5A 4D3FA 5JCXA 5JY6A 4E3ZA 1LLCA 3LQFA 3WYCA 4B3IA 3DO5A 1T1RA 4II3A 1T2AA 4RVUA 5T57A 1HDRA 1A4UA 3N58A 1BG6A 1FDVA 5L45A 1U1IA 4C4OA 1T25A 1D4FA 2JFFA 4BGVA 3PYXA 3G3EA 3CZMA 3I9JA 2P9EA 1NR1A 1YJ8A 3FPLA 3VOSA 3SVTA 3DAGA 3ITDA 3PIDA 1ZH8A 1X14A 3OJ0A 4XIJA 2RIRA 4IIUA 3FN4A 1MVYA 1UZLA 4IBOA 1HKUA 3AUAA 1JKJA 2EWMA 3JQAD 3BTSA 3IOYA 4OH1A 3ADPA 5JPIA 1GU7A 4BKRA 2HMVA 1T4BA 1N1GA 4HX5A 4BUCA 2WD7B 4E0BA 4MJLA 4WCFC 2CF5A 4GSLA 1DFHA 2NTNA 3GMDA 4PFJA 1I36A 1PQWA 1U7TA 1DIAA 1EVYA 5IN4A 4AJ1A 1HT0A 2Y1OA 4MVJF 5LC1A 3Q2IA 3GUYA 1ARZA 4CMEA 4LMRA 2YHUA 3ETGA 2VNSA 4CV3A 2AEJA 5CHEA 2QX7A 4OKNA 1SO8A 3H9QA 5B1YA 1MV8A 3QWAA 3K6JA 3L07A 4BMNA 2BFMA 2AQ8A 1KEVA 1T24A 4IS3A 4CM9D 4WASA 5KWEA 5ES3A 1Z75A 4Z3DA 1T2EA 3FWNA 3INTA 4JP3A 1JLLA 2VOJA 1JWBB 2D1YA 3OIGA 1H9AA 4XWYA 3WJ7A 3OIFA 1VL6A 2JFHA 4AJIA 4OQYA 3BHMA 2BGMA 2OMEA 3MEQA 1NYTA 2YQ5A 3Q6IA 1N7HA 3ZU4A 3JCZA 3KZVA 3RASA 1S46A 3BMOA 3ROQA 3GN1A 2G17A 2LDXA 1MC5A 2B5WA 1UH5A 3LLVA 3QLJA 4GLLA 4P4NA 2EP7A 2E48A 3LVFO 2PWZA 4RVGA 5AOVA 2QW8A 3ULKA 2B0JA 4BV8A 5KJCA 3EVTA 3ONDA 4UEOA 4MVJI 2E6UX 3ORFA 1F8FA 3EMKA 4ALMA 4FGSA 4J2HA 4EW6A 4CQMB 4YB8A 4U8GA 1WP4A 5G4KB 3WIEA 1HE2A 2VZ9A 3VKUA 5BSFA 2FPGA 1PJTA 1MP0A 4GL4A 3HUDA 4B8ZA 1U5CA 3OBBA 2WWRA 3ZWMA 3CSDA 1P33A 4ZN6A 2ILTA 2GCGA 3DBLA 1SC6A 5KKAA 4MINA 5DZSA 4DIBA 1Q2XA 1UP4A 3CTMA 4M54A 2XPCA 5G4LA 4WEQA 2NVUB 4MVJG 3C7DB 4BNTA 3O8QB 5JAQA 3AY3A 3DZHA 3PQEA 4XA8A 2EHDA 5A3JA 5MDHA 3E9NA 3VAZA 1YJQA 4J2OA 3KVOA 1E6UA 1EUCA 3JQBC 1HWYA 2UV8A 5F1PA 1VM6A 4NFYA 4J16A 2CMDA 1YOVA 2IZ0A 3QRWA 1BGVA 4Q3BA 5TIIA 2CFCA 2X23A 2X5OA 3ON5A 4EEXA 1KY4A 2AE2A 4E5MA 5GZ3A 3NT4A 2CVZA 3QIVA 1ZXLA 1LQTA 2UDPA 3H2SA 1HDZA 4J9VA 4DWVA 3G0OA 4UVHA 1SOWA 3BMOB 5J23A 1ONOA 4PG4A 3SXPA 3FCOA 1M76A 3U09A 2D4AA 3E5RA 4H16A 4KTVE 4BGIA 2A4KA 4GWGA 3S2GA 4Z0HO 4DQVA 4BKUA 2EJVA 4FJ0A 4OSPA 4P22A 5I8WA 3I9MA 4LRSB 1GEEA 3KRTA 3ZW8A 5BQFA 4LGVA 1VL0A 2P4QA 1YKFA 4UUMA 4KOAA 3G1TA 3ZHZA 3A4VA 2WJPA 1EBUA 4XGIA 5JAZA 3VHRA 3C85A 1U8XX 3KYDB 3MJ4A 2H1SA 3M1AA 3VH1A 3V1UA 4UVEA 1G6KA 3GT0A 3WTCA 1P1KA 1O6ZA 4KZPA 4R54A 3OIDA 4XYBA 2Y99A 8ADHA 1DIGA 1UXIA 3ZWYA 2QZ9A 1P3DA 1YBMA 4KUGA 3C7CB 1NVGA 2RBEA 1CJCA 3WWYA 1ISJA 2Q50A 1LSJA 3HADA 4CMEC 3KUXA 2HCTA 1XDWA 4BO6A 1FMCA 4HY3A 4D79A 3F5SA 3IP3A 3JD3A 3L6OO 3PGJA 3EW7A 4JNKA 4OJNA 4YJHB 2C29D 2Q2WA 2OBNA 1QV6A 4A5OA 4WCFA 1I30A 1YQDA 1PJCA 2FMUA 4GPD1 4UAGA 3AY7A 4CM5A 4WCFB 4H7PA 1UXHA 4INAA 4N5LA 1LQUA 2V7PA 1X7DA 3D7LA 4EUFA 3WBBA 4E13A 3CH6A 5U4QA 5F5LA 3PRJA 4IDBA 5EIOA 1Z74A 1D1TA 2BH9A 2NACA 3V1TC 4EJMA 3NJ4A 4NU5A 1Z6ZA 2R6JA 2MAOA 4IJKA 1FF9A 5DBGA 4HXYA 1XSEA 4Y6SA 2HAEA 4PVCA 3CZRA 3JD1A 3TF5A 4EUEA 4F46A 5TNXA 3B20A 2FR8A 1ZK2A 3RROA 4B3HA 3H65A 3E48A 1GPJA 5CDGA 2YV1A 1UAGA 4K6FA 4L75A 1Z7EA 4YBZA 3ABIA 1DSSG 1EBFA 4BNYA 5G0VA 4TMFA 4CMKA 2X6TA 1C3VA 2YUTA 4I5DA 3AI3A 1MB4A 2YV2A 1A72A 1EQUA 4J91A 4AJHA 2JKVA 3QQPA 1GYPA 2P5YA 4PLPA 1RM0A 3BA1A 2I67A 1W0CA 2HMTA 4D3SA 1MFZA 1H6BA 3GVIA 5BNIA 1E7YA 2AE1A 2WDZA 3HQ4O 2OORA 3RIHA 2Q4BA 4PIVA 3IIEA 3PDJA 3QWHA 5A5FA 2Y68A 1RJWA 1J49A 1ZFNA 1O8CA 4O6VA 4ND1A 3ASUA 3L4SO 3F3SA 3I23A 2WYVA 2NTVA 4ZJUA 5GMOA 1H6CA 2E37A 3PJFA 1UP6A 3C1TA 2D0IA 4YAJA 2P4HX 2PD3A 3U62A 2NV6A 3WYEA 4DVJA 5KVVA 1E1KA 5L4SA 4LMPA 3TQHA 1BDMA 3AM4A 4RVFA 2EF1A 3VZSA 2ZTMA 1Q0LA 3F6YA 4IXTA 1O0SA 4D46A 4CMGA 1Y8RA 1PJSA 4OL9A 1X0VA 3NKLA 2C0CA 2WE7A 4HADA 4TZTA 1SCUA 4CR8A 2NVBA 3UF0A 1NP3A 4IM7A 3ZV4A 2DVMA 3BMNB 3LK7A 2YFQA 2P91A 3UERA 5DBIA 3OEYA 5HA5A 3DWFA 3RU9A 1RM4A 4L8VA 4TRMA 2I6TA 1DRUA 4CM8B 1C14A 4LCEA 3JQEA 1GPDG 5DT9A 3UUWA 4DYDA 4YPOA 4RF2A 1O94A 1IULA 3TZCA 1C0PA 3U5TA 1YOVB 3TZ6A 3NDJA 3TL3A 1O89A 1D8AA 2C2YA 3CE6A 3PLNA 4OM8A 1P1FA 4O5OA 2O4CA 3GGGA 3GVXA 3HZZA 4YYZA 2PV7A 3BTVA 4NPCA 3FNGA 1QXSA 3RUHA 2I99A 2JHGA 3NGXA 4P8RA 4QEDA 3N7UA 1MW1A 2BFPA 4B4OA 1WPQA 1PJQA 1MXHA 2DT5A 5KCZA 1TEHA 1E3WA 4Y67A 1SPXA 2VZ8A 3C1AA 3VDRA 3MJVA 4PLHA 1D7OA 5ICMA 2DAPA 4Y8VA 1O5IA 4R1NA 2EKLA 2XOXA 3Q3CA 1HTBA 2HK7A 4FC6A 3EGOA 1AN9A 3K92A 4I5FA 1IHXA 1YO6A 2A94A 4GMFA 4FFPA 4AJ2A 4ROSA 3UVEA 1VSVA 1UR5A 3F1KA 4Z0PA 4IZIA 3HDYA 2PLAA 1R0SA 4BOYA 1YL5A 5C37A 3DHEA 3RUDA 3GNTA 1OBFO 3A06A 1ZBQA 3WNQA 1I3LA 4D0SA 5DULA 3V5NA 1NWCA 3UN1A 5FI3A 2UYYA 1ULSA 4MP8A 1IPFA 4CLRB 1PJ3A 2GD1O 5HRUA 1DC3A 4FGWA 3NGLA 1F8GA 1HZJA 3GRPA 1YBVA 3L9WA 4RPLA 2EP5A 2RH8A 3AFMA 4NBWA 1A71A 2HQ1A 3KM0A 2BLLA 3K30A 4M49A 4QSMA 4WPGA 4CQLB 2VYNA 2BELA 1M2WA 1N7GA 1HXHA 3WOHA 5TF4A 1O95A 2A92A 1QYVA 1DO8A 2GDZA 1PGOA 1HF3A 5AYVA 1KOLA 1KYQA 5CPBA 3ITKA 1Y5RA 4CXFA 3PFWO 3U49A 1HL3A 1LNQA 2Q1UA 1ZJZA 1BVUA 3PJEA 2IRWA 3RSHA 3ZU2A 2V65A 4G2NA 5ER9A 1JA9A 2VTEA 2O7GA 4ZQFA 4BNFA 1GYRA 1WDKA 3E1KA 3VPFA 3RJ9A 4RQUA 3MWEB 3V1YA 1OMOA 3NEPX 5AXCA 4YAIA 1WW8A 1A7KA 4XRRA 1NASA 1P1IA 1K3TA 5DP1A 3KYDA 3WFIA 2X1HA 4EBFA 5ADHA 1BTOA 3JYPA 3GZNA 2C2XA 1GQQA 3U4IA 2VTDA 4ID9A 5JDIA 2GYYA 3IKTA 1ZJYA 1I10A 3GFBA 3S8MA 4Q39A 4LCJA 4CL8A 1ISFA 2O23A 3GVCA 3W6ZA 4IGEA 1ENYA 5JO0A 2G0TA 1EUDA 4BNUA 1J0XO 1N5DA 4AFNA 3AI2A 3GC6A 4RVSA 3RBVA 4HP8A 2AG8A 2X7HA 3UICA 2EKPA 3ZI0A 1N8KA 5H83A 1E5QA 2GNAA 2J3HA 4YQYA 4MDHA 2E4AA 4B3JA 1ZS2A 3M1LA 4K28A 5IJZA 4W6ZA 5L7TA 4YJHA 4UVDA 5IXYA 1KBZA 3G1UA 3GEGA 5CDYA 2ZYDA 4S1VA 4Y6RA 3O03A 2EW8A 3I83A 5TT0A 4RL6A 5ICSA 3H2ZA 4RDHA 4LVCA 1QYDA 2BGKA 2Q99A 3MZ0A 2J3JA 1W73A 3TL2A 4RGBA 4BNXA 4NZ9A 4HFNA 4XQGA 3KSDO 3KSUA 1ML3A 3BZUA 4IQGA 4NDNE 4P4GA 2FZWA 4UUOA 3ICPA 4RDIA 3RD5A 4Q3EA 4WKGA 5HBRA 3ZV6A 2FWMX 1VPDA 4QFCA 1WDMA 5F1OA 4J7CA 1B7GO 5CFZA 3GDGA 2PKQO 2DPHA 1ZK1A 4E2YA 3PDUA 5EESA 1PR9A 1YS4A 2VRCA 4OXKA 4M8SA 4FFOA 3WGHA 1C1XA 3LT1A 1P1RA 3DQPA 4FCCA 4URFA 1NWHA 4DLLA 5JW6A 3WSVA 1E3LA 5CDUA 3HB5X 3ZDFA 2VWPA 2Q2VA 3JTMA 4ZICA 2V6FA 5FWNA 5DDIP 3D4NA 2IDZA 2Z1MA 1LLDA 3RFXA 4A10A 1KVRA 4CLEA 3MOGA 3IJPA 3BXXA 3BMCA 4NIMA 2IYPA 3I9OA 1XQ6A 4ND2A 4O0LA 1B8VA 2UUOA 1OZAA 3JD4A 3BYZA 4K6CA 4YJFA 4N5MA 4KQWA 4OOFA 1ISMA 1BHSA 3D3EA 1P9LA 4KWIA 4KMSA 1H0KA 4ND3A 5THQA 3UH1A 3ANNA 2AQKA 3LF1A 5F5NA 5U1PA 5BSHA 4I5GA 1JDJA 3AOGA 4TKMA 2CDBA 3DBRA 4QO7A 2PH3A 2MAPA 4I9NA 4UUNA 4RZIA 4ND5A 5EQDA 1JN0A 1R37A 3D4PA 4RF3A 4J1NA 3JQ9C 3RC9A 3OF2A 1Y9AA 4E4YA 4ZQGA 1QRRA 3K73O 4D45A 5F1KA 2X5KO 3ZV3A 2RHCA 4X54A 1K89A 2OOSA 4PLCA 4Z6KA 4IDCA 4NJMB 4PG7A 3HFGA 4YT8A 2X9VA 2VUSA 4PZEA 1XU9A 2R2GA 4JLWA 4CLRA 3R3JA 5F21A 3WFJA 3ANLA 4FIZA 4WLOA 2DPGA 4Q3NA 3JQCA 4ND4A 1SC5A 1SZJG 1VJTA 1JKIA 3OQBA 1DRVA 5IDYA 1YGYA 3K31A 3T7EA 3UFXA 2FHSA 3AI1A 2C54A 4R5HA 2CVOA 1JAXA 1MG5A 1H6DA 5IZ4A 1UJMA 4YAKA 4B7UA 1PQPA 4R01A 1BWSA 3H6KA 4YT4A 1H2HA 4ZA2A 4J1SA 4XYMA 4WOKA 2E82A 1R4NB 2RCYA 2YY7A 2Y1CA 2H9IA 2OXIA 1Y7TA 1K5HA 3PTZA 1B3BA 2H63A 2IE0A 1Z45A 1NNUA 5LDHA 2OP1A 2BRUA 3KTDA 4LK3A 3VPXA 4PG6A 2O3UA 4DA9A 5L51A 3JYLA 3GNSA 3NRCA 4YRDA 3VDQA 5A4DA 3OM9A 3Q9NA 1FK8A 5K6AA 3OJEA 1T1SA 4K9DA 5IDXA 1M66A 1ZIDA 3K96A 2IEDA 4I1IA 4KTTE 3KLPX 4YEDA 2HJSA 5IN5A 1JU9A 2W2KA 2IYOA 3ZU3A 1IZ9A 4A03A 3NT5A 5A04A 2ET6A 2X58A 4XRGA 3UW3A 4GH5A 1UP7A 4WCDA 3C8MA 4DBZA 3MTJA 1A27A 3IUPA 4FOSA 3W8DA 2ZIZA 3LZ6A 1U2GA 2HK8A 3E82A 3I9LA 1LSOA 1AE1A 1DLIA 2VT2A 4LVUA 1NVTA 5KVCA 4PCVA 3OH8A 4XCVA 2X0RA 4MVJP 1XCBA 3ZN2A 3LC2O 2BKAA 1N92A 4K26A 1BVRA 1I33A 1UXJA 3ZHXA 2I3AA 9LDTA 1WVGA 5FF9A 4F6LA 3ANMA 3L4BC 1IYZA 1ADCA 2PA3A 2G82A 4IDFA
chains in the Genus database with same CATH superfamily
5GONF 2C1EA 5JWOA 3FCUB 4YVFA 2QL9A 3ZWPA 1QPZA 1P81A 1SCAA 1KH2A 4L85A 4EGSA 3B6ZA 2DBVO 5JSYA 5A1JA 5AW0A 2KX7A 3RUFA 3O8LA 4O4LA 4DYVA 5HIJA 1NUHA 2NN3C 2BUAA 1SXIA 2YBDA 4EPYA 2XGOA 4LHEA 4X95A 3UGQA 3W5CA 2ZI9A 3CVXA 2NYVA 4HX2A 3FGZA 2FZKA 4M9SA 3DHWC 3MBOA 1JAZA 5AESA 2QTWB 3PUHA 3PV0A 3C45A 1VMIA 4GLOA 1UEXC 4J7UA 2JLQA 4D0NA 3VYWA 3H7AA 4Y2UA 1EUYA 3D2AA 1U0JA 2ATEA 5BOVA 2WTUA 3PEVA 3ROFA 2FVXA 1DCTA 2EJTA 2GAIA 4Y2TA 4JP1A 4XO4A 1U3UA 4TL8A 2W0MA 2YN2A 1GLNA 3NIWA 3ZHBA 2R00A 1SKBA 4TSKA 4U9HS 2ZB2A 1AF4A 1S9DA 4ZZ3A 2H1RA 2LPMA 3X1MA 5AJUA 3FD8A 3CHQA 3GEHA 2JLSA 4IRUB 5EUMA 3GZNB 3V48A 3FJYA 2JV7A 2XOKD 2H85A 2HSDA 4MWDA 1UMKA 4X8HA 2BFCA 1H2EA 3AI7A 3TSCA 2JAUA 4A6DA 5CK5A 2MYTA 1NU8A 3MTIA 4JENA 2VZ0A 1V47A 2OP0A 1ZO8A 4KOEC 1V3QE 3N28A 3HFSA 1RYBA 2O0LA 4QHYA 4XVHA 1W5AA 2J3IA 2QE7A 2O59A 1MORA 2H00A 4LSMA 1ATZA 2Q4EA 4G97A 4W1SA 3TBFA 1MDBA 2PUAA 1LI4A 4LRTB 4Z4EA 1UBGA 2J3KA 3JVUA 1J90A 5TQVA 5IF9A 4BU0A 4CW7A 3CJRA 3FB4A 5EMLA 3V2UA 4UBIA 2JFGA 1KU6A 3BULA 1WB9A 2PFGA 1EB9A 2AYYA 5AVVA 1R0WA 3FUIA 2VAMA 5B64A 4J7XA 2W6ZA 2ZVJA 1YJBA 3HVIA 4PX5A 1Q0TA 3OE7D 1UOEA 4WBNF 5D5PA 2HDHA 2X15A 1XVVA 1ONSA 4U63A 4ZFNA 1DCMA 4WZZA 4Q1CA 2CLKB 3PB3A 3FYUA 3OCYA 3MTQA 1PR6A 1OASA 2XTJA 2G40A 2QF7A 5E1BA 1CLUA 5BSMA 4X0EA 3LOPA 1X87A 1SD5A 4H1HA 1GP2A 2CDAA 1CZNA 1YZ3A 1NULA 2DWCA 3LJKA 3KU1A 3LPDA 3LQKA 4IF6A 1NF8A 1WTCA 3CKKA 4JVLA 3FUVA 1P74A 4OUDA 4LRUA 3BEDA 3JSXA 1YZFA 4H6WA 1N6RA 3ZZUA 4EPXA 4UFPA 4PAOA 3SC2A 1D2MA 2F43A 5F35A 2H4FA 2B30A 5LP6C 2HK6A 1ZEMA 1L3BA 5D7BA 4E2FA 4Z4QA 1AV7A 3I32A 2IY9A 1K06A 3LLSA 1YTLA 3HCEA 4G5YA 4IOMA 4QGAA 3ETDA 3IB6A 4RNCA 4QPNA 2WD8A 2VFAA 4RAOA 4S12A 2BFBB 1LC0A 2JFZA 3EUWA 4HO1X 4MUBA 1Y8QB 5K8CA 2IBTA 2G8NA 3QVMA 3PHJA 3BXEA 1GTG1 5EA2A 3I04A 4TLEA 1LU9A 2V55B 2GLUA 1VL1A 2VDUE 3D2BA 2BE9A 2YV4A 1YVUA 5AJVB 2CFIA 1U0NA 3OLQA 1WXGA 1Z6PA 1P0MA 2IYFA 2X0NA 5DNVA 3SLGA 4A8JB 4MW6A 4BJHB 4PYRA 2NZUG 3T99A 4QU0A 3TZHA 1RI1A 2UVDA 1BDHA 3RFTA 1YL6A 2JFUA 4OFXA 1W25A 1FYDA 3TDKA 1U28A 4U6SA 1J0EA 3V32A 1UL1X 1XKXA 2IYSA 2MDTA 5REQB 5H7XA 1VCHA 2PH5A 1PUJA 1XKQA 4FEEA 1RT9A 4NBVA 3S3TA 1DDIA 3IVAA 4RJTA 1HV8A 3HDHA 3TTSA 5K8UA 4F4JA 2M6RA 2B8NA 4FDMA 2BEWA 4JAVC 1U94A 1WZUA 1GNLA 4LOIA 3K94A 3O47A 5ALGA 4ALJA 3MQ2A 1D1SA 1Z5WA 3FZEA 1COZA 1LVGA 3ETJA 5CA0A 4CEHA 2OCXA 1HX7A 2YXPX 1JGTA 2C0QA 4HQLA 3ZBPA 2QT1A 1ZD9A 4MQBA 5TJ9A 4ZT6A 3CF4A 4IUDS 4MQMA 4O2BA 5CT4A 4E5DA 5A4AA 4HKTA 4IY1A 4MMZB 5IK2D 3W9SA 2FH5B 2ZETA 2W93A 1UKYA 2DSNA 2J6IA 3E9MA 4JYBA 4QARA 3U9TA 1U2TA 5K6RA 5EJAA 3JWEA 1KI3A 1OD6A 2H2IA 4A0FA 1H3FA 5LLTA 4DOMA 2DZDA 2C99A 4CM7A 4HK4A 2C96A 3PZRA 1UJ2A 2QLNA 1R6UA 2O3QA 2HLHA 3FDZB 3GK3A 4JA2A 4NZOA 4OP1A 3SR3A 1I0IA 4IMIB 4XMWA 4EM6A 2ZZKA 3CHRA 4F9TA 3CZKA 4UTPA 3GLGB 2I2XB 2JLVA 2ECOA 1T9BA 3QBEA 4YV2A 4NBTA 2GK7A 2PT7A 3QM1A 4RPIA 3V6MA 2GF9A 4JLSA 4P2BA 1YB5A 1HE3A 2ZJ3A 1LSUA 3A4TA 1WCYA 4LAFA 4OQFA 1X19A 2UZ1B 4ETIA 1T9AA 2Q0XA 1H1LA 4TM8A 1PTJC 4XNAA 4R2IA 3I1IA 3ZGOA 4R2XA 3NUZA 3NLLA 3PC8C 8MHTA 1OIWA 2Z2KA 5B4UA 3A70A 4L9AA 3KQYA 1GFSA 3IPLA 3EQ6A 1BD3A 1GZHB 3K72B 4MQLA 1SHLA 3BHJA 4YNBA 3CLSD 2ZUWA 2LP4Y 2BGTA 3SBDA 3LW7A 2XCLA 3EXIA 5E6SA 1XKLA 2Y1WA 4QXRA 1E2GA 1PBNA 3PA8A 2I71A 4CGZA 1Q3TA 3OEWA 1VLQA 2ZRDA 1S8OA 4JC8A 3BBLA 3W3AH 1U90A 2OBXA 5FL7D 2PM8A 5BN1A 4NQWA 3OOJA 2WOJA 3KQMA 2X0JA 2O3TA 3GGOA 3T34A 4GOKA 2YOHA 1D2EA 1HQYE 5IBPA 2CXTA 2H4ZA 2H2GA 2W2MA 4HI0E 1R16A 4Y1EA 3EH1A 3GJYA 5DM0A 1W5TA 1SEVA 2LCFA 3F0TA 2AEEA 1JAHA 3DHYA 3N2GA 1G8AA 4O2LA 2BR5A 1DQPA 3GR6A 4BQFA 4AUNA 4D96A 4NBUA 1K5PA 1VTKA 3I9KA 2V96A 5IYZB 3OM0A 2YR0A 1QGDA 5FWYB 3P19A 1UKBA 4BBJA 3TR5A 1Q7EA 4HAOA 2VRNA 2HHHB 8AT1A 3UO8B 3R4CA 5TX7A 4C0BA 2FSFA 2JATA 4B82A 5TEWA 2QEQA 1C29B 1IBRA 5I7HA 1J6UA 2EKDA 3K2IA 4OAQA 3R5KA 1I7PA 2VAVA 2YVAA 1ZIXA 4EPVA 2JLRA 3GAAA 4M0MA 4MVJM 4AYSA 5LKAA 3CUVA 3UB3A 1ORVA 1UDBA 2O0KA 4PZDA 1JFVA 5ITVA 1E2EA 4KVAA 1FYVA 2BM0A 2EXXA 5JBIA 1AK2A 1SU8A 1X9HA 2B98A 3MCWA 3R5SA 2QKYA 2PCLA 1Y7IA 4KQJA 4RWZA 4XJTA 4Z0NA 2XB8A 3TN7A 5J47A 4PHTA 1Q6YA 2FQXA 2ZUUA 3PQ8A 3G79A 3GT3A 4QPPA 5CVJA 1NW9B 3L8CA 3D6UA 1SKUA 2MINA 1IB6A 3I9FA 3AHJA 5FBZA 2I4LA 2P67A 4GSKA 4BNZA 4DMFA 3JQQA 2VDMB 4KH0A 4HQOA 1PZNA 2WT4A 2ZKLA 3O3OB 4MB0A 5AW1A 2C9BA 4NJMA 3SQLA 2NNLD 1H8HA 3A4IA 1P45A 4HNQA 3WV5A 3KJQA 2YINC 1VRWA 1RLMA 4I4CA 5BWNA 1I24A 3N6XA 5I7RA 4KE7A 1XAGA 5CDFA 3V2GA 5LZ4A 4HGPA 3R3UA 3KS9A 3LUCA 1OAOA 1NF9A 3NI2A 2WWFA 3AUFA 3HU1A 3N07A 3NV9A 3QBTA 3QELA 4MGIR 4MGZR 5DBEX 2Y2VA 1P1HA 2HIHA 5EIHA 4TXNA 4ACAA 1TGVA 1D2NA 5KOJB 1DC8A 2A1IA 2I1LA 1EQ2A 4U7TB 3GLHA 4QXQA 4MVJA 5TQ0A 1CEYA 3N2GB 2RGRA 4FSDA 4C7JA 2AW5A 5EUQB 1XXHB 1QCCA 2WW8A 1E77A 2XD9A 5FEMA 3B51X 1Z8FA 3ED5A 3IBFA 4GZ5A 1L4LA 1Y4AE 3U3OA 2LWIA 2HLDA 4V0SA 3VHQA 4O3MA 2R6FA 4S2UA 1KMQA 1AKUA 2EAUA 4XWTA 5DJ5A 3NPAA 5CH3A 1OYOA 3NASA 4GBGA 3MWGA 1MG0A 2NSDA 5K0CA 1LPMA 4BLTA 2W2LA 3DDCA 2UVQA 1LKZA 1Z4LA 3LCJA 3M6IA 3ROEA 1E1MA 2E3JA 4XPIA 2ZXGA 2H5IA 4Y9DA 2JJ2D 5LQAA 3WRYA 3EVGA 1TAQA 3ZHYA 5A5GA 2IXBA 3UC9A 2CNWD 3PQ2A 5C8YA 2NO4A 2R7AA 1EFUA 1HA3A 4HHEA 2QT9A 4JT8A 2A5LA 1TF5A 3AOEA 4K6GA 1ZU5A 1B8PA 4B0PA 1VHDA 1FRNA 1V8DA 1HZZC 4XVRA 1CY0A 2L82A 3QUQA 3D5TA 5JSHA 2VA9A 4FVTA 2VAXA 2GH1A 4L5IA 2AFIA 4RPHA 3CZ5A 1PR0A 3NBUA 1FNSA 4XNDA 4LISA 1ZI8A 2GGSA 1E5DA 3ZK9A 3WBJA 4HGQA 3WLKX 1L8LA 4BLWA 8LDHA 1NKTA 5HLTA 1PG0A 1C7EA 1QYIA 1NXXA 2GN8A 3AF0A 1X3ZA 2RMKA 1GITA 4I4IA 3ZIAA 2H11A 1Z56C 4DREA 2PH7A 4EG7A 3LUHA 2HADA 1HFEL 3Q9LA 1BU5A 4AZ3B 2WV9A 2JCYA 1RWKA 2I6GA 3ENZA 3IO3A 3SX2A 2JBHA 3JQ7A 4B73A 3KV3O 1E1NA 1ZZGA 1JLRA 4HTFA 1YK0A 1HLFA 3SSOA 3JQ7B 5DB4A 1Y6RA 4JI6B 4E4RA 3IUEA 2ZXFA 5KNDH 3B8HA 5KQGA 3GNQA 1UPBA 3ONFA 5F9FA 1L7VC 2AR9A 1JJFA 2W5UA 1LF0A 3FMFA 3O82A 2B5OA 3CPSA 4KFTA 4WWHA 3R9IA 3U4MA 2HA3A 3DL7A 1W4ZA 4FHCA 4YUAA 1F2TA 3PFBA 1DUIA 1TZMA 2BGRA 2JRCA 1N1EA 3EWAA 2CLCX 3UIEA 4V24A 3RC7A 1OX5A 6GPBA 3U7FB 5GY7A 3WGGA 1OT3A 4PPYA 2HWYA 4KXUA 1E7RA 3OOEA 4QULA 3T94A 5BNTA 4YA6A 1FBTA 5KYWB 4PSUA 4DQUA 5I7EA 4KCGA 1QH1A 1OR7A 1UZUA 1PGNA 2R751 4WLUA 1Q1QA 4PQYA 2I4NA 4DJEC 4FJ2A 2H18A 4MUEA 1M6HA 2EEZA 4HEQA 3GLFE 3V80A 3PTAA 3LL4A 4N82A 2G0AA 3HBNA 4U2EA 1UT8A 4QJBA 3TPZA 4LFCB 4HV4A 4RORA 1YC2A 5AUNB 4MV5A 3G8YA 1L5YA 4BQEA 4B6OA 1L7DA 2O3JA 3DO6A 1ZKDA 3H4VA 4JSRA 4BO8A 1BX3A 4DUZB 4XYEA 2FUCA 3HEAA 3R44A 3L7NA 1UADA 3EZNA 4JEIA 4DJFC 3CIOA 1GDDA 1GZ5A 2X1VA 4A8TA 1ZXXA 3K6KA 5C1OA 4LRWA 6ABPA 2JLZA 1TEVA 2AFIB 3CZGA 1Q0RA 4CIDA 3GP5A 1FA9A 3U3RA 5L7WA 3WADA 2B25A 4FFWA 4RJLA 4QUDA 2QZSA 1KDYA 3TYXA 1EP2B 2DTXA 4R1QA 4WKOA 4C0WA 1ORTA 2BDUA 2RHBA 1J00A 1QU2A 4FKBA 5CH8A 3NAMA 4BO7A 5IF3A 5GONB 3G13A 3QEMB 4E22A 4L7QA 1VPVA 2ZBFA 2J5RA 3GJ4A 1T6XA 3RVNA 3H5IA 4RVOA 3LPAA 4OEHA 2BONA 3ZWQA 5C35A 5EQFA 2AC7A 3ZGXA 5FWDA 4QPJC 1F0NA 1NW5A 1U4OA 2PGAA 4Q3OA 1PP4A 1KFCB 1M8PA 3ECAA 4FKMA 1EFVA 4I2VA 2DECA 2G08A 2VYVD 4XARA 5IAJA 4MB6A 1RYZA 2HQSA 1AS3A 3ZZ0A 4V1CI 1W96A 3A9RA 2CXNA 1Z28A 3CU5A 4AKSA 1T4DA 3IVMA 4WK6A 1Q50A 3SF0A 1JNYA 4UW9A 1G21E 2XYQA 3VA7A 2OCYC 1HO3A 2V7WA 4QODA 1DHTA 2F59A 3KYBA 3OCXA 3T7JA 1U7PA 1XROA 2QIPA 4MUFA 2COEA 3A6FA 3DC7A 5A9SB 2VC2B 1OX4B 5JYEA 5L95A 1WM1A 2AX4A 5JLAA 3LDFA 3OT4A 1Y6QA 5FI5A 4AO7A 3RS5A 2C57A 2HF2A 9MHTA 3L8HA 4TYWA 5AXDA 1OVMA 2CY0A 4JI5B 3TBHA 3T5DA 4BLQA 2ZTLA 1CZHA 4XWGA 2EFEB 1NW8A 1MCZA 2W8BB 4TL7A 4RZQA 5E3HA 2I7XA 4CHTA 2IW1A 1YFJA 3ZE1B 4Q05A 3HNRA 4BB5A 3L77A 1UK7A 1MNAA 3MNFA 4YV0A 2WWHA 3C41J 3LU1A 4XMXA 1ZWLA 4ZAYA 4DUYB 3HY6A 1HE1C 2I1QA 3F49S 3QHPA 1XDSA 3D6MA 3DE6X 4MAMA 4YWJA 3WMWA 3WWEA 2B1JA 4JGGA 1WUIS 2FETA 4A8PA 4CMIA 2Q07A 3JALA 4A2CA 5ALVA 5LJLA 1ZAYA 1WB5A 3T15A 1CLEA 2VQ6A 2BDEA 1SELA 4B80A 1DT3A 1TM7E 3HU5A 4DQXA 2QRPA 1TL7C 3AERB 1R4MA 2XQ0A 4FEYA 1F2UB 1KQPA 1TQ2A 1VRVA 3H1BA 5DBFA 3ST7A 1Z3CA 3N2LA 3VXKA 1G20A 2WM9B 1R4MB 5IZCC 1WG8A 4AJPA 4PG5A 1CS0A 3V2IA 1YASA 1GN9A 3FPSA 1LPOA 4ZVTA 4QATA 3DKRA 3I2YX 4RK0A 3U0VA 4AY2A 1I0LA 4XN2A 1W88B 2RG7A 5EIWA 5C52B 1M9NA 2WF8A 2I80A 3A4MA 5JDCA 4BJ6A 3KEDA 1WCIB 4D4HA 2PFSA 4PRLA 2DKNA 3TIXB 1TPZA 4DIDA 3OOYA 1P1JA 2B78A 2GN1A 1JPJA 2FW0A 1UUFA 3C16C 3HY3A 1U2ZA 1VFPA 3K2BA 1KZGB 3W0LB 4LSGA 1R1DA 2ZRCA 2P1DA 2FG5A 1AHIA 1QE5A 5DNWA 1ZCJA 3T9AA 1FVHA 1O03A 1UJ4A 4Z3OA 4DV1B 4KYTA 4BX2A 5IKPA 3L92A 3LIPA 1OFHA 3RDPA 4DV4B 1ADBA 2QYOA 1OX4A 2N1MA 1XF9A 4NSNA 4B35A 1L4EA 3KETA 2JGAA 3EY4A 1KFEB 4DCTA 2WUDA 2E0IA 3PL5A 1J0AA 3VTZA 2IW3A 3MT7A 3ABSB 2AR0A 3CZ9A 3SFVA 2WJ4A 3JQPA 5I9NA 3BREA 5DXJA 2P9QA 3AKCA 4GGPA 4RU1A 3T7IA 3U9WA 1JALA 4EQ6B 1ODTC 2JLXA 2FFJA 1PJZA 2E49A 3B82A 3LECA 3QI2A 2VWQA 3IP5A 4WXHA 2WJHA 3CV3A 3NUGA 1ITZA 3A31A 3AT1A 2DH6A 3FYTA 4R1SA 4PGFA 1P2VA 3R24A 1AQLA 1XWIA 4MH0R 3RNOA 1DAPA 4IFBA 3U6KA 1DJNA 4ZQBA 4L8YA 2LR0A 4C76A 4K9OA 3EIQA 1BEZA 3D6VA 1A4RA 1B0UA 4ZU3A 1GNPA 4P5DA 1Q92A 1W85B 2V7EA 4PGAA 2ZW9A 4TVKA 1YB1A 1MC4A 5AKIA 4KWEA 2XMDA 1Y48E 1K3UB 2W98A 2GAOA 3DZIA 1SBHA 1MOZA 3IRUA 4D0RA 2PJDA 2YRXA 1P0CA 2VCHA 5LXTF 2BYTA 4GKKB 2C2OA 2IYEA 4NH4A 1B8UA 3B1KA 1WHTA 2QVGA 2H0RA 3OJLA 1L5KA 4AJKA 1ZG3A 3VTFA 2BI8A 3ODGA 4MQFB 1Q0UA 1H2XA 1Q57A 3NHAA 5HYVA 3VV2A 1FDSA 3K6RA 4XM1A 3KR1A 2CSXA 4XYLA 3CN9A 3L9XA 1SK8A 1XJ0A 1ZZEA 4KIGA 3P1JA 1GUZA 2PEYA 1SUWA 2OM6A 1L8QA 1FS5A 4YJ3B 3SYNA 3S1SA 4R9VA 2VTBB 4BVAA 3I76A 1FYXA 5JYDA 2WKWA 2GYVA 1NFQA 4IGKA 3SJ7A 4XXHA 5KREA 1HOXA 2QPOA 3SYKA 1E1QA 2FZEA 2GEKA 2H7YA 3AVYA 1IBCA 3QVJA 1FZTA 4WTOA 1GSHA 1A50B 1R9JA 4YUVA 2W42A 5E7JA 1U63A 4RLSA 2VXCA 1VHQA 4FFRA 1N77A 3FTNA 4C4ZA 1O87A 4WI1A 1CR0A 3SJCA 1W1WA 2YHSA 1OZ0A 1M1YE 4OHPA 5AFSA 4F4CA 5H02A 2RJOA 5CFRA 5JSUA 4FFBA 3UHFA 4ZOQI 3FWZA 5AK0A 4A2QA 2Y05A 1KI6A 4JEHA 4LVNA 1P2TA 3THYA 1XTBA 5JC1A 3OE7A 3Q5DA 2V7QA 1V1JA 1RKBA 2OPBA 3IOEA 4K5LA 3QY0A 3OESA 1EFDN 4CT5A 2O2HA 5JMWA 2D59A 4QXOA 3PCRB 1AOXA 5C53B 3OO1A 2WHRA 2JGEA 1IOLA 3GGCA 1X6VA 3WB2A 4BFXA 2CYBA 4PAGA 5IDQA 4J0QA 1VCNA 2JIDA 2ODQA 4N4AA 4U0JA 2IPLA 1TQ6A 3MA0A 3Q7TA 2C5EA 4ZQHA 1QIEA 4PW4A 4GX1A 4AP9A 4C89A 3HSSA 1C7FA 5JQGF 5HGXA 3ZX4A 3LFUA 2Q0SA 2GUGA 2HA2A 3WQQA 3S29A 1DBRA 1D0VA 5DE3A 2VVTA 1VRCA 4DMLA 2B1GA 2XY4A 1N2EA 2ZSKA 3ZY5A 1ODSA 4MYDA 2PUFA 1PGPA 1PIWA 1ZD2P 3EDRA 2WM8A 2Z3ZA 4TX1A 4GAEA 1KXZA 2CDCA 4DGSA 3I30X 5HKLA 4RF4A 4JKOA 1NUAA 1R5OA 1NOJA 2X1LA 3G2PA 2PKEA 4RQTA 3U4HA 4OXNA 4ZEXA 4OGLA 3IPCA 4O8CA 3LCVB 4R2HA 3AVOA 3RAFC 2DJ5A 3QJYA 4PO3X 2WWWA 5A4JA 3FU0A 4KVZA 2ZUFA 4Q3CA 4WK0B 2QE7D 2AI1A 4K7JA 2ACVA 3SEQA 5I48A 3QENA 1WMSA 3GMIA 2IUFA 3IP8A 3FUEA 4HVTA 2GS9A 5L7YA 4BVHA 1SVMA 1TK2A 1SGWA 1ZJ4A 3A3KA 3AR7A 3CB4A 3VR5D 2J46A 4GP6A 2G70A 1TT5B 3OZBA 4JQZA 1GA6A 4TWJA 4QJ4A 1IUPA 2NZ8A 3B5EA 3LLMA 2DG2A 4ZQIA 4QUKA 3UK2A 4W8HA 3RB8A 1VE1A 2CJYA 5J4HA 2RAPA 1ZONA 3JQGB 2ZAGA 3U61B 1EZ4A 3BRSA 1GNSA 3SNHA 3WGNA 2EBUA 3UJ6A 3KQVA 4CMCA 5KYUA 4XQEA 2HSJA 3ZD6A 1WPXA 2JA1A 2BIFA 2O57A 3HRHA 2D1SA 3ER6A 3PR3A 4LXIA 4RLFA 4PR3A 4RD6A 3ENKA 2V6BA 3GAFA 4BNIA 2B83A 2LVBA 4M76B 1KI2A 1GUDA 2GCNA 4YAGA 1E4OA 5EP4A 4TTJA 3RYIA 1J70A 4E2XA 2DQKA 3CRQA 1EFCA 3LC0A 2DMRA 4U2CA 4AW9A 4IXNA 1VXOA 4BMXA 5IEJA 4PIPA 4P98A 1KEKA 2NZXA 4LYYA 3KZNA 1XZIA 2C5ZA 2I8AA 2XQFA 3DLTA 1UFQA 3AOEC 3OQ1A 3B9PA 2C9YA 2EFGA 4QYIA 4QXAA 1VG8A 2RAVA 1O08A 4E1VA 3D7RA 1V1MA 3G2NA 1X9GA 4G4IA 2O5RA 1JLHA 1H0SA 3CR8A 1JW9B 2J9ZB 4LZJA 5AHRA 1KVSA 3WB1A 3A1TA 4BDSA 1W36B 2Y92A 4NDAA 2QTBA 3DFKA 4YRRA 2QMEA 3IEXA 4ZW3A 1C4KA 1UINA 1UQRA 1AA9A 2R87A 4NE7A 4QOHA 3H75A 2Z56A 3ZNOA 4WXEA 5GZ6A 4C0SA 5BP7A 5JMTA 4DHEA 2EF0A 2HI0A 5DEIA 4DDUA 4M1YA 4WGFA 2HCRA 2OLJA 2FB9A 3IC5A 4DWOA 1GZVA 3OC0A 3HSYA 4Z54A 2DBRA 2MCFA 2HM7A 1R50A 1VSUA 1ZRSA 2HWUA 1O96B 2WWXA 4X90A 5EINA 4N39A 1TKAA 4QHTA 2WHPA 1ZSVA 2F64A 1N2GA 3HGTA 3ZHRA 2H0AA 4ZCSA 5H16A 5KOHB 3ZV7A 3NCTA 3TSZA 4E88A 1MO3A 2XVZA 4B7CA 1DP4A 3UA4A 2EL9A 1Q19A 6Q21A 1FFWA 4PC3A 1OC4A 3LKDA 4IOLA 3OUTA 1HK7A 1KC3A 1YL7A 4DMCA 2QQ5A 2HYIC 2UXBB 2HOQA 1Y8RB 4W1RA 2DHCA 1WY7A 2L0XA 4XGKA 3V55A 4NR0A 4B2YA 2QI9C 1IOWA 4Q1EA 2GVZC 1G5FA 1GIAA 1XGKA 1NF3A 4Y98A 4YAEA 5C31A 3S2FA 2XAUA 5JFOA 2O7VA 4K5OA 5A9RA 3BGWA 2BPOA 3PITA 1CUIA 5B37A 4OHMA 3STWA 4UVGA 1QFZA 1U04A 2B4TO 2HF7A 2LBPA 3C6XA 1M73E 3MS2A 4U2KA 5CEJA 3WX0A 3FZQA 3YASA 1CDOA 4V1CB 3CNNA 3GJ7A 5ABPA 3EVZA 1EK6A 2WRZA 3K1ZA 3TQRA 3DDNA 5I7WA 1SIBE 4EJ2A 4ZW6A 3GFGA 4HTAA 2KYRA 1KDTA 5IAGA 1ZHOA 3OQOA 4LXGA 1P8AA 3FDFA 5CURA 5KJFA 3QF4B 4F21A 1LRLA 2BFOA 1SURA 3HWRA 3K9LA 3LP5A 4TMYA 4JASB 2Y1KA 4CMHA 3H9EO 1PWHA 1R18A 2QU8A 4RH0A 3MTBA 4CV2A 3F5DA 2AHRA 2IU3A 3EVBA 1B1AA 2HXGA 2J5KA 1FDWA 4WACA 4QO8A 3TJMA 2VJCA 3KTFA 2Q62A 4DSZA 3C7KA 1VKOA 2VXOA 2BFEB 1QVZA 1H9BA 2WG0A 1ZH4A 4QDZA 1XMXA 1RLOA 5H3CA 3BL6A 3R0XA 4FYJA 1ODIA 4Q4HB 4DC0A 1J9EA 4JUIA 4JBHA 2PSDA 4GBJA 2FK7A 4RY8A 5LUBA 4HEJA 3WIBA 2G83A 1F5SA 2VI5A 5DHFA 3U3KA 1I7QB 2DHRA 4GOND 4Y0AA 4JC5A 4QBGB 4ZO6A 1EJBA 4NQZA 1VGRA 4XB2A 5IVDA 3JWHA 3DEJA 4Y2JA 3EEQA 3REQA 3NJ8A 1LV8A 5KU7A 2MINB 2PXAA 3KP1A 3M9WA 5JHHB 1EEHA 1QRSA 3WMGA 1U8UA 3WHPA 4Z53A 4U7PB 3GXOA 3ZJUA 1XZKA 1MZVA 3A37A 3C4VA 4PPGA 4Q7KA 1KJIA 1V5WA 1C8VB 4S0XA 4ZEVA 2VPIA 4FGZA 1R6DA 1APBA 1U8FO 4G1CA 2GARA 2P2NA 4LF9B 2FFQA 3JYQA 4LF5B 1KNQA 5E7MA 1DUSA 2R8YA 3BSYA 3BWEA 3DE1X 4IMRA 4JA0A 1PLLA 3P2KA 4DCCA 4RTJA 2APJA 3KQLA 2BFAA 2ZIWB 3CX4A 2R48A 5FYDA 4EGQA 1BEUB 1Y6JA 2ERCA 3GMSA 2P69A 1Y1LA 4HQRA 3EBLA 4KX5A 4WLVA 5EYPB 2CNBA 3KSAC 1FFEA 1ULAA 3KLNA 3M33A 5HILA 4AJNA 5KWIA 2H4YA 2PGNA 4RMHA 1EWYA 3D64A 4V1CA 4MCIA 2W22A 1EHIA 1KOFA 4JNCA 4N0MA 3DP7A 3R0QA 4S1TA 4UHJA 5TARA 4XJXA 3L7JA 4U5XA 3NIFB 4XFDA 3VISA 1JUDA 3Q11A 5KTYA 3ZI7A 2XGMA 3GOHA 4U1RA 3N2IA 4FXPA 3OZTA 3HN6A 1MO5A 2WZBA 1ZUNB 1U9ZA 4D1YA 3HPRA 1CX9B 4L5BA 2PUHA 4UU7A 2IHJA 2YYYA 4MP3A 4TKVB 3B2XA 4PEVA 3WLFA 1Q0QA 4L50A 2HIAA 3C3EA 3RANA 5P8WA 3IL2A 4IZHA 4LQDA 5FPKA 5JFGA 1GUFA 4DXHA 3WL6A 1S01A 3JYHA 3AU8A 3CG4A 1K98A 3P2YA 2A7XA 3L7OA 3L0PA 1UDAA 4TS1A 3DTTA 2XZTA 4Q7QA 2OQVA 2GDJA 2A7OA 1J42A 3AIIA 1NBMD 3HLTA 3V8QA 1L7BA 1PR1A 4UHHA 2WEKA 2OA0A 4AI6A 2NT4A 2W6PA 4RK7A 1P7WA 1CY1A 1E59A 1G2IA 1L1FA 2O7QA 1THMA 2Z0MA 3ORYA 4E12A 1YVPA 3DKIA 2EKZA 3S8EA 3T95A 2ISCA 2BUCA 3O2NA 4LDQA 1PUIA 4GWKA 3TSAA 2D2FA 2HMUA 4CIXA 1LJUA 1V3UA 2O2EA 1UBTS 4G56A 4R9SA 1GL6A 1QX3A 1ZA1A 4C20A 2WG1A 3ESZA 4IG9A 3HRKA 3QPCA 4B7AA 5DGIA 2CE2X 1RJEA 2H2AA 3DFZA 4DLUA 2PL1A 1RPZA 3PEUA 2PKWA 3KYIB 3K5IA 4FR2A 1RHRA 4IINA 1C80A 5F2NA 1H3LA 2V5AA 2RGCA 1Z08A 3I3SR 5BMOA 3VVBA 1TTQB 1U8AA 4RLQA 3FPGA 4D4LA 4EUHA 1KZ9A 4F97A 1LJ8A 3M6MD 1DT5A 2ONCA 4CF7A 3ECSA 1ZXBA 4LWPA 4GKBA 3N8HA 1PYOA 4FOOA 4PBTA 1G8YA 1LTKA 4JQCA 1BH6A 2VSYA 1OXKB 1WP9A 1LLQA 2PKRA 1OE0A 3GRCA 1QCYA 1ZP6A 3EIOA 4KJZA 1VL8A 4F60A 5IULC 4QQFA 1E1DA 3DAOA 5HF9A 4H1VA 2W83A 1MVLA 5KWSA 3FMPB 3BJMA 1O7JA 3GG9A 2XUQA 3IUJA 3M49A 4XPIB 3ZXUB 3JR3A 1FE8A 4YONB 2WT9A 1I13A 1T8RA 3SBEA 4YV1A 1QTIA 3H17A 5FR2A 1A7UA 4B76A 5JXGA 4P4LA 4G23A 3EPLA 1JYEA 1OXTA 1B43A 1LS6A 3IA2A 2QUAA 4UQPA 3CNLA 4XMZA 1UBMS 3SYTA 3NBZC 4Z9YA 1E7SA 3E1SA 4HWRA 1C4WA 1CFZA 2BT4A 3WGIA 3Q2OA 3B7RL 1DBSA 1Q0HA 1MLDA 1QONA 4JOCA 4XO5A 4JCOA 4POAA 2QP4A 1FP4B 2J59A 4Q19A 3STHA 4BO2A 2QT0A 2XQVA 1P1BA 1XNGA 2G9RA 3OPYI 3SFTA 2AZ4A 1H5UA 1VBFA 3AHCA 3SE7A 4AUEA 1L4MA 1USWA 5FNVA 1PS9A 2I1WA 4K9RA 3CLTC 1G8PA 4ZO4A 5EJ9A 2IH4A 3UFBA 1AF7A 3BC1A 3T9CA 4HNHA 3EYWA 4Q3LA 3T3NA 1DADA 3GYBA 3PNKA 3R5JA 4IJUA 4UMDA 5IBRA 3D02A 3Q6MA 3T9DA 1CDZA 1RQNA 4MKTA 2RI0A 1ZCAA 4FW9A 4JHLA 2FP3A 4CNQA 3Q0EA 3AB8A 3NG1A 1YI1A 2HU5A 3DBVO 4RK6A 5JS2A 3U7GA 1ENZA 1UC4B 1VGQA 4M9XA 1PWEA 3HN7A 2P1ZA 1AC5A 4NYJQ 2F3TA 3OOSA 4C7OA 3TNLA 3PGA1 1FTGA 1WQ3A 3VO2A 4GGOA 5LP6A 4G0NA 2VP0A 2WJVA 1GA1A 1RYHA 3HCFA 4MKFA 3WIDA 4AM8A 5A6SA 2GM3A 4PZ0A 1B15A 4WFIA 5E1MA 5T4BA 4EMTA 2K7FA 5JNSA 1QIDA 3UC5A 4BN4A 1ISIA 2F90A 3SEZA 2P77A 3W8EA 5HFNA 1PL7A 1YR7A 3QOFA 3ZQ4A 1FUEA 3OHSX 5A6VA 4ZYXA 4JP8A 2PGDA 3N39C 4DLKA 4ZCMA 5JSFA 2V1UA 5EXTA 3NOOA 4QMEA 4FP9A 3AWDA 4H4CA 4B85A 2JI8A 4DEXA 1SQ6A 3BWCA 2XNDD 3UTDA 3EDMA 2ATXA 3RCBA 1T5LA 3VNQA 4BUJA 1N9ZA 4R8LA 5AVWA 1AXEA 1W0JD 3LV8A 1JKJB 3NX4A 1WKVA 2QXTA 3O1IC 4QNNA 3EISA 3CVJA 3FYCA 4GM4A 3GUUA 3ORHA 2IODA 2QLLA 1AG9A 1XTQA 3K1TA 5IXSA 1KRHA 2OGZA 2QYSA 5D1NA 3TUIC 1JHZA 4ECAA 3K0FA 3U26A 3AJ8A 2OOKA 1V0JA 4Q3AA 3LFHA 4MWCA 2JJQA 1ZGHA 3FPEA 4AY4A 1WHSB 2WJJA 3FWPA 3KIPA 4TOIA 1VE3A 3T8VA 1AB5A 4F2GA 5JJ5A 1HQCA 5DH9A 1A88A 4GX5A 3IR7A 4WL0A 4C4RA 4FWTA 1RQ7A 4FC7A 3HUFA 3BAZA 1YJAA 5D6OA 3RK1A 2ZRGA 1XQVA 1LPSA 1XRNA 3Q1LA 2XGGA 3D8TA 3CPHA 4RA6B 1U9IC 2CLMB 1UPFA 4FTWA 3T3DA 4CM4B 5K3AA 5ALXA 1VSBA 4RLHA 5C34B 2R79A 3K3PA 3OZWA 3WGOA 2ACEA 4K1LA 1UT5A 3V4PB 3E3NA 1C0LA 3K5PA 4E09A 4DZZA 1YZYA 3UAZA 3HJBA 4ZHQF 1FX0B 4HQ6A 4UXHA 5B6JA 5DNUA 3QFCA 3DD5A 1WDTA 4PC2A 5JH7B 4WNAB 3HWWA 1A5SB 1A3CA 2VJBA 1TIBA 3E9DA 5DCUA 3T7AA 3AVXA 2QTZA 3KVRA 1N33B 3KJZA 3MHTA 3HBLA 2WPDD 2VLIA 3R0ZA 2A88A 3HHPA 1IOZA 4JGBA 1PYDA 2GHQA 3PDHA 2DP4E 2OBLA 5DTEA 5K0BA 5L3SB 4DCJA 2GQ0A 5A1TA 3H86A 1SM4A 3F74A 4EH1A 3TAHA 5HX7A 2PVSA 1JR4A 1E79D 1XF1A 3AL2A 1U7DA 3EWSA 1W6UA 3CT6A 3IT0A 4F71A 1DRKA 1GXSA 1TF2A 2WU3A 4N18A 3KQNA 4JI0B 1ZYUA 3HGMA 1JYSA 5E9AA 2VNAA 4LXQA 1GXSB 2VR1A 3BGVA 4Q1FA 1FLAA 1JT2A 3VPHA 5IAKA 1BXRA 2N3ZA 2XIQA 5K20A 1AUQA 2X6QA 4Z7NB 2WV7A 1Y3CE 2ZS9A 3INGA 4R7TA 3VAYA 4RTMA 1KY2A 3BERA 5AH0A 2DHEA 1DEAA 3HR4A 4D8WA 2NZWA 2EP8A 1SHUX 5EMKA 4MRNA 3KHKA 4BB6A 1A76A 1NQTA 4DBLE 5ERGB 5HJ7A 2UYHA 3ME5A 4IDGA 1SUBA 1MV5A 3HCNA 2CXPA 4L8WB 3OQVA 1UBEA 3FTDA 1MMFB 2P27A 3WGJA 3ELUA 4OHYA 1ZMOA 2RE8A 4CKEB 1Q3HA 2O8EB 1ID8A 3R77A 3BD6A 3LPCA 4MWEA 4DDKA 3MIIA 2WFMA 4IIEA 1O4WA 3AQIA 3T5TA 3FXAA 4G81A 2XNJA 3GLIB 4C05A 1IY0A 3EBHA 4NOKA 4AKEA 1LEHA 4DY6A 1TLFA 1RYYA 2QN3A 2N75A 3LKVA 1KPIA 1N4DA 4GI7A 2NVUA 1OXBB 2LNDA 1LD3A 4FFNA 3E7XA 3GFPA 4FLMA 1NL3A 2VZLA 4TMTA 5NULA 3R7DA 3HM9A 1Z35A 1DV2A 1QYWA 2PA0A 3A8TA 4KPUB 4AC9A 3GRZA 1RWNA 2CEKA 2JIQA 4YCAA 3EJWA 3UV7A 4P3KA 4KPUA 1WMDA 4EB6A 2CXRA 5EMNA 4L3WA 5MFPA 3LZDA 2ZTHA 1SOMA 1XKTA 4N3GA 5T8KC 1NW4A 5D3MA 2B34A 2YJ5A 2P9YA 2X41A 1L7QA 1E79A 5K1ZA 3BE8A 1BW9B 3N2ZB 4FSHA 221PA 3IA7A 3LT0A 5EVCA 2QM3A 4WUTA 3HACA 5BWBA 2NQ8A 3O38A 4HUJA 4MEBA 4KO3S 1Y6FA 2C8VA 4NXMB 1NDUA 3MCTA 2JHFA 3AF6A 5AWFC 1S5PA 3CPJB 3ENNA 3HA7A 3FHJA 5IHXA 2M32A 3N5CA 4MVJH 3KD2A 1E6EA 5EJFA 2G36A 2PKXA 2WFLB 4CCYB 2NYUA 2HNBA 3L8EA 5UKDA 1UPCA 5FAXA 5C7OO 1SWWA 2IHUA 3ONEA 4IOKA 5ICGA 1S7CA 3IAM1 1Q1GA 1IVSA 1AB6A 3LMKA 3S2EA 4FGJA 2WJYA 3KOYA 2H9AA 5A4IS 4M0LA 4NPAA 2NWQA 4RY2A 4NZPA 2OMKA 1A5AB 2B7LA 5EFOA 2YKGA 2HYDA 3VOTA 4KSYA 4QVGA 4QPCA 2GNOA 4KLCA 2YNMD 1EPUA 3TG2A 4P35A 1R15A 2F7SA 4TSFD 3HXQA 2WFAA 4R05A 2ORED 2GF0A 2CUKA 3I62A 3OUZA 1K08A 1C0IA 2H2FA 5CT9A 1XDGA 4K9MA 4AJEA 3KHUA 4WXPA 4AWAA 5JXIA 4OJQA 2E9SA 3EGIA 4G37A 1NRWA 1P0FA 5CG1A 2HIGA 4HEA1 1TPYA 1AGPA 5ENVA 1SR8A 1ZVVA 5TSDA 3G0GA 1MA3A 2MSLA 4MDEA 4HN2A 4ZANA 3ZWWA 4X2UA 4G2TA