2A7OA

Solution structure of the hset2/hypb sri domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
100
structure length
100
Chain Sequence
TSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Huntingtin interacting protein B
publication title Solution structure of the Set2 Rpb1 interacting domain of human Set2 and its interaction with the hyperphosphorylated C-terminal domain of Rpb1
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08236 SRI SRI (Set2 Rpb1 interacting) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.100 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2a7oA00
2C5ZA 2A7OA
chains in the Genus database with same CATH superfamily
2O7GA 5DULA 5JC1A 3FUIA 2JD1A 5HNHA 4K5MA 4Q4EA 4J3BA 3CHQA 4XNBA 4FCAA 4FLQA 5JBIA 1H19A 3FTWA 4ZX3A 3B3BA 3JT1A 2Y1EA 4XN8A 1MW2A 3B7RL 4FLRA 2EGHA 3UCQA 3FUKA 5BPPA 2QVWA 3JSZA 4QPEA 2JD2A 4XMZA 4K5NA 3VVLA 3ZHYA 3IIEA 5JMPA 1HS6A 4ARFA 4Y6PA 2WPGA 3CZKA 4LUPA 2PUSA 3CZLA 2FFLA 2MAPA 2JCXA 3FHEA 2XPZA 4MS6A 4XMTA 5FWQA 2ZXGA 2XPYA 3UERA 3VVMA 4CXFA 4GAAA 3U9WA 2XQ0A 3B2XA 3CZGA 3PUUA 3KEDA 1Q0QA 3CHPA 4ZX6A 3FH8A 4XN7A 1H3LA 4ZW6A 4RCVA 1T1RA 4Q4IA 4JNDA 3HW2A 2WZFA 2B61A 3Q43A 3FTSA 3RC8A 2QJ1A 5HNFA 4DPRA 3AU9A 1ONOA 1SC5A 2DQ6A 3B7TA 4R5TA 4XNDA 5DYFA 3B7UX 4ZX4A 2Y1DA 2JD0A 4NQWA 4PW4A 3UEQA 4ZW7A 2JV7A 3FH5A 3FTXA 3EBHA 2HPOA 2R59A 2MAOA 1MW3A 4XMXA 2VLAA 4BKXA 2R72A 3CHOA 1K5HA 3FULA 2VJ8A 3FUDA 4Y67A 1SQMA 3WQRA 4ZQTA 4Y6SA 3FTVA 4ZX5A 4AYSA 1SG7A 5EV7A 5DLLA 3WQQA 4XN1A 3FTYA 4Y6RA 4RSYA 4A03A 4ZQGA 2Y1FA 3FU5A 3FH7A 4R5VA 4K5OA 4XMWA 3FUNA 5JAZA 3FUFA 4K5LA 1RP3A 2JCVA 3ANMA 3ZHXA 3FUMA 4XMVA 1JG9A 1R0KA 3EBIA 3FUJA 4ZW8A 3FUHA 3QJXA 4KP7A 3CZEA 1ONNA 2A7OA 3ANLA 3FTUA 4AR8A 3RC3A 3AUAA 4XN2A 4QHPA 4XO5A 2WZGA 1T1SA 2R70A 3A06A 4GAEA 4XMUA 4ZQHA 1G5AA 4AR1A 5JNLA 4XO4A 4XNAA 3B34A 4R7LA 4AR9A 4K5PA 2C82A 4AICA 5JO0A 1X3ZA 1MW1A 3FUEA 4ZW5A 2DQMA 1R0LA 3FU6A 4OOEA 1Q0LA 2C5ZA 4ZW3A 1Q0HA 3B2PA 3ZI0A 1JGIA 4R5XA 3B37A 2Y1CA 1ZS2A 2JCYA 4PU2A 3RASA 1MVYA 1MW0A 3CXBA 4ZN6A 2HPTA 3B7SA 4PVBA 3FTZA 3CHRA 1GW6A 1OR7A 2RJIA 2GTQA 3AU8A 1S46A 3CHSA 3R0IA 4FLSA 4MKTA 4QUOA 5JMWA 4ZQEA 1JVSA 4RVBA 2PL5A 4XO3A 3ZHZA 3T0YA 4XN5A 4XN4A 3T8VA 2PGGA 3ANNA 3Q44A 1ONPA 4QMEA 1X3WA 4FLOA 4L2LA 4QIRA 3EBGA 4ZQFA 3FU3A 3WQSB 4X2UA 3CIAA 3FU0A 4OOFA 3A14A 2Y1GA 5AENA 5HLTA 4XN9A
chains in the Genus database with same CATH topology
2O7GA 5DULA 5JC1A 3FUIA 2JD1A 5HNHA 4K5MA 4Q4EA 4J3BA 3CHQA 4XNBA 4FCAA 4FLQA 5JBIA 1H19A 3FTWA 4ZX3A 3B3BA 3JT1A 2Y1EA 4XN8A 1MW2A 3B7RL 4FLRA 2EGHA 3UCQA 3FUKA 5BPPA 2QVWA 3JSZA 4QPEA 2JD2A 4XMZA 4K5NA 3VVLA 3ZHYA 3IIEA 5JMPA 1HS6A 4ARFA 4Y6PA 2WPGA 3CZKA 4LUPA 2PUSA 3CZLA 2FFLA 2MAPA 2JCXA 3FHEA 2XPZA 4MS6A 4XMTA 5FWQA 2ZXGA 2XPYA 3UERA 3VVMA 4CXFA 4GAAA 3U9WA 2XQ0A 3B2XA 3CZGA 3PUUA 3KEDA 1Q0QA 3CHPA 4ZX6A 3FH8A 4XN7A 1H3LA 4ZW6A 4RCVA 1T1RA 4Q4IA 4JNDA 2WZFA 2B61A 3Q43A 3FTSA 3RC8A 2QJ1A 5HNFA 4DPRA 3AU9A 1ONOA 1SC5A 2DQ6A 3B7TA 4R5TA 4XNDA 5DYFA 3B7UX 4ZX4A 2Y1DA 2JD0A 4NQWA 4PW4A 3UEQA 4ZW7A 2JV7A 3FH5A 3FTXA 3EBHA 2HPOA 2R59A 2MAOA 1MW3A 4XMXA 2VLAA 4BKXA 2R72A 3CHOA 1K5HA 3FULA 2VJ8A 3FUDA 4Y67A 1SQMA 3WQRA 4ZQTA 4Y6SA 3FTVA 4ZX5A 4AYSA 1SG7A 5EV7A 5DLLA 3WQQA 4XN1A 3FTYA 4Y6RA 4RSYA 4A03A 4ZQGA 2Y1FA 3FU5A 3FH7A 4R5VA 4K5OA 4XMWA 3FUNA 5JAZA 3FUFA 4K5LA 1RP3A 2JCVA 3ANMA 3ZHXA 3FUMA 4XMVA 1JG9A 1R0KA 3EBIA 3FUJA 4ZW8A 3FUHA 3QJXA 4KP7A 3CZEA 1ONNA 2A7OA 3ANLA 3FTUA 4AR8A 3RC3A 3AUAA 4XN2A 4QHPA 4XO5A 2WZGA 1T1SA 2R70A 3A06A 4GAEA 4XMUA 4ZQHA 1G5AA 4AR1A 5JNLA 4XO4A 4XNAA 3B34A 4R7LA 4AR9A 4K5PA 2C82A 4AICA 5JO0A 1X3ZA 1MW1A 3FUEA 4ZW5A 2DQMA 1R0LA 3FU6A 4OOEA 1Q0LA 2C5ZA 4ZW3A 1Q0HA 3B2PA 3ZI0A 1JGIA 4R5XA 3B37A 2Y1CA 1ZS2A 2JCYA 4PU2A 3RASA 1MVYA 1MW0A 4ZN6A 2HPTA 3B7SA 4PVBA 3FTZA 3CHRA 1GW6A 1OR7A 2RJIA 2GTQA 3AU8A 1S46A 3CHSA 3R0IA 4FLSA 4MKTA 4QUOA 5JMWA 4ZQEA 1JVSA 4RVBA 2PL5A 4XO3A 3ZHZA 3T0YA 4XN5A 4XN4A 3T8VA 2PGGA 3ANNA 3Q44A 1ONPA 4QMEA 1X3WA 4FLOA 4L2LA 4QIRA 3EBGA 4ZQFA 3FU3A 3WQSB 4X2UA 3CIAA 3FU0A 4OOFA 3A14A 2Y1GA 5AENA 5HLTA 4XN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Z A;  2A7O A; 
#chains in the Genus database with same CATH topology
 2O7G A;  5DUL A;  5JC1 A;  3FUI A;  2JD1 A;  5HNH A;  4K5M A;  4Q4E A;  4J3B A;  3CHQ A;  4XNB A;  4FCA A;  4FLQ A;  5JBI A;  1H19 A;  3FTW A;  4ZX3 A;  3B3B A;  3JT1 A;  2Y1E A;  4XN8 A;  1MW2 A;  3B7R L;  4FLR A;  2EGH A;  3UCQ A;  3FUK A;  5BPP A;  2QVW A;  3JSZ A;  4QPE A;  2JD2 A;  4XMZ A;  4K5N A;  3VVL A;  3ZHY A;  3IIE A;  5JMP A;  1HS6 A;  4ARF A;  4Y6P A;  2WPG A;  3CZK A;  4LUP A;  2PUS A;  3CZL A;  2FFL A;  2MAP A;  2JCX A;  3FHE A;  2XPZ A;  4MS6 A;  4XMT A;  5FWQ A;  2ZXG A;  2XPY A;  3UER A;  3VVM A;  4CXF A;  4GAA A;  3U9W A;  2XQ0 A;  3B2X A;  3CZG A;  3PUU A;  3KED A;  1Q0Q A;  3CHP A;  4ZX6 A;  3FH8 A;  4XN7 A;  1H3L A;  4ZW6 A;  4RCV A;  1T1R A;  4Q4I A;  4JND A;  3HW2 A;  2WZF A;  2B61 A;  3Q43 A;  3FTS A;  3RC8 A;  2QJ1 A;  5HNF A;  4DPR A;  3AU9 A;  1ONO A;  1SC5 A;  2DQ6 A;  3B7T A;  4R5T A;  4XND A;  5DYF A;  3B7U X;  4ZX4 A;  2Y1D A;  2JD0 A;  4NQW A;  4PW4 A;  3UEQ A;  4ZW7 A;  2JV7 A;  3FH5 A;  3FTX A;  3EBH A;  2HPO A;  2R59 A;  2MAO A;  1MW3 A;  4XMX A;  2VLA A;  4BKX A;  2R72 A;  3CHO A;  1K5H A;  3FUL A;  2VJ8 A;  3FUD A;  4Y67 A;  1SQM A;  3WQR A;  4ZQT A;  4Y6S A;  3FTV A;  4ZX5 A;  4AYS A;  1SG7 A;  5EV7 A;  5DLL A;  3WQQ A;  4XN1 A;  3FTY A;  4Y6R A;  4RSY A;  4A03 A;  4ZQG A;  2Y1F A;  3FU5 A;  3FH7 A;  4R5V A;  4K5O A;  4XMW A;  3FUN A;  5JAZ A;  3FUF A;  4K5L A;  1RP3 A;  2JCV A;  3ANM A;  3ZHX A;  3FUM A;  4XMV A;  1JG9 A;  1R0K A;  3EBI A;  3FUJ A;  4ZW8 A;  3FUH A;  3QJX A;  4KP7 A;  3CZE A;  1ONN A;  2A7O A;  3ANL A;  3FTU A;  4AR8 A;  3RC3 A;  3AUA A;  4XN2 A;  4QHP A;  4XO5 A;  2WZG A;  1T1S A;  2R70 A;  3A06 A;  4GAE A;  4XMU A;  4ZQH A;  1G5A A;  4AR1 A;  5JNL A;  4XO4 A;  4XNA A;  3B34 A;  4R7L A;  4AR9 A;  4K5P A;  2C82 A;  4AIC A;  5JO0 A;  1X3Z A;  1MW1 A;  3FUE A;  4ZW5 A;  2DQM A;  1R0L A;  3FU6 A;  4OOE A;  1Q0L A;  2C5Z A;  4ZW3 A;  1Q0H A;  3B2P A;  3ZI0 A;  1JGI A;  4R5X A;  3B37 A;  2Y1C A;  1ZS2 A;  2JCY A;  4PU2 A;  3RAS A;  1MVY A;  1MW0 A;  3CXB A;  4ZN6 A;  2HPT A;  3B7S A;  4PVB A;  3FTZ A;  3CHR A;  1GW6 A;  1OR7 A;  2RJI A;  2GTQ A;  3AU8 A;  1S46 A;  3CHS A;  3R0I A;  4FLS A;  4MKT A;  4QUO A;  5JMW A;  4ZQE A;  1JVS A;  4RVB A;  2PL5 A;  4XO3 A;  3ZHZ A;  3T0Y A;  4XN5 A;  4XN4 A;  3T8V A;  2PGG A;  3ANN A;  3Q44 A;  1ONP A;  4QME A;  1X3W A;  4FLO A;  4L2L A;  4QIR A;  3EBG A;  4ZQF A;  3FU3 A;  3WQS B;  4X2U A;  3CIA A;  3FU0 A;  4OOF A;  3A14 A;  2Y1G A;  5AEN A;  5HLT A;  4XN9 A; 
#chains in the Genus database with same CATH homology
 2O7G A;  5DUL A;  5JC1 A;  3FUI A;  2JD1 A;  5HNH A;  4K5M A;  4Q4E A;  4J3B A;  3CHQ A;  4XNB A;  4FCA A;  4FLQ A;  5JBI A;  1H19 A;  3FTW A;  4ZX3 A;  3B3B A;  3JT1 A;  2Y1E A;  4XN8 A;  1MW2 A;  3B7R L;  4FLR A;  2EGH A;  3UCQ A;  3FUK A;  5BPP A;  2QVW A;  3JSZ A;  4QPE A;  2JD2 A;  4XMZ A;  4K5N A;  3VVL A;  3ZHY A;  3IIE A;  5JMP A;  1HS6 A;  4ARF A;  4Y6P A;  2WPG A;  3CZK A;  4LUP A;  2PUS A;  3CZL A;  2FFL A;  2MAP A;  2JCX A;  3FHE A;  2XPZ A;  4MS6 A;  4XMT A;  5FWQ A;  2ZXG A;  2XPY A;  3UER A;  3VVM A;  4CXF A;  4GAA A;  3U9W A;  2XQ0 A;  3B2X A;  3CZG A;  3PUU A;  3KED A;  1Q0Q A;  3CHP A;  4ZX6 A;  3FH8 A;  4XN7 A;  1H3L A;  4ZW6 A;  4RCV A;  1T1R A;  4Q4I A;  4JND A;  2WZF A;  2B61 A;  3Q43 A;  3FTS A;  3RC8 A;  2QJ1 A;  5HNF A;  4DPR A;  3AU9 A;  1ONO A;  1SC5 A;  2DQ6 A;  3B7T A;  4R5T A;  4XND A;  5DYF A;  3B7U X;  4ZX4 A;  2Y1D A;  2JD0 A;  4NQW A;  4PW4 A;  3UEQ A;  4ZW7 A;  2JV7 A;  3FH5 A;  3FTX A;  3EBH A;  2HPO A;  2R59 A;  2MAO A;  1MW3 A;  4XMX A;  2VLA A;  4BKX A;  2R72 A;  3CHO A;  1K5H A;  3FUL A;  2VJ8 A;  3FUD A;  4Y67 A;  1SQM A;  3WQR A;  4ZQT A;  4Y6S A;  3FTV A;  4ZX5 A;  4AYS A;  1SG7 A;  5EV7 A;  5DLL A;  3WQQ A;  4XN1 A;  3FTY A;  4Y6R A;  4RSY A;  4A03 A;  4ZQG A;  2Y1F A;  3FU5 A;  3FH7 A;  4R5V A;  4K5O A;  4XMW A;  3FUN A;  5JAZ A;  3FUF A;  4K5L A;  1RP3 A;  2JCV A;  3ANM A;  3ZHX A;  3FUM A;  4XMV A;  1JG9 A;  1R0K A;  3EBI A;  3FUJ A;  4ZW8 A;  3FUH A;  3QJX A;  4KP7 A;  3CZE A;  1ONN A;  2A7O A;  3ANL A;  3FTU A;  4AR8 A;  3RC3 A;  3AUA A;  4XN2 A;  4QHP A;  4XO5 A;  2WZG A;  1T1S A;  2R70 A;  3A06 A;  4GAE A;  4XMU A;  4ZQH A;  1G5A A;  4AR1 A;  5JNL A;  4XO4 A;  4XNA A;  3B34 A;  4R7L A;  4AR9 A;  4K5P A;  2C82 A;  4AIC A;  5JO0 A;  1X3Z A;  1MW1 A;  3FUE A;  4ZW5 A;  2DQM A;  1R0L A;  3FU6 A;  4OOE A;  1Q0L A;  2C5Z A;  4ZW3 A;  1Q0H A;  3B2P A;  3ZI0 A;  1JGI A;  4R5X A;  3B37 A;  2Y1C A;  1ZS2 A;  2JCY A;  4PU2 A;  3RAS A;  1MVY A;  1MW0 A;  4ZN6 A;  2HPT A;  3B7S A;  4PVB A;  3FTZ A;  3CHR A;  1GW6 A;  1OR7 A;  2RJI A;  2GTQ A;  3AU8 A;  1S46 A;  3CHS A;  3R0I A;  4FLS A;  4MKT A;  4QUO A;  5JMW A;  4ZQE A;  1JVS A;  4RVB A;  2PL5 A;  4XO3 A;  3ZHZ A;  3T0Y A;  4XN5 A;  4XN4 A;  3T8V A;  2PGG A;  3ANN A;  3Q44 A;  1ONP A;  4QME A;  1X3W A;  4FLO A;  4L2L A;  4QIR A;  3EBG A;  4ZQF A;  3FU3 A;  3WQS B;  4X2U A;  3CIA A;  3FU0 A;  4OOF A;  3A14 A;  2Y1G A;  5AEN A;  5HLT A;  4XN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...