1SC5A

Sigma-28(flia)/flgm complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
232
structure length
228
Chain Sequence
KNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor FliA
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 82
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sc5A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1sc5A02
4ZQEA 3ANNA 1R0LA 2JD2A 3ANMA 3CZGA 1MW0A 1ONOA 4QICA 4Y67A 5DULA 4LUPA 3T0YA 4ZQHA 2Y1EA 4ZN6A 4FLRA 4FLOA 3R0IA 1T1SA 4ZQFA 2O7GA 4FLQA 3RASA 5JBIA 1SC5A 2Y1FA 4Y6PA 1K5HA 4RCVA 3ZHXA 3A06A 3ANLA 2MAPA 3N0RA 3WQSB 3AUAA 4G97A 3CZLA 3WQRA 1RP3A 2Y1GA 3ZI0A 5JAZA 1MW2A 4ZQGA 4NQWA 1MW3A 3WQQA 1OR7A 4AYSA 3AU9A 2JCXA 2JD1A 2EGHA 5JC1A 5JMPA 1JGIA 2Y1CA 3ZHZA 3AU8A 3UEQA 1ONNA 2JD0A 4GAEA 1ZS2A 3ZHYA 4AICA 2Y1DA 4CXFA 3IIEA 4OOFA 1Q0QA 3CZEA 3UCQA 3UERA 4Y6SA 4A03A 1H3LA 1ONPA 4OOEA 4KP7A 2WPGA 2LFWA 1JVSA 4Y6RA 5JMWA 3CZKA 1S46A 2MAOA 1MVYA 1MW1A 1JG9A 4FLSA 5JO0A 1T1RA 2C82A 3A14A 2JCVA 2JCYA 1Q0HA 1Q0LA 1G5AA 5JNLA 1R0KA
chains in the Genus database with same CATH superfamily
4E02A 3CRLA 3FUFA 4QMEA 2YGWA 3CE2A 3RC3A 3C2PA 1T9GA 4XN9A 3CZGA 1XFWA 3FU6A 1MW0A 1UKWA 3B3BA 3Q23A 4X28C 4L3YA 3KEDA 4DPRA 3Q43A 4U83A 2RF7A 5GJWE 1UDYA 4XN7A 4FF3A 3FUEA 2DDHA 4QIRA 1X3ZA 2OJQA 3B7TA 4AKHA 4K5MA 1H19A 2MAPA 3CHQA 3D9EA 4JEKA 4ZYJA 3N0RA 4ARFA 2RFQA 1EGDA 4XMWA 3WQSB 2WZFA 3FTYA 4Q5CA 3VKGA 3C46A 3D1IA 1GKXA 4XNAA 3CZLA 3OWMA 2Z1QA 3CHRA 2EBHX 2IX6A 2E0AA 4FF4A 5BRMA 4K5NA 2XQ0A 3FU3A 5B5WA 2C12A 3MKHA 2EGHA 2JD1A 1BUCA 4XMUA 5K3HA 3MPJA 1JGIA 2FP1A 5J71A 4AI6A 4JIOA 4X2UA 3FUDA 3BNFA 2VIGA 1ONNA 1LVCA 2D29A 2PGGA 3ZHYA 4L1FA 2Y1DA 2R70A 4CXFA 2CJ7A 2A7OA 3GNCA 5B6BA 1K90A 3M9VA 4XO3A 1H3LA 3Q22A 2R03A 4ZW7A 4KP7A 5GJVE 3FUJA 4K5PA 1JQIA 2FP2A 3FH8A 4ZW6A 2PL5A 4RM7A 1HS6A 3D9GA 2BU5A 4WJYA 3MDEA 1PI1A 1S46A 2XS1A 3FULA 4XO5A 3CXBA 3PUUA 2BU6A 2RJIA 5JO0A 2BU8A 4R5TA 5M4MA 2CJ6A 2CJ4A 2C82A 2JCVA 4IV6A 2VR0A 3EONA 4AR9A 4ZQTA 1G5AA 2DQMA 3CIAA 3QJXA 1R0KA 4QHPA 4AR8A 2ZDYA 3VVMA 1R0LA 2JD2A 1W07A 3HWCA 4OO2A 4F0XA 2CJ5A 2CJ8A 3B7RL 4HR3A 5M4PA 1ONOA 4KS9A 4HKSA 4Y67A 1PK0A 3X0XA 2OR0A 2YYIA 4MKTA 4PVBA 4ZXVA 2RDZA 1R3BA 4ZN6A 2ZO5A 4FLRA 4QPEA 2FONA 3R0IA 4XMXA 2O7GA 4FLQA 4ZX5A 3FCJA 3B7UX 2Y1FA 3TZ0A 5B5VA 1WS9A 4L38A 1X3WA 2WZGA 1Y8OA 2PNRA 3A06A 4H81A 3EOMA 1GKZA 2ZDXA 1SQMA 2JBSA 3D9DA 4ZW5A 3NF4A 2E80A 3WQRA 2R59A 3FH7A 3OIBA 2QR4A 5M4KA 5JAZA 2R05A 2ZAFA 4ZQGA 2AZEA 5K3IA 2GTQA 4AYSA 3AU9A 2JCXA 5JMPA 4J1VA 2WBIA 4N5FA 2PUSA 2BU2A 4RVBA 4R5XA 3CRKA 3RC8A 2FFLA 4L3XA 2VF1A 3SXQA 3LGQA 3FTXA 2R0NA 1Y8NA 3FUNA 1Y8PA 4NXLA 1Q0QA 1X90A 3R7KA 2JBRA 4ZX6A 4Y6SA 4FCAA 4A03A 1FS7A 1OAHA 2C5ZA 5AENA 3FTSA 4MP7A 2GBBA 3SF6A 2ZKJA 5EV7A 4FF2A 3MPIA 4Q0TA 5HLTA 4P79A 2PO4A 4M9AA 3EBIA 3VADA 2R02A 3PFDA 3MDDA 2AO2A 1R2JA 1XFUA 1JG9A 4GAAA 2Q8FA 4FLSA 1IS2A 4V25A 3A14A 2JCYA 4IRNA 4QUOA 1SIRA 3F29A 3D2RA 3FU5A 4JIZA 2VJ8A 5JNLA 3FUIA 1S26A 4KCFA 5DLLA 3ANNA 3HW2A 3AFEA 3ANMA 4MP2A 1GU6A 4PU2A 4Q4EA 4E00A 4LUPA 4G5EA 3FU0A 3T0YA 4Q17A 5BRKA 5K3GA 2Y1EA 2J7AA 1FS8A 1SK6A 2HJNA 3EBGA 2IX5A 4FLOA 3P4TA 4R7LA 1T1SA 5JBIA 3BNGA 2ZXGA 1SC5A 3TZ5A 3CHPA 3B7SA 3Q0AA 3CHOA 4ZW8A 2XS8A 4Y6PA 1K5HA 4RCVA 3FHEA 3ANLA 2F6LA 3S7WA 2QJ1A 3SWOA 2A1TA 3TZ2A 3X29A 4V26A 2YYKA 4JNDA 1X91A 4G97A 1RP3A 4LQQB 3ZI0A 4ZW3A 1XFZA 5K3JA 3SCEA 4H85A 1MW3A 3LG1A 1OR7A 1GW6A 4L2LA 4P13A 5BPPA 3FTVA 2Y1CA 3ZHZA 3JSZA 4LQSB 3UEQA 1JM6A 1XFVA 2E81A 4XN8A 3FUHA 4GAEA 1SG7A 4FZ4A 5DYFA 3T8VA 2DQ6A 3UU9A 3FTWA 1X8ZA 3IIEA 4OOFA 3B37A 3U9WA 4Q5BA 2BTZA 3UCQA 3CHSA 1ONPA 4MPCA 5FWQA 1U8VA 4J3BA 2WPGA 3VVLA 4MS6A 3L1TA 4L3ZA 3BNJA 1JVSA 1RJ4A 4HKRA 3UBRA 3CZKA 4XN1A 2HPTA 3AFFA 3MXLA 4FF1A 3FTZA 3Q24A 4Q4IA 1EGEA 2YYLA 1FS9A 4ZX3A 2PG0A 4DOYA 3Q44A 1Q0HA 1Q0LA 4AKGA 1K8TA 4MPNA 2YYJA 4W9UA 1IVHA 4ZQEA 4K5LA 2BU7A 2VLAA 2XPYA 2OEVA 4H7QA 2Q8GA 4QICA 5DULA 2JBTA 4ZQHA 2YYGA 3X0YA 2UXWA 2R0MA 5HNFA 3FUMA 2JIFA 4ZQFA 3RASA 4R5VA 3D9FA 2C0UA 4XVXA 3C3LA 1QDBA 4XMVA 4O5MA 3GQTA 3ZHXA 2R72A 1EGCA 3KMLA 3VKHA 3B2PA 3BNHA 2EBAA 4DZYA 2Q8HA 2REHA 3D6BA 4ZX4A 4XNBA 1XG2B 3AUAA 4AR1A 1RX0A 4MPEA 3B34A 2Y1GA 1GJVA 4X28A 1MW2A 4NQWA 3II9A 3WQQA 1SIQA 2XPZA 4BKXA 2EC5A 5M4NA 3FTUA 5HNHA 4RSYA 2B61A 3OWAA 5JC1A 4KSAA 3AU8A 3JT1A 2OEXA 3EBHA 2EBFX 2JD0A 4Q4UA 4AKIA 1ZS2A 3TZ4A 4AICA 3FH5A 2HPOA 4XMTA 3TORA 3CZEA 4XO4A 4E01A 3UERA 3RKHA 1Y0VA 3FUKA 1XFYA 3MMOA 4K5OA 1K93A 4XN5A 4OOEA 3GM6A 4PW4A 3B96A 2JV7A 2LFWA 4Y6RA 5JMWA 2MAOA 1MVYA 4KTOA 4Q1OA 1XFXA 1MW1A 2YYMA 2QVWA 2CX9A 3TTBA 1T1RA 2OT4A 5J6AA 2XQRB 4XN2A 3FO3A 1RJ1A 2Q8IA 3B2XA 4XN4A 4KSFA 4XNDA 4XMZA 2DVLA
chains in the Genus database with same CATH topology
3FUFA 4QMEA 2YGWA 3CE2A 3RC3A 3C2PA 4XN9A 3CZGA 1XFWA 3FU6A 1MW0A 3B3BA 3Q23A 3KEDA 4DPRA 3Q43A 5GJWE 4XN7A 4FF3A 3FUEA 4QIRA 1X3ZA 3B7TA 4AKHA 4K5MA 1H19A 2MAPA 3CHQA 3N0RA 4ARFA 4XMWA 3WQSB 2WZFA 3FTYA 3VKGA 3C46A 4XNAA 3CZLA 3CHRA 2EBHX 4FF4A 4K5NA 2XQ0A 3FU3A 2EGHA 2JD1A 4XMUA 1JGIA 2FP1A 4AI6A 4X2UA 3FUDA 1ONNA 1LVCA 2PGGA 3ZHYA 2Y1DA 2R70A 4CXFA 2A7OA 1K90A 4XO3A 1H3LA 3Q22A 4ZW7A 4KP7A 5GJVE 3FUJA 4K5PA 2FP2A 3FH8A 4ZW6A 2PL5A 1HS6A 1S46A 3FULA 4XO5A 3PUUA 2RJIA 5JO0A 4R5TA 2C82A 2JCVA 4AR9A 4ZQTA 1G5AA 2DQMA 3CIAA 3QJXA 1R0KA 4QHPA 4AR8A 3VVMA 1R0LA 2JD2A 4F0XA 3B7RL 1ONOA 4KS9A 4HKSA 4Y67A 1PK0A 4MKTA 4PVBA 4ZN6A 4FLRA 4QPEA 3R0IA 4XMXA 2O7GA 4FLQA 4ZX5A 3B7UX 2Y1FA 1X3WA 2WZGA 3A06A 1SQMA 4ZW5A 3WQRA 2R59A 3FH7A 2QR4A 5JAZA 4ZQGA 2AZEA 2GTQA 4AYSA 3AU9A 2JCXA 5JMPA 2PUSA 4RVBA 4R5XA 3RC8A 2FFLA 2VF1A 3FTXA 3FUNA 1Q0QA 4ZX6A 4Y6SA 4FCAA 4A03A 2C5ZA 5AENA 3FTSA 2GBBA 5EV7A 4FF2A 5HLTA 4P79A 2PO4A 3EBIA 2AO2A 1XFUA 1JG9A 4GAAA 4FLSA 3A14A 2JCYA 4QUOA 3FU5A 2VJ8A 5JNLA 3FUIA 1S26A 5DLLA 3ANNA 3ANMA 4PU2A 4Q4EA 4LUPA 3FU0A 3T0YA 2Y1EA 1SK6A 3EBGA 4FLOA 4R7LA 1T1SA 5JBIA 2ZXGA 1SC5A 3CHPA 3B7SA 3Q0AA 3CHOA 4ZW8A 4Y6PA 1K5HA 4RCVA 3FHEA 3ANLA 2F6LA 2QJ1A 3X29A 4JNDA 4G97A 1RP3A 3ZI0A 4ZW3A 1XFZA 1MW3A 1OR7A 1GW6A 4L2LA 5BPPA 3FTVA 2Y1CA 3ZHZA 3JSZA 3UEQA 1XFVA 4XN8A 3FUHA 4GAEA 1SG7A 4FZ4A 5DYFA 3T8VA 2DQ6A 3FTWA 3IIEA 4OOFA 3B37A 3U9WA 3UCQA 3CHSA 1ONPA 5FWQA 4J3BA 2WPGA 3VVLA 4MS6A 1JVSA 4HKRA 3CZKA 4XN1A 2HPTA 4FF1A 3FTZA 3Q24A 4Q4IA 4ZX3A 3Q44A 1Q0HA 1Q0LA 4AKGA 1K8TA 4ZQEA 4K5LA 2VLAA 2XPYA 4QICA 5DULA 4ZQHA 5HNFA 3FUMA 4ZQFA 3RASA 4R5VA 3C3LA 4XMVA 3ZHXA 2R72A 3KMLA 3VKHA 3B2PA 4ZX4A 4XNBA 3AUAA 4AR1A 3B34A 2Y1GA 1MW2A 4NQWA 3WQQA 2XPZA 4BKXA 2EC5A 3FTUA 5HNHA 4RSYA 2B61A 5JC1A 4KSAA 3AU8A 3JT1A 3EBHA 2EBFX 2JD0A 4AKIA 1ZS2A 4AICA 3FH5A 2HPOA 4XMTA 3CZEA 4XO4A 3UERA 1Y0VA 3FUKA 1XFYA 4K5OA 1K93A 4XN5A 4OOEA 4PW4A 2JV7A 2LFWA 4Y6RA 5JMWA 2MAOA 1MVYA 1XFXA 1MW1A 2QVWA 1T1RA 4XN2A 3B2XA 4XN4A 4KSFA 4XNDA 4XMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQE A;  3ANN A;  1R0L A;  2JD2 A;  3ANM A;  3CZG A;  1MW0 A;  1ONO A;  4QIC A;  4Y67 A;  5DUL A;  4LUP A;  3T0Y A;  4ZQH A;  2Y1E A;  4ZN6 A;  4FLR A;  4FLO A;  3R0I A;  1T1S A;  4ZQF A;  2O7G A;  4FLQ A;  3RAS A;  5JBI A;  1SC5 A;  2Y1F A;  4Y6P A;  1K5H A;  4RCV A;  3ZHX A;  3A06 A;  3ANL A;  2MAP A;  3N0R A;  3WQS B;  3AUA A;  4G97 A;  3CZL A;  3WQR A;  1RP3 A;  2Y1G A;  3ZI0 A;  5JAZ A;  1MW2 A;  4ZQG A;  4NQW A;  1MW3 A;  3WQQ A;  1OR7 A;  4AYS A;  3AU9 A;  2JCX A;  2JD1 A;  2EGH A;  5JC1 A;  5JMP A;  1JGI A;  2Y1C A;  3ZHZ A;  3AU8 A;  3UEQ A;  1ONN A;  2JD0 A;  4GAE A;  1ZS2 A;  3ZHY A;  4AIC A;  2Y1D A;  4CXF A;  3IIE A;  4OOF A;  1Q0Q A;  3CZE A;  3UCQ A;  3UER A;  4Y6S A;  4A03 A;  1H3L A;  1ONP A;  4OOE A;  4KP7 A;  2WPG A;  2LFW A;  1JVS A;  4Y6R A;  5JMW A;  3CZK A;  1S46 A;  2MAO A;  1MVY A;  1MW1 A;  1JG9 A;  4FLS A;  5JO0 A;  1T1R A;  2C82 A;  3A14 A;  2JCV A;  2JCY A;  1Q0H A;  1Q0L A;  1G5A A;  5JNL A;  1R0K A; 
#chains in the Genus database with same CATH topology
 4E02 A;  3CRL A;  3FUF A;  4QME A;  2YGW A;  3CE2 A;  3RC3 A;  3C2P A;  1T9G A;  4XN9 A;  3CZG A;  1XFW A;  3FU6 A;  1MW0 A;  1UKW A;  3B3B A;  3Q23 A;  4X28 C;  4L3Y A;  3KED A;  4DPR A;  3Q43 A;  4U83 A;  2RF7 A;  5GJW E;  1UDY A;  4XN7 A;  4FF3 A;  3FUE A;  2DDH A;  4QIR A;  1X3Z A;  2OJQ A;  3B7T A;  4AKH A;  4K5M A;  1H19 A;  2MAP A;  3CHQ A;  3D9E A;  4JEK A;  4ZYJ A;  3N0R A;  4ARF A;  2RFQ A;  1EGD A;  4XMW A;  3WQS B;  2WZF A;  3FTY A;  4Q5C A;  3VKG A;  3C46 A;  3D1I A;  1GKX A;  4XNA A;  3CZL A;  3OWM A;  2Z1Q A;  3CHR A;  2EBH X;  2IX6 A;  2E0A A;  4FF4 A;  5BRM A;  4K5N A;  2XQ0 A;  3FU3 A;  5B5W A;  2C12 A;  3MKH A;  2EGH A;  2JD1 A;  1BUC A;  4XMU A;  5K3H A;  3MPJ A;  1JGI A;  2FP1 A;  5J71 A;  4AI6 A;  4JIO A;  4X2U A;  3FUD A;  3BNF A;  2VIG A;  1ONN A;  1LVC A;  2D29 A;  2PGG A;  3ZHY A;  4L1F A;  2Y1D A;  2R70 A;  4CXF A;  2CJ7 A;  2A7O A;  3GNC A;  5B6B A;  1K90 A;  3M9V A;  4XO3 A;  1H3L A;  3Q22 A;  2R03 A;  4ZW7 A;  4KP7 A;  5GJV E;  3FUJ A;  4K5P A;  1JQI A;  2FP2 A;  3FH8 A;  4ZW6 A;  2PL5 A;  4RM7 A;  1HS6 A;  3D9G A;  2BU5 A;  4WJY A;  3MDE A;  1PI1 A;  1S46 A;  2XS1 A;  3FUL A;  4XO5 A;  3CXB A;  3PUU A;  2BU6 A;  2RJI A;  5JO0 A;  2BU8 A;  4R5T A;  5M4M A;  2CJ6 A;  2CJ4 A;  2C82 A;  2JCV A;  4IV6 A;  2VR0 A;  3EON A;  4AR9 A;  4ZQT A;  1G5A A;  2DQM A;  3CIA A;  3QJX A;  1R0K A;  4QHP A;  4AR8 A;  2ZDY A;  3VVM A;  1R0L A;  2JD2 A;  1W07 A;  3HWC A;  4OO2 A;  4F0X A;  2CJ5 A;  2CJ8 A;  3B7R L;  4HR3 A;  5M4P A;  1ONO A;  4KS9 A;  4HKS A;  4Y67 A;  1PK0 A;  3X0X A;  2OR0 A;  2YYI A;  4MKT A;  4PVB A;  4ZXV A;  2RDZ A;  1R3B A;  4ZN6 A;  2ZO5 A;  4FLR A;  4QPE A;  2FON A;  3R0I A;  4XMX A;  2O7G A;  4FLQ A;  4ZX5 A;  3FCJ A;  3B7U X;  2Y1F A;  3TZ0 A;  5B5V A;  1WS9 A;  4L38 A;  1X3W A;  2WZG A;  1Y8O A;  2PNR A;  3A06 A;  4H81 A;  3EOM A;  1GKZ A;  2ZDX A;  1SQM A;  2JBS A;  3D9D A;  4ZW5 A;  3NF4 A;  2E80 A;  3WQR A;  2R59 A;  3FH7 A;  3OIB A;  2QR4 A;  5M4K A;  5JAZ A;  2R05 A;  2ZAF A;  4ZQG A;  2AZE A;  5K3I A;  2GTQ A;  4AYS A;  3AU9 A;  2JCX A;  5JMP A;  4J1V A;  2WBI A;  4N5F A;  2PUS A;  2BU2 A;  4RVB A;  4R5X A;  3CRK A;  3RC8 A;  2FFL A;  4L3X A;  2VF1 A;  3SXQ A;  3LGQ A;  3FTX A;  2R0N A;  1Y8N A;  3FUN A;  1Y8P A;  4NXL A;  1Q0Q A;  1X90 A;  3R7K A;  2JBR A;  4ZX6 A;  4Y6S A;  4FCA A;  4A03 A;  1FS7 A;  1OAH A;  2C5Z A;  5AEN A;  3FTS A;  4MP7 A;  2GBB A;  3SF6 A;  2ZKJ A;  5EV7 A;  4FF2 A;  3MPI A;  4Q0T A;  5HLT A;  4P79 A;  2PO4 A;  4M9A A;  3EBI A;  3VAD A;  2R02 A;  3PFD A;  3MDD A;  2AO2 A;  1R2J A;  1XFU A;  1JG9 A;  4GAA A;  2Q8F A;  4FLS A;  1IS2 A;  4V25 A;  3A14 A;  2JCY A;  4IRN A;  4QUO A;  1SIR A;  3F29 A;  3D2R A;  3FU5 A;  4JIZ A;  2VJ8 A;  5JNL A;  3FUI A;  1S26 A;  4KCF A;  5DLL A;  3ANN A;  3HW2 A;  3AFE A;  3ANM A;  4MP2 A;  1GU6 A;  4PU2 A;  4Q4E A;  4E00 A;  4LUP A;  4G5E A;  3FU0 A;  3T0Y A;  4Q17 A;  5BRK A;  5K3G A;  2Y1E A;  2J7A A;  1FS8 A;  1SK6 A;  2HJN A;  3EBG A;  2IX5 A;  4FLO A;  3P4T A;  4R7L A;  1T1S A;  5JBI A;  3BNG A;  2ZXG A;  1SC5 A;  3TZ5 A;  3CHP A;  3B7S A;  3Q0A A;  3CHO A;  4ZW8 A;  2XS8 A;  4Y6P A;  1K5H A;  4RCV A;  3FHE A;  3ANL A;  2F6L A;  3S7W A;  2QJ1 A;  3SWO A;  2A1T A;  3TZ2 A;  3X29 A;  4V26 A;  2YYK A;  4JND A;  1X91 A;  4G97 A;  1RP3 A;  4LQQ B;  3ZI0 A;  4ZW3 A;  1XFZ A;  5K3J A;  3SCE A;  4H85 A;  1MW3 A;  3LG1 A;  1OR7 A;  1GW6 A;  4L2L A;  4P13 A;  5BPP A;  3FTV A;  2Y1C A;  3ZHZ A;  3JSZ A;  4LQS B;  3UEQ A;  1JM6 A;  1XFV A;  2E81 A;  4XN8 A;  3FUH A;  4GAE A;  1SG7 A;  4FZ4 A;  5DYF A;  3T8V A;  2DQ6 A;  3UU9 A;  3FTW A;  1X8Z A;  3IIE A;  4OOF A;  3B37 A;  3U9W A;  4Q5B A;  2BTZ A;  3UCQ A;  3CHS A;  1ONP A;  4MPC A;  5FWQ A;  1U8V A;  4J3B A;  2WPG A;  3VVL A;  4MS6 A;  3L1T A;  4L3Z A;  3BNJ A;  1JVS A;  1RJ4 A;  4HKR A;  3UBR A;  3CZK A;  4XN1 A;  2HPT A;  3AFF A;  3MXL A;  4FF1 A;  3FTZ A;  3Q24 A;  4Q4I A;  1EGE A;  2YYL A;  1FS9 A;  4ZX3 A;  2PG0 A;  4DOY A;  3Q44 A;  1Q0H A;  1Q0L A;  4AKG A;  1K8T A;  4MPN A;  2YYJ A;  4W9U A;  1IVH A;  4ZQE A;  4K5L A;  2BU7 A;  2VLA A;  2XPY A;  2OEV A;  4H7Q A;  2Q8G A;  4QIC A;  5DUL A;  2JBT A;  4ZQH A;  2YYG A;  3X0Y A;  2UXW A;  2R0M A;  5HNF A;  3FUM A;  2JIF A;  4ZQF A;  3RAS A;  4R5V A;  3D9F A;  2C0U A;  4XVX A;  3C3L A;  1QDB A;  4XMV A;  4O5M A;  3GQT A;  3ZHX A;  2R72 A;  1EGC A;  3KML A;  3VKH A;  3B2P A;  3BNH A;  2EBA A;  4DZY A;  2Q8H A;  2REH A;  3D6B A;  4ZX4 A;  4XNB A;  1XG2 B;  3AUA A;  4AR1 A;  1RX0 A;  4MPE A;  3B34 A;  2Y1G A;  1GJV A;  4X28 A;  1MW2 A;  4NQW A;  3II9 A;  3WQQ A;  1SIQ A;  2XPZ A;  4BKX A;  2EC5 A;  5M4N A;  3FTU A;  5HNH A;  4RSY A;  2B61 A;  3OWA A;  5JC1 A;  4KSA A;  3AU8 A;  3JT1 A;  2OEX A;  3EBH A;  2EBF X;  2JD0 A;  4Q4U A;  4AKI A;  1ZS2 A;  3TZ4 A;  4AIC A;  3FH5 A;  2HPO A;  4XMT A;  3TOR A;  3CZE A;  4XO4 A;  4E01 A;  3UER A;  3RKH A;  1Y0V A;  3FUK A;  1XFY A;  3MMO A;  4K5O A;  1K93 A;  4XN5 A;  4OOE A;  3GM6 A;  4PW4 A;  3B96 A;  2JV7 A;  2LFW A;  4Y6R A;  5JMW A;  2MAO A;  1MVY A;  4KTO A;  4Q1O A;  1XFX A;  1MW1 A;  2YYM A;  2QVW A;  2CX9 A;  3TTB A;  1T1R A;  2OT4 A;  5J6A A;  2XQR B;  4XN2 A;  3FO3 A;  1RJ1 A;  2Q8I A;  3B2X A;  4XN4 A;  4KSF A;  4XND A;  4XMZ A;  2DVL A; 
#chains in the Genus database with same CATH homology
 3FUF A;  4QME A;  2YGW A;  3CE2 A;  3RC3 A;  3C2P A;  4XN9 A;  3CZG A;  1XFW A;  3FU6 A;  1MW0 A;  3B3B A;  3Q23 A;  3KED A;  4DPR A;  3Q43 A;  5GJW E;  4XN7 A;  4FF3 A;  3FUE A;  4QIR A;  1X3Z A;  3B7T A;  4AKH A;  4K5M A;  1H19 A;  2MAP A;  3CHQ A;  3N0R A;  4ARF A;  4XMW A;  3WQS B;  2WZF A;  3FTY A;  3VKG A;  3C46 A;  4XNA A;  3CZL A;  3CHR A;  2EBH X;  4FF4 A;  4K5N A;  2XQ0 A;  3FU3 A;  2EGH A;  2JD1 A;  4XMU A;  1JGI A;  2FP1 A;  4AI6 A;  4X2U A;  3FUD A;  1ONN A;  1LVC A;  2PGG A;  3ZHY A;  2Y1D A;  2R70 A;  4CXF A;  2A7O A;  1K90 A;  4XO3 A;  1H3L A;  3Q22 A;  4ZW7 A;  4KP7 A;  5GJV E;  3FUJ A;  4K5P A;  2FP2 A;  3FH8 A;  4ZW6 A;  2PL5 A;  1HS6 A;  1S46 A;  3FUL A;  4XO5 A;  3PUU A;  2RJI A;  5JO0 A;  4R5T A;  2C82 A;  2JCV A;  4AR9 A;  4ZQT A;  1G5A A;  2DQM A;  3CIA A;  3QJX A;  1R0K A;  4QHP A;  4AR8 A;  3VVM A;  1R0L A;  2JD2 A;  4F0X A;  3B7R L;  1ONO A;  4KS9 A;  4HKS A;  4Y67 A;  1PK0 A;  4MKT A;  4PVB A;  4ZN6 A;  4FLR A;  4QPE A;  3R0I A;  4XMX A;  2O7G A;  4FLQ A;  4ZX5 A;  3B7U X;  2Y1F A;  1X3W A;  2WZG A;  3A06 A;  1SQM A;  4ZW5 A;  3WQR A;  2R59 A;  3FH7 A;  2QR4 A;  5JAZ A;  4ZQG A;  2AZE A;  2GTQ A;  4AYS A;  3AU9 A;  2JCX A;  5JMP A;  2PUS A;  4RVB A;  4R5X A;  3RC8 A;  2FFL A;  2VF1 A;  3FTX A;  3FUN A;  1Q0Q A;  4ZX6 A;  4Y6S A;  4FCA A;  4A03 A;  2C5Z A;  5AEN A;  3FTS A;  2GBB A;  5EV7 A;  4FF2 A;  5HLT A;  4P79 A;  2PO4 A;  3EBI A;  2AO2 A;  1XFU A;  1JG9 A;  4GAA A;  4FLS A;  3A14 A;  2JCY A;  4QUO A;  3FU5 A;  2VJ8 A;  5JNL A;  3FUI A;  1S26 A;  5DLL A;  3ANN A;  3ANM A;  4PU2 A;  4Q4E A;  4LUP A;  3FU0 A;  3T0Y A;  2Y1E A;  1SK6 A;  3EBG A;  4FLO A;  4R7L A;  1T1S A;  5JBI A;  2ZXG A;  1SC5 A;  3CHP A;  3B7S A;  3Q0A A;  3CHO A;  4ZW8 A;  4Y6P A;  1K5H A;  4RCV A;  3FHE A;  3ANL A;  2F6L A;  2QJ1 A;  3X29 A;  4JND A;  4G97 A;  1RP3 A;  3ZI0 A;  4ZW3 A;  1XFZ A;  1MW3 A;  1OR7 A;  1GW6 A;  4L2L A;  5BPP A;  3FTV A;  2Y1C A;  3ZHZ A;  3JSZ A;  3UEQ A;  1XFV A;  4XN8 A;  3FUH A;  4GAE A;  1SG7 A;  4FZ4 A;  5DYF A;  3T8V A;  2DQ6 A;  3FTW A;  3IIE A;  4OOF A;  3B37 A;  3U9W A;  3UCQ A;  3CHS A;  1ONP A;  5FWQ A;  4J3B A;  2WPG A;  3VVL A;  4MS6 A;  1JVS A;  4HKR A;  3CZK A;  4XN1 A;  2HPT A;  4FF1 A;  3FTZ A;  3Q24 A;  4Q4I A;  4ZX3 A;  3Q44 A;  1Q0H A;  1Q0L A;  4AKG A;  1K8T A;  4ZQE A;  4K5L A;  2VLA A;  2XPY A;  4QIC A;  5DUL A;  4ZQH A;  5HNF A;  3FUM A;  4ZQF A;  3RAS A;  4R5V A;  3C3L A;  4XMV A;  3ZHX A;  2R72 A;  3KML A;  3VKH A;  3B2P A;  4ZX4 A;  4XNB A;  3AUA A;  4AR1 A;  3B34 A;  2Y1G A;  1MW2 A;  4NQW A;  3WQQ A;  2XPZ A;  4BKX A;  2EC5 A;  3FTU A;  5HNH A;  4RSY A;  2B61 A;  5JC1 A;  4KSA A;  3AU8 A;  3JT1 A;  3EBH A;  2EBF X;  2JD0 A;  4AKI A;  1ZS2 A;  4AIC A;  3FH5 A;  2HPO A;  4XMT A;  3CZE A;  4XO4 A;  3UER A;  1Y0V A;  3FUK A;  1XFY A;  4K5O A;  1K93 A;  4XN5 A;  4OOE A;  4PW4 A;  2JV7 A;  2LFW A;  4Y6R A;  5JMW A;  2MAO A;  1MVY A;  1XFX A;  1MW1 A;  2QVW A;  1T1R A;  4XN2 A;  3B2X A;  4XN4 A;  4KSF A;  4XND A;  4XMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...