1SC5A

Sigma-28(flia)/flgm complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
232
structure length
228
Chain Sequence
KNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords RNA polymerase sigma factor FliA
total genus 82
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sc5A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1sc5A02
1G5AA 2Y1FA 4FLQA 4G97A 3CZGA 4QICA 3UCQA 2O7GA 1H3LA 1T1RA 1K5HA 4ZN6A 1MW1A 3ZHZA 2Y1EA 5JBIA 1MW0A 2EGHA 3A14A 2Y1GA 1ONNA 4ZQGA 1ZS2A 3AUAA 4AYSA 4ZQHA 4FLOA 1MVYA 4Y6PA 4KP7A 1ONOA 1JGIA 4LUPA 3UEQA 4CXFA 1T1SA 5JMPA 4FLSA 4Y6SA 1MW2A 2JCVA 2JD0A 3ANNA 2Y1CA 2LFWA 3A06A 2C82A 3RASA 2Y1DA 4Y67A 4ZQFA 3AU9A 2WPGA 3WQRA 1R0KA 3CZKA 4FLRA 1RP3A 3WQQA 3N0RA 4Y6RA 1ONPA 3WQSB 3IIEA 5JAZA 3ZHYA 3ZI0A 1Q0LA 5JNLA 3CZEA 1Q0QA 2MAPA 3AU8A 1OR7A 3ZHXA 2JCXA 1R0LA 5DULA 5JC1A 2JD2A 4AICA 1S46A 1Q0HA 4OOFA 5JO0A 1JVSA 1MW3A 1SC5A 1JG9A 3CZLA 3R0IA 4GAEA 5JMWA 2MAOA 4OOEA 3T0YA 2JCYA 4NQWA 4A03A 4RCVA 3ANMA 4ZQEA 3UERA 3ANLA 2JD1A
chains in the Genus database with same CATH superfamily
5HLTA 4XNDA 4Q5CA 4FF2A 2FFLA 4XNBA 3Q22A 4XNAA 4XO5A 4JNDA 4XN7A 5M4NA 2QVWA 1T1RA 3PUUA 4ZW3A 2A7OA 4ZQTA 3FHEA 3SXQA 3BNFA 3BNJA 2C0UA 3FU0A 2Q8HA 1S26A 3LG1A 5AENA 3B7TA 1ONNA 3FUJA 1FS8A 4AI6A 2OEVA 4ZQHA 3SF6A 4FLOA 3VVMA 1XFXA 2J7AA 1BUCA 4KP7A 4XMTA 1XFZA 4MS6A 2BU5A 2R0NA 2YYGA 2XPZA 4BKXA 1FS9A 1PK0A 4E02A 5K3HA 3M9VA 3UEQA 3X0XA 5EV7A 4FLSA 3GQTA 1XFUA 4AKHA 1MW2A 2JCVA 4XN4A 3TZ0A 4R5XA 4XMXA 3CHOA 3RASA 2YYKA 4QHPA 3AU9A 2Q8IA 1XFVA 2C12A 3CRKA 3KMLA 2IX6A 3TZ5A 4ZW8A 2IX5A 3WQQA 1RJ4A 2F6LA 2XQRB 3FUNA 1R3BA 3IIEA 4XMWA 3ZI0A 1Q0LA 4O5MA 4E00A 2ZKJA 5HNHA 3EBIA 1OAHA 1Q0QA 2MAPA 4WJYA 3FULA 2PNRA 2PGGA 4HKSA 4OO2A 4AICA 1SIRA 1S46A 2XS8A 5JO0A 1SQMA 3VADA 3NF4A 3R0IA 4GAEA 1RJ1A 2CJ8A 2MAOA 3AFFA 4MP7A 2VJ8A 4A03A 4AKIA 5J6AA 3U9WA 3UBRA 4ZYJA 4J1VA 4W9UA 3MDEA 3UERA 3ANLA 2GTQA 2PUSA 4JIOA 3GM6A 2XS1A 4PU2A 2DQMA 4XN5A 3C46A 4H7QA 2FP1A 4Q17A 3UCQA 3D9FA 4XO3A 4FZ4A 1H3LA 3FH8A 3SWOA 2BU7A 3FUFA 1K5HA 3TZ2A 4ZX5A 4KTOA 3FU5A 4GAAA 3GNCA 3D9DA 5JBIA 1MW0A 3FTSA 3P4TA 3FTXA 4ZX6A 1X91A 2GBBA 2B61A 5BRKA 4ZQGA 1K8TA 3EONA 4N5FA 2C5ZA 1X3WA 4Q0TA 4R7LA 4JIZA 1MVYA 3F29A 5BRMA 2CJ7A 5M4MA 2E81A 1JGIA 3II9A 2VF1A 1K90A 5K3JA 3B7SA 1K93A 2BU2A 4KSAA 3CHPA 4KCFA 3FU3A 3D1IA 4XVXA 4XN2A 3VKHA 2Y1CA 1WS9A 2DQ6A 4R5TA 4LQSB 2C82A 3Q24A 2Y1DA 4NXLA 4Y67A 2OEXA 3KEDA 3Q43A 4RSYA 3BNHA 3CXBA 2JIFA 2YYIA 3CZKA 4L3ZA 2R02A 4XN1A 4Q1OA 4FLRA 1T9GA 4Y6RA 3ZHYA 3FTYA 2OJQA 4MPNA 3B7UX 5JNLA 2VIGA 1Y8OA 1X8ZA 3RKHA 4MPEA 2WZGA 1OR7A 4L38A 2JCXA 3T8VA 3CIAA 1HS6A 1PI1A 3FCJA 2R72A 2JD2A 3OWAA 2ZAFA 4V26A 4LQQB 3LGQA 3VVLA 2EBAA 4OOFA 1H19A 4QIRA 1MW3A 1IVHA 2VR0A 1JG9A 4X28C 3FH5A 2ZDYA 5JMWA 1GKXA 3T0YA 3TZ4A 2JCYA 4NQWA 3OIBA 2VLAA 5M4KA 2WBIA 3ANMA 2AZEA 4K5OA 4R5VA 4FF3A 1SK6A 3FO3A 1G5AA 2Y1FA 1Y0VA 4G97A 3CZGA 2YGWA 3D9EA 4XN8A 1GU6A 3BNGA 5GJWE 3FUKA 2EBHX 2O7GA 1R2JA 3B96A 3FUIA 2Q8GA 4PW4A 1SIQA 4PVBA 2RF7A 4ZN6A 4RM7A 1MW1A 5M4PA 3ZHZA 2Y1EA 4K5MA 4XN9A 3TTBA 3B34A 2E80A 2Y1GA 1ZS2A 4DOYA 4K5NA 3QJXA 4Y6PA 3AFEA 4M9AA 2Q8FA 4E01A 3SCEA 2R59A 2JBRA 4LUPA 4Q5BA 4X2UA 4CXFA 1T1SA 2HPTA 1Y8PA 3TORA 4Y6SA 4AR9A 2JD0A 2A1TA 2OT4A 4Q4IA 4V25A 3B37A 3PFDA 5DYFA 3B2XA 2JBSA 4AR1A 1GKZA 2PO4A 5K3GA 2WPGA 3WQRA 1R0KA 1XG2B 4L3YA 3CHQA 3FTVA 3FTUA 2FP2A 1GW6A 5DLLA 2D29A 4K5PA 3RC3A 3WQSB 4RVBA 5JAZA 4XO4A 4K5LA 3MPIA 4MP2A 5K3IA 2JV7A 3FUEA 4Q4EA 3X29A 2ZXGA 1LVCA 3ZHXA 2EC5A 3FTWA 1R0LA 2ZDXA 1RX0A 5GJVE 3RC8A 3MXLA 3EBGA 4IRNA 2PG0A 4HR3A 4DZYA 1UDYA 3B2PA 3MPJA 1JVSA 2ZO5A 2PL5A 3D9GA 3CZLA 3S7WA 3JT1A 3CHSA 3MKHA 4OOEA 4RCVA 1QDBA 3VKGA 3EOMA 2Z1QA 3FTZA 2CJ6A 4ZQEA 4Q4UA 2XPYA 4QUOA 2R0MA 1JQIA 2CX9A 3MMOA 4FLQA 1FS7A 4AR8A 4QICA 2BTZA 3CRLA 5B5VA 2WZFA 3D6BA 4J3BA 4L2LA 4HKRA 2DVLA 2QJ1A 4FF4A 3EBHA 3JSZA 1JM6A 4F0XA 4P79A 2EGHA 4ZW5A 4XMUA 1X3ZA 3A14A 4KSFA 1EGCA 3HW2A 4XMZA 3AUAA 4AYSA 2CJ4A 1EGEA 3FUDA 2RJIA 4DPRA 3MDDA 2EBFX 2UXWA 2HPOA 4KS9A 1ONOA 4AKGA 2E0AA 1XFWA 2R70A 4QPEA 5JMPA 3B3BA 1EGDA 3B7RL 2REHA 2YYJA 2XQ0A 3ANNA 2BU8A 4FF1A 1X90A 4H81A 4U83A 3Q44A 5B5WA 4ZW6A 2R05A 4JEKA 2RDZA 2LFWA 3A06A 3X0YA 4P13A 4FCAA 5FWQA 4G5EA 2YYMA 4L1FA 4ZQFA 3R7KA 4L3XA 1W07A 3FH7A 2FONA 3CHRA 4ARFA 2OR0A 1RP3A 3N0RA 1UKWA 1ONPA 1U8VA 4ZW7A 3FUHA 4IV6A 3D2RA 3C3LA 3C2PA 3CZEA 4ZXVA 4MKTA 1XFYA 3AU8A 4H85A 5J71A 2JBTA 5BPPA 4MPCA 2CJ5A 5DULA 5JC1A 2HJNA 4X28A 2RFQA 1GJVA 3Q23A 1Q0HA 2AO2A 2DDHA 1IS2A 2YYLA 4QMEA 2R03A 1SC5A 5HNFA 1Y8NA 4XMVA 4ZX4A 3OWMA 5B6BA 3L1TA 3CE2A 3UU9A 3HWCA 3FUMA 2BU6A 3FU6A 4ZX3A 3Q0AA 2QR4A 2JD1A 1SG7A
chains in the Genus database with same CATH topology
5HLTA 4PU2A 1G5AA 2DQMA 2Y1FA 4XN5A 4XNDA 3C46A 4FF2A 4FLQA 2FFLA 4XNBA 1Y0VA 4G97A 3CZGA 2YGWA 4AR8A 4QICA 2FP1A 4XN8A 5GJWE 3Q22A 3UCQA 3FUKA 4XNAA 2EBHX 4XO5A 4JNDA 4XO3A 3C3LA 2O7GA 4FZ4A 4XN7A 1H3LA 2WZFA 3FH8A 2QVWA 1T1RA 4J3BA 3FUIA 4L2LA 3FUFA 4PW4A 1K5HA 3PUUA 4PVBA 2A7OA 4ZW3A 4ZN6A 4ZQTA 1MW1A 2QJ1A 3FHEA 4ZX5A 3FU5A 4HKRA 4GAAA 3ZHZA 4FF4A 2Y1EA 5JBIA 3EBHA 3JSZA 1MW0A 4K5MA 4XN9A 4F0XA 3FTSA 3FU0A 2EGHA 3FTXA 4ZW5A 4XMUA 4P79A 1S26A 3B34A 4ZX6A 5AENA 1X3ZA 3A14A 2GBBA 2B61A 2Y1GA 4KSFA 3B7TA 1ONNA 4XMZA 4ZQGA 3FUJA 1K8TA 1ZS2A 4AI6A 2C5ZA 1X3WA 3AUAA 4AYSA 4R7LA 4K5NA 4ZQHA 4FLOA 3QJXA 3VVMA 1XFXA 1MVYA 3FUDA 2RJIA 4KP7A 4Y6PA 4DPRA 4MS6A 4XMTA 1XFZA 2EBFX 2HPOA 4KS9A 1ONOA 1JGIA 2XPZA 4BKXA 1PK0A 4AKGA 2R59A 4LUPA 3C2PA 1XFWA 2VF1A 4X2UA 2R70A 4QPEA 1T1SA 5EV7A 3B3BA 5JMPA 3UEQA 4FLSA 2HPTA 4CXFA 1K90A 1XFUA 4AKHA 3B7RL 4Y6SA 3B7SA 1MW2A 2JCVA 4AR9A 1K93A 4KSAA 3CHPA 2XQ0A 4XN4A 2JD0A 3ANNA 3FU3A 4FF1A 4XN2A 3VKHA 2Y1CA 3Q44A 4R5XA 4Q4IA 4ZW6A 3B37A 4XMXA 2DQ6A 4R5TA 3A06A 2LFWA 5DYFA 2C82A 3Q24A 3B2XA 2Y1DA 3CHOA 4FCAA 4Y67A 5FWQA 3RASA 4AR1A 3KEDA 3Q43A 4RSYA 4QHPA 4ZQFA 2PO4A 3AU9A 2WPGA 1XFVA 3WQRA 1R0KA 3CZKA 3CHQA 3FH7A 4XN1A 3FTVA 3FTUA 3KMLA 3CHRA 4FLRA 4ZW8A 4ARFA 1RP3A 3WQQA 3N0RA 4Y6RA 2F6LA 2FP2A 1GW6A 1ONPA 5DLLA 3FUNA 4K5PA 3RC3A 3WQSB 4ZW7A 4RVBA 3FUHA 3IIEA 5JAZA 3ZHYA 4XMWA 3FTYA 4K5LA 4XO4A 3B7UX 1Q0LA 3ZI0A 5JNLA 2JV7A 3FUEA 4Q4EA 3X29A 3CZEA 5HNHA 2ZXGA 1LVCA 3EBIA 4MKTA 1Q0QA 2WZGA 2MAPA 3AU8A 1OR7A 1XFYA 3ZHXA 5BPPA 2JCXA 3T8VA 3CIAA 3FTWA 3FULA 1R0LA 2EC5A 5DULA 1HS6A 2PGGA 5JC1A 5GJVE 3RC8A 4HKSA 2R72A 2JD2A 3EBGA 4AICA 3Q23A 1S46A 1Q0HA 3VVLA 2AO2A 4OOFA 1H19A 3B2PA 5JO0A 1JVSA 4QIRA 1MW3A 1SQMA 4QMEA 1SC5A 1JG9A 2PL5A 5HNFA 3CZLA 3FH5A 3R0IA 4XMVA 4GAEA 3JT1A 4ZX4A 3CHSA 2MAOA 4OOEA 3T0YA 2VJ8A 5JMWA 2JCYA 4NQWA 4A03A 2VLAA 3CE2A 4RCVA 3VKGA 3FUMA 4AKIA 3FTZA 3FU6A 3ANMA 3U9WA 4ZX3A 2AZEA 4K5OA 4R5VA 2QR4A 3Q0AA 4ZQEA 3UERA 3ANLA 2JD1A 2GTQA 1SK6A 2PUSA 2XPYA 4FF3A 4QUOA 1SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5A A;  2Y1F A;  4FLQ A;  4G97 A;  3CZG A;  4QIC A;  3UCQ A;  2O7G A;  1H3L A;  1T1R A;  1K5H A;  4ZN6 A;  1MW1 A;  3ZHZ A;  2Y1E A;  5JBI A;  1MW0 A;  2EGH A;  3A14 A;  2Y1G A;  1ONN A;  4ZQG A;  1ZS2 A;  3AUA A;  4AYS A;  4ZQH A;  4FLO A;  1MVY A;  4Y6P A;  4KP7 A;  1ONO A;  1JGI A;  4LUP A;  3UEQ A;  4CXF A;  1T1S A;  5JMP A;  4FLS A;  4Y6S A;  1MW2 A;  2JCV A;  2JD0 A;  3ANN A;  2Y1C A;  2LFW A;  3A06 A;  2C82 A;  3RAS A;  2Y1D A;  4Y67 A;  4ZQF A;  3AU9 A;  2WPG A;  3WQR A;  1R0K A;  3CZK A;  4FLR A;  1RP3 A;  3WQQ A;  3N0R A;  4Y6R A;  1ONP A;  3WQS B;  3IIE A;  5JAZ A;  3ZHY A;  3ZI0 A;  1Q0L A;  5JNL A;  3CZE A;  1Q0Q A;  2MAP A;  3AU8 A;  1OR7 A;  3ZHX A;  2JCX A;  1R0L A;  5DUL A;  5JC1 A;  2JD2 A;  4AIC A;  1S46 A;  1Q0H A;  4OOF A;  5JO0 A;  1JVS A;  1MW3 A;  1SC5 A;  1JG9 A;  3CZL A;  3R0I A;  4GAE A;  5JMW A;  2MAO A;  4OOE A;  3T0Y A;  2JCY A;  4NQW A;  4A03 A;  4RCV A;  3ANM A;  4ZQE A;  3UER A;  3ANL A;  2JD1 A; 
#chains in the Genus database with same CATH topology
 5HLT A;  4XND A;  4Q5C A;  4FF2 A;  2FFL A;  4XNB A;  3Q22 A;  4XNA A;  4XO5 A;  4JND A;  4XN7 A;  5M4N A;  2QVW A;  1T1R A;  3PUU A;  4ZW3 A;  2A7O A;  4ZQT A;  3FHE A;  3SXQ A;  3BNF A;  3BNJ A;  2C0U A;  3FU0 A;  2Q8H A;  1S26 A;  3LG1 A;  5AEN A;  3B7T A;  1ONN A;  3FUJ A;  1FS8 A;  4AI6 A;  2OEV A;  4ZQH A;  3SF6 A;  4FLO A;  3VVM A;  1XFX A;  2J7A A;  1BUC A;  4KP7 A;  4XMT A;  1XFZ A;  4MS6 A;  2BU5 A;  2R0N A;  2YYG A;  2XPZ A;  4BKX A;  1FS9 A;  1PK0 A;  4E02 A;  5K3H A;  3M9V A;  3UEQ A;  3X0X A;  5EV7 A;  4FLS A;  3GQT A;  1XFU A;  4AKH A;  1MW2 A;  2JCV A;  4XN4 A;  3TZ0 A;  4R5X A;  4XMX A;  3CHO A;  3RAS A;  2YYK A;  4QHP A;  3AU9 A;  2Q8I A;  1XFV A;  2C12 A;  3CRK A;  3KML A;  2IX6 A;  3TZ5 A;  4ZW8 A;  2IX5 A;  3WQQ A;  1RJ4 A;  2F6L A;  2XQR B;  3FUN A;  1R3B A;  3IIE A;  4XMW A;  3ZI0 A;  1Q0L A;  4O5M A;  4E00 A;  2ZKJ A;  5HNH A;  3EBI A;  1OAH A;  1Q0Q A;  2MAP A;  4WJY A;  3FUL A;  2PNR A;  2PGG A;  4HKS A;  4OO2 A;  4AIC A;  1SIR A;  1S46 A;  2XS8 A;  5JO0 A;  1SQM A;  3VAD A;  3NF4 A;  3R0I A;  4GAE A;  1RJ1 A;  2CJ8 A;  2MAO A;  3AFF A;  4MP7 A;  2VJ8 A;  4A03 A;  4AKI A;  5J6A A;  3U9W A;  3UBR A;  4ZYJ A;  4J1V A;  4W9U A;  3MDE A;  3UER A;  3ANL A;  2GTQ A;  2PUS A;  4JIO A;  3GM6 A;  2XS1 A;  4PU2 A;  2DQM A;  4XN5 A;  3C46 A;  4H7Q A;  2FP1 A;  4Q17 A;  3UCQ A;  3D9F A;  4XO3 A;  4FZ4 A;  1H3L A;  3FH8 A;  3SWO A;  2BU7 A;  3FUF A;  1K5H A;  3TZ2 A;  4ZX5 A;  4KTO A;  3FU5 A;  4GAA A;  3GNC A;  3D9D A;  5JBI A;  1MW0 A;  3FTS A;  3P4T A;  3FTX A;  4ZX6 A;  1X91 A;  2GBB A;  2B61 A;  5BRK A;  4ZQG A;  1K8T A;  3EON A;  4N5F A;  2C5Z A;  1X3W A;  4Q0T A;  4R7L A;  4JIZ A;  1MVY A;  3F29 A;  5BRM A;  2CJ7 A;  5M4M A;  2E81 A;  1JGI A;  3II9 A;  2VF1 A;  1K90 A;  5K3J A;  3B7S A;  1K93 A;  2BU2 A;  4KSA A;  3CHP A;  4KCF A;  3FU3 A;  3D1I A;  4XVX A;  4XN2 A;  3VKH A;  2Y1C A;  1WS9 A;  2DQ6 A;  4R5T A;  4LQS B;  2C82 A;  3Q24 A;  2Y1D A;  4NXL A;  4Y67 A;  2OEX A;  3KED A;  3Q43 A;  4RSY A;  3BNH A;  3CXB A;  2JIF A;  2YYI A;  3CZK A;  4L3Z A;  2R02 A;  4XN1 A;  4Q1O A;  4FLR A;  1T9G A;  4Y6R A;  3ZHY A;  3FTY A;  2OJQ A;  4MPN A;  3B7U X;  5JNL A;  2VIG A;  1Y8O A;  1X8Z A;  3RKH A;  4MPE A;  2WZG A;  1OR7 A;  4L38 A;  2JCX A;  3T8V A;  3CIA A;  1HS6 A;  1PI1 A;  3FCJ A;  2R72 A;  2JD2 A;  3OWA A;  2ZAF A;  4V26 A;  4LQQ B;  3LGQ A;  3VVL A;  2EBA A;  4OOF A;  1H19 A;  4QIR A;  1MW3 A;  1IVH A;  2VR0 A;  1JG9 A;  4X28 C;  3FH5 A;  2ZDY A;  5JMW A;  1GKX A;  3T0Y A;  3TZ4 A;  2JCY A;  4NQW A;  3OIB A;  2VLA A;  5M4K A;  2WBI A;  3ANM A;  2AZE A;  4K5O A;  4R5V A;  4FF3 A;  1SK6 A;  3FO3 A;  1G5A A;  2Y1F A;  1Y0V A;  4G97 A;  3CZG A;  2YGW A;  3D9E A;  4XN8 A;  1GU6 A;  3BNG A;  5GJW E;  3FUK A;  2EBH X;  2O7G A;  1R2J A;  3B96 A;  3FUI A;  2Q8G A;  4PW4 A;  1SIQ A;  4PVB A;  2RF7 A;  4ZN6 A;  4RM7 A;  1MW1 A;  5M4P A;  3ZHZ A;  2Y1E A;  4K5M A;  4XN9 A;  3TTB A;  3B34 A;  2E80 A;  2Y1G A;  1ZS2 A;  4DOY A;  4K5N A;  3QJX A;  4Y6P A;  3AFE A;  4M9A A;  2Q8F A;  4E01 A;  3SCE A;  2R59 A;  2JBR A;  4LUP A;  4Q5B A;  4X2U A;  4CXF A;  1T1S A;  2HPT A;  1Y8P A;  3TOR A;  4Y6S A;  4AR9 A;  2JD0 A;  2A1T A;  2OT4 A;  4Q4I A;  4V25 A;  3B37 A;  3PFD A;  5DYF A;  3B2X A;  2JBS A;  4AR1 A;  1GKZ A;  2PO4 A;  5K3G A;  2WPG A;  3WQR A;  1R0K A;  1XG2 B;  4L3Y A;  3CHQ A;  3FTV A;  3FTU A;  2FP2 A;  1GW6 A;  5DLL A;  2D29 A;  4K5P A;  3RC3 A;  3WQS B;  4RVB A;  5JAZ A;  4XO4 A;  4K5L A;  3MPI A;  4MP2 A;  5K3I A;  2JV7 A;  3FUE A;  4Q4E A;  3X29 A;  2ZXG A;  1LVC A;  3ZHX A;  2EC5 A;  3FTW A;  1R0L A;  2ZDX A;  1RX0 A;  5GJV E;  3RC8 A;  3MXL A;  3EBG A;  4IRN A;  2PG0 A;  4HR3 A;  4DZY A;  1UDY A;  3B2P A;  3MPJ A;  1JVS A;  2ZO5 A;  2PL5 A;  3D9G A;  3CZL A;  3S7W A;  3JT1 A;  3CHS A;  3MKH A;  4OOE A;  4RCV A;  1QDB A;  3VKG A;  3EOM A;  2Z1Q A;  3FTZ A;  2CJ6 A;  4ZQE A;  4Q4U A;  2XPY A;  4QUO A;  2R0M A;  1JQI A;  2CX9 A;  3MMO A;  4FLQ A;  1FS7 A;  4AR8 A;  4QIC A;  2BTZ A;  3CRL A;  5B5V A;  2WZF A;  3D6B A;  4J3B A;  4L2L A;  4HKR A;  2DVL A;  2QJ1 A;  4FF4 A;  3EBH A;  3JSZ A;  1JM6 A;  4F0X A;  4P79 A;  2EGH A;  4ZW5 A;  4XMU A;  1X3Z A;  3A14 A;  4KSF A;  1EGC A;  3HW2 A;  4XMZ A;  3AUA A;  4AYS A;  2CJ4 A;  1EGE A;  3FUD A;  2RJI A;  4DPR A;  3MDD A;  2EBF X;  2UXW A;  2HPO A;  4KS9 A;  1ONO A;  4AKG A;  2E0A A;  1XFW A;  2R70 A;  4QPE A;  5JMP A;  3B3B A;  1EGD A;  3B7R L;  2REH A;  2YYJ A;  2XQ0 A;  3ANN A;  2BU8 A;  4FF1 A;  1X90 A;  4H81 A;  4U83 A;  3Q44 A;  5B5W A;  4ZW6 A;  2R05 A;  4JEK A;  2RDZ A;  2LFW A;  3A06 A;  3X0Y A;  4P13 A;  4FCA A;  5FWQ A;  4G5E A;  2YYM A;  4L1F A;  4ZQF A;  3R7K A;  4L3X A;  1W07 A;  3FH7 A;  2FON A;  3CHR A;  4ARF A;  2OR0 A;  1RP3 A;  3N0R A;  1UKW A;  1ONP A;  1U8V A;  4ZW7 A;  3FUH A;  4IV6 A;  3D2R A;  3C3L A;  3C2P A;  3CZE A;  4ZXV A;  4MKT A;  1XFY A;  3AU8 A;  4H85 A;  5J71 A;  2JBT A;  5BPP A;  4MPC A;  2CJ5 A;  5DUL A;  5JC1 A;  2HJN A;  4X28 A;  2RFQ A;  1GJV A;  3Q23 A;  1Q0H A;  2AO2 A;  2DDH A;  1IS2 A;  2YYL A;  4QME A;  2R03 A;  1SC5 A;  5HNF A;  1Y8N A;  4XMV A;  4ZX4 A;  3OWM A;  5B6B A;  3L1T A;  3CE2 A;  3UU9 A;  3HWC A;  3FUM A;  2BU6 A;  3FU6 A;  4ZX3 A;  3Q0A A;  2QR4 A;  2JD1 A;  1SG7 A; 
#chains in the Genus database with same CATH homology
 5HLT A;  4PU2 A;  1G5A A;  2DQM A;  2Y1F A;  4XN5 A;  4XND A;  3C46 A;  4FF2 A;  4FLQ A;  2FFL A;  4XNB A;  1Y0V A;  4G97 A;  3CZG A;  2YGW A;  4AR8 A;  4QIC A;  2FP1 A;  4XN8 A;  5GJW E;  3Q22 A;  3UCQ A;  3FUK A;  4XNA A;  2EBH X;  4XO5 A;  4JND A;  4XO3 A;  3C3L A;  2O7G A;  4FZ4 A;  4XN7 A;  1H3L A;  2WZF A;  3FH8 A;  2QVW A;  1T1R A;  4J3B A;  3FUI A;  4L2L A;  3FUF A;  4PW4 A;  1K5H A;  3PUU A;  4PVB A;  2A7O A;  4ZW3 A;  4ZN6 A;  4ZQT A;  1MW1 A;  2QJ1 A;  3FHE A;  4ZX5 A;  3FU5 A;  4HKR A;  4GAA A;  3ZHZ A;  4FF4 A;  2Y1E A;  5JBI A;  3EBH A;  3JSZ A;  1MW0 A;  4K5M A;  4XN9 A;  4F0X A;  3FTS A;  3FU0 A;  2EGH A;  3FTX A;  4ZW5 A;  4XMU A;  4P79 A;  1S26 A;  3B34 A;  4ZX6 A;  5AEN A;  1X3Z A;  3A14 A;  2GBB A;  2B61 A;  2Y1G A;  4KSF A;  3B7T A;  1ONN A;  4XMZ A;  4ZQG A;  3FUJ A;  1K8T A;  1ZS2 A;  4AI6 A;  2C5Z A;  1X3W A;  3AUA A;  4AYS A;  4R7L A;  4K5N A;  4ZQH A;  4FLO A;  3QJX A;  3VVM A;  1XFX A;  1MVY A;  3FUD A;  2RJI A;  4KP7 A;  4Y6P A;  4DPR A;  4MS6 A;  4XMT A;  1XFZ A;  2EBF X;  2HPO A;  4KS9 A;  1ONO A;  1JGI A;  2XPZ A;  4BKX A;  1PK0 A;  4AKG A;  2R59 A;  4LUP A;  3C2P A;  1XFW A;  2VF1 A;  4X2U A;  2R70 A;  4QPE A;  1T1S A;  5EV7 A;  3B3B A;  5JMP A;  3UEQ A;  4FLS A;  2HPT A;  4CXF A;  1K90 A;  1XFU A;  4AKH A;  3B7R L;  4Y6S A;  3B7S A;  1MW2 A;  2JCV A;  4AR9 A;  1K93 A;  4KSA A;  3CHP A;  2XQ0 A;  4XN4 A;  2JD0 A;  3ANN A;  3FU3 A;  4FF1 A;  4XN2 A;  3VKH A;  2Y1C A;  3Q44 A;  4R5X A;  4Q4I A;  4ZW6 A;  3B37 A;  4XMX A;  2DQ6 A;  4R5T A;  3A06 A;  2LFW A;  5DYF A;  2C82 A;  3Q24 A;  3B2X A;  2Y1D A;  3CHO A;  4FCA A;  4Y67 A;  5FWQ A;  3RAS A;  4AR1 A;  3KED A;  3Q43 A;  4RSY A;  4QHP A;  4ZQF A;  2PO4 A;  3AU9 A;  2WPG A;  1XFV A;  3WQR A;  1R0K A;  3CZK A;  3CHQ A;  3FH7 A;  4XN1 A;  3FTV A;  3FTU A;  3KML A;  3CHR A;  4FLR A;  4ZW8 A;  4ARF A;  1RP3 A;  3WQQ A;  3N0R A;  4Y6R A;  2F6L A;  2FP2 A;  1GW6 A;  1ONP A;  5DLL A;  3FUN A;  4K5P A;  3RC3 A;  3WQS B;  4ZW7 A;  4RVB A;  3FUH A;  3IIE A;  5JAZ A;  3ZHY A;  4XMW A;  3FTY A;  4K5L A;  4XO4 A;  3B7U X;  1Q0L A;  3ZI0 A;  5JNL A;  2JV7 A;  3FUE A;  4Q4E A;  3X29 A;  3CZE A;  5HNH A;  2ZXG A;  1LVC A;  3EBI A;  4MKT A;  1Q0Q A;  2WZG A;  2MAP A;  3AU8 A;  1OR7 A;  1XFY A;  3ZHX A;  5BPP A;  2JCX A;  3T8V A;  3CIA A;  3FTW A;  3FUL A;  1R0L A;  2EC5 A;  5DUL A;  1HS6 A;  2PGG A;  5JC1 A;  5GJV E;  3RC8 A;  4HKS A;  2R72 A;  2JD2 A;  3EBG A;  4AIC A;  3Q23 A;  1S46 A;  1Q0H A;  3VVL A;  2AO2 A;  4OOF A;  1H19 A;  3B2P A;  5JO0 A;  1JVS A;  4QIR A;  1MW3 A;  1SQM A;  4QME A;  1SC5 A;  1JG9 A;  2PL5 A;  5HNF A;  3CZL A;  3FH5 A;  3R0I A;  4XMV A;  4GAE A;  3JT1 A;  4ZX4 A;  3CHS A;  2MAO A;  4OOE A;  3T0Y A;  2VJ8 A;  5JMW A;  2JCY A;  4NQW A;  4A03 A;  2VLA A;  3CE2 A;  4RCV A;  3VKG A;  3FUM A;  4AKI A;  3FTZ A;  3FU6 A;  3ANM A;  3U9W A;  4ZX3 A;  2AZE A;  4K5O A;  4R5V A;  2QR4 A;  3Q0A A;  4ZQE A;  3UER A;  3ANL A;  2JD1 A;  2GTQ A;  1SK6 A;  2PUS A;  2XPY A;  4FF3 A;  4QUO A;  1SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...