1SC5A

Sigma-28(flia)/flgm complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
232
structure length
228
Chain Sequence
KNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor FliA
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 82
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sc5A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1sc5A02
4Y6SA 4ZQGA 5JNLA 2Y1GA 4LUPA 3WQQA 3R0IA 3UERA 1H3LA 4G97A 3CZGA 4ZQEA 1ONNA 1RP3A 3AU9A 1R0KA 3RASA 4A03A 1ONOA 2Y1DA 5JC1A 3CZLA 4FLOA 1MW3A 1JG9A 5DULA 3ANNA 3UCQA 4RCVA 2JD2A 1S46A 3A06A 2JCYA 2Y1EA 2WPGA 4FLQA 3ZHZA 3ANMA 3ANLA 3AU8A 5JMPA 1JGIA 4KP7A 1MW2A 1Q0QA 4NQWA 1ONPA 4GAEA 1Q0HA 1K5HA 4Y6PA 3UEQA 3CZKA 4OOEA 2MAOA 2JCXA 5JMWA 1MW0A 4AYSA 5JAZA 2LFWA 2JCVA 3N0RA 1T1RA 3ZHXA 3ZI0A 1MW1A 3A14A 3ZHYA 4Y6RA 3AUAA 4ZQFA 4AICA 1Q0LA 3T0YA 1R0LA 4FLRA 1SC5A 1JVSA 4FLSA 2JD0A 3CZEA 1MVYA 1ZS2A 1G5AA 2MAPA 2JD1A 4CXFA 2C82A 1OR7A 2EGHA 4OOFA 3IIEA 4ZQHA 3WQSB 5JBIA 4QICA 3WQRA 4ZN6A 2O7GA 1T1SA 4Y67A 5JO0A 2Y1FA 2Y1CA
chains in the Genus database with same CATH superfamily
4Y6SA 4ZQGA 2QR4A 2VJ8A 3TTBA 3CRKA 2JV7A 3FUFA 2EBHX 3CE2A 4DPRA 1XFVA 4G97A 3SCEA 2CJ5A 2YYGA 4AR8A 1H19A 3TZ4A 3VADA 2Q8HA 2REHA 3D6BA 1RP3A 4FF1A 3CXBA 2IX5A 4K5NA 1R3BA 2ZDYA 4A03A 2Y1DA 5JC1A 3D9DA 3CZLA 4ZW6A 4XN8A 1MW3A 4XVXA 4ZYJA 2OEVA 2E81A 3UCQA 4MP7A 1S46A 3A06A 2PG0A 5M4PA 1XFYA 4AKIA 2JIFA 4RM7A 3ANLA 3B7SA 3B2XA 4QIRA 3FUEA 3PUUA 3HWCA 2F6LA 3D9FA 1Y8NA 2ZAFA 4AR9A 3OIBA 4XMUA 4XMZA 3B37A 2R05A 4AYSA 4ZX6A 5JAZA 1Y0VA 3FH7A 1JM6A 4IV6A 4FF2A 4JIZA 1XFXA 4HKRA 3A14A 1UKWA 3TZ0A 2BU8A 5GJWE 3AUAA 3CHOA 1RJ1A 3T0YA 2XQ0A 1X8ZA 4FLRA 5HNFA 4R7LA 2JD0A 4AKGA 5DYFA 2MAPA 2EBFX 4CXFA 2A7OA 2DQMA 3Q44A 5K3IA 4H7QA 3B7TA 4FZ4A 3FULA 4X28A 4Q4EA 3WQSB 3CIAA 2HJNA 4QICA 4WJYA 5M4NA 4R5VA 3F29A 4MPNA 4ZX4A 2Y1FA 4PVBA 2Y1CA 4XN1A 4JIOA 1WS9A 3Q22A 3FU3A 3FO3A 2Y1GA 5HLTA 3Q0AA 2DVLA 1SG7A 1H3LA 4E02A 3Q23A 3BNFA 2IX6A 1K93A 2YGWA 1RJ4A 1ONNA 3FUDA 3FUHA 2YYIA 5K3GA 3RKHA 2PNRA 4Q4UA 1FS7A 1PI1A 3MPJA 3AFEA 4MPEA 4XNBA 4XMVA 1K90A 2QVWA 2ZDXA 5DULA 4V26A 4JNDA 3LGQA 2JD2A 3RC8A 2RF7A 4XN4A 3D2RA 2Q8GA 2JBRA 5EV7A 4K5OA 3ANMA 1LVCA 3GQTA 5M4KA 2C0UA 3FTXA 4HKSA 1JGIA 3VVMA 5M4MA 2EBAA 3FTUA 3EOMA 2CJ6A 3GM6A 1X3WA 3OWAA 3SF6A 4NQWA 2GBBA 4Y6PA 4Q1OA 4NXLA 3UEQA 3FTVA 4XN7A 3FUNA 4ZW8A 3CHSA 4DZYA 4OOEA 2MAOA 2DQ6A 3VKGA 1MW0A 3MKHA 2LFWA 3N0RA 3B34A 3EONA 3RC3A 2YYLA 3TZ5A 3MXLA 2JBSA 2XPYA 3B7RL 3L1TA 3FHEA 5GJVE 4E01A 4Y6RA 1RX0A 2R70A 2HPTA 3FTWA 3MPIA 4AICA 3VVLA 4XN5A 4AI6A 2OEXA 1Q0LA 1XG2B 4XNAA 2FP2A 1JVSA 1GU6A 4X2UA 3S7WA 4HR3A 2R59A 3JSZA 3CZEA 3B2PA 1XFWA 3BNHA 4AKHA 1MVYA 4L2LA 2CJ4A 2YYJA 2CJ7A 2C82A 1UDYA 2YYMA 1EGDA 3TZ2A 4MS6A 3MDEA 3WQRA 5JO0A 2BTZA 2ZKJA 3FUJA 4J1VA 1SIRA 4LUPA 1XFZA 3R0IA 3UERA 4ZXVA 2Q8FA 2VR0A 1IVHA 4XO3A 4MKTA 2R72A 2ZO5A 1GW6A 2XPZA 4RVBA 2CJ8A 1ONOA 2R03A 4QHPA 2YYKA 4FLOA 3Q43A 2B61A 4L38A 4LQSB 3NF4A 2RFQA 5J6AA 4J3BA 2Q8IA 5FWQA 2Y1EA 4Q17A 2WPGA 4H85A 3MDDA 4ZW7A 3ZHZA 4FF3A 2J7AA 1X91A 3AU8A 4FF4A 4E00A 5JMPA 4ZX5A 1EGCA 1Y8OA 2E80A 4KP7A 1MW2A 4K5LA 4X28C 3FTSA 1XFUA 1ONPA 2BU7A 4QUOA 4MPCA 1K5HA 4LQQB 4MP2A 4K5MA 4PW4A 2VLAA 5K3JA 5JMWA 2UXWA 3PFDA 3ZHXA 3CHQA 1MW1A 4KCFA 4QPEA 1W07A 2BU5A 4W9UA 5AENA 2AO2A 4Q5BA 4N5FA 2FFLA 3KEDA 3ZHYA 2HPOA 2XS1A 5B5VA 1GKXA 1QDBA 3UBRA 4ZQFA 4XN2A 4QMEA 4XO4A 2JBTA 4XO5A 4ZW5A 5HNHA 4ZX3A 1SK6A 1T9GA 2CX9A 4FLSA 2PO4A 3II9A 3SWOA 3FTZA 1G5AA 2R02A 1GJVA 4JEKA 3EBIA 2PL5A 3CHPA 3FUIA 4L3YA 3D9EA 1SIQA 4XMTA 2EGHA 3P4TA 4O5MA 2XQRB 1S26A 4KSAA 3GNCA 4ARFA 1SQMA 3R7KA 4ZN6A 4BKXA 1T1SA 3CRLA 4Y67A 4Q4IA 1X3ZA 3M9VA 4OO2A 2JCXA 5DLLA 3FU0A 3JT1A 5JNLA 3FUKA 5J71A 3WQQA 3X0YA 4R5XA 2C12A 3CZGA 4Q0TA 2VIGA 4ZQEA 1GKZA 2EC5A 4ZW3A 3AU9A 3D9GA 1R0KA 5BRKA 3FUMA 3RASA 2OT4A 2VF1A 1JG9A 3FH8A 4U83A 3ANNA 3EBGA 4XNDA 1Y8PA 4RCVA 5BRMA 2R0MA 2JCYA 2OR0A 2PUSA 3BNGA 4FLQA 4DOYA 3HW2A 2BU6A 2ZXGA 3OWMA 1OAHA 3C46A 1JQIA 3TORA 3UU9A 1FS8A 2E0AA 2Z1QA 1FS9A 3AFFA 3FH5A 4H81A 2OJQA 1Q0QA 2WZFA 4ZQTA 2XS8A 4GAEA 1Q0HA 1PK0A 3FU5A 4P79A 3CZKA 3D1IA 4PU2A 3QJXA 2D29A 3B96A 4R5TA 3X29A 2JCVA 2BU2A 1T1RA 2R0NA 3BNJA 3ZI0A 4P13A 2RDZA 2RJIA 4F0XA 3KMLA 3LG1A 2WBIA 3EBHA 3B3BA 4FCAA 4KSFA 4RSYA 3VKHA 4AR1A 4M9AA 4K5PA 3T8VA 1R2JA 4IRNA 1R0LA 4GAAA 1BUCA 1X90A 4XMXA 3U9WA 1SC5A 3SXQA 2C5ZA 4XN9A 1EGEA 1HS6A 4G5EA 1IS2A 2AZEA 1ZS2A 3C2PA 2FP1A 3CHRA 2JD1A 3FCJA 4V25A 5B5WA 2PGGA 4KS9A 2DDHA 1OR7A 5K3HA 4XMWA 3X0XA 1U8VA 3B7UX 5BPPA 4Q5CA 4L3ZA 2GTQA 3FTYA 4OOFA 2FONA 2A1TA 3C3LA 3IIEA 2QJ1A 4ZQHA 1K8TA 3MMOA 4KTOA 5JBIA 3Q24A 2O7GA 4L3XA 5B6BA 4L1FA 3FU6A 2WZGA
chains in the Genus database with same CATH topology
4Y6SA 4ZQGA 2QR4A 2VJ8A 2JV7A 3FUFA 2EBHX 3CE2A 4DPRA 1XFVA 4G97A 4AR8A 1H19A 4FF1A 1RP3A 4K5NA 4A03A 2Y1DA 5JC1A 3CZLA 4ZW6A 4XN8A 1MW3A 3UCQA 1S46A 3A06A 1XFYA 4AKIA 3ANLA 3B7SA 3B2XA 4QIRA 3FUEA 3PUUA 2F6LA 4AR9A 4XMUA 4XMZA 3B37A 4AYSA 4ZX6A 5JAZA 1Y0VA 3FH7A 4FF2A 1XFXA 4HKRA 3A14A 5GJWE 3AUAA 3CHOA 3T0YA 2XQ0A 4FLRA 5HNFA 4R7LA 2JD0A 4AKGA 5DYFA 2MAPA 2EBFX 4CXFA 2A7OA 2DQMA 3Q44A 3B7TA 4FZ4A 3FULA 4Q4EA 3WQSB 3CIAA 4QICA 4R5VA 4ZX4A 2Y1FA 4PVBA 2Y1CA 4XN1A 3Q22A 3FU3A 2Y1GA 5HLTA 3Q0AA 1SG7A 1H3LA 3Q23A 1K93A 2YGWA 1ONNA 3FUDA 3FUHA 4XNBA 4XMVA 1K90A 2QVWA 5DULA 4JNDA 2JD2A 3RC8A 4XN4A 5EV7A 4K5OA 3ANMA 1LVCA 3FTXA 4HKSA 1JGIA 3VVMA 3FTUA 1X3WA 4NQWA 2GBBA 4Y6PA 3UEQA 3FTVA 4XN7A 3FUNA 4ZW8A 3CHSA 4OOEA 2MAOA 2DQ6A 3VKGA 1MW0A 2LFWA 3N0RA 3B34A 3RC3A 2XPYA 3B7RL 3FHEA 5GJVE 4Y6RA 2R70A 2HPTA 3FTWA 4AICA 3VVLA 4XN5A 4AI6A 1Q0LA 4XNAA 2FP2A 1JVSA 4X2UA 2R59A 3JSZA 3CZEA 3B2PA 1XFWA 4AKHA 1MVYA 4L2LA 2C82A 4MS6A 3WQRA 5JO0A 3FUJA 4LUPA 1XFZA 3R0IA 3UERA 4XO3A 4MKTA 2R72A 1GW6A 2XPZA 4RVBA 1ONOA 4QHPA 4FLOA 3Q43A 2B61A 4J3BA 5FWQA 2Y1EA 2WPGA 4ZW7A 3ZHZA 4FF3A 3AU8A 4FF4A 5JMPA 4ZX5A 4KP7A 1MW2A 4K5LA 3FTSA 1XFUA 1ONPA 4QUOA 1K5HA 4K5MA 4PW4A 2VLAA 5JMWA 3ZHXA 3CHQA 1MW1A 4QPEA 5AENA 2AO2A 2FFLA 3KEDA 3ZHYA 2HPOA 4ZQFA 4XN2A 4QMEA 4XO4A 4XO5A 4ZW5A 5HNHA 4ZX3A 1SK6A 4FLSA 2PO4A 3FTZA 1G5AA 3EBIA 2PL5A 3CHPA 3FUIA 4XMTA 2EGHA 1S26A 4KSAA 4ARFA 1SQMA 4ZN6A 4BKXA 1T1SA 4Y67A 4Q4IA 1X3ZA 2JCXA 5DLLA 3FU0A 3JT1A 5JNLA 3FUKA 3WQQA 4R5XA 3CZGA 4ZQEA 2EC5A 4ZW3A 3AU9A 1R0KA 3FUMA 3RASA 2VF1A 1JG9A 3FH8A 3ANNA 3EBGA 4XNDA 4RCVA 2JCYA 2PUSA 4FLQA 2ZXGA 3C46A 3FH5A 1Q0QA 2WZFA 4ZQTA 4GAEA 1Q0HA 1PK0A 3FU5A 4P79A 3CZKA 4PU2A 3QJXA 4R5TA 3X29A 2JCVA 1T1RA 3ZI0A 2RJIA 4F0XA 3KMLA 3EBHA 3B3BA 4FCAA 4KSFA 4RSYA 3VKHA 4AR1A 4K5PA 3T8VA 1R0LA 4GAAA 4XMXA 3U9WA 1SC5A 2C5ZA 4XN9A 1HS6A 2AZEA 1ZS2A 3C2PA 2FP1A 3CHRA 2JD1A 2PGGA 4KS9A 1OR7A 4XMWA 3B7UX 5BPPA 2GTQA 3FTYA 4OOFA 3C3LA 3IIEA 2QJ1A 4ZQHA 1K8TA 5JBIA 3Q24A 2O7GA 3FU6A 2WZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6S A;  4ZQG A;  5JNL A;  2Y1G A;  4LUP A;  3WQQ A;  3R0I A;  3UER A;  1H3L A;  4G97 A;  3CZG A;  4ZQE A;  1ONN A;  1RP3 A;  3AU9 A;  1R0K A;  3RAS A;  4A03 A;  1ONO A;  2Y1D A;  5JC1 A;  3CZL A;  4FLO A;  1MW3 A;  1JG9 A;  5DUL A;  3ANN A;  3UCQ A;  4RCV A;  2JD2 A;  1S46 A;  3A06 A;  2JCY A;  2Y1E A;  2WPG A;  4FLQ A;  3ZHZ A;  3ANM A;  3ANL A;  3AU8 A;  5JMP A;  1JGI A;  4KP7 A;  1MW2 A;  1Q0Q A;  4NQW A;  1ONP A;  4GAE A;  1Q0H A;  1K5H A;  4Y6P A;  3UEQ A;  3CZK A;  4OOE A;  2MAO A;  2JCX A;  5JMW A;  1MW0 A;  4AYS A;  5JAZ A;  2LFW A;  2JCV A;  3N0R A;  1T1R A;  3ZHX A;  3ZI0 A;  1MW1 A;  3A14 A;  3ZHY A;  4Y6R A;  3AUA A;  4ZQF A;  4AIC A;  1Q0L A;  3T0Y A;  1R0L A;  4FLR A;  1SC5 A;  1JVS A;  4FLS A;  2JD0 A;  3CZE A;  1MVY A;  1ZS2 A;  1G5A A;  2MAP A;  2JD1 A;  4CXF A;  2C82 A;  1OR7 A;  2EGH A;  4OOF A;  3IIE A;  4ZQH A;  3WQS B;  5JBI A;  4QIC A;  3WQR A;  4ZN6 A;  2O7G A;  1T1S A;  4Y67 A;  5JO0 A;  2Y1F A;  2Y1C A; 
#chains in the Genus database with same CATH topology
 4Y6S A;  4ZQG A;  2QR4 A;  2VJ8 A;  3TTB A;  3CRK A;  2JV7 A;  3FUF A;  2EBH X;  3CE2 A;  4DPR A;  1XFV A;  4G97 A;  3SCE A;  2CJ5 A;  2YYG A;  4AR8 A;  1H19 A;  3TZ4 A;  3VAD A;  2Q8H A;  2REH A;  3D6B A;  1RP3 A;  4FF1 A;  3CXB A;  2IX5 A;  4K5N A;  1R3B A;  2ZDY A;  4A03 A;  2Y1D A;  5JC1 A;  3D9D A;  3CZL A;  4ZW6 A;  4XN8 A;  1MW3 A;  4XVX A;  4ZYJ A;  2OEV A;  2E81 A;  3UCQ A;  4MP7 A;  1S46 A;  3A06 A;  2PG0 A;  5M4P A;  1XFY A;  4AKI A;  2JIF A;  4RM7 A;  3ANL A;  3B7S A;  3B2X A;  4QIR A;  3FUE A;  3PUU A;  3HWC A;  2F6L A;  3D9F A;  1Y8N A;  2ZAF A;  4AR9 A;  3OIB A;  4XMU A;  4XMZ A;  3B37 A;  2R05 A;  4AYS A;  4ZX6 A;  5JAZ A;  1Y0V A;  3FH7 A;  1JM6 A;  4IV6 A;  4FF2 A;  4JIZ A;  1XFX A;  4HKR A;  3A14 A;  1UKW A;  3TZ0 A;  2BU8 A;  5GJW E;  3AUA A;  3CHO A;  1RJ1 A;  3T0Y A;  2XQ0 A;  1X8Z A;  4FLR A;  5HNF A;  4R7L A;  2JD0 A;  4AKG A;  5DYF A;  2MAP A;  2EBF X;  4CXF A;  2A7O A;  2DQM A;  3Q44 A;  5K3I A;  4H7Q A;  3B7T A;  4FZ4 A;  3FUL A;  4X28 A;  4Q4E A;  3WQS B;  3CIA A;  2HJN A;  4QIC A;  4WJY A;  5M4N A;  4R5V A;  3F29 A;  4MPN A;  4ZX4 A;  2Y1F A;  4PVB A;  2Y1C A;  4XN1 A;  4JIO A;  1WS9 A;  3Q22 A;  3FU3 A;  3FO3 A;  2Y1G A;  5HLT A;  3Q0A A;  2DVL A;  1SG7 A;  1H3L A;  4E02 A;  3Q23 A;  3BNF A;  2IX6 A;  1K93 A;  2YGW A;  1RJ4 A;  1ONN A;  3FUD A;  3FUH A;  2YYI A;  5K3G A;  3RKH A;  2PNR A;  4Q4U A;  1FS7 A;  1PI1 A;  3MPJ A;  3AFE A;  4MPE A;  4XNB A;  4XMV A;  1K90 A;  2QVW A;  2ZDX A;  5DUL A;  4V26 A;  4JND A;  3LGQ A;  2JD2 A;  3RC8 A;  2RF7 A;  4XN4 A;  3D2R A;  2Q8G A;  2JBR A;  5EV7 A;  4K5O A;  3ANM A;  1LVC A;  3GQT A;  5M4K A;  2C0U A;  3FTX A;  4HKS A;  1JGI A;  3VVM A;  5M4M A;  2EBA A;  3FTU A;  3EOM A;  2CJ6 A;  3GM6 A;  1X3W A;  3OWA A;  3SF6 A;  4NQW A;  2GBB A;  4Y6P A;  4Q1O A;  4NXL A;  3UEQ A;  3FTV A;  4XN7 A;  3FUN A;  4ZW8 A;  3CHS A;  4DZY A;  4OOE A;  2MAO A;  2DQ6 A;  3VKG A;  1MW0 A;  3MKH A;  2LFW A;  3N0R A;  3B34 A;  3EON A;  3RC3 A;  2YYL A;  3TZ5 A;  3MXL A;  2JBS A;  2XPY A;  3B7R L;  3L1T A;  3FHE A;  5GJV E;  4E01 A;  4Y6R A;  1RX0 A;  2R70 A;  2HPT A;  3FTW A;  3MPI A;  4AIC A;  3VVL A;  4XN5 A;  4AI6 A;  2OEX A;  1Q0L A;  1XG2 B;  4XNA A;  2FP2 A;  1JVS A;  1GU6 A;  4X2U A;  3S7W A;  4HR3 A;  2R59 A;  3JSZ A;  3CZE A;  3B2P A;  1XFW A;  3BNH A;  4AKH A;  1MVY A;  4L2L A;  2CJ4 A;  2YYJ A;  2CJ7 A;  2C82 A;  1UDY A;  2YYM A;  1EGD A;  3TZ2 A;  4MS6 A;  3MDE A;  3WQR A;  5JO0 A;  2BTZ A;  2ZKJ A;  3FUJ A;  4J1V A;  1SIR A;  4LUP A;  1XFZ A;  3R0I A;  3UER A;  4ZXV A;  2Q8F A;  2VR0 A;  1IVH A;  4XO3 A;  4MKT A;  2R72 A;  2ZO5 A;  1GW6 A;  2XPZ A;  4RVB A;  2CJ8 A;  1ONO A;  2R03 A;  4QHP A;  2YYK A;  4FLO A;  3Q43 A;  2B61 A;  4L38 A;  4LQS B;  3NF4 A;  2RFQ A;  5J6A A;  4J3B A;  2Q8I A;  5FWQ A;  2Y1E A;  4Q17 A;  2WPG A;  4H85 A;  3MDD A;  4ZW7 A;  3ZHZ A;  4FF3 A;  2J7A A;  1X91 A;  3AU8 A;  4FF4 A;  4E00 A;  5JMP A;  4ZX5 A;  1EGC A;  1Y8O A;  2E80 A;  4KP7 A;  1MW2 A;  4K5L A;  4X28 C;  3FTS A;  1XFU A;  1ONP A;  2BU7 A;  4QUO A;  4MPC A;  1K5H A;  4LQQ B;  4MP2 A;  4K5M A;  4PW4 A;  2VLA A;  5K3J A;  5JMW A;  2UXW A;  3PFD A;  3ZHX A;  3CHQ A;  1MW1 A;  4KCF A;  4QPE A;  1W07 A;  2BU5 A;  4W9U A;  5AEN A;  2AO2 A;  4Q5B A;  4N5F A;  2FFL A;  3KED A;  3ZHY A;  2HPO A;  2XS1 A;  5B5V A;  1GKX A;  1QDB A;  3UBR A;  4ZQF A;  4XN2 A;  4QME A;  4XO4 A;  2JBT A;  4XO5 A;  4ZW5 A;  5HNH A;  4ZX3 A;  1SK6 A;  1T9G A;  2CX9 A;  4FLS A;  2PO4 A;  3II9 A;  3SWO A;  3FTZ A;  1G5A A;  2R02 A;  1GJV A;  4JEK A;  3EBI A;  2PL5 A;  3CHP A;  3FUI A;  4L3Y A;  3D9E A;  1SIQ A;  4XMT A;  2EGH A;  3P4T A;  4O5M A;  2XQR B;  1S26 A;  4KSA A;  3GNC A;  4ARF A;  1SQM A;  3R7K A;  4ZN6 A;  4BKX A;  1T1S A;  3CRL A;  4Y67 A;  4Q4I A;  1X3Z A;  3M9V A;  4OO2 A;  2JCX A;  5DLL A;  3FU0 A;  3JT1 A;  5JNL A;  3FUK A;  5J71 A;  3WQQ A;  3X0Y A;  4R5X A;  2C12 A;  3CZG A;  4Q0T A;  2VIG A;  4ZQE A;  1GKZ A;  2EC5 A;  4ZW3 A;  3AU9 A;  3D9G A;  1R0K A;  5BRK A;  3FUM A;  3RAS A;  2OT4 A;  2VF1 A;  1JG9 A;  3FH8 A;  4U83 A;  3ANN A;  3EBG A;  4XND A;  1Y8P A;  4RCV A;  5BRM A;  2R0M A;  2JCY A;  2OR0 A;  2PUS A;  3BNG A;  4FLQ A;  4DOY A;  3HW2 A;  2BU6 A;  2ZXG A;  3OWM A;  1OAH A;  3C46 A;  1JQI A;  3TOR A;  3UU9 A;  1FS8 A;  2E0A A;  2Z1Q A;  1FS9 A;  3AFF A;  3FH5 A;  4H81 A;  2OJQ A;  1Q0Q A;  2WZF A;  4ZQT A;  2XS8 A;  4GAE A;  1Q0H A;  1PK0 A;  3FU5 A;  4P79 A;  3CZK A;  3D1I A;  4PU2 A;  3QJX A;  2D29 A;  3B96 A;  4R5T A;  3X29 A;  2JCV A;  2BU2 A;  1T1R A;  2R0N A;  3BNJ A;  3ZI0 A;  4P13 A;  2RDZ A;  2RJI A;  4F0X A;  3KML A;  3LG1 A;  2WBI A;  3EBH A;  3B3B A;  4FCA A;  4KSF A;  4RSY A;  3VKH A;  4AR1 A;  4M9A A;  4K5P A;  3T8V A;  1R2J A;  4IRN A;  1R0L A;  4GAA A;  1BUC A;  1X90 A;  4XMX A;  3U9W A;  1SC5 A;  3SXQ A;  2C5Z A;  4XN9 A;  1EGE A;  1HS6 A;  4G5E A;  1IS2 A;  2AZE A;  1ZS2 A;  3C2P A;  2FP1 A;  3CHR A;  2JD1 A;  3FCJ A;  4V25 A;  5B5W A;  2PGG A;  4KS9 A;  2DDH A;  1OR7 A;  5K3H A;  4XMW A;  3X0X A;  1U8V A;  3B7U X;  5BPP A;  4Q5C A;  4L3Z A;  2GTQ A;  3FTY A;  4OOF A;  2FON A;  2A1T A;  3C3L A;  3IIE A;  2QJ1 A;  4ZQH A;  1K8T A;  3MMO A;  4KTO A;  5JBI A;  3Q24 A;  2O7G A;  4L3X A;  5B6B A;  4L1F A;  3FU6 A;  2WZG A; 
#chains in the Genus database with same CATH homology
 4Y6S A;  4ZQG A;  2QR4 A;  2VJ8 A;  2JV7 A;  3FUF A;  2EBH X;  3CE2 A;  4DPR A;  1XFV A;  4G97 A;  4AR8 A;  1H19 A;  4FF1 A;  1RP3 A;  4K5N A;  4A03 A;  2Y1D A;  5JC1 A;  3CZL A;  4ZW6 A;  4XN8 A;  1MW3 A;  3UCQ A;  1S46 A;  3A06 A;  1XFY A;  4AKI A;  3ANL A;  3B7S A;  3B2X A;  4QIR A;  3FUE A;  3PUU A;  2F6L A;  4AR9 A;  4XMU A;  4XMZ A;  3B37 A;  4AYS A;  4ZX6 A;  5JAZ A;  1Y0V A;  3FH7 A;  4FF2 A;  1XFX A;  4HKR A;  3A14 A;  5GJW E;  3AUA A;  3CHO A;  3T0Y A;  2XQ0 A;  4FLR A;  5HNF A;  4R7L A;  2JD0 A;  4AKG A;  5DYF A;  2MAP A;  2EBF X;  4CXF A;  2A7O A;  2DQM A;  3Q44 A;  3B7T A;  4FZ4 A;  3FUL A;  4Q4E A;  3WQS B;  3CIA A;  4QIC A;  4R5V A;  4ZX4 A;  2Y1F A;  4PVB A;  2Y1C A;  4XN1 A;  3Q22 A;  3FU3 A;  2Y1G A;  5HLT A;  3Q0A A;  1SG7 A;  1H3L A;  3Q23 A;  1K93 A;  2YGW A;  1ONN A;  3FUD A;  3FUH A;  4XNB A;  4XMV A;  1K90 A;  2QVW A;  5DUL A;  4JND A;  2JD2 A;  3RC8 A;  4XN4 A;  5EV7 A;  4K5O A;  3ANM A;  1LVC A;  3FTX A;  4HKS A;  1JGI A;  3VVM A;  3FTU A;  1X3W A;  4NQW A;  2GBB A;  4Y6P A;  3UEQ A;  3FTV A;  4XN7 A;  3FUN A;  4ZW8 A;  3CHS A;  4OOE A;  2MAO A;  2DQ6 A;  3VKG A;  1MW0 A;  2LFW A;  3N0R A;  3B34 A;  3RC3 A;  2XPY A;  3B7R L;  3FHE A;  5GJV E;  4Y6R A;  2R70 A;  2HPT A;  3FTW A;  4AIC A;  3VVL A;  4XN5 A;  4AI6 A;  1Q0L A;  4XNA A;  2FP2 A;  1JVS A;  4X2U A;  2R59 A;  3JSZ A;  3CZE A;  3B2P A;  1XFW A;  4AKH A;  1MVY A;  4L2L A;  2C82 A;  4MS6 A;  3WQR A;  5JO0 A;  3FUJ A;  4LUP A;  1XFZ A;  3R0I A;  3UER A;  4XO3 A;  4MKT A;  2R72 A;  1GW6 A;  2XPZ A;  4RVB A;  1ONO A;  4QHP A;  4FLO A;  3Q43 A;  2B61 A;  4J3B A;  5FWQ A;  2Y1E A;  2WPG A;  4ZW7 A;  3ZHZ A;  4FF3 A;  3AU8 A;  4FF4 A;  5JMP A;  4ZX5 A;  4KP7 A;  1MW2 A;  4K5L A;  3FTS A;  1XFU A;  1ONP A;  4QUO A;  1K5H A;  4K5M A;  4PW4 A;  2VLA A;  5JMW A;  3ZHX A;  3CHQ A;  1MW1 A;  4QPE A;  5AEN A;  2AO2 A;  2FFL A;  3KED A;  3ZHY A;  2HPO A;  4ZQF A;  4XN2 A;  4QME A;  4XO4 A;  4XO5 A;  4ZW5 A;  5HNH A;  4ZX3 A;  1SK6 A;  4FLS A;  2PO4 A;  3FTZ A;  1G5A A;  3EBI A;  2PL5 A;  3CHP A;  3FUI A;  4XMT A;  2EGH A;  1S26 A;  4KSA A;  4ARF A;  1SQM A;  4ZN6 A;  4BKX A;  1T1S A;  4Y67 A;  4Q4I A;  1X3Z A;  2JCX A;  5DLL A;  3FU0 A;  3JT1 A;  5JNL A;  3FUK A;  3WQQ A;  4R5X A;  3CZG A;  4ZQE A;  2EC5 A;  4ZW3 A;  3AU9 A;  1R0K A;  3FUM A;  3RAS A;  2VF1 A;  1JG9 A;  3FH8 A;  3ANN A;  3EBG A;  4XND A;  4RCV A;  2JCY A;  2PUS A;  4FLQ A;  2ZXG A;  3C46 A;  3FH5 A;  1Q0Q A;  2WZF A;  4ZQT A;  4GAE A;  1Q0H A;  1PK0 A;  3FU5 A;  4P79 A;  3CZK A;  4PU2 A;  3QJX A;  4R5T A;  3X29 A;  2JCV A;  1T1R A;  3ZI0 A;  2RJI A;  4F0X A;  3KML A;  3EBH A;  3B3B A;  4FCA A;  4KSF A;  4RSY A;  3VKH A;  4AR1 A;  4K5P A;  3T8V A;  1R0L A;  4GAA A;  4XMX A;  3U9W A;  1SC5 A;  2C5Z A;  4XN9 A;  1HS6 A;  2AZE A;  1ZS2 A;  3C2P A;  2FP1 A;  3CHR A;  2JD1 A;  2PGG A;  4KS9 A;  1OR7 A;  4XMW A;  3B7U X;  5BPP A;  2GTQ A;  3FTY A;  4OOF A;  3C3L A;  3IIE A;  2QJ1 A;  4ZQH A;  1K8T A;  5JBI A;  3Q24 A;  2O7G A;  3FU6 A;  2WZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...