1SC5A

Sigma-28(flia)/flgm complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
232
structure length
228
Chain Sequence
b'KNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor FliA
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 82
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sc5A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1sc5A02
4RCVA 3CZGA 2MAPA 3R0IA 1Q0HA 3CZLA 4FLSA 3IIEA 1R0KA 5JO0A 5JAZA 3CZKA 4OOEA 2JCXA 1MW1A 2Y1CA 1JGIA 4FLOA 4ZQHA 3WQQA 2Y1GA 1RP3A 4Y6SA 1OR7A 3ANNA 4Y6PA 3WQRA 1MW0A 2JD1A 5JBIA 3AU8A 4LUPA 4ZQFA 3N0RA 4ZQEA 1Q0LA 4G97A 5DULA 2Y1DA 3AU9A 2MAOA 2Y1EA 3ZHZA 4FLQA 4Y6RA 1ZS2A 5JMPA 1SC5A 1JVSA 5JNLA 3ZHXA 1ONNA 2LFWA 1H3LA 4ZQGA 3A14A 4KP7A 1K5HA 3ZHYA 1MW3A 3ANMA 1MW2A 3CZEA 4AICA 1MVYA 3UERA 3T0YA 4AYSA 1JG9A 4A03A 1ONOA 1G5AA 4OOFA 2O7GA 3WQSB 5JC1A 3ZI0A 2WPGA 2JD0A 4QICA 1Q0QA 2JCVA 2JCYA 3RASA 4CXFA 4FLRA 2C82A 2EGHA 2Y1FA 3UCQA 4ZN6A 3UEQA 3AUAA 4GAEA 4Y67A 1R0LA 1T1SA 3ANLA 1ONPA 1T1RA 3A06A 1S46A 5JMWA 2JD2A 4NQWA
chains in the Genus database with same CATH superfamily
4H7QA 3CZGA 5B5VA 1SQMA 3OIBA 3D1IA 2A7OA 4QMEA 2D29A 4AKHA 2Q8HA 3D9EA 1Q0HA 2GTQA 3FU3A 1R2JA 4ZW5A 2YYJA 2YYIA 4ZX4A 2AZEA 3B7UX 3IIEA 4R7LA 5JO0A 1XFYA 4DZYA 2J7AA 3VVLA 2ZXGA 1Y0VA 4JEKA 4X28A 4X28C 4H81A 1MW1A 4ZX6A 2XS8A 1WS9A 2E80A 2ZDXA 1GJVA 3HWCA 4ZYJA 2Q8GA 3L1TA 3MPIA 1GW6A 2JD1A 5JBIA 3Q24A 3GNCA 2QR4A 3X0XA 4FF1A 3CE2A 3FTSA 2Z1QA 4QIRA 4ZX3A 2BU7A 3FULA 3B7RL 3ZHZA 4O5MA 4MPNA 1ZS2A 3FUMA 5AENA 3ZHXA 2C0UA 3FTVA 3AFFA 4K5LA 4NXLA 3FO3A 3U9WA 2PNRA 2YYGA 3OWMA 2C5ZA 4XN2A 4JIZA 4MP7A 3FUJA 2JV7A 4G5EA 2IX6A 3X0YA 4Q1OA 3FTUA 4XMVA 2CJ5A 4V25A 3UERA 5DLLA 4RSYA 4AYSA 3RC8A 4OOFA 4XMWA 4JIOA 5JC1A 2A1TA 3OWAA 5FWQA 4QICA 1Q0QA 4CXFA 3FCJA 4FLRA 5K3IA 2C82A 2Y1FA 2VR0A 3UCQA 4FF2A 3KMLA 4KTOA 3B2XA 1H19A 1HS6A 2RF7A 3SWOA 2GBBA 2R72A 2Q8FA 1ONPA 4XO4A 2HPOA 1EGEA 1EGCA 5EV7A 1S46A 4XN7A 3D9FA 2R02A 2JBSA 3MDEA 4FF3A 4XMZA 3QJXA 3LGQA 2MAPA 4JNDA 5J6AA 2R05A 4IV6A 3CXBA 2BU2A 3CZLA 2BU8A 3TORA 1PI1A 4MPEA 2EBHX 3FTYA 2E81A 2QVWA 2JBRA 3LG1A 4ZXVA 3CHRA 2JCXA 4R5XA 1JQIA 3C2PA 4LQQB 4K5MA 5BPPA 1SK6A 4KSFA 1SG7A 1S26A 3AFEA 3SCEA 4Q4EA 4ZQHA 2Y1GA 3MDDA 2CJ4A 5M4KA 3C46A 3JT1A 2R03A 4K5PA 3II9A 1GU6A 4V26A 3AU8A 1Y8NA 2FONA 4ZQFA 3D2RA 4RVBA 4XNAA 4XN8A 2VLAA 4G97A 4RM7A 5M4NA 2Y1DA 4KCFA 3AU9A 3FTXA 2Y1EA 4FLQA 2OT4A 4AKGA 4PVBA 3FUIA 2DDHA 5JNLA 4AI6A 2ZKJA 1H3LA 2R0MA 3F29A 1K5HA 2OJQA 1GKXA 3X29A 4Q17A 4HR3A 2YGWA 3BNHA 1Y8PA 3ANMA 1Y8OA 1MW2A 3VADA 4WJYA 2PUSA 3FUNA 4J3BA 1ONOA 5M4PA 2F6LA 2JD0A 2RDZA 2JCVA 4AKIA 3C3LA 4ZN6A 1XG2B 3FH8A 1UKWA 4R5VA 2CJ6A 4L3YA 2WZGA 4GAEA 4Y67A 1R0LA 2YYKA 3B3BA 2DQ6A 1T1SA 1W07A 3ANLA 5HNHA 1T1RA 3R7KA 3A06A 4E02A 4E01A 2WBIA 4MP2A 4N5FA 4DPRA 4XVXA 1X3WA 1X90A 3SXQA 4NQWA 1SIRA 3MPJA 1FS7A 4RCVA 5M4MA 3VKHA 3M9VA 2B61A 2BU5A 1FS9A 3JSZA 2ZO5A 2FFLA 4BKXA 3FHEA 1R0KA 4W9UA 3VVMA 3EONA 5JAZA 2FP2A 4OO2A 4ZX5A 3B96A 2Y1CA 2EBAA 4MS6A 4Q4UA 3S7WA 3Q22A 2AO2A 1JGIA 2PG0A 2XQ0A 1XFWA 3WQQA 1RP3A 4Y6SA 1OR7A 2OR0A 2Q8IA 4L1FA 4Y6PA 3WQRA 1MW0A 2ZAFA 3CRKA 4P13A 4HKRA 3B7TA 3EBIA 3FUFA 5B5WA 1T9GA 1IVHA 3BNFA 3N0RA 4Q5CA 4ZQEA 4L2LA 5DULA 4LQSB 2EC5A 4ZW3A 2XPYA 3CHQA 3TTBA 1SC5A 4X2UA 1ONNA 3FTWA 4ZQGA 3A14A 4XN9A 4K5NA 4KP7A 4XN1A 4Q4IA 2REHA 3BNGA 3KEDA 3ZHYA 3FH5A 1MW3A 2PGGA 4K5OA 4XNDA 4XMTA 1OAHA 3CZEA 2CX9A 4MKTA 1MVYA 4P79A 3EBHA 3FTZA 2EBFX 2CJ7A 1XFZA 2DVLA 2QJ1A 3CHPA 3D6BA 4FCAA 2VJ8A 3CIAA 3ZI0A 3Q43A 3PFDA 2JCYA 2R0NA 2YYLA 3D9GA 1K90A 4AR8A 1R3BA 3CHSA 2YYMA 3B7SA 3Q44A 3UEQA 2UXWA 3FU6A 3B37A 5GJVE 3FU0A 5HLTA 4KS9A 4J1VA 4PW4A 3TZ5A 5J71A 3D9DA 2R59A 4XN4A 3FUEA 4Q5BA 1X91A 1JM6A 3UU9A 4ZW6A 3BNJA 4F0XA 1X3ZA 2IX5A 4XO3A 2XS1A 3EBGA 1K8TA 4AR9A 5B6BA 4ZQTA 3R0IA 3TZ2A 1LVCA 2R70A 1UDYA 3MXLA 4FLSA 2XPZA 2VIGA 2FP1A 3NF4A 1IS2A 5GJWE 3RC3A 3CZKA 3GQTA 3HW2A 4OOEA 5DYFA 4XO5A 1RJ4A 3CHOA 1QDBA 2JIFA 4FZ4A 4FLOA 1K93A 1GKZA 1XFUA 4H85A 5BRKA 2BTZA 3ANNA 2CJ8A 3MMOA 3UBRA 1FS8A 5K3JA 2JBTA 3SF6A 5HNFA 3B2PA 4ARFA 3FUDA 4LUPA 1PK0A 2RFQA 4MPCA 5BRMA 3Q23A 3EOMA 2OEVA 1Q0LA 3RKHA 5K3HA 4M9AA 4L3XA 2MAOA 2WZFA 5K3GA 4XMUA 1XFVA 4Y6RA 1RJ1A 2VF1A 3Q0AA 5JMPA 1JVSA 2HJNA 2LFWA 2XQRB 3TZ4A 4KSAA 4AR1A 4Q0TA 4FF4A 4IRNA 4DOYA 4QPEA 4QHPA 1U8VA 4AICA 3P4TA 4E00A 3T0YA 1JG9A 4A03A 4QUOA 1G5AA 4ZW7A 3CRLA 2O7GA 1XFXA 3VKGA 3WQSB 1SIQA 2PL5A 1EGDA 2WPGA 3GM6A 4R5TA 3RASA 4L3ZA 3FH7A 3MKHA 4PU2A 3FUHA 2C12A 4HKSA 3FU5A 2EGHA 2HPTA 2ZDYA 4L38A 3AUAA 2OEXA 4ZW8A 4XMXA 3FUKA 3PUUA 1X8ZA 2BU6A 5JMWA 2RJIA 4XNBA 4U83A 4XN5A 3T8VA 2JD2A 1RX0A 3TZ0A 2E0AA 2PO4A 4GAAA 3B34A 2DQMA 1BUCA
chains in the Genus database with same CATH topology
3CZGA 1SQMA 2A7OA 4QMEA 4AKHA 1Q0HA 2GTQA 3FU3A 4ZW5A 4ZX4A 2AZEA 3B7UX 3IIEA 4R7LA 5JO0A 1XFYA 3VVLA 2ZXGA 1Y0VA 1MW1A 4ZX6A 1GW6A 2JD1A 5JBIA 3Q24A 2QR4A 4FF1A 3CE2A 3FTSA 4QIRA 4ZX3A 3FULA 3B7RL 3ZHZA 1ZS2A 3FUMA 5AENA 3ZHXA 3FTVA 4K5LA 3U9WA 2C5ZA 4XN2A 3FUJA 2JV7A 3FTUA 4XMVA 3UERA 5DLLA 4RSYA 4AYSA 3RC8A 4OOFA 4XMWA 5JC1A 5FWQA 4QICA 1Q0QA 4CXFA 4FLRA 2C82A 2Y1FA 3UCQA 4FF2A 3KMLA 3B2XA 1H19A 1HS6A 2GBBA 2R72A 1ONPA 4XO4A 2HPOA 5EV7A 1S46A 4XN7A 4FF3A 4XMZA 3QJXA 2MAPA 4JNDA 3CZLA 2EBHX 3FTYA 2QVWA 3CHRA 2JCXA 4R5XA 3C2PA 4K5MA 5BPPA 1SK6A 4KSFA 1SG7A 1S26A 4Q4EA 4ZQHA 2Y1GA 3C46A 3JT1A 4K5PA 3AU8A 4ZQFA 4RVBA 4XNAA 4XN8A 2VLAA 4G97A 2Y1DA 3AU9A 3FTXA 2Y1EA 4FLQA 4AKGA 4PVBA 3FUIA 5JNLA 4AI6A 1H3LA 1K5HA 3X29A 2YGWA 3ANMA 1MW2A 2PUSA 3FUNA 4J3BA 1ONOA 2F6LA 2JD0A 2JCVA 4AKIA 3C3LA 4ZN6A 3FH8A 4R5VA 2WZGA 4GAEA 4Y67A 1R0LA 3B3BA 2DQ6A 1T1SA 3ANLA 5HNHA 1T1RA 3A06A 4DPRA 1X3WA 4NQWA 4RCVA 3VKHA 2B61A 3JSZA 2FFLA 4BKXA 3FHEA 1R0KA 3VVMA 5JAZA 2FP2A 4ZX5A 2Y1CA 4MS6A 3Q22A 2AO2A 1JGIA 2XQ0A 1XFWA 3WQQA 1RP3A 4Y6SA 1OR7A 4Y6PA 3WQRA 1MW0A 4HKRA 3B7TA 3EBIA 3FUFA 3N0RA 4ZQEA 4L2LA 5DULA 2EC5A 4ZW3A 2XPYA 3CHQA 1SC5A 4X2UA 1ONNA 3FTWA 4ZQGA 3A14A 4XN9A 4K5NA 4KP7A 4XN1A 4Q4IA 3KEDA 3ZHYA 3FH5A 1MW3A 2PGGA 4K5OA 4XNDA 4XMTA 3CZEA 4MKTA 1MVYA 4P79A 2EBFX 3EBHA 3FTZA 1XFZA 2QJ1A 3CHPA 4FCAA 2VJ8A 3CIAA 3ZI0A 3Q43A 2JCYA 1K90A 4AR8A 3CHSA 3B7SA 3Q44A 3UEQA 3FU6A 3B37A 5GJVE 3FU0A 5HLTA 4KS9A 4PW4A 2R59A 4XN4A 3FUEA 4ZW6A 4F0XA 1X3ZA 4XO3A 3EBGA 1K8TA 4AR9A 4ZQTA 3R0IA 1LVCA 2R70A 4FLSA 2XPZA 2FP1A 5GJWE 3RC3A 3CZKA 4OOEA 5DYFA 4XO5A 3CHOA 4FZ4A 4FLOA 1K93A 1XFUA 3ANNA 5HNFA 3B2PA 4ARFA 3FUDA 4LUPA 1PK0A 3Q23A 1Q0LA 2MAOA 2WZFA 4XMUA 1XFVA 4Y6RA 2VF1A 3Q0AA 5JMPA 1JVSA 2LFWA 4KSAA 4AR1A 4FF4A 4QPEA 4QHPA 4AICA 3T0YA 1JG9A 4A03A 4QUOA 1G5AA 4ZW7A 2O7GA 1XFXA 3VKGA 3WQSB 2PL5A 2WPGA 4R5TA 3RASA 3FH7A 4PU2A 3FUHA 4HKSA 3FU5A 2EGHA 2HPTA 3AUAA 4ZW8A 4XMXA 3FUKA 3PUUA 5JMWA 2RJIA 4XNBA 4XN5A 3T8VA 2JD2A 2PO4A 4GAAA 3B34A 2DQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCV A;  3CZG A;  2MAP A;  3R0I A;  1Q0H A;  3CZL A;  4FLS A;  3IIE A;  1R0K A;  5JO0 A;  5JAZ A;  3CZK A;  4OOE A;  2JCX A;  1MW1 A;  2Y1C A;  1JGI A;  4FLO A;  4ZQH A;  3WQQ A;  2Y1G A;  1RP3 A;  4Y6S A;  1OR7 A;  3ANN A;  4Y6P A;  3WQR A;  1MW0 A;  2JD1 A;  5JBI A;  3AU8 A;  4LUP A;  4ZQF A;  3N0R A;  4ZQE A;  1Q0L A;  4G97 A;  5DUL A;  2Y1D A;  3AU9 A;  2MAO A;  2Y1E A;  3ZHZ A;  4FLQ A;  4Y6R A;  1ZS2 A;  5JMP A;  1SC5 A;  1JVS A;  5JNL A;  3ZHX A;  1ONN A;  2LFW A;  1H3L A;  4ZQG A;  3A14 A;  4KP7 A;  1K5H A;  3ZHY A;  1MW3 A;  3ANM A;  1MW2 A;  3CZE A;  4AIC A;  1MVY A;  3UER A;  3T0Y A;  4AYS A;  1JG9 A;  4A03 A;  1ONO A;  1G5A A;  4OOF A;  2O7G A;  3WQS B;  5JC1 A;  3ZI0 A;  2WPG A;  2JD0 A;  4QIC A;  1Q0Q A;  2JCV A;  2JCY A;  3RAS A;  4CXF A;  4FLR A;  2C82 A;  2EGH A;  2Y1F A;  3UCQ A;  4ZN6 A;  3UEQ A;  3AUA A;  4GAE A;  4Y67 A;  1R0L A;  1T1S A;  3ANL A;  1ONP A;  1T1R A;  3A06 A;  1S46 A;  5JMW A;  2JD2 A;  4NQW A; 
#chains in the Genus database with same CATH topology
 4H7Q A;  3CZG A;  5B5V A;  1SQM A;  3OIB A;  3D1I A;  2A7O A;  4QME A;  2D29 A;  4AKH A;  2Q8H A;  3D9E A;  1Q0H A;  2GTQ A;  3FU3 A;  1R2J A;  4ZW5 A;  2YYJ A;  2YYI A;  4ZX4 A;  2AZE A;  3B7U X;  3IIE A;  4R7L A;  5JO0 A;  1XFY A;  4DZY A;  2J7A A;  3VVL A;  2ZXG A;  1Y0V A;  4JEK A;  4X28 A;  4X28 C;  4H81 A;  1MW1 A;  4ZX6 A;  2XS8 A;  1WS9 A;  2E80 A;  2ZDX A;  1GJV A;  3HWC A;  4ZYJ A;  2Q8G A;  3L1T A;  3MPI A;  1GW6 A;  2JD1 A;  5JBI A;  3Q24 A;  3GNC A;  2QR4 A;  3X0X A;  4FF1 A;  3CE2 A;  3FTS A;  2Z1Q A;  4QIR A;  4ZX3 A;  2BU7 A;  3FUL A;  3B7R L;  3ZHZ A;  4O5M A;  4MPN A;  1ZS2 A;  3FUM A;  5AEN A;  3ZHX A;  2C0U A;  3FTV A;  3AFF A;  4K5L A;  4NXL A;  3FO3 A;  3U9W A;  2PNR A;  2YYG A;  3OWM A;  2C5Z A;  4XN2 A;  4JIZ A;  4MP7 A;  3FUJ A;  2JV7 A;  4G5E A;  2IX6 A;  3X0Y A;  4Q1O A;  3FTU A;  4XMV A;  2CJ5 A;  4V25 A;  3UER A;  5DLL A;  4RSY A;  4AYS A;  3RC8 A;  4OOF A;  4XMW A;  4JIO A;  5JC1 A;  2A1T A;  3OWA A;  5FWQ A;  4QIC A;  1Q0Q A;  4CXF A;  3FCJ A;  4FLR A;  5K3I A;  2C82 A;  2Y1F A;  2VR0 A;  3UCQ A;  4FF2 A;  3KML A;  4KTO A;  3B2X A;  1H19 A;  1HS6 A;  2RF7 A;  3SWO A;  2GBB A;  2R72 A;  2Q8F A;  1ONP A;  4XO4 A;  2HPO A;  1EGE A;  1EGC A;  5EV7 A;  1S46 A;  4XN7 A;  3D9F A;  2R02 A;  2JBS A;  3MDE A;  4FF3 A;  4XMZ A;  3QJX A;  3LGQ A;  2MAP A;  4JND A;  5J6A A;  2R05 A;  4IV6 A;  3CXB A;  2BU2 A;  3CZL A;  2BU8 A;  3TOR A;  1PI1 A;  4MPE A;  2EBH X;  3FTY A;  2E81 A;  2QVW A;  2JBR A;  3LG1 A;  4ZXV A;  3CHR A;  2JCX A;  4R5X A;  1JQI A;  3C2P A;  4LQQ B;  4K5M A;  5BPP A;  1SK6 A;  4KSF A;  1SG7 A;  1S26 A;  3AFE A;  3SCE A;  4Q4E A;  4ZQH A;  2Y1G A;  3MDD A;  2CJ4 A;  5M4K A;  3C46 A;  3JT1 A;  2R03 A;  4K5P A;  3II9 A;  1GU6 A;  4V26 A;  3AU8 A;  1Y8N A;  2FON A;  4ZQF A;  3D2R A;  4RVB A;  4XNA A;  4XN8 A;  2VLA A;  4G97 A;  4RM7 A;  5M4N A;  2Y1D A;  4KCF A;  3AU9 A;  3FTX A;  2Y1E A;  4FLQ A;  2OT4 A;  4AKG A;  4PVB A;  3FUI A;  2DDH A;  5JNL A;  4AI6 A;  2ZKJ A;  1H3L A;  2R0M A;  3F29 A;  1K5H A;  2OJQ A;  1GKX A;  3X29 A;  4Q17 A;  4HR3 A;  2YGW A;  3BNH A;  1Y8P A;  3ANM A;  1Y8O A;  1MW2 A;  3VAD A;  4WJY A;  2PUS A;  3FUN A;  4J3B A;  1ONO A;  5M4P A;  2F6L A;  2JD0 A;  2RDZ A;  2JCV A;  4AKI A;  3C3L A;  4ZN6 A;  1XG2 B;  3FH8 A;  1UKW A;  4R5V A;  2CJ6 A;  4L3Y A;  2WZG A;  4GAE A;  4Y67 A;  1R0L A;  2YYK A;  3B3B A;  2DQ6 A;  1T1S A;  1W07 A;  3ANL A;  5HNH A;  1T1R A;  3R7K A;  3A06 A;  4E02 A;  4E01 A;  2WBI A;  4MP2 A;  4N5F A;  4DPR A;  4XVX A;  1X3W A;  1X90 A;  3SXQ A;  4NQW A;  1SIR A;  3MPJ A;  1FS7 A;  4RCV A;  5M4M A;  3VKH A;  3M9V A;  2B61 A;  2BU5 A;  1FS9 A;  3JSZ A;  2ZO5 A;  2FFL A;  4BKX A;  3FHE A;  1R0K A;  4W9U A;  3VVM A;  3EON A;  5JAZ A;  2FP2 A;  4OO2 A;  4ZX5 A;  3B96 A;  2Y1C A;  2EBA A;  4MS6 A;  4Q4U A;  3S7W A;  3Q22 A;  2AO2 A;  1JGI A;  2PG0 A;  2XQ0 A;  1XFW A;  3WQQ A;  1RP3 A;  4Y6S A;  1OR7 A;  2OR0 A;  2Q8I A;  4L1F A;  4Y6P A;  3WQR A;  1MW0 A;  2ZAF A;  3CRK A;  4P13 A;  4HKR A;  3B7T A;  3EBI A;  3FUF A;  5B5W A;  1T9G A;  1IVH A;  3BNF A;  3N0R A;  4Q5C A;  4ZQE A;  4L2L A;  5DUL A;  4LQS B;  2EC5 A;  4ZW3 A;  2XPY A;  3CHQ A;  3TTB A;  1SC5 A;  4X2U A;  1ONN A;  3FTW A;  4ZQG A;  3A14 A;  4XN9 A;  4K5N A;  4KP7 A;  4XN1 A;  4Q4I A;  2REH A;  3BNG A;  3KED A;  3ZHY A;  3FH5 A;  1MW3 A;  2PGG A;  4K5O A;  4XND A;  4XMT A;  1OAH A;  3CZE A;  2CX9 A;  4MKT A;  1MVY A;  4P79 A;  3EBH A;  3FTZ A;  2EBF X;  2CJ7 A;  1XFZ A;  2DVL A;  2QJ1 A;  3CHP A;  3D6B A;  4FCA A;  2VJ8 A;  3CIA A;  3ZI0 A;  3Q43 A;  3PFD A;  2JCY A;  2R0N A;  2YYL A;  3D9G A;  1K90 A;  4AR8 A;  1R3B A;  3CHS A;  2YYM A;  3B7S A;  3Q44 A;  3UEQ A;  2UXW A;  3FU6 A;  3B37 A;  5GJV E;  3FU0 A;  5HLT A;  4KS9 A;  4J1V A;  4PW4 A;  3TZ5 A;  5J71 A;  3D9D A;  2R59 A;  4XN4 A;  3FUE A;  4Q5B A;  1X91 A;  1JM6 A;  3UU9 A;  4ZW6 A;  3BNJ A;  4F0X A;  1X3Z A;  2IX5 A;  4XO3 A;  2XS1 A;  3EBG A;  1K8T A;  4AR9 A;  5B6B A;  4ZQT A;  3R0I A;  3TZ2 A;  1LVC A;  2R70 A;  1UDY A;  3MXL A;  4FLS A;  2XPZ A;  2VIG A;  2FP1 A;  3NF4 A;  1IS2 A;  5GJW E;  3RC3 A;  3CZK A;  3GQT A;  3HW2 A;  4OOE A;  5DYF A;  4XO5 A;  1RJ4 A;  3CHO A;  1QDB A;  2JIF A;  4FZ4 A;  4FLO A;  1K93 A;  1GKZ A;  1XFU A;  4H85 A;  5BRK A;  2BTZ A;  3ANN A;  2CJ8 A;  3MMO A;  3UBR A;  1FS8 A;  5K3J A;  2JBT A;  3SF6 A;  5HNF A;  3B2P A;  4ARF A;  3FUD A;  4LUP A;  1PK0 A;  2RFQ A;  4MPC A;  5BRM A;  3Q23 A;  3EOM A;  2OEV A;  1Q0L A;  3RKH A;  5K3H A;  4M9A A;  4L3X A;  2MAO A;  2WZF A;  5K3G A;  4XMU A;  1XFV A;  4Y6R A;  1RJ1 A;  2VF1 A;  3Q0A A;  5JMP A;  1JVS A;  2HJN A;  2LFW A;  2XQR B;  3TZ4 A;  4KSA A;  4AR1 A;  4Q0T A;  4FF4 A;  4IRN A;  4DOY A;  4QPE A;  4QHP A;  1U8V A;  4AIC A;  3P4T A;  4E00 A;  3T0Y A;  1JG9 A;  4A03 A;  4QUO A;  1G5A A;  4ZW7 A;  3CRL A;  2O7G A;  1XFX A;  3VKG A;  3WQS B;  1SIQ A;  2PL5 A;  1EGD A;  2WPG A;  3GM6 A;  4R5T A;  3RAS A;  4L3Z A;  3FH7 A;  3MKH A;  4PU2 A;  3FUH A;  2C12 A;  4HKS A;  3FU5 A;  2EGH A;  2HPT A;  2ZDY A;  4L38 A;  3AUA A;  2OEX A;  4ZW8 A;  4XMX A;  3FUK A;  3PUU A;  1X8Z A;  2BU6 A;  5JMW A;  2RJI A;  4XNB A;  4U83 A;  4XN5 A;  3T8V A;  2JD2 A;  1RX0 A;  3TZ0 A;  2E0A A;  2PO4 A;  4GAA A;  3B34 A;  2DQM A;  1BUC A; 
#chains in the Genus database with same CATH homology
 3CZG A;  1SQM A;  2A7O A;  4QME A;  4AKH A;  1Q0H A;  2GTQ A;  3FU3 A;  4ZW5 A;  4ZX4 A;  2AZE A;  3B7U X;  3IIE A;  4R7L A;  5JO0 A;  1XFY A;  3VVL A;  2ZXG A;  1Y0V A;  1MW1 A;  4ZX6 A;  1GW6 A;  2JD1 A;  5JBI A;  3Q24 A;  2QR4 A;  4FF1 A;  3CE2 A;  3FTS A;  4QIR A;  4ZX3 A;  3FUL A;  3B7R L;  3ZHZ A;  1ZS2 A;  3FUM A;  5AEN A;  3ZHX A;  3FTV A;  4K5L A;  3U9W A;  2C5Z A;  4XN2 A;  3FUJ A;  2JV7 A;  3FTU A;  4XMV A;  3UER A;  5DLL A;  4RSY A;  4AYS A;  3RC8 A;  4OOF A;  4XMW A;  5JC1 A;  5FWQ A;  4QIC A;  1Q0Q A;  4CXF A;  4FLR A;  2C82 A;  2Y1F A;  3UCQ A;  4FF2 A;  3KML A;  3B2X A;  1H19 A;  1HS6 A;  2GBB A;  2R72 A;  1ONP A;  4XO4 A;  2HPO A;  5EV7 A;  1S46 A;  4XN7 A;  4FF3 A;  4XMZ A;  3QJX A;  2MAP A;  4JND A;  3CZL A;  2EBH X;  3FTY A;  2QVW A;  3CHR A;  2JCX A;  4R5X A;  3C2P A;  4K5M A;  5BPP A;  1SK6 A;  4KSF A;  1SG7 A;  1S26 A;  4Q4E A;  4ZQH A;  2Y1G A;  3C46 A;  3JT1 A;  4K5P A;  3AU8 A;  4ZQF A;  4RVB A;  4XNA A;  4XN8 A;  2VLA A;  4G97 A;  2Y1D A;  3AU9 A;  3FTX A;  2Y1E A;  4FLQ A;  4AKG A;  4PVB A;  3FUI A;  5JNL A;  4AI6 A;  1H3L A;  1K5H A;  3X29 A;  2YGW A;  3ANM A;  1MW2 A;  2PUS A;  3FUN A;  4J3B A;  1ONO A;  2F6L A;  2JD0 A;  2JCV A;  4AKI A;  3C3L A;  4ZN6 A;  3FH8 A;  4R5V A;  2WZG A;  4GAE A;  4Y67 A;  1R0L A;  3B3B A;  2DQ6 A;  1T1S A;  3ANL A;  5HNH A;  1T1R A;  3A06 A;  4DPR A;  1X3W A;  4NQW A;  4RCV A;  3VKH A;  2B61 A;  3JSZ A;  2FFL A;  4BKX A;  3FHE A;  1R0K A;  3VVM A;  5JAZ A;  2FP2 A;  4ZX5 A;  2Y1C A;  4MS6 A;  3Q22 A;  2AO2 A;  1JGI A;  2XQ0 A;  1XFW A;  3WQQ A;  1RP3 A;  4Y6S A;  1OR7 A;  4Y6P A;  3WQR A;  1MW0 A;  4HKR A;  3B7T A;  3EBI A;  3FUF A;  3N0R A;  4ZQE A;  4L2L A;  5DUL A;  2EC5 A;  4ZW3 A;  2XPY A;  3CHQ A;  1SC5 A;  4X2U A;  1ONN A;  3FTW A;  4ZQG A;  3A14 A;  4XN9 A;  4K5N A;  4KP7 A;  4XN1 A;  4Q4I A;  3KED A;  3ZHY A;  3FH5 A;  1MW3 A;  2PGG A;  4K5O A;  4XND A;  4XMT A;  3CZE A;  4MKT A;  1MVY A;  4P79 A;  2EBF X;  3EBH A;  3FTZ A;  1XFZ A;  2QJ1 A;  3CHP A;  4FCA A;  2VJ8 A;  3CIA A;  3ZI0 A;  3Q43 A;  2JCY A;  1K90 A;  4AR8 A;  3CHS A;  3B7S A;  3Q44 A;  3UEQ A;  3FU6 A;  3B37 A;  5GJV E;  3FU0 A;  5HLT A;  4KS9 A;  4PW4 A;  2R59 A;  4XN4 A;  3FUE A;  4ZW6 A;  4F0X A;  1X3Z A;  4XO3 A;  3EBG A;  1K8T A;  4AR9 A;  4ZQT A;  3R0I A;  1LVC A;  2R70 A;  4FLS A;  2XPZ A;  2FP1 A;  5GJW E;  3RC3 A;  3CZK A;  4OOE A;  5DYF A;  4XO5 A;  3CHO A;  4FZ4 A;  4FLO A;  1K93 A;  1XFU A;  3ANN A;  5HNF A;  3B2P A;  4ARF A;  3FUD A;  4LUP A;  1PK0 A;  3Q23 A;  1Q0L A;  2MAO A;  2WZF A;  4XMU A;  1XFV A;  4Y6R A;  2VF1 A;  3Q0A A;  5JMP A;  1JVS A;  2LFW A;  4KSA A;  4AR1 A;  4FF4 A;  4QPE A;  4QHP A;  4AIC A;  3T0Y A;  1JG9 A;  4A03 A;  4QUO A;  1G5A A;  4ZW7 A;  2O7G A;  1XFX A;  3VKG A;  3WQS B;  2PL5 A;  2WPG A;  4R5T A;  3RAS A;  3FH7 A;  4PU2 A;  3FUH A;  4HKS A;  3FU5 A;  2EGH A;  2HPT A;  3AUA A;  4ZW8 A;  4XMX A;  3FUK A;  3PUU A;  5JMW A;  2RJI A;  4XNB A;  4XN5 A;  3T8V A;  2JD2 A;  2PO4 A;  4GAA A;  3B34 A;  2DQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...