1SC5A

Sigma-28(flia)/flgm complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
232
structure length
228
Chain Sequence
KNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the flagellar sigma/anti-sigma complex sigma(28)/FlgM reveals an intact sigma factor in an inactive conformation.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords RNA polymerase sigma factor FliA
total genus 82
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sc5A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1sc5A02
1T1SA 1ONNA 4FLSA 4RCVA 1JVSA 2Y1EA 1JGIA 5JBIA 1RP3A 5JC1A 1MW2A 5DULA 1R0LA 2JD2A 5JMWA 3UERA 1ONOA 2JCVA 3AU8A 4Y6SA 3CZEA 1S46A 2O7GA 4G97A 2Y1FA 3IIEA 4GAEA 1G5AA 2MAOA 4ZQEA 2LFWA 4CXFA 4ZQHA 2Y1DA 4FLRA 1ZS2A 5JMPA 3UEQA 2JD0A 4ZN6A 4FLQA 3RASA 3T0YA 1K5HA 4Y6RA 1SC5A 1MW3A 2JCYA 2JCXA 3ANMA 1MVYA 1Q0HA 4Y6PA 2MAPA 2Y1CA 3A14A 3ANLA 3ZHXA 3ZI0A 4QICA 2EGHA 4LUPA 1T1RA 1MW1A 3CZKA 3CZLA 3AU9A 4A03A 1Q0LA 3ANNA 4FLOA 3WQSB 1OR7A 4KP7A 3UCQA 4AICA 3ZHYA 4OOFA 1Q0QA 4NQWA 2WPGA 1ONPA 4AYSA 5JO0A 2Y1GA 4ZQGA 2JD1A 4OOEA 3WQRA 2C82A 5JAZA 1MW0A 1H3LA 1R0KA 3ZHZA 5JNLA 3N0RA 3R0IA 3CZGA 3A06A 3WQQA 1JG9A 3AUAA 4ZQFA 4Y67A
chains in the Genus database with same CATH superfamily
3C2PA 1T1SA 3GNCA 3X29A 5M4KA 2RFQA 4RCVA 4R5XA 3TZ4A 4XMUA 1EGDA 2Y1EA 1JGIA 1H19A 3PUUA 5K3GA 3EBHA 3Q24A 4DPRA 4ZQTA 4XN8A 3AFEA 3GM6A 2EBAA 3M9VA 3CHPA 2E80A 4Y6SA 2CJ8A 2ZXGA 3Q44A 3TZ5A 5HNHA 4ARFA 3VVLA 4KTOA 3IIEA 4ZQEA 4RSYA 2LFWA 4HKSA 4MKTA 4L1FA 1EGEA 4H81A 3FTSA 4BKXA 2VF1A 3UEQA 4FLQA 3F29A 4Q4EA 4K5LA 2C12A 1MW3A 3TORA 1RJ4A 3FUEA 2VJ8A 2FP1A 4E01A 2JCXA 2ZAFA 4L3YA 4L2LA 3EONA 3CHOA 3RKHA 4AKHA 4Y6PA 2MAPA 2YYMA 2Z1QA 3P4TA 2Y1CA 4ZX3A 4XN4A 2E81A 4QIRA 4QUOA 3VKHA 5M4NA 5DYFA 2XQ0A 1X8ZA 4XMWA 3L1TA 5BRKA 3B96A 3SXQA 3D1IA 4LUPA 3CE2A 2BU6A 3FUNA 1Q0LA 1FS8A 4FLOA 2DQ6A 1FS9A 4FCAA 1OR7A 3BNJA 3B7UX 2IX6A 4NQWA 3S7WA 2WPGA 3C3LA 2ZO5A 2VLAA 5GJWE 3FTZA 3Q43A 5J6AA 3U9WA 3EBIA 3CXBA 5DLLA 5K3IA 4R5TA 4DOYA 3B34A 5JNLA 2R03A 4QPEA 3BNFA 3CZGA 2R72A 2C0UA 2YYKA 3CRLA 3BNHA 2HPOA 4KCFA 3FUKA 1XFUA 1JG9A 2YGWA 4L38A 3EBGA 4J3BA 2ZDXA 2VIGA 3AUAA 3CHRA 3FU6A 4ZX5A 4LQSB 4X2UA 1GW6A 4FLSA 3CHQA 1SIRA 4JEKA 3D9DA 2RF7A 2ZDYA 3B7SA 4RVBA 1JM6A 1RP3A 5JC1A 4K5OA 4V26A 1SG7A 2R02A 2YYGA 1R0LA 1GKXA 2JD2A 5JMWA 3B7TA 2HJNA 3D9GA 3R7KA 2WZGA 3CRKA 4ZX6A 2GBBA 3CZEA 3II9A 1OAHA 3LGQA 2Y1FA 4GAEA 3KMLA 2MAOA 3FH5A 4CXFA 4G5EA 4FZ4A 2J7AA 4IV6A 3RC3A 2JD0A 1XFWA 2BU5A 4XMVA 5B5VA 3RASA 2PGGA 1K5HA 3VVMA 4Y6RA 3TZ2A 2REHA 2JCYA 2CX9A 1HS6A 4ZX4A 3QJXA 3FUHA 3ANMA 1GKZA 4MS6A 4MPCA 1XFVA 2B61A 3ANLA 4R7LA 2FONA 3JT1A 2BTZA 3OWAA 3FULA 5HNFA 3UU9A 2PUSA 4A03A 2EBHX 3ANNA 4FF2A 4XMZA 1QDBA 3D6BA 2QR4A 3B2XA 4KSFA 4FF3A 3FTUA 4KP7A 4AICA 1R3BA 3B2PA 2E0AA 2R05A 4OOFA 1ONPA 5BRMA 4ZQGA 2ZKJA 2XPYA 4MPNA 4O5MA 1X3WA 2R0NA 4XNDA 2JBTA 2FFLA 1XFYA 4ZW7A 4HR3A 3SWOA 3R0IA 4X28A 2CJ4A 2WBIA 3WQQA 1XFXA 2AO2A 1Y8NA 2UXWA 4Q5BA 2BU8A 2VR0A 1G5AA 1IVHA 3MDEA 1EGCA 1JQIA 2JBSA 1K8TA 5AENA 3FU5A 1K93A 4U83A 1W07A 4XN2A 3Q0AA 2BU7A 3LG1A 2QVWA 2OR0A 4XO3A 3FTVA 3UERA 1ONOA 3FUFA 2WZFA 2JCVA 5HLTA 3UBRA 5K3HA 4Q5CA 3CHSA 3MPIA 1PK0A 3NF4A 1S46A 2O7GA 4G97A 4XNBA 2JV7A 3FH8A 3FU3A 4XN1A 4XN7A 4ZQHA 4JNDA 4Q1OA 4ZW8A 4DZYA 4M9AA 4L3ZA 4FLRA 1ZS2A 5JMPA 2R59A 4H7QA 2R70A 5FWQA 3T0YA 2FP2A 1SC5A 1RJ1A 4XO4A 4XN5A 4XNAA 3X0YA 4XMTA 4QMEA 2OEVA 1MVYA 1Q0HA 5EV7A 2F6LA 1X91A 1BUCA 4GAAA 2DVLA 2OJQA 3ZHXA 4AKIA 4NXLA 3ZI0A 3FTXA 4QICA 2Q8HA 4XN9A 2EGHA 1Y8OA 2CJ5A 2DDHA 3PFDA 1MW1A 2A1TA 3CZKA 4W9UA 3AU9A 4Q4UA 4MPEA 3D2RA 3MPJA 3D9FA 3WQSB 2XS8A 3CIAA 4HKRA 3MMOA 4JIZA 1XG2B 1XFZA 3UCQA 3OIBA 2YYIA 1Q0QA 3AFFA 2OEXA 1WS9A 1RX0A 2D29A 5JO0A 4MP7A 2RDZA 2Q8GA 3C46A 2JD1A 4OOEA 4KS9A 1T9GA 3BNGA 3VADA 3KEDA 2YYJA 3FO3A 4E02A 1MW0A 3HWCA 1H3LA 1R0KA 2IX5A 3ZHZA 4OO2A 3B7RL 3A06A 2RJIA 4AR9A 1GU6A 3MXLA 2BU2A 2Q8IA 4J1VA 2PNRA 5B5WA 1R2JA 3FTWA 4Y67A 2EC5A 4H85A 5BPPA 3FUIA 4E00A 4KSAA 1ONNA 3FUMA 4ZW5A 3GQTA 2JIFA 4LQQB 4RM7A 5K3JA 1SQMA 4Q4IA 1UDYA 4F0XA 1JVSA 5JBIA 5B6BA 4K5PA 3FUJA 4ZXVA 1MW2A 2YYLA 5DULA 2CJ6A 3X0XA 3Q23A 3TZ0A 3D9EA 3RC8A 5M4PA 3AU8A 4AKGA 3FHEA 1GJVA 1SK6A 1Y0VA 3MKHA 2AZEA 4ZW3A 4AR8A 4PVBA 3SF6A 3MDDA 2Y1DA 2XPZA 2EBFX 4Q0TA 2XS1A 3FCJA 4AR1A 1X90A 4ZN6A 2Q8FA 3SCEA 2PO4A 4V25A 1S26A 1U8VA 3FU0A 3EOMA 5M4MA 1LVCA 4N5FA 5J71A 2A7OA 2OT4A 4Q17A 3A14A 3OWMA 1SIQA 4K5NA 3JSZA 4XVXA 3HW2A 3VKGA 1FS7A 2JBRA 1T1RA 1PI1A 4FF4A 3CZLA 4AI6A 4WJYA 2C5ZA 4JIOA 4P79A 2GTQA 3FH7A 3ZHYA 3Q22A 4P13A 4X28C 4IRNA 1X3ZA 4FF1A 1Y8PA 3FTYA 4L3XA 1IS2A 4XO5A 5GJVE 4AYSA 1UKWA 3B37A 2Y1GA 4PU2A 2DQMA 4R5VA 4ZYJA 1K90A 4PW4A 3TTBA 3WQRA 2PL5A 2C82A 4MP2A 5JAZA 2QJ1A 2R0MA 3B3BA 2CJ7A 3N0RA 2XQRB 4QHPA 4ZW6A 3T8VA 2PG0A 2HPTA 4K5MA 4XMXA 4ZQFA 3FUDA
chains in the Genus database with same CATH topology
3C2PA 1T1SA 3X29A 3FUIA 1GW6A 4KSAA 1ONNA 3CHQA 4FLSA 3FUMA 4RCVA 4ZW5A 5AENA 1K8TA 4R5XA 1SQMA 4Q4IA 3B7SA 4XMUA 3FU5A 1JVSA 2Y1EA 1JGIA 1H19A 4RVBA 5JBIA 4K5PA 4XN2A 1RP3A 1K93A 3Q0AA 3PUUA 3FUJA 5JC1A 1MW2A 2QVWA 4K5OA 1SG7A 3EBHA 5DULA 3Q24A 4DPRA 4XO3A 4ZQTA 1R0LA 3FTVA 4XN8A 3Q23A 2JD2A 5JMWA 3RC8A 3B7TA 3UERA 1ONOA 3FUFA 2WZFA 2JCVA 3AU8A 5HLTA 4AKGA 2WZGA 3CHPA 3CHSA 4Y6SA 1PK0A 4ZX6A 3FHEA 1SK6A 2GBBA 1Y0VA 2ZXGA 3Q44A 3CZEA 1S46A 5HNHA 4ARFA 2O7GA 4G97A 2Y1FA 3VVLA 4XNBA 3IIEA 4GAEA 2AZEA 3KMLA 2MAOA 4RSYA 4ZQEA 4ZW3A 3FH5A 4AR8A 2JV7A 4PVBA 4MKTA 3FH8A 3FU3A 4XN1A 4XN7A 4CXFA 4ZQHA 4JNDA 2Y1DA 2XPZA 2EBFX 4ZW8A 4FZ4A 3FTSA 4FLRA 4BKXA 1ZS2A 3RC3A 2VF1A 5JMPA 3UEQA 4AR1A 2JD0A 2R59A 1XFWA 4XMVA 4FLQA 4ZN6A 3RASA 2R70A 5FWQA 2PGGA 4K5LA 4Q4EA 1K5HA 3T0YA 3VVMA 4Y6RA 2FP2A 1SC5A 2PO4A 1MW3A 4XO4A 1S26A 3FUEA 2JCYA 2VJ8A 3FU0A 4XN5A 2JCXA 1HS6A 4XNAA 4ZX4A 1LVCA 2FP1A 4L2LA 3QJXA 3CHOA 4XMTA 4QMEA 3FUHA 3ANMA 1MVYA 1Q0HA 4Y6PA 2MAPA 4AKHA 2A7OA 4MS6A 2Y1CA 5EV7A 4ZX3A 4XN4A 2F6LA 1XFVA 4QIRA 3A14A 4QUOA 2B61A 3ANLA 4GAAA 3VKHA 3ZHXA 5DYFA 4R7LA 4K5NA 4AKIA 3JSZA 2XQ0A 4XMWA 3ZI0A 3VKGA 3FTXA 4QICA 4XN9A 3JT1A 2EGHA 4LUPA 1T1RA 1MW1A 3CE2A 3FULA 5HNFA 4F0XA 4FF4A 3CZKA 2PUSA 3CZLA 3AU9A 3FUNA 4A03A 1Q0LA 2EBHX 4AI6A 3ANNA 4FF2A 4FLOA 2DQ6A 4FCAA 4XMZA 4HKRA 3WQSB 3CIAA 2LFWA 1OR7A 3B2XA 2QR4A 4KSFA 4FF3A 3FTUA 2C5ZA 1XFZA 4P79A 2GTQA 4KP7A 3UCQA 4AICA 3B7UX 3B2PA 3FH7A 3ZHYA 3Q22A 4ZX5A 4OOFA 1Q0QA 1X3ZA 4NQWA 2WPGA 4FF1A 3FTYA 3C3LA 4XO5A 5GJVE 1ONPA 4AYSA 5JO0A 3B37A 2Y1GA 4PU2A 2VLAA 5GJWE 3FTZA 3Q43A 2DQMA 4ZQGA 2JD1A 3C46A 4OOEA 2XPYA 4R5VA 4KS9A 4Y67A 1K90A 4PW4A 3KEDA 3U9WA 2PL5A 2C82A 1X3WA 3WQRA 3EBIA 4XNDA 2FFLA 5DLLA 5JAZA 1MW0A 2QJ1A 1H3LA 1R0KA 4R5TA 1XFYA 3B34A 3B3BA 4ZW7A 3ZHZA 5JNLA 3N0RA 4QPEA 3R0IA 3CZGA 2R72A 4QHPA 3B7RL 4ZW6A 3T8VA 3A06A 2RJIA 2HPOA 4AR9A 3FUKA 4HKSA 2HPTA 3WQQA 1XFXA 1XFUA 1JG9A 4K5MA 2AO2A 2YGWA 3EBGA 4J3BA 4XMXA 3AUAA 3CHRA 3FTWA 3FUDA 3FU6A 4ZQFA 1G5AA 2EC5A 4X2UA 5BPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1S A;  1ONN A;  4FLS A;  4RCV A;  1JVS A;  2Y1E A;  1JGI A;  5JBI A;  1RP3 A;  5JC1 A;  1MW2 A;  5DUL A;  1R0L A;  2JD2 A;  5JMW A;  3UER A;  1ONO A;  2JCV A;  3AU8 A;  4Y6S A;  3CZE A;  1S46 A;  2O7G A;  4G97 A;  2Y1F A;  3IIE A;  4GAE A;  1G5A A;  2MAO A;  4ZQE A;  2LFW A;  4CXF A;  4ZQH A;  2Y1D A;  4FLR A;  1ZS2 A;  5JMP A;  3UEQ A;  2JD0 A;  4ZN6 A;  4FLQ A;  3RAS A;  3T0Y A;  1K5H A;  4Y6R A;  1SC5 A;  1MW3 A;  2JCY A;  2JCX A;  3ANM A;  1MVY A;  1Q0H A;  4Y6P A;  2MAP A;  2Y1C A;  3A14 A;  3ANL A;  3ZHX A;  3ZI0 A;  4QIC A;  2EGH A;  4LUP A;  1T1R A;  1MW1 A;  3CZK A;  3CZL A;  3AU9 A;  4A03 A;  1Q0L A;  3ANN A;  4FLO A;  3WQS B;  1OR7 A;  4KP7 A;  3UCQ A;  4AIC A;  3ZHY A;  4OOF A;  1Q0Q A;  4NQW A;  2WPG A;  1ONP A;  4AYS A;  5JO0 A;  2Y1G A;  4ZQG A;  2JD1 A;  4OOE A;  3WQR A;  2C82 A;  5JAZ A;  1MW0 A;  1H3L A;  1R0K A;  3ZHZ A;  5JNL A;  3N0R A;  3R0I A;  3CZG A;  3A06 A;  3WQQ A;  1JG9 A;  3AUA A;  4ZQF A;  4Y67 A; 
#chains in the Genus database with same CATH topology
 3C2P A;  1T1S A;  3GNC A;  3X29 A;  5M4K A;  2RFQ A;  4RCV A;  4R5X A;  3TZ4 A;  4XMU A;  1EGD A;  2Y1E A;  1JGI A;  1H19 A;  3PUU A;  5K3G A;  3EBH A;  3Q24 A;  4DPR A;  4ZQT A;  4XN8 A;  3AFE A;  3GM6 A;  2EBA A;  3M9V A;  3CHP A;  2E80 A;  4Y6S A;  2CJ8 A;  2ZXG A;  3Q44 A;  3TZ5 A;  5HNH A;  4ARF A;  3VVL A;  4KTO A;  3IIE A;  4ZQE A;  4RSY A;  2LFW A;  4HKS A;  4MKT A;  4L1F A;  1EGE A;  4H81 A;  3FTS A;  4BKX A;  2VF1 A;  3UEQ A;  4FLQ A;  3F29 A;  4Q4E A;  4K5L A;  2C12 A;  1MW3 A;  3TOR A;  1RJ4 A;  3FUE A;  2VJ8 A;  2FP1 A;  4E01 A;  2JCX A;  2ZAF A;  4L3Y A;  4L2L A;  3EON A;  3CHO A;  3RKH A;  4AKH A;  4Y6P A;  2MAP A;  2YYM A;  2Z1Q A;  3P4T A;  2Y1C A;  4ZX3 A;  4XN4 A;  2E81 A;  4QIR A;  4QUO A;  3VKH A;  5M4N A;  5DYF A;  2XQ0 A;  1X8Z A;  4XMW A;  3L1T A;  5BRK A;  3B96 A;  3SXQ A;  3D1I A;  4LUP A;  3CE2 A;  2BU6 A;  3FUN A;  1Q0L A;  1FS8 A;  4FLO A;  2DQ6 A;  1FS9 A;  4FCA A;  1OR7 A;  3BNJ A;  3B7U X;  2IX6 A;  4NQW A;  3S7W A;  2WPG A;  3C3L A;  2ZO5 A;  2VLA A;  5GJW E;  3FTZ A;  3Q43 A;  5J6A A;  3U9W A;  3EBI A;  3CXB A;  5DLL A;  5K3I A;  4R5T A;  4DOY A;  3B34 A;  5JNL A;  2R03 A;  4QPE A;  3BNF A;  3CZG A;  2R72 A;  2C0U A;  2YYK A;  3CRL A;  3BNH A;  2HPO A;  4KCF A;  3FUK A;  1XFU A;  1JG9 A;  2YGW A;  4L38 A;  3EBG A;  4J3B A;  2ZDX A;  2VIG A;  3AUA A;  3CHR A;  3FU6 A;  4ZX5 A;  4LQS B;  4X2U A;  1GW6 A;  4FLS A;  3CHQ A;  1SIR A;  4JEK A;  3D9D A;  2RF7 A;  2ZDY A;  3B7S A;  4RVB A;  1JM6 A;  1RP3 A;  5JC1 A;  4K5O A;  4V26 A;  1SG7 A;  2R02 A;  2YYG A;  1R0L A;  1GKX A;  2JD2 A;  5JMW A;  3B7T A;  2HJN A;  3D9G A;  3R7K A;  2WZG A;  3CRK A;  4ZX6 A;  2GBB A;  3CZE A;  3II9 A;  1OAH A;  3LGQ A;  2Y1F A;  4GAE A;  3KML A;  2MAO A;  3FH5 A;  4CXF A;  4G5E A;  4FZ4 A;  2J7A A;  4IV6 A;  3RC3 A;  2JD0 A;  1XFW A;  2BU5 A;  4XMV A;  5B5V A;  3RAS A;  2PGG A;  1K5H A;  3VVM A;  4Y6R A;  3TZ2 A;  2REH A;  2JCY A;  2CX9 A;  1HS6 A;  4ZX4 A;  3QJX A;  3FUH A;  3ANM A;  1GKZ A;  4MS6 A;  4MPC A;  1XFV A;  2B61 A;  3ANL A;  4R7L A;  2FON A;  3JT1 A;  2BTZ A;  3OWA A;  3FUL A;  5HNF A;  3UU9 A;  2PUS A;  4A03 A;  2EBH X;  3ANN A;  4FF2 A;  4XMZ A;  1QDB A;  3D6B A;  2QR4 A;  3B2X A;  4KSF A;  4FF3 A;  3FTU A;  4KP7 A;  4AIC A;  1R3B A;  3B2P A;  2E0A A;  2R05 A;  4OOF A;  1ONP A;  5BRM A;  4ZQG A;  2ZKJ A;  2XPY A;  4MPN A;  4O5M A;  1X3W A;  2R0N A;  4XND A;  2JBT A;  2FFL A;  1XFY A;  4ZW7 A;  4HR3 A;  3SWO A;  3R0I A;  4X28 A;  2CJ4 A;  2WBI A;  3WQQ A;  1XFX A;  2AO2 A;  1Y8N A;  2UXW A;  4Q5B A;  2BU8 A;  2VR0 A;  1G5A A;  1IVH A;  3MDE A;  1EGC A;  1JQI A;  2JBS A;  1K8T A;  5AEN A;  3FU5 A;  1K93 A;  4U83 A;  1W07 A;  4XN2 A;  3Q0A A;  2BU7 A;  3LG1 A;  2QVW A;  2OR0 A;  4XO3 A;  3FTV A;  3UER A;  1ONO A;  3FUF A;  2WZF A;  2JCV A;  5HLT A;  3UBR A;  5K3H A;  4Q5C A;  3CHS A;  3MPI A;  1PK0 A;  3NF4 A;  1S46 A;  2O7G A;  4G97 A;  4XNB A;  2JV7 A;  3FH8 A;  3FU3 A;  4XN1 A;  4XN7 A;  4ZQH A;  4JND A;  4Q1O A;  4ZW8 A;  4DZY A;  4M9A A;  4L3Z A;  4FLR A;  1ZS2 A;  5JMP A;  2R59 A;  4H7Q A;  2R70 A;  5FWQ A;  3T0Y A;  2FP2 A;  1SC5 A;  1RJ1 A;  4XO4 A;  4XN5 A;  4XNA A;  3X0Y A;  4XMT A;  4QME A;  2OEV A;  1MVY A;  1Q0H A;  5EV7 A;  2F6L A;  1X91 A;  1BUC A;  4GAA A;  2DVL A;  2OJQ A;  3ZHX A;  4AKI A;  4NXL A;  3ZI0 A;  3FTX A;  4QIC A;  2Q8H A;  4XN9 A;  2EGH A;  1Y8O A;  2CJ5 A;  2DDH A;  3PFD A;  1MW1 A;  2A1T A;  3CZK A;  4W9U A;  3AU9 A;  4Q4U A;  4MPE A;  3D2R A;  3MPJ A;  3D9F A;  3WQS B;  2XS8 A;  3CIA A;  4HKR A;  3MMO A;  4JIZ A;  1XG2 B;  1XFZ A;  3UCQ A;  3OIB A;  2YYI A;  1Q0Q A;  3AFF A;  2OEX A;  1WS9 A;  1RX0 A;  2D29 A;  5JO0 A;  4MP7 A;  2RDZ A;  2Q8G A;  3C46 A;  2JD1 A;  4OOE A;  4KS9 A;  1T9G A;  3BNG A;  3VAD A;  3KED A;  2YYJ A;  3FO3 A;  4E02 A;  1MW0 A;  3HWC A;  1H3L A;  1R0K A;  2IX5 A;  3ZHZ A;  4OO2 A;  3B7R L;  3A06 A;  2RJI A;  4AR9 A;  1GU6 A;  3MXL A;  2BU2 A;  2Q8I A;  4J1V A;  2PNR A;  5B5W A;  1R2J A;  3FTW A;  4Y67 A;  2EC5 A;  4H85 A;  5BPP A;  3FUI A;  4E00 A;  4KSA A;  1ONN A;  3FUM A;  4ZW5 A;  3GQT A;  2JIF A;  4LQQ B;  4RM7 A;  5K3J A;  1SQM A;  4Q4I A;  1UDY A;  4F0X A;  1JVS A;  5JBI A;  5B6B A;  4K5P A;  3FUJ A;  4ZXV A;  1MW2 A;  2YYL A;  5DUL A;  2CJ6 A;  3X0X A;  3Q23 A;  3TZ0 A;  3D9E A;  3RC8 A;  5M4P A;  3AU8 A;  4AKG A;  3FHE A;  1GJV A;  1SK6 A;  1Y0V A;  3MKH A;  2AZE A;  4ZW3 A;  4AR8 A;  4PVB A;  3SF6 A;  3MDD A;  2Y1D A;  2XPZ A;  2EBF X;  4Q0T A;  2XS1 A;  3FCJ A;  4AR1 A;  1X90 A;  4ZN6 A;  2Q8F A;  3SCE A;  2PO4 A;  4V25 A;  1S26 A;  1U8V A;  3FU0 A;  3EOM A;  5M4M A;  1LVC A;  4N5F A;  5J71 A;  2A7O A;  2OT4 A;  4Q17 A;  3A14 A;  3OWM A;  1SIQ A;  4K5N A;  3JSZ A;  4XVX A;  3HW2 A;  3VKG A;  1FS7 A;  2JBR A;  1T1R A;  1PI1 A;  4FF4 A;  3CZL A;  4AI6 A;  4WJY A;  2C5Z A;  4JIO A;  4P79 A;  2GTQ A;  3FH7 A;  3ZHY A;  3Q22 A;  4P13 A;  4X28 C;  4IRN A;  1X3Z A;  4FF1 A;  1Y8P A;  3FTY A;  4L3X A;  1IS2 A;  4XO5 A;  5GJV E;  4AYS A;  1UKW A;  3B37 A;  2Y1G A;  4PU2 A;  2DQM A;  4R5V A;  4ZYJ A;  1K90 A;  4PW4 A;  3TTB A;  3WQR A;  2PL5 A;  2C82 A;  4MP2 A;  5JAZ A;  2QJ1 A;  2R0M A;  3B3B A;  2CJ7 A;  3N0R A;  2XQR B;  4QHP A;  4ZW6 A;  3T8V A;  2PG0 A;  2HPT A;  4K5M A;  4XMX A;  4ZQF A;  3FUD A; 
#chains in the Genus database with same CATH homology
 3C2P A;  1T1S A;  3X29 A;  3FUI A;  1GW6 A;  4KSA A;  1ONN A;  3CHQ A;  4FLS A;  3FUM A;  4RCV A;  4ZW5 A;  5AEN A;  1K8T A;  4R5X A;  1SQM A;  4Q4I A;  3B7S A;  4XMU A;  3FU5 A;  1JVS A;  2Y1E A;  1JGI A;  1H19 A;  4RVB A;  5JBI A;  4K5P A;  4XN2 A;  1RP3 A;  1K93 A;  3Q0A A;  3PUU A;  3FUJ A;  5JC1 A;  1MW2 A;  2QVW A;  4K5O A;  1SG7 A;  3EBH A;  5DUL A;  3Q24 A;  4DPR A;  4XO3 A;  4ZQT A;  1R0L A;  3FTV A;  4XN8 A;  3Q23 A;  2JD2 A;  5JMW A;  3RC8 A;  3B7T A;  3UER A;  1ONO A;  3FUF A;  2WZF A;  2JCV A;  3AU8 A;  5HLT A;  4AKG A;  2WZG A;  3CHP A;  3CHS A;  4Y6S A;  1PK0 A;  4ZX6 A;  3FHE A;  1SK6 A;  2GBB A;  1Y0V A;  2ZXG A;  3Q44 A;  3CZE A;  1S46 A;  5HNH A;  4ARF A;  2O7G A;  4G97 A;  2Y1F A;  3VVL A;  4XNB A;  3IIE A;  4GAE A;  2AZE A;  3KML A;  2MAO A;  4RSY A;  4ZQE A;  4ZW3 A;  3FH5 A;  4AR8 A;  2JV7 A;  4PVB A;  4MKT A;  3FH8 A;  3FU3 A;  4XN1 A;  4XN7 A;  4CXF A;  4ZQH A;  4JND A;  2Y1D A;  2XPZ A;  2EBF X;  4ZW8 A;  4FZ4 A;  3FTS A;  4FLR A;  4BKX A;  1ZS2 A;  3RC3 A;  2VF1 A;  5JMP A;  3UEQ A;  4AR1 A;  2JD0 A;  2R59 A;  1XFW A;  4XMV A;  4FLQ A;  4ZN6 A;  3RAS A;  2R70 A;  5FWQ A;  2PGG A;  4K5L A;  4Q4E A;  1K5H A;  3T0Y A;  3VVM A;  4Y6R A;  2FP2 A;  1SC5 A;  2PO4 A;  1MW3 A;  4XO4 A;  1S26 A;  3FUE A;  2JCY A;  2VJ8 A;  3FU0 A;  4XN5 A;  2JCX A;  1HS6 A;  4XNA A;  4ZX4 A;  1LVC A;  2FP1 A;  4L2L A;  3QJX A;  3CHO A;  4XMT A;  4QME A;  3FUH A;  3ANM A;  1MVY A;  1Q0H A;  4Y6P A;  2MAP A;  4AKH A;  2A7O A;  4MS6 A;  2Y1C A;  5EV7 A;  4ZX3 A;  4XN4 A;  2F6L A;  1XFV A;  4QIR A;  3A14 A;  4QUO A;  2B61 A;  3ANL A;  4GAA A;  3VKH A;  3ZHX A;  5DYF A;  4R7L A;  4K5N A;  4AKI A;  3JSZ A;  2XQ0 A;  4XMW A;  3ZI0 A;  3VKG A;  3FTX A;  4QIC A;  4XN9 A;  3JT1 A;  2EGH A;  4LUP A;  1T1R A;  1MW1 A;  3CE2 A;  3FUL A;  5HNF A;  4F0X A;  4FF4 A;  3CZK A;  2PUS A;  3CZL A;  3AU9 A;  3FUN A;  4A03 A;  1Q0L A;  2EBH X;  4AI6 A;  3ANN A;  4FF2 A;  4FLO A;  2DQ6 A;  4FCA A;  4XMZ A;  4HKR A;  3WQS B;  3CIA A;  2LFW A;  1OR7 A;  3B2X A;  2QR4 A;  4KSF A;  4FF3 A;  3FTU A;  2C5Z A;  1XFZ A;  4P79 A;  2GTQ A;  4KP7 A;  3UCQ A;  4AIC A;  3B7U X;  3B2P A;  3FH7 A;  3ZHY A;  3Q22 A;  4ZX5 A;  4OOF A;  1Q0Q A;  1X3Z A;  4NQW A;  2WPG A;  4FF1 A;  3FTY A;  3C3L A;  4XO5 A;  5GJV E;  1ONP A;  4AYS A;  5JO0 A;  3B37 A;  2Y1G A;  4PU2 A;  2VLA A;  5GJW E;  3FTZ A;  3Q43 A;  2DQM A;  4ZQG A;  2JD1 A;  3C46 A;  4OOE A;  2XPY A;  4R5V A;  4KS9 A;  4Y67 A;  1K90 A;  4PW4 A;  3KED A;  3U9W A;  2PL5 A;  2C82 A;  1X3W A;  3WQR A;  3EBI A;  4XND A;  2FFL A;  5DLL A;  5JAZ A;  1MW0 A;  2QJ1 A;  1H3L A;  1R0K A;  4R5T A;  1XFY A;  3B34 A;  3B3B A;  4ZW7 A;  3ZHZ A;  5JNL A;  3N0R A;  4QPE A;  3R0I A;  3CZG A;  2R72 A;  4QHP A;  3B7R L;  4ZW6 A;  3T8V A;  3A06 A;  2RJI A;  2HPO A;  4AR9 A;  3FUK A;  4HKS A;  2HPT A;  3WQQ A;  1XFX A;  1XFU A;  1JG9 A;  4K5M A;  2AO2 A;  2YGW A;  3EBG A;  4J3B A;  4XMX A;  3AUA A;  3CHR A;  3FTW A;  3FUD A;  3FU6 A;  4ZQF A;  1G5A A;  2EC5 A;  4X2U A;  5BPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...