1X3WA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
320
structure length
320
Chain Sequence
b'NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptide:N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 101
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3wA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3wA04
3HOYI 3GTOI 3HOWI 1YUAA 2JS4A 5C44I 3RZOI 3H3VJ 4X6AI 3S1MI 4BXXI 3S1NI 3HOUI 4Y7NI 2YU9I 4A3DI 3S15I 4A3JI 4BY7I 2KPIA 1NUIA 3CQZI 3S14I 1X3ZA 4XX2A 2B63I 3ESWA 1RLYA 4NBBA 4A3KI 4A3LI 3LUSA 3HOVI 2R92I 4A3II 2DE6A 3K7AI 2AKLA 1WCMI 3FKII 3GTPI 4NOZA 4NB9A 5CM2M 4A3GI 1Y1VI 4BY1I 1TWCI 1Y1WI 3EERA 4A93I 1DL6A 3VMGA 3GTMS 2K5RA 2NVYI 4A3FI 2NVQI 1SFOI 5C4XI 1USPA 4BBRI 2NVTI 5IP9I 3H0GI 3S16I 1Y1VS 2JA6I 2JNYA 4A3MI 2NVXI 2R7ZI 1RO4A 2DE7A 2E2JI 1USPB 3GKQA 2E2HI 1VLAA 3S1QI 1TWAI 4A3EI 2JA7I 4BBSI 4NBAA 1I50I 2RBLA 4NBDA 3I4NI 3PO3I 1TFIA 2R93I 3GTKI 1I6HI 2BJOA 3HOZI 1TWGI 4QTUA 1ZB9A 3I07A 3GTLI 3S1RI 2E2II 1LQLA 1WW9A 3VB9A 2JR6A 3M4OI 2HF1A 4NBCA 3PO2I 3VMIA 3M3YI 3S2HI 1X3WA 3U50C 3I4MI 3S17I 5FLMI 4QTTA 2VUMI 5IP7I 1N2FA 4NBGA 4Y52I 3GTQI 4MH4A 5C4JI 3VMHA 4NBFA 4A3BI 4NBEA 2P3YA 3GTJI 3S2DI 1K83I 2F4MA 1QYPA 1I3QI 1L1OC 3PO3S 1PFTA 2F4OA 5C3EI 1TWHI 2J6AA 3RZDI 3GCFA 2JA8I 1ML8A 4NBHA 2JA5I 2DE5A 1R9TI 1ZB8A 2PK7A 3HOXI 4A3CI 3GTGI 1TWFI 3D6WA 3Q87A 3GTMI 4NB8A
chains in the Genus database with same CATH superfamily
3FHEA 3JT1A 4CL1A 3G4S1 3H3VJ 1VQM1 3S1NI 2YU9I 3I55Z 1RO0A 3CIAA 1VQKZ 2VPZA 3J80f 3S15I 3EBHA 3UEQA 5DYFA 2KPIA 2RPRA 3CQZI 3CC7Z 4AICA 2JIOA 1RLYA 4E2YA 1Z01A 4A3KI 4XMZA 4XMTA 1JJ2Z 1K732 4RSYA 2R92I 4AR8A 5T67A 3CD6Z 3JAMb 4Q4IA 2GU2A 5T6BA 1VQ91 3NH4A 4JNDA 3AUAA 3FUKA 4ZQGA 5CM2M 4A3GI 1Y1VI 3MZKB 4OOFA 2HU9A 1JGIA 3EBGA 3WQRA 1MW3A 2K5RA 5D1PA 3I551 4A3FI 3IFUA 4RVFA 3WQQA 2H85A 1USPA 4BBRI 2NVTI 4NFRA 3H0GI 3B2XA 1WIIA 4XN4A 1ZH1A 5FLXf 4A03A 1KC82 4RS4A 3IX0A 1H19A 2R7ZI 2DE7A 2E2JI 3ANLA 4Y6RA 1VQLZ 3S1QI 1VLAA 3CCM1 2JA7I 4R5XA 1QVFZ 4BBSI 3PO3I 1RQFA 2R93I 2DQ6A 2MAPA 1VQOZ 3FU3A 4R5VA 1Q7Y2 3HOZI 3NDIA 3GTLI 4ZX6A 3CZKA 2E2II 2C82A 3FQMA 2PGGA 3VVLA 2HF1A 4ZX3A 3FTXA 4XO4A 1Q16A 3HW2A 3M3YI 1K5HA 3S2HI 1X3WA 3ZHZA 3U50C 3S17I 1YUKA 1NP6A 5FLMI 2JD1A 2VUMI 1W2BY 4Y52I 4X2UA 4NBGA 1YHQ1 3CZLA 3GTQI 3CC41 4E30A 1MW2A 1Q0HA 4NBFA 3VMHA 2AYDA 2O53A 2P28A 2QRCB 3AU8A 1I3QI 1L1OC 2F4OA 4XO5A 3CPWY 2J6AA 3HKZA 3RZDI 3GCFA 2JA8I 2XQ0A 1ML8A 1FDIA 2ZXGA 1YJWZ 1N8R2 1ZB8A 5A2Qb 3FU6A 3HOXI 4A3CI 4Y6PA 1TWFI 4E31A 3G6EZ 4NB8A 1H3LA 2OTL1 1VQN1 3BG1B 3FUJA 2VUGA 5T64A 2QEX1 3GTOI 1YJNZ 1YUAA 4ZW7A 1ONPA 2JS4A 1KD12 1ONOA 3VTNA 3RZOI 3FTSA 5HNHA 1K9M2 2Y0SA 3CCL1 4K5MA 3S1MI 3F3FC 4XN2A 4XN1A 1FDOA 1VQ7Z 1YI21 3CHQA 4XO3A 4A3JI 3A14A 2W03A 4BY7I 2Y1DA 3CCU1 3ESWA 2VJ8A 4J3BA 2Q51A 2PUSA 3G6E1 4KP7A 2R59A 1MVYA 3KIHA 4E2XA 2QJ1A 1P9NA 3CXCZ 2AKLA 1T1RA 3FUMA 3QJXA 3J81f 4NOZA 4ZX5A 2LEXA 3OW2Z 3ZHXA 3FH8A 1Q861 4AYSA 5BPPA 1WJ2A 3FTYA 1S46A 3FUHA 4ZW3A 1VQ71 3CCSZ 2NVQI 3QWUA 4XN5A 3F3PC 4AR1A 3S16I 1YIT1 3ANNA 1Y1VS 3CCR1 1SC5A 2XPZA 5IT9f 4Q4EA 3CC21 1RO4A 2V8KA 4QUOA 1USPB 3GKQA 1VQ8Z 1TWAI 2OOYB 3NDJA 3TDHB 3FU0A 3I4NI 1I50I 1TFIA 2YADA 4OOEA 4K5LA 1S7MA 2WAQA 4GAAA 2IV2X 3CCVZ 3CMEZ 4ARFA 4ZQTA 3I07A 3RC3A 3CCJZ 2RJIA 2QA4Z 2V8IA 1LQLA 4TNUA 2JCYA 3VB9A 2JR6A 1KQSZ 3M4OI 1VQK1 1QVGZ 4MD8A 1Q821 4XMXA 3CC71 3NH8A 3VMIA 2C5ZA 3CCEZ 3I4MI 1VQ6Z 2JCVA 2NAPA 4Y6SA 3CD61 2A7OA 1OR7A 4R5TA 5HLTA 3S14I 3UCQA 3CME1 3CXBA 5FWQA 4XN9A 3CCJ1 3B2PA 4NBEA 1KRLA 1K8A2 2P3YA 3GTJI 2FFLA 1K83I 1PFTA 5C3EI 2JCXA 1Q0QA 1JJ2Y 2WZFA 3FUEA 1NJI1 1VQL1 3BG0B 1SIWA 2V3VA 3Q87A 4K5OA 4NQWA 3P5JB 4ZQEA 4S1TA 5JO0A 3JAMf 4FCAA 1M1K1 3FU5A 1VQO1 3IIEA 4MS6A 4X6AI 2QREB 3PUUA 4RVBA 4EWCA 2W04A 4Y7NI 2EGHA 1M902 4ZN6A 4XNBA 2O4HA 3B7TA 1NUIA 3RASA 1X3ZA 2O7GA 4E2ZA 3I56Z 4RVHA 4ZW8A 1QXFA 4HGYA 4A3LI 3FTUA 1ONNA 1QVFY 3HOVI 4A3II 3FULA 2IZ3A 2DE6A 4AR9A 3FKII 2Y1GA 2VLAA 4FLSA 1YIJZ 3GTPI 4K5PA 1ZS2A 3A06A 2IZ4A 3Q43A 2XPYA 1TWCI 2JIMA 2VPWA 3EERA 1SG7A 3U9WA 1Y1WI 4A93I 1DL6A 3GTMS 2NVYI 1Q811 1VQPZ 1VQ5Z 1YJ9Z 4DPRA 4QMEA 1SFOI 4BKXA 3B7UX 2G2KA 4PVBA 5IP9I 3J80b 2K3RA 4E33A 2R6MA 2JA6I 3I561 3FH5A 1YJW1 3ZHYA 2JNYA 3CHSA 5D1OB 3T4NB 4E32A 4QHPA 4FLOA 4XNDA 3FQQA 2E2HI 1MW0A 3NFZA 4NBAA 1JVSA 2QVWA 2RBLA 4NBDA 3CMAZ 1R0LA 3G71Z 4XN7A 1N8R1 1YJN1 3GTKI 3G4SZ 1I6HI 4QTUA 1ZB9A 3B37A 2JV7A 4MXUA 3S1RI 3JSZA 1VQMZ 1VQ51 4RCVA 5DLLA 1YJ91 4K5NA 2OZKA 1G5AA 2JD2A 1WW9A 4XMUA 5D1OA 2DQMA 3KEDA 3ANMA 4NBCA 1K9M1 3CCQZ 3CZGA 3T8VA 4QTTA 3FUFA 5A2Qf 5HNFA 3FUIA 1WZNA 2GTHA 4MD7A 2E7ZA 5IP7I 2KI7B 3G711 5JAZA 1VQ9Z 2R72A 1Q822 4A3BI 2QR1B 3IR7A 2M6NA 3UERA 4XMWA 2F4MA 3D2LA 4MRIA 4RV9A 3CCS1 1S72Z 1VQ4Z 2WZGA 3PO3S 4XMVA 4GAEA 3EEDA 2Y1CA 4HGZA 2Y1FA 3CCQ1 4NBHA 3RC8A 2JMOA 2OOXB 1Q0LA 1R9TI 5JNLA 2JUBA 1VQ81 3GTGI 3D6WA 3CXCY 3ZI0A 3CCMZ 3NH5A 2EGTA 5JMPA 1AA6A 5AN9F 3OW2Y 4ZX4A 1JG9A 4AYBA 1W2BZ 3HOYI 3HOWI 3FUNA 1RO2A 5C44I 3CCV1 4XN8A 3AU9A 5LL6f 1K731 2Q4ZA 2QA41 1Y8CA 2M48A 1VQ41 1S721 1MW1A 4QIRA 2JIRA 1NJI2 4BXXI 3HOUI 2V45A 3B34A 4A3DI 4MD9A 4XNAA 2R70A 4DK1A 4FLRA 4MKTA 3CHOA 2WB1A 3CPWZ 4QPEA 4LUPA 4XX2A 1R0KA 1M1K2 5JC1A 1RNIA 2B63I 3CCE1 2VF1A 2I3CA 4NBBA 3KIFA 3LUSA 1VQ61 5JBIA 4DQYB 3CZEA 1HS6A 3K7AI 4NH1C 3EBIA 1YHQZ 3B3BA 1WCMI 2WPGA 5EV7A 1KC81 1Z02A 3CC4Z 4NB9A 3IF8A 4BY1I 4RVGA 3FTZA 2QKDA 3FTVA 4RVDA 2JIQA 2Y1EA 3VMGA 1KQSY 1QVGY 5C4XI 3Q44A 3CHPA 1Q7Y1 3T0YA 3MZLB 2RHBA 2GTQA 1K8A1 3FTWA 1X0TA 4A3MI 2NVXI 3D9XA 3B7SA 2OTJZ 2PM9A 5DULA 2VPXA 4ZQHA 4HH4A 4A3EI 2E9HA 2OTLZ 1VQNZ 1Q812 2QEXZ 2HPOA 2LFUA 3J81b 2BJOA 1TWGI 4PU2A 3J7A4 2HPTA 3TE5B 3CCLZ 4FLQA 4PW4A 4E2WA 1YI2Z 2QRDB 3R0IA 3FH7A 3CCUZ 3PO2I 2ZAEB 5IT9b 2OTJ1 2V8JA 1QF8A 4Y67A 1Q862 1M901 2RIQA 4MONA 2JIPA 1N2FA 3MONA 4CXFA 4ZW5A 1YIJ1 1RP3A 5AENA 4MH4A 5C4JI 1SQMA 1T1SA 2PL5A 4ZW6A 4L2LA 2GTIA 3S2DI 4DGLA 5JMWA 1JWHC 1VQP1 1QYPA 3B7RL 2PMZA 2RT9A 3FUDA 1TWHI 1YITZ 1KD11 4R7LA 3CCRZ 3WQSB 4ZQFA 2JA5I 1GW6A 5FLXb 2DE5A 2LIYA 2VPYA 3CC2Z 2JD0A 3CHRA 2PK7A 3GTMI 2MAOA 1Z03A 2QLVB 3CMA1 3VVMA 2B61A
chains in the Genus database with same CATH topology
3FHEA 3JT1A 4CL1A 3G4S1 3H3VJ 1VQM1 3S1NI 2YU9I 3I55Z 1RO0A 3CIAA 1VQKZ 3S15I 3J80f 3EBHA 3UEQA 5DYFA 2KPIA 2RPRA 3CQZI 3CC7Z 4AICA 1RLYA 4E2YA 1Z01A 4A3KI 4XMZA 4XMTA 1JJ2Z 1K732 4RSYA 2R92I 4AR8A 5T67A 3CD6Z 3JAMb 4Q4IA 2GU2A 5T6BA 1VQ91 3NH4A 4JNDA 3AUAA 3FUKA 4ZQGA 5CM2M 4A3GI 1Y1VI 3MZKB 4OOFA 2HU9A 1JGIA 3EBGA 3WQRA 1MW3A 2K5RA 5D1PA 3I551 4A3FI 3IFUA 4RVFA 3WQQA 2H85A 1USPA 4BBRI 2NVTI 4NFRA 3H0GI 3B2XA 1WIIA 4XN4A 1ZH1A 5FLXf 4A03A 1KC82 4RS4A 3IX0A 1H19A 2R7ZI 2DE7A 2E2JI 3ANLA 4Y6RA 1VQLZ 3S1QI 1VLAA 3CCM1 2JA7I 4R5XA 1QVFZ 4BBSI 3PO3I 1RQFA 2R93I 2DQ6A 2MAPA 1VQOZ 3FU3A 4R5VA 1Q7Y2 3HOZI 3NDIA 3GTLI 4ZX6A 3CZKA 2E2II 2C82A 3FQMA 2PGGA 3VVLA 2HF1A 4ZX3A 3FTXA 4XO4A 3M3YI 1K5HA 3S2HI 1X3WA 3ZHZA 3U50C 3S17I 1YUKA 1NP6A 5FLMI 2JD1A 2VUMI 1W2BY 4Y52I 4X2UA 4NBGA 1YHQ1 3CZLA 3GTQI 3CC41 4E30A 1MW2A 1Q0HA 4NBFA 3VMHA 2O53A 2P28A 2QRCB 3AU8A 1I3QI 1L1OC 2F4OA 4XO5A 3CPWY 2J6AA 3HKZA 3RZDI 3GCFA 2JA8I 2XQ0A 1ML8A 2ZXGA 1YJWZ 1N8R2 1ZB8A 5A2Qb 3FU6A 3HOXI 4A3CI 4Y6PA 1TWFI 4E31A 3G6EZ 4NB8A 1H3LA 2OTL1 1VQN1 3BG1B 3FUJA 2VUGA 5T64A 2QEX1 3GTOI 1YJNZ 1YUAA 4ZW7A 1ONPA 2JS4A 1KD12 1ONOA 3VTNA 3RZOI 3FTSA 5HNHA 1K9M2 2Y0SA 3CCL1 4K5MA 3S1MI 3F3FC 4XN2A 4XN1A 1YI21 1VQ7Z 3CHQA 4XO3A 4A3JI 3A14A 2W03A 4BY7I 2Y1DA 3CCU1 3ESWA 2VJ8A 4J3BA 2Q51A 2PUSA 3G6E1 4KP7A 2R59A 1MVYA 3KIHA 4E2XA 2QJ1A 1P9NA 3CXCZ 2AKLA 1T1RA 3FUMA 3QJXA 3J81f 4NOZA 4ZX5A 3OW2Z 3ZHXA 3FH8A 1Q861 4AYSA 5BPPA 3FTYA 1S46A 3FUHA 4ZW3A 1VQ71 3CCSZ 2NVQI 3QWUA 4XN5A 3F3PC 4AR1A 3S16I 1YIT1 3ANNA 1Y1VS 3CCR1 1SC5A 2XPZA 5IT9f 4Q4EA 3CC21 1RO4A 2V8KA 4QUOA 1USPB 3GKQA 1VQ8Z 1TWAI 2OOYB 3NDJA 3TDHB 3FU0A 3I4NI 1I50I 1TFIA 2YADA 4OOEA 4K5LA 1S7MA 2WAQA 4GAAA 3CCVZ 3CMEZ 4ARFA 4ZQTA 3I07A 3RC3A 3CCJZ 2RJIA 2QA4Z 2V8IA 1LQLA 4TNUA 2JCYA 3VB9A 2JR6A 1KQSZ 3M4OI 1VQK1 1QVGZ 4MD8A 1Q821 4XMXA 3CC71 3NH8A 3VMIA 2C5ZA 3CCEZ 3I4MI 1VQ6Z 2JCVA 4Y6SA 3CD61 2A7OA 1OR7A 4R5TA 5HLTA 3S14I 3UCQA 3CME1 5FWQA 4XN9A 3CCJ1 3B2PA 4NBEA 1KRLA 1K8A2 2P3YA 3GTJI 2FFLA 1K83I 1PFTA 5C3EI 2JCXA 1Q0QA 1JJ2Y 2WZFA 3FUEA 1NJI1 1VQL1 3BG0B 3Q87A 4K5OA 4NQWA 3P5JB 4ZQEA 4S1TA 5JO0A 3JAMf 4FCAA 1M1K1 3FU5A 1VQO1 3IIEA 4MS6A 4X6AI 2QREB 3PUUA 4RVBA 4EWCA 2W04A 4Y7NI 2EGHA 1M902 4ZN6A 4XNBA 2O4HA 3B7TA 1NUIA 3RASA 1X3ZA 2O7GA 4E2ZA 3I56Z 4RVHA 4ZW8A 4HGYA 4A3LI 3FTUA 1ONNA 1QVFY 3HOVI 4A3II 3FULA 2IZ3A 2DE6A 4AR9A 3FKII 2Y1GA 2VLAA 4FLSA 1YIJZ 3GTPI 4K5PA 1ZS2A 3A06A 2IZ4A 3Q43A 2XPYA 1TWCI 1Y1WI 3EERA 4A93I 1SG7A 3U9WA 1DL6A 3GTMS 2NVYI 1Q811 1VQPZ 1VQ5Z 1YJ9Z 4DPRA 4QMEA 1SFOI 4BKXA 3B7UX 2G2KA 4PVBA 5IP9I 3J80b 2K3RA 4E33A 2R6MA 2JA6I 3I561 3FH5A 1YJW1 3ZHYA 2JNYA 3CHSA 5D1OB 3T4NB 4E32A 4QHPA 4FLOA 4XNDA 3FQQA 2E2HI 1MW0A 3NFZA 4NBAA 1JVSA 2QVWA 2RBLA 4NBDA 3CMAZ 1R0LA 3G71Z 4XN7A 1N8R1 1YJN1 3GTKI 3G4SZ 1I6HI 4QTUA 1ZB9A 3B37A 2JV7A 4MXUA 3S1RI 3JSZA 1VQMZ 1VQ51 4RCVA 5DLLA 1YJ91 4K5NA 2OZKA 1G5AA 2JD2A 1WW9A 4XMUA 5D1OA 2DQMA 3KEDA 3ANMA 4NBCA 1K9M1 3CCQZ 3CZGA 3T8VA 4QTTA 3FUFA 5A2Qf 5HNFA 3FUIA 2GTHA 4MD7A 5IP7I 2KI7B 3G711 5JAZA 1VQ9Z 2R72A 1Q822 4A3BI 2QR1B 2M6NA 3UERA 4XMWA 2F4MA 4MRIA 3CCS1 4RV9A 1S72Z 1VQ4Z 3PO3S 2WZGA 4XMVA 4GAEA 3EEDA 2Y1CA 4HGZA 2Y1FA 3CCQ1 4NBHA 3RC8A 2JMOA 2OOXB 1Q0LA 1R9TI 5JNLA 2JUBA 1VQ81 3GTGI 3D6WA 3CXCY 3ZI0A 3CCMZ 3NH5A 2EGTA 5JMPA 5AN9F 3OW2Y 4ZX4A 1JG9A 4AYBA 1W2BZ 3HOYI 3HOWI 3FUNA 1RO2A 5C44I 3CCV1 4XN8A 3AU9A 5LL6f 1K731 2Q4ZA 2QA41 2M48A 1VQ41 1S721 1MW1A 4QIRA 1NJI2 4BXXI 3HOUI 3B34A 4A3DI 4MD9A 4XNAA 2R70A 4DK1A 4FLRA 4MKTA 3CHOA 2WB1A 3CPWZ 4QPEA 4LUPA 4XX2A 1R0KA 1M1K2 5JC1A 1RNIA 2B63I 3CCE1 2VF1A 2I3CA 4NBBA 3KIFA 3LUSA 1VQ61 5JBIA 4DQYB 3CZEA 1HS6A 3K7AI 4NH1C 3EBIA 1YHQZ 3B3BA 1WCMI 2WPGA 5EV7A 1KC81 1Z02A 3CC4Z 4NB9A 3IF8A 4BY1I 4RVGA 3FTZA 2QKDA 3FTVA 4RVDA 2Y1EA 3VMGA 1KQSY 1QVGY 5C4XI 3Q44A 3CHPA 1Q7Y1 3T0YA 3MZLB 2RHBA 2GTQA 1K8A1 3FTWA 1X0TA 4A3MI 2NVXI 3D9XA 3B7SA 2OTJZ 2PM9A 5DULA 4ZQHA 4HH4A 4A3EI 2E9HA 2OTLZ 1VQNZ 1Q812 2QEXZ 2HPOA 2LFUA 3J81b 2BJOA 1TWGI 4PU2A 3J7A4 2HPTA 3TE5B 3CCLZ 4FLQA 4PW4A 4E2WA 1YI2Z 2QRDB 3R0IA 3FH7A 3CCUZ 3PO2I 2ZAEB 5IT9b 2OTJ1 2V8JA 1QF8A 4Y67A 1Q862 1M901 2RIQA 4MONA 1N2FA 3MONA 4CXFA 4ZW5A 1YIJ1 1RP3A 5AENA 4MH4A 5C4JI 1SQMA 1T1SA 2PL5A 4ZW6A 4L2LA 2GTIA 3S2DI 4DGLA 5JMWA 1JWHC 1VQP1 1QYPA 3B7RL 2PMZA 2RT9A 3FUDA 1TWHI 1YITZ 1KD11 4R7LA 3CCRZ 3WQSB 4ZQFA 2JA5I 1GW6A 5FLXb 2DE5A 2LIYA 3CC2Z 2JD0A 3CHRA 2PK7A 3GTMI 2MAOA 1Z03A 2QLVB 3CMA1 3VVMA 2B61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  3GTO I;  3HOW I;  1YUA A;  2JS4 A;  5C44 I;  3RZO I;  3H3V J;  4X6A I;  3S1M I;  4BXX I;  3S1N I;  3HOU I;  4Y7N I;  2YU9 I;  4A3D I;  3S15 I;  4A3J I;  4BY7 I;  2KPI A;  1NUI A;  3CQZ I;  3S14 I;  1X3Z A;  4XX2 A;  2B63 I;  3ESW A;  1RLY A;  4NBB A;  4A3K I;  4A3L I;  3LUS A;  3HOV I;  2R92 I;  4A3I I;  2DE6 A;  3K7A I;  2AKL A;  1WCM I;  3FKI I;  3GTP I;  4NOZ A;  4NB9 A;  5CM2 M;  4A3G I;  1Y1V I;  4BY1 I;  1TWC I;  1Y1W I;  3EER A;  4A93 I;  1DL6 A;  3VMG A;  3GTM S;  2K5R A;  2NVY I;  4A3F I;  2NVQ I;  1SFO I;  5C4X I;  1USP A;  4BBR I;  2NVT I;  5IP9 I;  3H0G I;  3S16 I;  1Y1V S;  2JA6 I;  2JNY A;  4A3M I;  2NVX I;  2R7Z I;  1RO4 A;  2DE7 A;  2E2J I;  1USP B;  3GKQ A;  2E2H I;  1VLA A;  3S1Q I;  1TWA I;  4A3E I;  2JA7 I;  4BBS I;  4NBA A;  1I50 I;  2RBL A;  4NBD A;  3I4N I;  3PO3 I;  1TFI A;  2R93 I;  3GTK I;  1I6H I;  2BJO A;  3HOZ I;  1TWG I;  4QTU A;  1ZB9 A;  3I07 A;  3GTL I;  3S1R I;  2E2I I;  1LQL A;  1WW9 A;  3VB9 A;  2JR6 A;  3M4O I;  2HF1 A;  4NBC A;  3PO2 I;  3VMI A;  3M3Y I;  3S2H I;  1X3W A;  3U50 C;  3I4M I;  3S17 I;  5FLM I;  4QTT A;  2VUM I;  5IP7 I;  1N2F A;  4NBG A;  4Y52 I;  3GTQ I;  4MH4 A;  5C4J I;  3VMH A;  4NBF A;  4A3B I;  4NBE A;  2P3Y A;  3GTJ I;  3S2D I;  1K83 I;  2F4M A;  1QYP A;  1I3Q I;  1L1O C;  3PO3 S;  1PFT A;  2F4O A;  5C3E I;  1TWH I;  2J6A A;  3RZD I;  3GCF A;  2JA8 I;  1ML8 A;  4NBH A;  2JA5 I;  2DE5 A;  1R9T I;  1ZB8 A;  2PK7 A;  3HOX I;  4A3C I;  3GTG I;  1TWF I;  3D6W A;  3Q87 A;  3GTM I;  4NB8 A; 
#chains in the Genus database with same CATH topology
 3FHE A;  3JT1 A;  4CL1 A;  3G4S 1;  3H3V J;  1VQM 1;  3S1N I;  2YU9 I;  3I55 Z;  1RO0 A;  3CIA A;  1VQK Z;  2VPZ A;  3J80 f;  3S15 I;  3EBH A;  3UEQ A;  5DYF A;  2KPI A;  2RPR A;  3CQZ I;  3CC7 Z;  4AIC A;  2JIO A;  1RLY A;  4E2Y A;  1Z01 A;  4A3K I;  4XMZ A;  4XMT A;  1JJ2 Z;  1K73 2;  4RSY A;  2R92 I;  4AR8 A;  5T67 A;  3CD6 Z;  3JAM b;  4Q4I A;  2GU2 A;  5T6B A;  1VQ9 1;  3NH4 A;  4JND A;  3AUA A;  3FUK A;  4ZQG A;  5CM2 M;  4A3G I;  1Y1V I;  3MZK B;  4OOF A;  2HU9 A;  1JGI A;  3EBG A;  3WQR A;  1MW3 A;  2K5R A;  5D1P A;  3I55 1;  4A3F I;  3IFU A;  4RVF A;  3WQQ A;  2H85 A;  1USP A;  4BBR I;  2NVT I;  4NFR A;  3H0G I;  3B2X A;  1WII A;  4XN4 A;  1ZH1 A;  5FLX f;  4A03 A;  1KC8 2;  4RS4 A;  3IX0 A;  1H19 A;  2R7Z I;  2DE7 A;  2E2J I;  3ANL A;  4Y6R A;  1VQL Z;  3S1Q I;  1VLA A;  3CCM 1;  2JA7 I;  4R5X A;  1QVF Z;  4BBS I;  3PO3 I;  1RQF A;  2R93 I;  2DQ6 A;  2MAP A;  1VQO Z;  3FU3 A;  4R5V A;  1Q7Y 2;  3HOZ I;  3NDI A;  3GTL I;  4ZX6 A;  3CZK A;  2E2I I;  2C82 A;  3FQM A;  2PGG A;  3VVL A;  2HF1 A;  4ZX3 A;  3FTX A;  4XO4 A;  1Q16 A;  3HW2 A;  3M3Y I;  1K5H A;  3S2H I;  1X3W A;  3ZHZ A;  3U50 C;  3S17 I;  1YUK A;  1NP6 A;  5FLM I;  2JD1 A;  2VUM I;  1W2B Y;  4Y52 I;  4X2U A;  4NBG A;  1YHQ 1;  3CZL A;  3GTQ I;  3CC4 1;  4E30 A;  1MW2 A;  1Q0H A;  4NBF A;  3VMH A;  2AYD A;  2O53 A;  2P28 A;  2QRC B;  3AU8 A;  1I3Q I;  1L1O C;  2F4O A;  4XO5 A;  3CPW Y;  2J6A A;  3HKZ A;  3RZD I;  3GCF A;  2JA8 I;  2XQ0 A;  1ML8 A;  1FDI A;  2ZXG A;  1YJW Z;  1N8R 2;  1ZB8 A;  5A2Q b;  3FU6 A;  3HOX I;  4A3C I;  4Y6P A;  1TWF I;  4E31 A;  3G6E Z;  4NB8 A;  1H3L A;  2OTL 1;  1VQN 1;  3BG1 B;  3FUJ A;  2VUG A;  5T64 A;  2QEX 1;  3GTO I;  1YJN Z;  1YUA A;  4ZW7 A;  1ONP A;  2JS4 A;  1KD1 2;  1ONO A;  3VTN A;  3RZO I;  3FTS A;  5HNH A;  1K9M 2;  2Y0S A;  3CCL 1;  4K5M A;  3S1M I;  3F3F C;  4XN2 A;  4XN1 A;  1FDO A;  1VQ7 Z;  1YI2 1;  3CHQ A;  4XO3 A;  4A3J I;  3A14 A;  2W03 A;  4BY7 I;  2Y1D A;  3CCU 1;  3ESW A;  2VJ8 A;  4J3B A;  2Q51 A;  2PUS A;  3G6E 1;  4KP7 A;  2R59 A;  1MVY A;  3KIH A;  4E2X A;  2QJ1 A;  1P9N A;  3CXC Z;  2AKL A;  1T1R A;  3FUM A;  3QJX A;  3J81 f;  4NOZ A;  4ZX5 A;  2LEX A;  3OW2 Z;  3ZHX A;  3FH8 A;  1Q86 1;  4AYS A;  5BPP A;  1WJ2 A;  3FTY A;  1S46 A;  3FUH A;  4ZW3 A;  1VQ7 1;  3CCS Z;  2NVQ I;  3QWU A;  4XN5 A;  3F3P C;  4AR1 A;  3S16 I;  1YIT 1;  3ANN A;  1Y1V S;  3CCR 1;  1SC5 A;  2XPZ A;  5IT9 f;  4Q4E A;  3CC2 1;  1RO4 A;  2V8K A;  4QUO A;  1USP B;  3GKQ A;  1VQ8 Z;  1TWA I;  2OOY B;  3NDJ A;  3TDH B;  3FU0 A;  3I4N I;  1I50 I;  1TFI A;  2YAD A;  4OOE A;  4K5L A;  1S7M A;  2WAQ A;  4GAA A;  2IV2 X;  3CCV Z;  3CME Z;  4ARF A;  4ZQT A;  3I07 A;  3RC3 A;  3CCJ Z;  2RJI A;  2QA4 Z;  2V8I A;  1LQL A;  4TNU A;  2JCY A;  3VB9 A;  2JR6 A;  1KQS Z;  3M4O I;  1VQK 1;  1QVG Z;  4MD8 A;  1Q82 1;  4XMX A;  3CC7 1;  3NH8 A;  3VMI A;  2C5Z A;  3CCE Z;  3I4M I;  1VQ6 Z;  2JCV A;  2NAP A;  4Y6S A;  3CD6 1;  2A7O A;  1OR7 A;  4R5T A;  5HLT A;  3S14 I;  3UCQ A;  3CME 1;  3CXB A;  5FWQ A;  4XN9 A;  3CCJ 1;  3B2P A;  4NBE A;  1KRL A;  1K8A 2;  2P3Y A;  3GTJ I;  2FFL A;  1K83 I;  1PFT A;  5C3E I;  2JCX A;  1Q0Q A;  1JJ2 Y;  2WZF A;  3FUE A;  1NJI 1;  1VQL 1;  3BG0 B;  1SIW A;  2V3V A;  3Q87 A;  4K5O A;  4NQW A;  3P5J B;  4ZQE A;  4S1T A;  5JO0 A;  3JAM f;  4FCA A;  1M1K 1;  3FU5 A;  1VQO 1;  3IIE A;  4MS6 A;  4X6A I;  2QRE B;  3PUU A;  4RVB A;  4EWC A;  2W04 A;  4Y7N I;  2EGH A;  1M90 2;  4ZN6 A;  4XNB A;  2O4H A;  3B7T A;  1NUI A;  3RAS A;  1X3Z A;  2O7G A;  4E2Z A;  3I56 Z;  4RVH A;  4ZW8 A;  1QXF A;  4HGY A;  4A3L I;  3FTU A;  1ONN A;  1QVF Y;  3HOV I;  4A3I I;  3FUL A;  2IZ3 A;  2DE6 A;  4AR9 A;  3FKI I;  2Y1G A;  2VLA A;  4FLS A;  1YIJ Z;  3GTP I;  4K5P A;  1ZS2 A;  3A06 A;  2IZ4 A;  3Q43 A;  2XPY A;  1TWC I;  2JIM A;  2VPW A;  3EER A;  1SG7 A;  3U9W A;  1Y1W I;  4A93 I;  1DL6 A;  3GTM S;  2NVY I;  1Q81 1;  1VQP Z;  1VQ5 Z;  1YJ9 Z;  4DPR A;  4QME A;  1SFO I;  4BKX A;  3B7U X;  2G2K A;  4PVB A;  5IP9 I;  3J80 b;  2K3R A;  4E33 A;  2R6M A;  2JA6 I;  3I56 1;  3FH5 A;  1YJW 1;  3ZHY A;  2JNY A;  3CHS A;  5D1O B;  3T4N B;  4E32 A;  4QHP A;  4FLO A;  4XND A;  3FQQ A;  2E2H I;  1MW0 A;  3NFZ A;  4NBA A;  1JVS A;  2QVW A;  2RBL A;  4NBD A;  3CMA Z;  1R0L A;  3G71 Z;  4XN7 A;  1N8R 1;  1YJN 1;  3GTK I;  3G4S Z;  1I6H I;  4QTU A;  1ZB9 A;  3B37 A;  2JV7 A;  4MXU A;  3S1R I;  3JSZ A;  1VQM Z;  1VQ5 1;  4RCV A;  5DLL A;  1YJ9 1;  4K5N A;  2OZK A;  1G5A A;  2JD2 A;  1WW9 A;  4XMU A;  5D1O A;  2DQM A;  3KED A;  3ANM A;  4NBC A;  1K9M 1;  3CCQ Z;  3CZG A;  3T8V A;  4QTT A;  3FUF A;  5A2Q f;  5HNF A;  3FUI A;  1WZN A;  2GTH A;  4MD7 A;  2E7Z A;  5IP7 I;  2KI7 B;  3G71 1;  5JAZ A;  1VQ9 Z;  2R72 A;  1Q82 2;  4A3B I;  2QR1 B;  3IR7 A;  2M6N A;  3UER A;  4XMW A;  2F4M A;  3D2L A;  4MRI A;  4RV9 A;  3CCS 1;  1S72 Z;  1VQ4 Z;  2WZG A;  3PO3 S;  4XMV A;  4GAE A;  3EED A;  2Y1C A;  4HGZ A;  2Y1F A;  3CCQ 1;  4NBH A;  3RC8 A;  2JMO A;  2OOX B;  1Q0L A;  1R9T I;  5JNL A;  2JUB A;  1VQ8 1;  3GTG I;  3D6W A;  3CXC Y;  3ZI0 A;  3CCM Z;  3NH5 A;  2EGT A;  5JMP A;  1AA6 A;  5AN9 F;  3OW2 Y;  4ZX4 A;  1JG9 A;  4AYB A;  1W2B Z;  3HOY I;  3HOW I;  3FUN A;  1RO2 A;  5C44 I;  3CCV 1;  4XN8 A;  3AU9 A;  5LL6 f;  1K73 1;  2Q4Z A;  2QA4 1;  1Y8C A;  2M48 A;  1VQ4 1;  1S72 1;  1MW1 A;  4QIR A;  2JIR A;  1NJI 2;  4BXX I;  3HOU I;  2V45 A;  3B34 A;  4A3D I;  4MD9 A;  4XNA A;  2R70 A;  4DK1 A;  4FLR A;  4MKT A;  3CHO A;  2WB1 A;  3CPW Z;  4QPE A;  4LUP A;  4XX2 A;  1R0K A;  1M1K 2;  5JC1 A;  1RNI A;  2B63 I;  3CCE 1;  2VF1 A;  2I3C A;  4NBB A;  3KIF A;  3LUS A;  1VQ6 1;  5JBI A;  4DQY B;  3CZE A;  1HS6 A;  3K7A I;  4NH1 C;  3EBI A;  1YHQ Z;  3B3B A;  1WCM I;  2WPG A;  5EV7 A;  1KC8 1;  1Z02 A;  3CC4 Z;  4NB9 A;  3IF8 A;  4BY1 I;  4RVG A;  3FTZ A;  2QKD A;  3FTV A;  4RVD A;  2JIQ A;  2Y1E A;  3VMG A;  1KQS Y;  1QVG Y;  5C4X I;  3Q44 A;  3CHP A;  1Q7Y 1;  3T0Y A;  3MZL B;  2RHB A;  2GTQ A;  1K8A 1;  3FTW A;  1X0T A;  4A3M I;  2NVX I;  3D9X A;  3B7S A;  2OTJ Z;  2PM9 A;  5DUL A;  2VPX A;  4ZQH A;  4HH4 A;  4A3E I;  2E9H A;  2OTL Z;  1VQN Z;  1Q81 2;  2QEX Z;  2HPO A;  2LFU A;  3J81 b;  2BJO A;  1TWG I;  4PU2 A;  3J7A 4;  2HPT A;  3TE5 B;  3CCL Z;  4FLQ A;  4PW4 A;  4E2W A;  1YI2 Z;  2QRD B;  3R0I A;  3FH7 A;  3CCU Z;  3PO2 I;  2ZAE B;  5IT9 b;  2OTJ 1;  2V8J A;  1QF8 A;  4Y67 A;  1Q86 2;  1M90 1;  2RIQ A;  4MON A;  2JIP A;  1N2F A;  3MON A;  4CXF A;  4ZW5 A;  1YIJ 1;  1RP3 A;  5AEN A;  4MH4 A;  5C4J I;  1SQM A;  1T1S A;  2PL5 A;  4ZW6 A;  4L2L A;  2GTI A;  3S2D I;  4DGL A;  5JMW A;  1JWH C;  1VQP 1;  1QYP A;  3B7R L;  2PMZ A;  2RT9 A;  3FUD A;  1TWH I;  1YIT Z;  1KD1 1;  4R7L A;  3CCR Z;  3WQS B;  4ZQF A;  2JA5 I;  1GW6 A;  5FLX b;  2DE5 A;  2LIY A;  2VPY A;  3CC2 Z;  2JD0 A;  3CHR A;  2PK7 A;  3GTM I;  2MAO A;  1Z03 A;  2QLV B;  3CMA 1;  3VVM A;  2B61 A; 
#chains in the Genus database with same CATH homology
 3FHE A;  3JT1 A;  4CL1 A;  3G4S 1;  3H3V J;  1VQM 1;  3S1N I;  2YU9 I;  3I55 Z;  1RO0 A;  3CIA A;  1VQK Z;  3S15 I;  3J80 f;  3EBH A;  3UEQ A;  5DYF A;  2KPI A;  2RPR A;  3CQZ I;  3CC7 Z;  4AIC A;  1RLY A;  4E2Y A;  1Z01 A;  4A3K I;  4XMZ A;  4XMT A;  1JJ2 Z;  1K73 2;  4RSY A;  2R92 I;  4AR8 A;  5T67 A;  3CD6 Z;  3JAM b;  4Q4I A;  2GU2 A;  5T6B A;  1VQ9 1;  3NH4 A;  4JND A;  3AUA A;  3FUK A;  4ZQG A;  5CM2 M;  4A3G I;  1Y1V I;  3MZK B;  4OOF A;  2HU9 A;  1JGI A;  3EBG A;  3WQR A;  1MW3 A;  2K5R A;  5D1P A;  3I55 1;  4A3F I;  3IFU A;  4RVF A;  3WQQ A;  2H85 A;  1USP A;  4BBR I;  2NVT I;  4NFR A;  3H0G I;  3B2X A;  1WII A;  4XN4 A;  1ZH1 A;  5FLX f;  4A03 A;  1KC8 2;  4RS4 A;  3IX0 A;  1H19 A;  2R7Z I;  2DE7 A;  2E2J I;  3ANL A;  4Y6R A;  1VQL Z;  3S1Q I;  1VLA A;  3CCM 1;  2JA7 I;  4R5X A;  1QVF Z;  4BBS I;  3PO3 I;  1RQF A;  2R93 I;  2DQ6 A;  2MAP A;  1VQO Z;  3FU3 A;  4R5V A;  1Q7Y 2;  3HOZ I;  3NDI A;  3GTL I;  4ZX6 A;  3CZK A;  2E2I I;  2C82 A;  3FQM A;  2PGG A;  3VVL A;  2HF1 A;  4ZX3 A;  3FTX A;  4XO4 A;  3M3Y I;  1K5H A;  3S2H I;  1X3W A;  3ZHZ A;  3U50 C;  3S17 I;  1YUK A;  1NP6 A;  5FLM I;  2JD1 A;  2VUM I;  1W2B Y;  4Y52 I;  4X2U A;  4NBG A;  1YHQ 1;  3CZL A;  3GTQ I;  3CC4 1;  4E30 A;  1MW2 A;  1Q0H A;  4NBF A;  3VMH A;  2O53 A;  2P28 A;  2QRC B;  3AU8 A;  1I3Q I;  1L1O C;  2F4O A;  4XO5 A;  3CPW Y;  2J6A A;  3HKZ A;  3RZD I;  3GCF A;  2JA8 I;  2XQ0 A;  1ML8 A;  2ZXG A;  1YJW Z;  1N8R 2;  1ZB8 A;  5A2Q b;  3FU6 A;  3HOX I;  4A3C I;  4Y6P A;  1TWF I;  4E31 A;  3G6E Z;  4NB8 A;  1H3L A;  2OTL 1;  1VQN 1;  3BG1 B;  3FUJ A;  2VUG A;  5T64 A;  2QEX 1;  3GTO I;  1YJN Z;  1YUA A;  4ZW7 A;  1ONP A;  2JS4 A;  1KD1 2;  1ONO A;  3VTN A;  3RZO I;  3FTS A;  5HNH A;  1K9M 2;  2Y0S A;  3CCL 1;  4K5M A;  3S1M I;  3F3F C;  4XN2 A;  4XN1 A;  1YI2 1;  1VQ7 Z;  3CHQ A;  4XO3 A;  4A3J I;  3A14 A;  2W03 A;  4BY7 I;  2Y1D A;  3CCU 1;  3ESW A;  2VJ8 A;  4J3B A;  2Q51 A;  2PUS A;  3G6E 1;  4KP7 A;  2R59 A;  1MVY A;  3KIH A;  4E2X A;  2QJ1 A;  1P9N A;  3CXC Z;  2AKL A;  1T1R A;  3FUM A;  3QJX A;  3J81 f;  4NOZ A;  4ZX5 A;  3OW2 Z;  3ZHX A;  3FH8 A;  1Q86 1;  4AYS A;  5BPP A;  3FTY A;  1S46 A;  3FUH A;  4ZW3 A;  1VQ7 1;  3CCS Z;  2NVQ I;  3QWU A;  4XN5 A;  3F3P C;  4AR1 A;  3S16 I;  1YIT 1;  3ANN A;  1Y1V S;  3CCR 1;  1SC5 A;  2XPZ A;  5IT9 f;  4Q4E A;  3CC2 1;  1RO4 A;  2V8K A;  4QUO A;  1USP B;  3GKQ A;  1VQ8 Z;  1TWA I;  2OOY B;  3NDJ A;  3TDH B;  3FU0 A;  3I4N I;  1I50 I;  1TFI A;  2YAD A;  4OOE A;  4K5L A;  1S7M A;  2WAQ A;  4GAA A;  3CCV Z;  3CME Z;  4ARF A;  4ZQT A;  3I07 A;  3RC3 A;  3CCJ Z;  2RJI A;  2QA4 Z;  2V8I A;  1LQL A;  4TNU A;  2JCY A;  3VB9 A;  2JR6 A;  1KQS Z;  3M4O I;  1VQK 1;  1QVG Z;  4MD8 A;  1Q82 1;  4XMX A;  3CC7 1;  3NH8 A;  3VMI A;  2C5Z A;  3CCE Z;  3I4M I;  1VQ6 Z;  2JCV A;  4Y6S A;  3CD6 1;  2A7O A;  1OR7 A;  4R5T A;  5HLT A;  3S14 I;  3UCQ A;  3CME 1;  5FWQ A;  4XN9 A;  3CCJ 1;  3B2P A;  4NBE A;  1KRL A;  1K8A 2;  2P3Y A;  3GTJ I;  2FFL A;  1K83 I;  1PFT A;  5C3E I;  2JCX A;  1Q0Q A;  1JJ2 Y;  2WZF A;  3FUE A;  1NJI 1;  1VQL 1;  3BG0 B;  3Q87 A;  4K5O A;  4NQW A;  3P5J B;  4ZQE A;  4S1T A;  5JO0 A;  3JAM f;  4FCA A;  1M1K 1;  3FU5 A;  1VQO 1;  3IIE A;  4MS6 A;  4X6A I;  2QRE B;  3PUU A;  4RVB A;  4EWC A;  2W04 A;  4Y7N I;  2EGH A;  1M90 2;  4ZN6 A;  4XNB A;  2O4H A;  3B7T A;  1NUI A;  3RAS A;  1X3Z A;  2O7G A;  4E2Z A;  3I56 Z;  4RVH A;  4ZW8 A;  4HGY A;  4A3L I;  3FTU A;  1ONN A;  1QVF Y;  3HOV I;  4A3I I;  3FUL A;  2IZ3 A;  2DE6 A;  4AR9 A;  3FKI I;  2Y1G A;  2VLA A;  4FLS A;  1YIJ Z;  3GTP I;  4K5P A;  1ZS2 A;  3A06 A;  2IZ4 A;  3Q43 A;  2XPY A;  1TWC I;  1Y1W I;  3EER A;  4A93 I;  1SG7 A;  3U9W A;  1DL6 A;  3GTM S;  2NVY I;  1Q81 1;  1VQP Z;  1VQ5 Z;  1YJ9 Z;  4DPR A;  4QME A;  1SFO I;  4BKX A;  3B7U X;  2G2K A;  4PVB A;  5IP9 I;  3J80 b;  2K3R A;  4E33 A;  2R6M A;  2JA6 I;  3I56 1;  3FH5 A;  1YJW 1;  3ZHY A;  2JNY A;  3CHS A;  5D1O B;  3T4N B;  4E32 A;  4QHP A;  4FLO A;  4XND A;  3FQQ A;  2E2H I;  1MW0 A;  3NFZ A;  4NBA A;  1JVS A;  2QVW A;  2RBL A;  4NBD A;  3CMA Z;  1R0L A;  3G71 Z;  4XN7 A;  1N8R 1;  1YJN 1;  3GTK I;  3G4S Z;  1I6H I;  4QTU A;  1ZB9 A;  3B37 A;  2JV7 A;  4MXU A;  3S1R I;  3JSZ A;  1VQM Z;  1VQ5 1;  4RCV A;  5DLL A;  1YJ9 1;  4K5N A;  2OZK A;  1G5A A;  2JD2 A;  1WW9 A;  4XMU A;  5D1O A;  2DQM A;  3KED A;  3ANM A;  4NBC A;  1K9M 1;  3CCQ Z;  3CZG A;  3T8V A;  4QTT A;  3FUF A;  5A2Q f;  5HNF A;  3FUI A;  2GTH A;  4MD7 A;  5IP7 I;  2KI7 B;  3G71 1;  5JAZ A;  1VQ9 Z;  2R72 A;  1Q82 2;  4A3B I;  2QR1 B;  2M6N A;  3UER A;  4XMW A;  2F4M A;  4MRI A;  3CCS 1;  4RV9 A;  1S72 Z;  1VQ4 Z;  3PO3 S;  2WZG A;  4XMV A;  4GAE A;  3EED A;  2Y1C A;  4HGZ A;  2Y1F A;  3CCQ 1;  4NBH A;  3RC8 A;  2JMO A;  2OOX B;  1Q0L A;  1R9T I;  5JNL A;  2JUB A;  1VQ8 1;  3GTG I;  3D6W A;  3CXC Y;  3ZI0 A;  3CCM Z;  3NH5 A;  2EGT A;  5JMP A;  5AN9 F;  3OW2 Y;  4ZX4 A;  1JG9 A;  4AYB A;  1W2B Z;  3HOY I;  3HOW I;  3FUN A;  1RO2 A;  5C44 I;  3CCV 1;  4XN8 A;  3AU9 A;  5LL6 f;  1K73 1;  2Q4Z A;  2QA4 1;  2M48 A;  1VQ4 1;  1S72 1;  1MW1 A;  4QIR A;  1NJI 2;  4BXX I;  3HOU I;  3B34 A;  4A3D I;  4MD9 A;  4XNA A;  2R70 A;  4DK1 A;  4FLR A;  4MKT A;  3CHO A;  2WB1 A;  3CPW Z;  4QPE A;  4LUP A;  4XX2 A;  1R0K A;  1M1K 2;  5JC1 A;  1RNI A;  2B63 I;  3CCE 1;  2VF1 A;  2I3C A;  4NBB A;  3KIF A;  3LUS A;  1VQ6 1;  5JBI A;  4DQY B;  3CZE A;  1HS6 A;  3K7A I;  4NH1 C;  3EBI A;  1YHQ Z;  3B3B A;  1WCM I;  2WPG A;  5EV7 A;  1KC8 1;  1Z02 A;  3CC4 Z;  4NB9 A;  3IF8 A;  4BY1 I;  4RVG A;  3FTZ A;  2QKD A;  3FTV A;  4RVD A;  2Y1E A;  3VMG A;  1KQS Y;  1QVG Y;  5C4X I;  3Q44 A;  3CHP A;  1Q7Y 1;  3T0Y A;  3MZL B;  2RHB A;  2GTQ A;  1K8A 1;  3FTW A;  1X0T A;  4A3M I;  2NVX I;  3D9X A;  3B7S A;  2OTJ Z;  2PM9 A;  5DUL A;  4ZQH A;  4HH4 A;  4A3E I;  2E9H A;  2OTL Z;  1VQN Z;  1Q81 2;  2QEX Z;  2HPO A;  2LFU A;  3J81 b;  2BJO A;  1TWG I;  4PU2 A;  3J7A 4;  2HPT A;  3TE5 B;  3CCL Z;  4FLQ A;  4PW4 A;  4E2W A;  1YI2 Z;  2QRD B;  3R0I A;  3FH7 A;  3CCU Z;  3PO2 I;  2ZAE B;  5IT9 b;  2OTJ 1;  2V8J A;  1QF8 A;  4Y67 A;  1Q86 2;  1M90 1;  2RIQ A;  4MON A;  1N2F A;  3MON A;  4CXF A;  4ZW5 A;  1YIJ 1;  1RP3 A;  5AEN A;  4MH4 A;  5C4J I;  1SQM A;  1T1S A;  2PL5 A;  4ZW6 A;  4L2L A;  2GTI A;  3S2D I;  4DGL A;  5JMW A;  1JWH C;  1VQP 1;  1QYP A;  3B7R L;  2PMZ A;  2RT9 A;  3FUD A;  1TWH I;  1YIT Z;  1KD1 1;  4R7L A;  3CCR Z;  3WQS B;  4ZQF A;  2JA5 I;  1GW6 A;  5FLX b;  2DE5 A;  2LIY A;  3CC2 Z;  2JD0 A;  3CHR A;  2PK7 A;  3GTM I;  2MAO A;  1Z03 A;  2QLV B;  3CMA 1;  3VVM A;  2B61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...