1X3WA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptide:N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 101
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3wA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3wA04
2KPIA 3LUSA 3GTGI 4A93I 4X6AI 1K83I 1ZB8A 2VUMI 3I4NI 4NBHA 3EERA 4NBFA 3HOZI 3Q87A 4Y52I 2JNYA 3S1QI 2DE5A 1USPB 3RZDI 1QYPA 1TWGI 3H3VJ 1DL6A 4NOZA 4A3FI 4A3LI 4A3KI 2JA8I 1TWCI 4A3MI 3S1MI 2E2HI 2NVTI 3S16I 1X3ZA 3GTMI 1WW9A 3HOVI 2E2JI 1TWAI 2BJOA 2J6AA 1I50I 5CM2M 3GTPI 1I3QI 3GTMS 3M3YI 3U50C 3S14I 1PFTA 3PO3I 4NBDA 2JR6A 1N2FA 4QTUA 1Y1VI 2JS4A 2F4OA 4NBBA 1VLAA 4A3JI 5IP9I 4A3II 4A3BI 3M4OI 2P3YA 3VMIA 3PO2I 3PO3S 3S2DI 3HOUI 2RBLA 1R9TI 2B63I 1Y1VS 1WCMI 2JA6I 2R93I 1ML8A 4A3EI 5C44I 4XX2A 3FKII 3S1RI 3HOYI 3S17I 2R7ZI 2AKLA 1I6HI 4MH4A 1USPA 3I4MI 3K7AI 4NBAA 1L1OC 4BBRI 4BY1I 4A3CI 1RLYA 1NUIA 1YUAA 4Y7NI 2E2II 2YU9I 4NB8A 2JA7I 3HOXI 1TFIA 3GCFA 3S15I 1RO4A 3GTOI 4BXXI 2K5RA 3GKQA 4A3GI 2R92I 4A3DI 2F4MA 2NVQI 4BBSI 3VMHA 3GTKI 1TWHI 3GTQI 5C4JI 3S2HI 4QTTA 3D6WA 2PK7A 3CQZI 2NVYI 3S1NI 3VB9A 1TWFI 3RZOI 1LQLA 4BY7I 3VMGA 4NBGA 1X3WA 5FLMI 2HF1A 5C3EI 3GTLI 3I07A 2DE7A 1ZB9A 2NVXI 3ESWA 2DE6A 4NBEA 5C4XI 3H0GI 3HOWI 4NB9A 4NBCA 3GTJI 1SFOI 2JA5I 5IP7I 1Y1WI
chains in the Genus database with same CATH superfamily
4EWCA 2WZGA 4E2XA 1RO2A 3CZKA 2V8IA 2GTQA 3JSZA 2VF1A 2R59A 4A93I 4FLQA 1Q7Y2 1ZB8A 4PVBA 4QPEA 3I4NI 3A06A 4BKXA 1MVYA 4ZX4A 3UCQA 2PM9A 4E2ZA 1Q861 4XNAA 3ZI0A 4XO3A 3CCLZ 2R70A 3EBGA 4XO5A 4ZQTA 1NP6A 4A3MI 3CXCZ 4ZW3A 3RASA 1RQFA 3T0YA 3AU8A 3CXCY 2Y1EA 1VQL1 1I50I 3GTPI 4DPRA 5D1OB 1JVSA 3NFZA 3IR7A 1T1RA 4AYBA 1YHQ1 2MAPA 3J7A4 2O7GA 2F4OA 4NBBA 2C82A 3CCR1 5IT9b 5BPPA 3ANNA 3CCJ1 5IP9I 1K9M2 3ANLA 3PO3S 3PO2I 1Q811 4RV9A 3HOUI 5JMWA 3CCE1 4ZW8A 1Y1VS 2R93I 3FTWA 5LL6f 4RSYA 3RC8A 4A3EI 5JBIA 1WIIA 4A03A 3S1RI 1YHQZ 1VQM1 2AKLA 4K5MA 3FH8A 4FCAA 1L1OC 4BBRI 3FH5A 1YJN1 2QRCB 2QA41 3CCRZ 1YUAA 2E2II 1Z02A 4Y6SA 3I551 4AR1A 3B7RL 3CCJZ 3CCM1 4PW4A 3OW2Y 4ZX3A 4R7LA 4DGLA 3GTOI 4BXXI 3NH8A 2RPRA 3CCEZ 1OR7A 2QLVB 3CZEA 4LUPA 1Q0LA 4QUOA 4E2YA 2GU2A 1NJI1 2NVQI 4MKTA 1VQMZ 3MONA 1YJNZ 2QA4Z 3FU3A 2EGTA 2PK7A 4XN1A 2NVYI 3NDJA 3VB9A 1LQLA 4BY7I 3VMGA 4NBGA 2Y1DA 1KQSZ 1VQ91 3CD61 2JIPA 5C3EI 2QRDB 2EGHA 4MONA 4RCVA 2WAQA 1ZB9A 3CCS1 1Q862 2NVXI 2C5ZA 4XO4A 1JJ2Y 1RNIA 2OOXB 2PUSA 3MZKB 4NBCA 2O53A 3IFUA 1SFOI 3FUEA 4ZN6A 2E2HI 2KPIA 5FWQA 2M48A 2K3RA 4RVGA 2Y1GA 2JIOA 3FTXA 3FQQA 2B61A 3CD6Z 1K5HA 1K83I 3CCU1 3PUUA 3CCSZ 3Q44A 1YJW1 3F3PC 2FFLA 4NBHA 3CC71 2IZ4A 3CCV1 3S1QI 2DE5A 3P5JB 1QYPA 4MD9A 5A2Qf 1K8A1 3H3VJ 5JMPA 1KRLA 2JIMA 3ZHXA 1ONPA 4FLRA 3EEDA 1M902 4A3LI 3FTUA 4NFRA 1TWCI 3Q43A 3IX0A 4MD7A 3CCUZ 1Q812 3S16I 3CPWY 2NVTI 1YJWZ 4OOFA 2Y0SA 3HOVI 1HS6A 1TWAI 1N8R1 1R0LA 4XMTA 1MW2A 1AA6A 1VQ41 3T8VA 1H19A 3VVLA 3CCVZ 3CC41 4AR8A 4ZW6A 1I3QI 3EBIA 3EBHA 4R5XA 3G6E1 5T64A 3PO3I 1SG7A 4MD8A 3FUKA 2PMZA 4FLSA 3WQRA 2VLAA 1Y1VI 2VPXA 1ZH1A 3KIHA 4GAEA 1VLAA 3B7TA 5T6BA 2A7OA 4Q4IA 1NJI2 3S2DI 3M4OI 3B3BA 3VMIA 1MW3A 1H3LA 3WQQA 2DQMA 3KIFA 2E9HA 3CC4Z 4ZX5A 1WCMI 1S721 3G6EZ 3FTZA 2R7ZI 1G5AA 2QJ1A 3I4MI 4NBAA 5JNLA 1Z01A 1YJ91 4Y7NI 4Y6PA 1KD11 5A2Qb 3HW2A 1GW6A 1FDOA 2LFUA 2JA7I 3GCFA 3QWUA 4HH4A 3B2PA 2Y1FA 4XN7A 4TNUA 2IV2X 3J80f 2R92I 4K5PA 1FDIA 2Q4ZA 2F4MA 4NH1C 4BBSI 3GTKI 1S72Z 1VQLZ 2RT9A 3GTQI 5D1PA 2OTL1 1Y8CA 3CHRA 1YIT1 1MW1A 4QTTA 4PU2A 1YJ9Z 3D6WA 2Y1CA 4XMUA 3S1NI 4ZQGA 4AYSA 3RZOI 4RS4A 4ZX6A 1RP3A 5HNFA 4FLOA 4XN4A 5JC1A 2VUGA 3D2LA 3FTYA 2V8KA 2JCYA 3CHQA 2JIRA 3GTLI 3CZGA 1S7MA 3I07A 2YADA 3FU6A 3FULA 2E7ZA 4XN8A 1K8A2 3H0GI 1K731 3CMA1 2PGGA 4J3BA 3B37A 1YITZ 2KI7B 4ZQEA 1Y1WI 2OTJ1 3B34A 5DLLA 2QEX1 1Q821 4E2WA 3LUSA 1N8R2 3G4S1 2LEXA 4ZQFA 2AYDA 2R72A 1M1K1 3I55Z 4X2UA 3CCMZ 5FLXb 3HOZI 3Q87A 5DULA 4Y52I 4XMVA 1SQMA 3R0IA 4AICA 1KQSY 3BG0B 3RZDI 2OTJZ 4AR9A 1TWGI 3ZHYA 3J80b 3CC21 4A3FI 4A3KI 1QVFZ 2JA8I 1KC81 4JNDA 3G4SZ 4QHPA 3S1MI 1X3ZA 1VQ71 1VQK1 2BJOA 4CXFA 4R5TA 4Y6RA 1VQ9Z 3TE5B 3UEQA 4RVDA 4E30A 3GTMS 3M3YI 1R0KA 3BG1B 3CC2Z 1KD12 3S14I 1PFTA 4S1TA 4NBDA 4ZW5A 1N2FA 4K5NA 3T4NB 2XPYA 4L2LA 4K5OA 4QTUA 1QVGZ 2H85A 3CZLA 1SC5A 5T67A 1VQKZ 3FUFA 2JD0A 4A3BI 2P3YA 1VQN1 4KP7A 1Q0QA 3FUMA 1YUKA 2RBLA 2VPZA 2MAOA 2P28A 2B63I 2JA6I 4XN9A 1ML8A 2OOYB 1ONOA 5C44I 2V45A 3CC7Z 3S17I 5EV7A 4MH4A 1WZNA 1USPA 2O4HA 3K7AI 3CCQ1 5AN9F 4BY1I 4A3CI 1RLYA 1NUIA 2OZKA 3RC3A 1VQO1 4Q4EA 4HGYA 2VJ8A 2YU9I 4NB8A 3HOXI 1TFIA 3S15I 1VQNZ 3AUAA 1K732 2XPZA 2K5RA 4XMZA 4QMEA 1YIJ1 1Z03A 4A3DI 3CCL1 1Q822 2V8JA 5JO0A 1VQ4Z 2JCVA 2HPOA 2WPGA 5C4JI 3NDIA 3CCQZ 4DQYB 4NQWA 1VQOZ 3U9WA 5IP7I 1M1K2 1W2BZ 2ZAEB 3ANMA 4QIRA 3CHPA 2JMOA 1W2BY 2PL5A 3CIAA 3AU9A 2DE7A 3FHEA 5FLXf 2M6NA 1YIJZ 3HKZA 4MXUA 3ESWA 5C4XI 4NBEA 2R6MA 1ZS2A 2NAPA 3FTVA 4NB9A 1KC82 4DK1A 3NH5A 4HGZA 3GTJI 3J81b 2JA5I 3JAMf 3KEDA 3UERA 1VQ51 1RO0A 1P9NA 3GTGI 3B7SA 4X6AI 3A14A 5HLTA 2GTHA 4GAAA 2Q51A 3G711 1Q16A 2VUMI 1Q0HA 3EERA 4NBFA 2QKDA 3CHSA 2JNYA 1X0TA 2JIQA 2I3CA 1USPB 1JGIA 3JT1A 3FTSA 5JAZA 1VQ5Z 1YI21 1DL6A 4NOZA 1M901 3F3FC 4XN2A 2WB1A 2OTLZ 1VQP1 3D9XA 2V3VA 3GTMI 1WW9A 3G71Z 3FUDA 3IIEA 3FUJA 2E2JI 4RVHA 2J6AA 5CM2M 1Q7Y1 2XQ0A 4ARFA 2JUBA 2RHBA 3FH7A 4R5VA 3OW2Z 5AENA 1YI2Z 3U50C 2WZFA 3CMAZ 2JD2A 4RVBA 2JR6A 1VQPZ 2W03A 4XMWA 2RIQA 3VTNA 2JS4A 1VQ61 2QEXZ 4ZQHA 3MZLB 4A3JI 3JAMb 2QVWA 3NH4A 4A3II 1MW0A 4OOEA 1QVFY 3QJXA 4E32A 4E31A 1R9TI 3FU0A 3TDHB 4MS6A 4XX2A 3FKII 3HOYI 3WQSB 3FUNA 2LIYA 1I6HI 2VPWA 2JD1A 1VQ81 1SIWA 2HPTA 1WJ2A 1VQ6Z 4XN5A 1JJ2Z 4XNBA 4E33A 3B7UX 1JWHC 1S46A 2GTIA 1RO4A 4CL1A 2QREB 3VVMA 3GKQA 1T1SA 3CXBA 4A3GI 1VQ7Z 1QVGY 3CME1 1K9M1 3FQMA 3VMHA 1TWHI 4XNDA 2HU9A 2QR1B 3J81f 4MRIA 5D1OA 1VQ8Z 4Y67A 3I561 3S2HI 1JG9A 3IF8A 2VPYA 1QF8A 4RVFA 2RJIA 3B2XA 3CQZI 5HNHA 3CHOA 3ZHZA 1TWFI 2IZ3A 2W04A 1X3WA 3FUHA 1QXFA 5FLMI 2HF1A 5DYFA 4ZW7A 3FU5A 3CMEZ 2DQ6A 2DE6A 4XMXA 3FUIA 2G2KA 3HOWI 4K5LA 2ZXGA 2JCXA 3CPWZ 2JV7A 3I56Z 5IT9f 1ONNA
chains in the Genus database with same CATH topology
4EWCA 2WZGA 4E2XA 1RO2A 3CZKA 2V8IA 2GTQA 3JSZA 2VF1A 2R59A 4A93I 4FLQA 1Q7Y2 1ZB8A 4PVBA 4QPEA 3I4NI 3A06A 4BKXA 1MVYA 4ZX4A 3UCQA 2PM9A 4E2ZA 1Q861 4XNAA 3ZI0A 4XO3A 3CCLZ 2R70A 3EBGA 4XO5A 4ZQTA 1NP6A 4A3MI 3CXCZ 4ZW3A 3RASA 1RQFA 3T0YA 3AU8A 3CXCY 2Y1EA 1VQL1 1I50I 3GTPI 4DPRA 5D1OB 1JVSA 3NFZA 1T1RA 4AYBA 1YHQ1 2MAPA 3J7A4 2O7GA 2F4OA 4NBBA 2C82A 3CCR1 5IT9b 5BPPA 3ANNA 3CCJ1 5IP9I 1K9M2 3ANLA 3PO3S 3PO2I 1Q811 4RV9A 3HOUI 5JMWA 3CCE1 4ZW8A 1Y1VS 2R93I 3FTWA 5LL6f 4RSYA 3RC8A 4A3EI 5JBIA 1WIIA 4A03A 3S1RI 1YHQZ 1VQM1 2AKLA 4K5MA 3FH8A 4FCAA 1L1OC 4BBRI 3FH5A 1YJN1 2QRCB 2QA41 3CCRZ 1YUAA 2E2II 1Z02A 4Y6SA 3I551 4AR1A 3B7RL 3CCJZ 3CCM1 4PW4A 3OW2Y 4ZX3A 4R7LA 4DGLA 3GTOI 4BXXI 3NH8A 2RPRA 3CCEZ 1OR7A 2QLVB 3CZEA 4LUPA 1Q0LA 4QUOA 4E2YA 2GU2A 1NJI1 2NVQI 4MKTA 1VQMZ 3MONA 1YJNZ 2QA4Z 3FU3A 2EGTA 2PK7A 4XN1A 2NVYI 3NDJA 3VB9A 1LQLA 4BY7I 3VMGA 4NBGA 2Y1DA 1KQSZ 1VQ91 3CD61 5C3EI 2QRDB 2EGHA 4MONA 4RCVA 2WAQA 1ZB9A 3CCS1 1Q862 2NVXI 2C5ZA 4XO4A 1JJ2Y 1RNIA 2OOXB 2PUSA 3MZKB 4NBCA 2O53A 3IFUA 1SFOI 3FUEA 4ZN6A 2E2HI 2KPIA 5FWQA 2M48A 2K3RA 4RVGA 2Y1GA 3FTXA 3FQQA 2B61A 3CD6Z 1K5HA 1K83I 3CCU1 3PUUA 3CCSZ 3Q44A 1YJW1 3F3PC 2FFLA 4NBHA 3CC71 2IZ4A 3CCV1 3S1QI 2DE5A 3P5JB 1QYPA 4MD9A 5A2Qf 1K8A1 3H3VJ 5JMPA 1KRLA 4A3LI 3ZHXA 1ONPA 4FLRA 3EEDA 1M902 3FTUA 4NFRA 1TWCI 3Q43A 3IX0A 4MD7A 3CCUZ 1Q812 3S16I 3CPWY 2NVTI 1YJWZ 4OOFA 2Y0SA 3HOVI 1HS6A 1TWAI 1N8R1 1R0LA 4XMTA 1MW2A 1VQ41 3T8VA 1H19A 3VVLA 3CCVZ 3CC41 4AR8A 4ZW6A 1I3QI 3EBIA 3EBHA 4R5XA 3G6E1 5T64A 3PO3I 1SG7A 4MD8A 3FUKA 2PMZA 4FLSA 3WQRA 2VLAA 1Y1VI 3KIHA 1ZH1A 4GAEA 1VLAA 3B7TA 5T6BA 2A7OA 4Q4IA 1NJI2 3S2DI 3M4OI 3B3BA 3VMIA 1MW3A 1H3LA 3WQQA 2DQMA 3KIFA 2E9HA 3CC4Z 4ZX5A 1WCMI 1S721 3G6EZ 3FTZA 2R7ZI 1G5AA 2QJ1A 3I4MI 4NBAA 5JNLA 1Z01A 1YJ91 4Y7NI 4Y6PA 1KD11 5A2Qb 2JA7I 1GW6A 2LFUA 3GCFA 3QWUA 4HH4A 3B2PA 2Y1FA 4XN7A 4TNUA 2R92I 3J80f 4K5PA 2Q4ZA 4NH1C 2F4MA 4BBSI 3GTKI 1S72Z 1VQLZ 2RT9A 3GTQI 5D1PA 2OTL1 3CHRA 1YIT1 1MW1A 4QTTA 4PU2A 1YJ9Z 3D6WA 2Y1CA 4XMUA 3S1NI 4ZQGA 4AYSA 3RZOI 4RS4A 4ZX6A 1RP3A 5HNFA 4FLOA 4XN4A 5JC1A 2VUGA 3FTYA 2V8KA 2JCYA 3CHQA 3GTLI 3CZGA 1S7MA 3I07A 2YADA 3FU6A 3FULA 4XN8A 1K8A2 3H0GI 1K731 3CMA1 2PGGA 4J3BA 3B37A 1YITZ 2KI7B 4ZQEA 1Y1WI 2OTJ1 3B34A 5DLLA 2QEX1 1Q821 4E2WA 3LUSA 1N8R2 3G4S1 4ZQFA 2R72A 1M1K1 3I55Z 4X2UA 3CCMZ 5FLXb 3HOZI 3Q87A 5DULA 4Y52I 4XMVA 1SQMA 3R0IA 4AICA 1KQSY 3BG0B 3RZDI 2OTJZ 4AR9A 1TWGI 3ZHYA 3J80b 3CC21 4A3FI 4A3KI 1QVFZ 2JA8I 1KC81 4JNDA 3G4SZ 4QHPA 3S1MI 1X3ZA 1VQ71 1VQK1 2BJOA 4CXFA 4R5TA 4Y6RA 1VQ9Z 3TE5B 3UEQA 4RVDA 4E30A 3GTMS 3M3YI 1R0KA 3BG1B 3CC2Z 1KD12 3S14I 1PFTA 4S1TA 4NBDA 4ZW5A 1N2FA 4K5NA 3T4NB 2XPYA 4L2LA 4K5OA 4QTUA 1QVGZ 2H85A 3CZLA 1SC5A 5T67A 1VQKZ 3FUFA 2JD0A 4A3BI 2P3YA 1VQN1 4KP7A 1Q0QA 3FUMA 1YUKA 2RBLA 2MAOA 2P28A 2B63I 2JA6I 4XN9A 1ML8A 2OOYB 1ONOA 5C44I 3CC7Z 3S17I 5EV7A 4MH4A 2O4HA 1USPA 3CCQ1 3K7AI 5AN9F 4BY1I 4A3CI 1RLYA 1NUIA 2OZKA 3RC3A 1VQO1 4Q4EA 4HGYA 2VJ8A 2YU9I 4NB8A 3HOXI 1TFIA 3S15I 1VQNZ 3AUAA 1K732 2XPZA 2K5RA 4XMZA 4QMEA 1YIJ1 1Z03A 4A3DI 3CCL1 1Q822 2V8JA 5JO0A 1VQ4Z 2JCVA 2HPOA 2WPGA 5C4JI 3NDIA 3CCQZ 4DQYB 4NQWA 1VQOZ 3U9WA 5IP7I 1M1K2 1W2BZ 2ZAEB 3ANMA 4QIRA 3CHPA 2JMOA 1W2BY 2PL5A 3CIAA 3AU9A 2DE7A 3FHEA 5FLXf 2M6NA 1YIJZ 3HKZA 4MXUA 3ESWA 5C4XI 4NBEA 2R6MA 1ZS2A 3FTVA 4NB9A 1KC82 4DK1A 3NH5A 4HGZA 3GTJI 3J81b 2JA5I 3JAMf 3KEDA 3UERA 1VQ51 1RO0A 1P9NA 3GTGI 3B7SA 4X6AI 3A14A 5HLTA 2GTHA 4GAAA 2Q51A 3G711 2VUMI 1Q0HA 3EERA 4NBFA 2QKDA 3CHSA 2JNYA 1X0TA 2I3CA 1USPB 1JGIA 3JT1A 3FTSA 5JAZA 1VQ5Z 1YI21 1DL6A 4NOZA 1M901 3F3FC 4XN2A 2WB1A 2OTLZ 1VQP1 3D9XA 3GTMI 1WW9A 3G71Z 3FUDA 3IIEA 3FUJA 2E2JI 4RVHA 2J6AA 5CM2M 1Q7Y1 2XQ0A 4ARFA 2JUBA 2RHBA 3FH7A 4R5VA 3OW2Z 5AENA 1YI2Z 3U50C 2WZFA 3CMAZ 2JD2A 4RVBA 2JR6A 1VQPZ 2W03A 4XMWA 2RIQA 3VTNA 2JS4A 1VQ61 2QEXZ 4ZQHA 3MZLB 4A3JI 3JAMb 2QVWA 3NH4A 4A3II 1MW0A 4OOEA 1QVFY 3QJXA 4E32A 4E31A 1R9TI 3FU0A 3TDHB 4MS6A 4XX2A 3FKII 3HOYI 3WQSB 3FUNA 2LIYA 1I6HI 2JD1A 1VQ81 2HPTA 1VQ6Z 4XN5A 1JJ2Z 4XNBA 4E33A 3B7UX 1JWHC 1S46A 2GTIA 1RO4A 4CL1A 2QREB 3VVMA 3GKQA 1T1SA 4A3GI 1VQ7Z 1QVGY 3CME1 1K9M1 3FQMA 3VMHA 1TWHI 4XNDA 2HU9A 2QR1B 3J81f 4MRIA 5D1OA 1VQ8Z 4Y67A 3I561 3S2HI 1JG9A 3IF8A 1QF8A 4RVFA 2RJIA 3B2XA 3CQZI 5HNHA 3CHOA 3ZHZA 1TWFI 2IZ3A 2W04A 1X3WA 3FUHA 5FLMI 2HF1A 5DYFA 4ZW7A 3FU5A 3CMEZ 2DQ6A 2DE6A 4XMXA 3FUIA 2G2KA 3HOWI 4K5LA 2ZXGA 2JCXA 3CPWZ 2JV7A 3I56Z 5IT9f 1ONNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  3LUS A;  3GTG I;  4A93 I;  4X6A I;  1K83 I;  1ZB8 A;  2VUM I;  3I4N I;  4NBH A;  3EER A;  4NBF A;  3HOZ I;  3Q87 A;  4Y52 I;  2JNY A;  3S1Q I;  2DE5 A;  1USP B;  3RZD I;  1QYP A;  1TWG I;  3H3V J;  1DL6 A;  4NOZ A;  4A3F I;  4A3L I;  4A3K I;  2JA8 I;  1TWC I;  4A3M I;  3S1M I;  2E2H I;  2NVT I;  3S16 I;  1X3Z A;  3GTM I;  1WW9 A;  3HOV I;  2E2J I;  1TWA I;  2BJO A;  2J6A A;  1I50 I;  5CM2 M;  3GTP I;  1I3Q I;  3GTM S;  3M3Y I;  3U50 C;  3S14 I;  1PFT A;  3PO3 I;  4NBD A;  2JR6 A;  1N2F A;  4QTU A;  1Y1V I;  2JS4 A;  2F4O A;  4NBB A;  1VLA A;  4A3J I;  5IP9 I;  4A3I I;  4A3B I;  3M4O I;  2P3Y A;  3VMI A;  3PO2 I;  3PO3 S;  3S2D I;  3HOU I;  2RBL A;  1R9T I;  2B63 I;  1Y1V S;  1WCM I;  2JA6 I;  2R93 I;  1ML8 A;  4A3E I;  5C44 I;  4XX2 A;  3FKI I;  3S1R I;  3HOY I;  3S17 I;  2R7Z I;  2AKL A;  1I6H I;  4MH4 A;  1USP A;  3I4M I;  3K7A I;  4NBA A;  1L1O C;  4BBR I;  4BY1 I;  4A3C I;  1RLY A;  1NUI A;  1YUA A;  4Y7N I;  2E2I I;  2YU9 I;  4NB8 A;  2JA7 I;  3HOX I;  1TFI A;  3GCF A;  3S15 I;  1RO4 A;  3GTO I;  4BXX I;  2K5R A;  3GKQ A;  4A3G I;  2R92 I;  4A3D I;  2F4M A;  2NVQ I;  4BBS I;  3VMH A;  3GTK I;  1TWH I;  3GTQ I;  5C4J I;  3S2H I;  4QTT A;  3D6W A;  2PK7 A;  3CQZ I;  2NVY I;  3S1N I;  3VB9 A;  1TWF I;  3RZO I;  1LQL A;  4BY7 I;  3VMG A;  4NBG A;  1X3W A;  5FLM I;  2HF1 A;  5C3E I;  3GTL I;  3I07 A;  2DE7 A;  1ZB9 A;  2NVX I;  3ESW A;  2DE6 A;  4NBE A;  5C4X I;  3H0G I;  3HOW I;  4NB9 A;  4NBC A;  3GTJ I;  1SFO I;  2JA5 I;  5IP7 I;  1Y1W I; 
#chains in the Genus database with same CATH topology
 4EWC A;  2WZG A;  4E2X A;  1RO2 A;  3CZK A;  2V8I A;  2GTQ A;  3JSZ A;  2VF1 A;  2R59 A;  4A93 I;  4FLQ A;  1Q7Y 2;  1ZB8 A;  4PVB A;  4QPE A;  3I4N I;  3A06 A;  4BKX A;  1MVY A;  4ZX4 A;  3UCQ A;  2PM9 A;  4E2Z A;  1Q86 1;  4XNA A;  3ZI0 A;  4XO3 A;  3CCL Z;  2R70 A;  3EBG A;  4XO5 A;  4ZQT A;  1NP6 A;  4A3M I;  3CXC Z;  4ZW3 A;  3RAS A;  1RQF A;  3T0Y A;  3AU8 A;  3CXC Y;  2Y1E A;  1VQL 1;  1I50 I;  3GTP I;  4DPR A;  5D1O B;  1JVS A;  3NFZ A;  3IR7 A;  1T1R A;  4AYB A;  1YHQ 1;  2MAP A;  3J7A 4;  2O7G A;  2F4O A;  4NBB A;  2C82 A;  3CCR 1;  5IT9 b;  5BPP A;  3ANN A;  3CCJ 1;  5IP9 I;  1K9M 2;  3ANL A;  3PO3 S;  3PO2 I;  1Q81 1;  4RV9 A;  3HOU I;  5JMW A;  3CCE 1;  4ZW8 A;  1Y1V S;  2R93 I;  3FTW A;  5LL6 f;  4RSY A;  3RC8 A;  4A3E I;  5JBI A;  1WII A;  4A03 A;  3S1R I;  1YHQ Z;  1VQM 1;  2AKL A;  4K5M A;  3FH8 A;  4FCA A;  1L1O C;  4BBR I;  3FH5 A;  1YJN 1;  2QRC B;  2QA4 1;  3CCR Z;  1YUA A;  2E2I I;  1Z02 A;  4Y6S A;  3I55 1;  4AR1 A;  3B7R L;  3CCJ Z;  3CCM 1;  4PW4 A;  3OW2 Y;  4ZX3 A;  4R7L A;  4DGL A;  3GTO I;  4BXX I;  3NH8 A;  2RPR A;  3CCE Z;  1OR7 A;  2QLV B;  3CZE A;  4LUP A;  1Q0L A;  4QUO A;  4E2Y A;  2GU2 A;  1NJI 1;  2NVQ I;  4MKT A;  1VQM Z;  3MON A;  1YJN Z;  2QA4 Z;  3FU3 A;  2EGT A;  2PK7 A;  4XN1 A;  2NVY I;  3NDJ A;  3VB9 A;  1LQL A;  4BY7 I;  3VMG A;  4NBG A;  2Y1D A;  1KQS Z;  1VQ9 1;  3CD6 1;  2JIP A;  5C3E I;  2QRD B;  2EGH A;  4MON A;  4RCV A;  2WAQ A;  1ZB9 A;  3CCS 1;  1Q86 2;  2NVX I;  2C5Z A;  4XO4 A;  1JJ2 Y;  1RNI A;  2OOX B;  2PUS A;  3MZK B;  4NBC A;  2O53 A;  3IFU A;  1SFO I;  3FUE A;  4ZN6 A;  2E2H I;  2KPI A;  5FWQ A;  2M48 A;  2K3R A;  4RVG A;  2Y1G A;  2JIO A;  3FTX A;  3FQQ A;  2B61 A;  3CD6 Z;  1K5H A;  1K83 I;  3CCU 1;  3PUU A;  3CCS Z;  3Q44 A;  1YJW 1;  3F3P C;  2FFL A;  4NBH A;  3CC7 1;  2IZ4 A;  3CCV 1;  3S1Q I;  2DE5 A;  3P5J B;  1QYP A;  4MD9 A;  5A2Q f;  1K8A 1;  3H3V J;  5JMP A;  1KRL A;  2JIM A;  3ZHX A;  1ONP A;  4FLR A;  3EED A;  1M90 2;  4A3L I;  3FTU A;  4NFR A;  1TWC I;  3Q43 A;  3IX0 A;  4MD7 A;  3CCU Z;  1Q81 2;  3S16 I;  3CPW Y;  2NVT I;  1YJW Z;  4OOF A;  2Y0S A;  3HOV I;  1HS6 A;  1TWA I;  1N8R 1;  1R0L A;  4XMT A;  1MW2 A;  1AA6 A;  1VQ4 1;  3T8V A;  1H19 A;  3VVL A;  3CCV Z;  3CC4 1;  4AR8 A;  4ZW6 A;  1I3Q I;  3EBI A;  3EBH A;  4R5X A;  3G6E 1;  5T64 A;  3PO3 I;  1SG7 A;  4MD8 A;  3FUK A;  2PMZ A;  4FLS A;  3WQR A;  2VLA A;  1Y1V I;  2VPX A;  1ZH1 A;  3KIH A;  4GAE A;  1VLA A;  3B7T A;  5T6B A;  2A7O A;  4Q4I A;  1NJI 2;  3S2D I;  3M4O I;  3B3B A;  3VMI A;  1MW3 A;  1H3L A;  3WQQ A;  2DQM A;  3KIF A;  2E9H A;  3CC4 Z;  4ZX5 A;  1WCM I;  1S72 1;  3G6E Z;  3FTZ A;  2R7Z I;  1G5A A;  2QJ1 A;  3I4M I;  4NBA A;  5JNL A;  1Z01 A;  1YJ9 1;  4Y7N I;  4Y6P A;  1KD1 1;  5A2Q b;  3HW2 A;  1GW6 A;  1FDO A;  2LFU A;  2JA7 I;  3GCF A;  3QWU A;  4HH4 A;  3B2P A;  2Y1F A;  4XN7 A;  4TNU A;  2IV2 X;  3J80 f;  2R92 I;  4K5P A;  1FDI A;  2Q4Z A;  2F4M A;  4NH1 C;  4BBS I;  3GTK I;  1S72 Z;  1VQL Z;  2RT9 A;  3GTQ I;  5D1P A;  2OTL 1;  1Y8C A;  3CHR A;  1YIT 1;  1MW1 A;  4QTT A;  4PU2 A;  1YJ9 Z;  3D6W A;  2Y1C A;  4XMU A;  3S1N I;  4ZQG A;  4AYS A;  3RZO I;  4RS4 A;  4ZX6 A;  1RP3 A;  5HNF A;  4FLO A;  4XN4 A;  5JC1 A;  2VUG A;  3D2L A;  3FTY A;  2V8K A;  2JCY A;  3CHQ A;  2JIR A;  3GTL I;  3CZG A;  1S7M A;  3I07 A;  2YAD A;  3FU6 A;  3FUL A;  2E7Z A;  4XN8 A;  1K8A 2;  3H0G I;  1K73 1;  3CMA 1;  2PGG A;  4J3B A;  3B37 A;  1YIT Z;  2KI7 B;  4ZQE A;  1Y1W I;  2OTJ 1;  3B34 A;  5DLL A;  2QEX 1;  1Q82 1;  4E2W A;  3LUS A;  1N8R 2;  3G4S 1;  2LEX A;  4ZQF A;  2AYD A;  2R72 A;  1M1K 1;  3I55 Z;  4X2U A;  3CCM Z;  5FLX b;  3HOZ I;  3Q87 A;  5DUL A;  4Y52 I;  4XMV A;  1SQM A;  3R0I A;  4AIC A;  1KQS Y;  3BG0 B;  3RZD I;  2OTJ Z;  4AR9 A;  1TWG I;  3ZHY A;  3J80 b;  3CC2 1;  4A3F I;  4A3K I;  1QVF Z;  2JA8 I;  1KC8 1;  4JND A;  3G4S Z;  4QHP A;  3S1M I;  1X3Z A;  1VQ7 1;  1VQK 1;  2BJO A;  4CXF A;  4R5T A;  4Y6R A;  1VQ9 Z;  3TE5 B;  3UEQ A;  4RVD A;  4E30 A;  3GTM S;  3M3Y I;  1R0K A;  3BG1 B;  3CC2 Z;  1KD1 2;  3S14 I;  1PFT A;  4S1T A;  4NBD A;  4ZW5 A;  1N2F A;  4K5N A;  3T4N B;  2XPY A;  4L2L A;  4K5O A;  4QTU A;  1QVG Z;  2H85 A;  3CZL A;  1SC5 A;  5T67 A;  1VQK Z;  3FUF A;  2JD0 A;  4A3B I;  2P3Y A;  1VQN 1;  4KP7 A;  1Q0Q A;  3FUM A;  1YUK A;  2RBL A;  2VPZ A;  2MAO A;  2P28 A;  2B63 I;  2JA6 I;  4XN9 A;  1ML8 A;  2OOY B;  1ONO A;  5C44 I;  2V45 A;  3CC7 Z;  3S17 I;  5EV7 A;  4MH4 A;  1WZN A;  1USP A;  2O4H A;  3K7A I;  3CCQ 1;  5AN9 F;  4BY1 I;  4A3C I;  1RLY A;  1NUI A;  2OZK A;  3RC3 A;  1VQO 1;  4Q4E A;  4HGY A;  2VJ8 A;  2YU9 I;  4NB8 A;  3HOX I;  1TFI A;  3S15 I;  1VQN Z;  3AUA A;  1K73 2;  2XPZ A;  2K5R A;  4XMZ A;  4QME A;  1YIJ 1;  1Z03 A;  4A3D I;  3CCL 1;  1Q82 2;  2V8J A;  5JO0 A;  1VQ4 Z;  2JCV A;  2HPO A;  2WPG A;  5C4J I;  3NDI A;  3CCQ Z;  4DQY B;  4NQW A;  1VQO Z;  3U9W A;  5IP7 I;  1M1K 2;  1W2B Z;  2ZAE B;  3ANM A;  4QIR A;  3CHP A;  2JMO A;  1W2B Y;  2PL5 A;  3CIA A;  3AU9 A;  2DE7 A;  3FHE A;  5FLX f;  2M6N A;  1YIJ Z;  3HKZ A;  4MXU A;  3ESW A;  5C4X I;  4NBE A;  2R6M A;  1ZS2 A;  2NAP A;  3FTV A;  4NB9 A;  1KC8 2;  4DK1 A;  3NH5 A;  4HGZ A;  3GTJ I;  3J81 b;  2JA5 I;  3JAM f;  3KED A;  3UER A;  1VQ5 1;  1RO0 A;  1P9N A;  3GTG I;  3B7S A;  4X6A I;  3A14 A;  5HLT A;  2GTH A;  4GAA A;  2Q51 A;  3G71 1;  1Q16 A;  2VUM I;  1Q0H A;  3EER A;  4NBF A;  2QKD A;  3CHS A;  2JNY A;  1X0T A;  2JIQ A;  2I3C A;  1USP B;  1JGI A;  3JT1 A;  3FTS A;  5JAZ A;  1VQ5 Z;  1YI2 1;  1DL6 A;  4NOZ A;  1M90 1;  3F3F C;  4XN2 A;  2WB1 A;  2OTL Z;  1VQP 1;  3D9X A;  2V3V A;  3GTM I;  1WW9 A;  3G71 Z;  3FUD A;  3IIE A;  3FUJ A;  2E2J I;  4RVH A;  2J6A A;  5CM2 M;  1Q7Y 1;  2XQ0 A;  4ARF A;  2JUB A;  2RHB A;  3FH7 A;  4R5V A;  3OW2 Z;  5AEN A;  1YI2 Z;  3U50 C;  2WZF A;  3CMA Z;  2JD2 A;  4RVB A;  2JR6 A;  1VQP Z;  2W03 A;  4XMW A;  2RIQ A;  3VTN A;  2JS4 A;  1VQ6 1;  2QEX Z;  4ZQH A;  3MZL B;  4A3J I;  3JAM b;  2QVW A;  3NH4 A;  4A3I I;  1MW0 A;  4OOE A;  1QVF Y;  3QJX A;  4E32 A;  4E31 A;  1R9T I;  3FU0 A;  3TDH B;  4MS6 A;  4XX2 A;  3FKI I;  3HOY I;  3WQS B;  3FUN A;  2LIY A;  1I6H I;  2VPW A;  2JD1 A;  1VQ8 1;  1SIW A;  2HPT A;  1WJ2 A;  1VQ6 Z;  4XN5 A;  1JJ2 Z;  4XNB A;  4E33 A;  3B7U X;  1JWH C;  1S46 A;  2GTI A;  1RO4 A;  4CL1 A;  2QRE B;  3VVM A;  3GKQ A;  1T1S A;  3CXB A;  4A3G I;  1VQ7 Z;  1QVG Y;  3CME 1;  1K9M 1;  3FQM A;  3VMH A;  1TWH I;  4XND A;  2HU9 A;  2QR1 B;  3J81 f;  4MRI A;  5D1O A;  1VQ8 Z;  4Y67 A;  3I56 1;  3S2H I;  1JG9 A;  3IF8 A;  2VPY A;  1QF8 A;  4RVF A;  2RJI A;  3B2X A;  3CQZ I;  5HNH A;  3CHO A;  3ZHZ A;  1TWF I;  2IZ3 A;  2W04 A;  1X3W A;  3FUH A;  1QXF A;  5FLM I;  2HF1 A;  5DYF A;  4ZW7 A;  3FU5 A;  3CME Z;  2DQ6 A;  2DE6 A;  4XMX A;  3FUI A;  2G2K A;  3HOW I;  4K5L A;  2ZXG A;  2JCX A;  3CPW Z;  2JV7 A;  3I56 Z;  5IT9 f;  1ONN A; 
#chains in the Genus database with same CATH homology
 4EWC A;  2WZG A;  4E2X A;  1RO2 A;  3CZK A;  2V8I A;  2GTQ A;  3JSZ A;  2VF1 A;  2R59 A;  4A93 I;  4FLQ A;  1Q7Y 2;  1ZB8 A;  4PVB A;  4QPE A;  3I4N I;  3A06 A;  4BKX A;  1MVY A;  4ZX4 A;  3UCQ A;  2PM9 A;  4E2Z A;  1Q86 1;  4XNA A;  3ZI0 A;  4XO3 A;  3CCL Z;  2R70 A;  3EBG A;  4XO5 A;  4ZQT A;  1NP6 A;  4A3M I;  3CXC Z;  4ZW3 A;  3RAS A;  1RQF A;  3T0Y A;  3AU8 A;  3CXC Y;  2Y1E A;  1VQL 1;  1I50 I;  3GTP I;  4DPR A;  5D1O B;  1JVS A;  3NFZ A;  1T1R A;  4AYB A;  1YHQ 1;  2MAP A;  3J7A 4;  2O7G A;  2F4O A;  4NBB A;  2C82 A;  3CCR 1;  5IT9 b;  5BPP A;  3ANN A;  3CCJ 1;  5IP9 I;  1K9M 2;  3ANL A;  3PO3 S;  3PO2 I;  1Q81 1;  4RV9 A;  3HOU I;  5JMW A;  3CCE 1;  4ZW8 A;  1Y1V S;  2R93 I;  3FTW A;  5LL6 f;  4RSY A;  3RC8 A;  4A3E I;  5JBI A;  1WII A;  4A03 A;  3S1R I;  1YHQ Z;  1VQM 1;  2AKL A;  4K5M A;  3FH8 A;  4FCA A;  1L1O C;  4BBR I;  3FH5 A;  1YJN 1;  2QRC B;  2QA4 1;  3CCR Z;  1YUA A;  2E2I I;  1Z02 A;  4Y6S A;  3I55 1;  4AR1 A;  3B7R L;  3CCJ Z;  3CCM 1;  4PW4 A;  3OW2 Y;  4ZX3 A;  4R7L A;  4DGL A;  3GTO I;  4BXX I;  3NH8 A;  2RPR A;  3CCE Z;  1OR7 A;  2QLV B;  3CZE A;  4LUP A;  1Q0L A;  4QUO A;  4E2Y A;  2GU2 A;  1NJI 1;  2NVQ I;  4MKT A;  1VQM Z;  3MON A;  1YJN Z;  2QA4 Z;  3FU3 A;  2EGT A;  2PK7 A;  4XN1 A;  2NVY I;  3NDJ A;  3VB9 A;  1LQL A;  4BY7 I;  3VMG A;  4NBG A;  2Y1D A;  1KQS Z;  1VQ9 1;  3CD6 1;  5C3E I;  2QRD B;  2EGH A;  4MON A;  4RCV A;  2WAQ A;  1ZB9 A;  3CCS 1;  1Q86 2;  2NVX I;  2C5Z A;  4XO4 A;  1JJ2 Y;  1RNI A;  2OOX B;  2PUS A;  3MZK B;  4NBC A;  2O53 A;  3IFU A;  1SFO I;  3FUE A;  4ZN6 A;  2E2H I;  2KPI A;  5FWQ A;  2M48 A;  2K3R A;  4RVG A;  2Y1G A;  3FTX A;  3FQQ A;  2B61 A;  3CD6 Z;  1K5H A;  1K83 I;  3CCU 1;  3PUU A;  3CCS Z;  3Q44 A;  1YJW 1;  3F3P C;  2FFL A;  4NBH A;  3CC7 1;  2IZ4 A;  3CCV 1;  3S1Q I;  2DE5 A;  3P5J B;  1QYP A;  4MD9 A;  5A2Q f;  1K8A 1;  3H3V J;  5JMP A;  1KRL A;  4A3L I;  3ZHX A;  1ONP A;  4FLR A;  3EED A;  1M90 2;  3FTU A;  4NFR A;  1TWC I;  3Q43 A;  3IX0 A;  4MD7 A;  3CCU Z;  1Q81 2;  3S16 I;  3CPW Y;  2NVT I;  1YJW Z;  4OOF A;  2Y0S A;  3HOV I;  1HS6 A;  1TWA I;  1N8R 1;  1R0L A;  4XMT A;  1MW2 A;  1VQ4 1;  3T8V A;  1H19 A;  3VVL A;  3CCV Z;  3CC4 1;  4AR8 A;  4ZW6 A;  1I3Q I;  3EBI A;  3EBH A;  4R5X A;  3G6E 1;  5T64 A;  3PO3 I;  1SG7 A;  4MD8 A;  3FUK A;  2PMZ A;  4FLS A;  3WQR A;  2VLA A;  1Y1V I;  3KIH A;  1ZH1 A;  4GAE A;  1VLA A;  3B7T A;  5T6B A;  2A7O A;  4Q4I A;  1NJI 2;  3S2D I;  3M4O I;  3B3B A;  3VMI A;  1MW3 A;  1H3L A;  3WQQ A;  2DQM A;  3KIF A;  2E9H A;  3CC4 Z;  4ZX5 A;  1WCM I;  1S72 1;  3G6E Z;  3FTZ A;  2R7Z I;  1G5A A;  2QJ1 A;  3I4M I;  4NBA A;  5JNL A;  1Z01 A;  1YJ9 1;  4Y7N I;  4Y6P A;  1KD1 1;  5A2Q b;  2JA7 I;  1GW6 A;  2LFU A;  3GCF A;  3QWU A;  4HH4 A;  3B2P A;  2Y1F A;  4XN7 A;  4TNU A;  2R92 I;  3J80 f;  4K5P A;  2Q4Z A;  4NH1 C;  2F4M A;  4BBS I;  3GTK I;  1S72 Z;  1VQL Z;  2RT9 A;  3GTQ I;  5D1P A;  2OTL 1;  3CHR A;  1YIT 1;  1MW1 A;  4QTT A;  4PU2 A;  1YJ9 Z;  3D6W A;  2Y1C A;  4XMU A;  3S1N I;  4ZQG A;  4AYS A;  3RZO I;  4RS4 A;  4ZX6 A;  1RP3 A;  5HNF A;  4FLO A;  4XN4 A;  5JC1 A;  2VUG A;  3FTY A;  2V8K A;  2JCY A;  3CHQ A;  3GTL I;  3CZG A;  1S7M A;  3I07 A;  2YAD A;  3FU6 A;  3FUL A;  4XN8 A;  1K8A 2;  3H0G I;  1K73 1;  3CMA 1;  2PGG A;  4J3B A;  3B37 A;  1YIT Z;  2KI7 B;  4ZQE A;  1Y1W I;  2OTJ 1;  3B34 A;  5DLL A;  2QEX 1;  1Q82 1;  4E2W A;  3LUS A;  1N8R 2;  3G4S 1;  4ZQF A;  2R72 A;  1M1K 1;  3I55 Z;  4X2U A;  3CCM Z;  5FLX b;  3HOZ I;  3Q87 A;  5DUL A;  4Y52 I;  4XMV A;  1SQM A;  3R0I A;  4AIC A;  1KQS Y;  3BG0 B;  3RZD I;  2OTJ Z;  4AR9 A;  1TWG I;  3ZHY A;  3J80 b;  3CC2 1;  4A3F I;  4A3K I;  1QVF Z;  2JA8 I;  1KC8 1;  4JND A;  3G4S Z;  4QHP A;  3S1M I;  1X3Z A;  1VQ7 1;  1VQK 1;  2BJO A;  4CXF A;  4R5T A;  4Y6R A;  1VQ9 Z;  3TE5 B;  3UEQ A;  4RVD A;  4E30 A;  3GTM S;  3M3Y I;  1R0K A;  3BG1 B;  3CC2 Z;  1KD1 2;  3S14 I;  1PFT A;  4S1T A;  4NBD A;  4ZW5 A;  1N2F A;  4K5N A;  3T4N B;  2XPY A;  4L2L A;  4K5O A;  4QTU A;  1QVG Z;  2H85 A;  3CZL A;  1SC5 A;  5T67 A;  1VQK Z;  3FUF A;  2JD0 A;  4A3B I;  2P3Y A;  1VQN 1;  4KP7 A;  1Q0Q A;  3FUM A;  1YUK A;  2RBL A;  2MAO A;  2P28 A;  2B63 I;  2JA6 I;  4XN9 A;  1ML8 A;  2OOY B;  1ONO A;  5C44 I;  3CC7 Z;  3S17 I;  5EV7 A;  4MH4 A;  2O4H A;  1USP A;  3CCQ 1;  3K7A I;  5AN9 F;  4BY1 I;  4A3C I;  1RLY A;  1NUI A;  2OZK A;  3RC3 A;  1VQO 1;  4Q4E A;  4HGY A;  2VJ8 A;  2YU9 I;  4NB8 A;  3HOX I;  1TFI A;  3S15 I;  1VQN Z;  3AUA A;  1K73 2;  2XPZ A;  2K5R A;  4XMZ A;  4QME A;  1YIJ 1;  1Z03 A;  4A3D I;  3CCL 1;  1Q82 2;  2V8J A;  5JO0 A;  1VQ4 Z;  2JCV A;  2HPO A;  2WPG A;  5C4J I;  3NDI A;  3CCQ Z;  4DQY B;  4NQW A;  1VQO Z;  3U9W A;  5IP7 I;  1M1K 2;  1W2B Z;  2ZAE B;  3ANM A;  4QIR A;  3CHP A;  2JMO A;  1W2B Y;  2PL5 A;  3CIA A;  3AU9 A;  2DE7 A;  3FHE A;  5FLX f;  2M6N A;  1YIJ Z;  3HKZ A;  4MXU A;  3ESW A;  5C4X I;  4NBE A;  2R6M A;  1ZS2 A;  3FTV A;  4NB9 A;  1KC8 2;  4DK1 A;  3NH5 A;  4HGZ A;  3GTJ I;  3J81 b;  2JA5 I;  3JAM f;  3KED A;  3UER A;  1VQ5 1;  1RO0 A;  1P9N A;  3GTG I;  3B7S A;  4X6A I;  3A14 A;  5HLT A;  2GTH A;  4GAA A;  2Q51 A;  3G71 1;  2VUM I;  1Q0H A;  3EER A;  4NBF A;  2QKD A;  3CHS A;  2JNY A;  1X0T A;  2I3C A;  1USP B;  1JGI A;  3JT1 A;  3FTS A;  5JAZ A;  1VQ5 Z;  1YI2 1;  1DL6 A;  4NOZ A;  1M90 1;  3F3F C;  4XN2 A;  2WB1 A;  2OTL Z;  1VQP 1;  3D9X A;  3GTM I;  1WW9 A;  3G71 Z;  3FUD A;  3IIE A;  3FUJ A;  2E2J I;  4RVH A;  2J6A A;  5CM2 M;  1Q7Y 1;  2XQ0 A;  4ARF A;  2JUB A;  2RHB A;  3FH7 A;  4R5V A;  3OW2 Z;  5AEN A;  1YI2 Z;  3U50 C;  2WZF A;  3CMA Z;  2JD2 A;  4RVB A;  2JR6 A;  1VQP Z;  2W03 A;  4XMW A;  2RIQ A;  3VTN A;  2JS4 A;  1VQ6 1;  2QEX Z;  4ZQH A;  3MZL B;  4A3J I;  3JAM b;  2QVW A;  3NH4 A;  4A3I I;  1MW0 A;  4OOE A;  1QVF Y;  3QJX A;  4E32 A;  4E31 A;  1R9T I;  3FU0 A;  3TDH B;  4MS6 A;  4XX2 A;  3FKI I;  3HOY I;  3WQS B;  3FUN A;  2LIY A;  1I6H I;  2JD1 A;  1VQ8 1;  2HPT A;  1VQ6 Z;  4XN5 A;  1JJ2 Z;  4XNB A;  4E33 A;  3B7U X;  1JWH C;  1S46 A;  2GTI A;  1RO4 A;  4CL1 A;  2QRE B;  3VVM A;  3GKQ A;  1T1S A;  4A3G I;  1VQ7 Z;  1QVG Y;  3CME 1;  1K9M 1;  3FQM A;  3VMH A;  1TWH I;  4XND A;  2HU9 A;  2QR1 B;  3J81 f;  4MRI A;  5D1O A;  1VQ8 Z;  4Y67 A;  3I56 1;  3S2H I;  1JG9 A;  3IF8 A;  1QF8 A;  4RVF A;  2RJI A;  3B2X A;  3CQZ I;  5HNH A;  3CHO A;  3ZHZ A;  1TWF I;  2IZ3 A;  2W04 A;  1X3W A;  3FUH A;  5FLM I;  2HF1 A;  5DYF A;  4ZW7 A;  3FU5 A;  3CME Z;  2DQ6 A;  2DE6 A;  4XMX A;  3FUI A;  2G2K A;  3HOW I;  4K5L A;  2ZXG A;  2JCX A;  3CPW Z;  2JV7 A;  3I56 Z;  5IT9 f;  1ONN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...