1X3WA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords peptide:N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 101
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3wA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3wA04
2JA5I 1NUIA 1K83I 1I6HI 4XX2A 1ZB9A 3H0GI 2F4OA 3I07A 2NVQI 1RLYA 1WCMI 4NBCA 3GTOI 3GTMI 3PO3I 2AKLA 3D6WA 2E2HI 1I3QI 1RO4A 2NVXI 4NBFA 2JR6A 4A3GI 3S14I 1TWHI 4A3CI 5FLMI 3VMIA 1ML8A 3LUSA 4A3BI 5IP7I 4BXXI 2HF1A 1TWCI 3HOWI 3K7AI 3GTKI 2E2II 3PO2I 2E2JI 3S16I 1Y1VS 5C4XI 1N2FA 3FKII 4NB8A 5CM2M 1ZB8A 4NBBA 3S2HI 1TWAI 2BJOA 4A3DI 3VB9A 4NBEA 4BBRI 3EERA 2JA7I 3GTGI 3GTLI 3S1MI 4NBHA 3HOZI 2P3YA 1SFOI 2NVTI 4NBGA 4MH4A 4A3EI 4NOZA 2F4MA 1Y1VI 2JA8I 1Y1WI 2K5RA 2DE5A 4A3II 1TWGI 4BBSI 1WW9A 3S17I 1PFTA 2J6AA 4QTTA 3VMHA 3GCFA 3M3YI 1X3WA 4NBAA 2JNYA 3HOYI 4A93I 5IP9I 4NBDA 3HOUI 2RBLA 2JS4A 3HOVI 4A3KI 1R9TI 4A3MI 1DL6A 3S1RI 1LQLA 1YUAA 3CQZI 2R93I 3H3VJ 2YU9I 3GKQA 4NB9A 2B63I 1I50I 4X6AI 4A3FI 4QTUA 3I4NI 3M4OI 3VMGA 3I4MI 2DE6A 3S15I 4Y52I 5C4JI 2JA6I 5C44I 3RZOI 1QYPA 3GTQI 1TWFI 3HOXI 2NVYI 2R92I 1USPB 3ESWA 3S2DI 1X3ZA 2PK7A 3GTPI 3S1QI 1L1OC 3U50C 1TFIA 1VLAA 3GTJI 4A3JI 3RZDI 4A3LI 3GTMS 2VUMI 3PO3S 2R7ZI 3Q87A 1USPA 4BY7I 2KPIA 5C3EI 2DE7A 4BY1I 4Y7NI 3S1NI
chains in the Genus database with same CATH superfamily
4ZX4A 1NUIA 2P28A 1H19A 3Q43A 4RVGA 1Q812 2QRCB 4XX2A 3CMEZ 3H0GI 1HS6A 1Q821 2NVQI 3CPWY 1NP6A 1RLYA 5JNLA 4NBCA 2M48A 3CME1 3CCEZ 2R70A 3FTXA 1SQMA 2C5ZA 1Q7Y2 1KD12 2RIQA 3EBGA 1MW1A 5D1PA 4XMXA 2LFUA 5JMPA 4FLSA 1R0KA 3TDHB 3VMIA 1JJ2Z 1Z03A 1Q822 5BPPA 4HGZA 1TWCI 4KP7A 1RQFA 1YJNZ 2E2II 3S16I 1Y1VS 1YJ91 2XPYA 1YJN1 2A7OA 3NH4A 5CM2M 3NDJA 4A3DI 3FUEA 3EERA 3GTGI 1Q0QA 4K5MA 3UCQA 3CIAA 4MS6A 4QMEA 5T64A 2P3YA 4XMTA 4FLQA 4NOZA 4ZQGA 3FTWA 4XNAA 1QF8A 4K5OA 2PGGA 2JA8I 3CHSA 1Y1WI 2QREB 3R0IA 2DE5A 1YI21 4AR8A 1TWGI 1VQ9Z 2VPWA 5T6BA 2J6AA 3GCFA 2OOYB 3FUIA 1VQKZ 1VQM1 1S46A 1X3WA 5EV7A 2JNYA 4A93I 2RBLA 1FDOA 3EEDA 4RVHA 5HNHA 2JIRA 3IX0A 4K5PA 4E2WA 4XMUA 2O4HA 2R72A 4E32A 4J3BA 1S72Z 1LQLA 3B37A 3FUNA 3FU6A 2B63I 3OW2Z 2K3RA 3CCRZ 3J81f 3BG1B 4X6AI 2LEXA 2HPOA 4Y6SA 4QTUA 3FTYA 3M4OI 3VMGA 1VQPZ 1ONNA 3I4MI 2IZ3A 3CPWZ 4XN7A 1VQ81 1TWFI 2B61A 3B2XA 2JIQA 5DYFA 3U9WA 3NFZA 3RC8A 2QKDA 3HKZA 4E2XA 3S2DI 4RSYA 2PK7A 3GTPI 3ZHYA 3AU8A 2QA4Z 2H85A 2JIMA 1JG9A 3I561 3F3FC 3Q87A 3F3PC 4QHPA 2KPIA 2W03A 5HNFA 2PUSA 3NH8A 4FCAA 4QPEA 3ZI0A 1JVSA 3FUKA 4R5XA 5D1OB 1YJWZ 2HPTA 3B2PA 4K5LA 1KC81 2MAOA 1YIJZ 3JSZA 1Q861 1YJW1 3FTSA 4EWCA 5T67A 3PO3I 3HW2A 3T0YA 3VTNA 4PU2A 1YIJ1 1M1K2 3CXCZ 2NVXI 4NH1C 2JIOA 3CCSZ 1JGIA 4ZQFA 4A3GI 1WZNA 1RP3A 3CHOA 2JIPA 4E2ZA 3CCL1 1VQ6Z 4NFRA 3CD6Z 3CCS1 3G4SZ 1P9NA 1Q862 2LIYA 3FH8A 2AYDA 1VQ61 3FUMA 4QIRA 4MD7A 1Q7Y1 1KD11 3CCU1 3NH5A 4E2YA 3B7UX 3CMAZ 1Q0HA 1N2FA 2RPRA 4Y6PA 3S2HI 3QWUA 1ZS2A 4GAEA 1TWAI 3CMA1 2Y1DA 4NQWA 1QVFY 3CXBA 1KQSY 4BBRI 2WZGA 2GU2A 2IV2X 1G5AA 3HOZI 1OR7A 5JC1A 2VPXA 1ONPA 4CL1A 4MH4A 4QUOA 3IF8A 4ZX3A 3FH7A 2G2KA 2YADA 3CCMZ 1K8A2 4ZX6A 2K5RA 1YHQZ 5AN9F 3CCM1 1YJ9Z 4BBSI 4BKXA 1YHQ1 4QTTA 1QVGZ 4OOEA 1VQ5Z 1RO2A 4DK1A 5FLXf 1K5HA 4PVBA 1N8R1 2RHBA 3J7A4 1VQ51 2QJ1A 2VPZA 3HOVI 3I551 4A3KI 2WPGA 1K9M1 2Y1EA 1YUAA 3UERA 3CQZI 3T8VA 1YUKA 2KI7B 2Y0SA 2V8KA 4E31A 3CCJ1 1YI2Z 3J81b 4RV9A 4NB9A 4X2UA 1N8R2 1W2BY 2JD1A 4AICA 1K732 3WQRA 3B7SA 1KRLA 2V3VA 3WQQA 3CC7Z 1VQMZ 1K9M2 4Y52I 2O53A 2WAQA 1YIT1 4R5VA 3ZHZA 3CC71 4DQYB 3VVMA 1VQ71 4A03A 1MVYA 4DGLA 2QEX1 2HU9A 1JWHC 1X3ZA 4XO5A 3FULA 1VQL1 2JCXA 4AR1A 4BY7I 3KEDA 2DE7A 2EGHA 3D2LA 2MAPA 4RS4A 5DLLA 2ZAEB 3FQQA 3S1NI 1K83I 2WB1A 1VQ8Z 2Q51A 1ZB9A 4TNUA 1QVFZ 4FLOA 2VUGA 3CZEA 3RASA 3I07A 3FH5A 5D1OA 3KIHA 1KQSZ 3FUDA 4ZQHA 1R0LA 3UEQA 1WCMI 2PM9A 3GTMI 5JO0A 2AKLA 4XN8A 1I3QI 3MZKB 1RO4A 3I56Z 2JR6A 3FU3A 4OOFA 4AR9A 4A3CI 1H3LA 1ML8A 2M6NA 3LUSA 4A3BI 2JCYA 5IP7I 1RNIA 4E30A 2HF1A 3HOWI 3GTKI 1M1K1 5JMWA 2E2JI 3PO2I 4ZN6A 5C4XI 2OOXB 2JV7A 4RVDA 4XN9A 5IT9b 1ZB8A 4MD8A 5AENA 5HLTA 4HGYA 3JAMf 4MXUA 1SIWA 3J80b 2JA7I 3S1MI 3CZGA 3JT1A 3CCLZ 5FWQA 4XMWA 4ZQTA 3CCV1 2Y1GA 3Q44A 3QJXA 4NBGA 2NVTI 3G71Z 4S1TA 1MW2A 4ZQEA 3CZLA 1Y1VI 2F4MA 1VQO1 1W2BZ 4ZW6A 3CCUZ 4ZW7A 3G711 2PMZA 1WW9A 3S17I 5FLXb 4XNBA 1PFTA 4PW4A 3VMHA 3FU0A 3FUHA 4XN2A 3PUUA 1K8A1 2NAPA 3HOUI 2FFLA 5IT9f 2JD2A 1R9TI 2OTJ1 3IR7A 2V45A 1DL6A 3J80f 4XN1A 2R93I 1WIIA 3ANNA 2I3CA 3KIFA 4MD9A 3IIEA 2OTLZ 2YU9I 3G6E1 1X0TA 3GKQA 3TE5B 2QR1B 1I50I 4A3FI 3VVLA 2OTL1 3I4NI 1VQ4Z 3FUFA 4Q4IA 3S15I 2O7GA 5C4JI 2JA6I 5C44I 3RZOI 1QYPA 2V8JA 4R7LA 3IFUA 3I55Z 1VQ41 3HOXI 2W04A 3CZKA 4HH4A 1K731 1GW6A 2DQMA 1USPB 4RCVA 3CCJZ 2WZFA 3U50C 3CCE1 1TFIA 1VLAA 1ZH1A 3CHQA 3RZDI 3ANLA 2JCVA 3PO3S 3FTZA 2QLVB 3FQMA 3BG0B 4BY1I 2XPZA 1T1SA 3AUAA 1NJI1 4GAAA 3A14A 2JA5I 1YITZ 1Q0LA 2GTIA 4ZX5A 1I6HI 4RVBA 4XN4A 4CXFA 1VQ7Z 2Y1CA 2OZKA 2VPYA 2F4OA 2QEXZ 3CHPA 3FHEA 3B7TA 3GTOI 2E2HI 3D6WA 3WQSB 1NJI2 3T4NB 3ANMA 3CXCY 4NBFA 4Q4EA 1VQLZ 3S14I 1Z01A 1TWHI 5FLMI 1QXFA 4MONA 4XN5A 2JD0A 4BXXI 2IZ4A 2RJIA 1MW0A 3FU5A 4XO3A 3K7AI 4DPRA 2JUBA 1SG7A 3FKII 4NB8A 4ZW3A 2V8IA 1VQ91 4NBBA 3JAMb 3FTUA 2BJOA 5DULA 4NBEA 3VB9A 1AA6A 3B3BA 4ZW5A 3NDIA 1VQK1 3CC2Z 4XMZA 3GTLI 2VF1A 4NBHA 2PL5A 3FUJA 1SFOI 3CC21 4A3EI 1Z02A 3FTVA 4L2LA 3D9XA 5A2Qb 1M901 2VJ8A 1S721 2ZXGA 2Y1FA 1JJ2Y 4MKTA 4AYBA 3EBHA 4A3II 2GTQA 2QRDB 3CC4Z 4K5NA 3CCR1 4XMVA 2EGTA 3RC3A 3AU9A 1QVGY 4FLRA 2XQ0A 3B7RL 1VQP1 3CC41 3M3YI 2RT9A 4NBAA 1M902 3HOYI 3A06A 1WJ2A 1ONOA 4NBDA 4R5TA 1T1RA 5IP9I 2JS4A 5JAZA 3MONA 3B34A 3CCVZ 1VQNZ 3CCQZ 2QVWA 4A3MI 1Q16A 1VQOZ 3S1RI 4LUPA 1VQN1 4Y67A 3CCQ1 3H3VJ 4AYSA 3MZLB 2Q4ZA 2QA41 1RO0A 1MW3A 1S7MA 5A2Qf 2R59A 2E7ZA 3P5JB 5LL6f 2DE6A 5JBIA 4JNDA 3GTQI 1SC5A 2VLAA 2C82A 1FDIA 4XO4A 2OTJZ 4ARFA 4Y6RA 2NVYI 2R92I 4XNDA 3CHRA 3ESWA 1Q811 3EBIA 3S1QI 2E9HA 1L1OC 2R6MA 4A3LI 3GTJI 3G6EZ 4A3JI 2GTHA 2JMOA 3GTMS 1KC82 2VUMI 4E33A 2R7ZI 1USPA 4RVFA 5C3EI 4MRIA 4Y7NI 3CD61 2DQ6A 4ZW8A 1Y8CA 3G4S1 3ZHXA 3OW2Y
chains in the Genus database with same CATH topology
4ZX4A 1NUIA 2P28A 1H19A 3Q43A 4RVGA 1Q812 2QRCB 4XX2A 3CMEZ 3H0GI 1HS6A 1Q821 2NVQI 3CPWY 1NP6A 1RLYA 5JNLA 4NBCA 2M48A 3CME1 3CCEZ 2R70A 3FTXA 1SQMA 2C5ZA 1Q7Y2 1KD12 2RIQA 3EBGA 1MW1A 5D1PA 4XMXA 2LFUA 5JMPA 4FLSA 1R0KA 3TDHB 3VMIA 1JJ2Z 1Z03A 1Q822 5BPPA 4HGZA 1TWCI 4KP7A 1RQFA 1YJNZ 2E2II 3S16I 1Y1VS 1YJ91 2XPYA 1YJN1 2A7OA 3NH4A 5CM2M 3NDJA 4A3DI 3FUEA 3EERA 3GTGI 1Q0QA 4K5MA 3UCQA 3CIAA 4MS6A 4QMEA 5T64A 2P3YA 4XMTA 4FLQA 4NOZA 4ZQGA 3FTWA 4XNAA 1QF8A 4K5OA 2PGGA 2JA8I 3CHSA 1Y1WI 2QREB 3R0IA 2DE5A 1YI21 4AR8A 1TWGI 1VQ9Z 5T6BA 2J6AA 3GCFA 2OOYB 3FUIA 1VQKZ 1VQM1 1S46A 1X3WA 5EV7A 2JNYA 4A93I 2RBLA 3EEDA 4RVHA 5HNHA 3IX0A 4K5PA 4E2WA 4XMUA 2O4HA 2R72A 4E32A 4J3BA 1S72Z 1LQLA 3B37A 3FUNA 3FU6A 2B63I 3OW2Z 2K3RA 3CCRZ 3J81f 3BG1B 4X6AI 2HPOA 4Y6SA 4QTUA 3FTYA 3M4OI 3VMGA 1VQPZ 1ONNA 3I4MI 2IZ3A 3CPWZ 4XN7A 1VQ81 1TWFI 2B61A 3B2XA 5DYFA 3U9WA 3NFZA 3RC8A 2QKDA 3HKZA 4E2XA 3S2DI 4RSYA 2PK7A 3GTPI 3ZHYA 3AU8A 2QA4Z 2H85A 1JG9A 3I561 3F3FC 3Q87A 3F3PC 4QHPA 2KPIA 2W03A 5HNFA 2PUSA 3NH8A 4FCAA 4QPEA 3ZI0A 1JVSA 3FUKA 4R5XA 5D1OB 1YJWZ 2HPTA 3B2PA 4K5LA 1KC81 2MAOA 1YIJZ 3JSZA 1Q861 1YJW1 3FTSA 4EWCA 5T67A 3PO3I 3T0YA 3VTNA 4PU2A 1YIJ1 1M1K2 3CXCZ 2NVXI 4NH1C 3CCSZ 1JGIA 4ZQFA 4A3GI 1RP3A 3CHOA 4E2ZA 3CCL1 1VQ6Z 4NFRA 3CD6Z 3CCS1 3G4SZ 1P9NA 1Q862 2LIYA 3FH8A 1VQ61 3FUMA 4QIRA 4MD7A 1Q7Y1 1KD11 3CCU1 3NH5A 4E2YA 3B7UX 3CMAZ 1Q0HA 1N2FA 2RPRA 4Y6PA 3S2HI 3QWUA 1ZS2A 4GAEA 1TWAI 3CMA1 2Y1DA 4NQWA 1QVFY 1KQSY 4BBRI 2WZGA 2GU2A 1G5AA 3HOZI 1OR7A 5JC1A 1ONPA 4CL1A 4MH4A 4QUOA 3IF8A 4ZX3A 3FH7A 2G2KA 2YADA 3CCMZ 1K8A2 4ZX6A 2K5RA 1YHQZ 5AN9F 3CCM1 1YJ9Z 4BBSI 4BKXA 1YHQ1 4QTTA 1QVGZ 4OOEA 1VQ5Z 1RO2A 4DK1A 5FLXf 1K5HA 4PVBA 1N8R1 2RHBA 3J7A4 1VQ51 2QJ1A 3HOVI 3I551 4A3KI 2WPGA 1K9M1 2Y1EA 1YUAA 3UERA 3CQZI 3T8VA 1YUKA 2KI7B 2Y0SA 2V8KA 4E31A 3CCJ1 1YI2Z 3J81b 4RV9A 4NB9A 4X2UA 1N8R2 1W2BY 2JD1A 4AICA 1K732 3WQRA 3B7SA 1KRLA 1VQMZ 3WQQA 3CC7Z 1K9M2 4Y52I 2O53A 2WAQA 1YIT1 4R5VA 3ZHZA 3CC71 4DQYB 3VVMA 1VQ71 4A03A 1MVYA 4DGLA 2QEX1 2HU9A 1JWHC 1X3ZA 4XO5A 3FULA 1VQL1 2JCXA 4AR1A 4BY7I 3KEDA 2DE7A 2EGHA 2MAPA 4RS4A 5DLLA 2ZAEB 3FQQA 3S1NI 1K83I 2WB1A 1VQ8Z 2Q51A 1ZB9A 4TNUA 1QVFZ 4FLOA 2VUGA 3CZEA 3RASA 3I07A 3FH5A 5D1OA 3KIHA 1KQSZ 3FUDA 4ZQHA 1R0LA 3UEQA 1WCMI 2PM9A 3GTMI 5JO0A 2AKLA 4XN8A 1I3QI 3MZKB 1RO4A 3I56Z 2JR6A 3FU3A 4OOFA 4AR9A 4A3CI 1H3LA 1ML8A 2M6NA 3LUSA 4A3BI 2JCYA 5IP7I 1RNIA 4E30A 2HF1A 3HOWI 3GTKI 1M1K1 5JMWA 2E2JI 3PO2I 4ZN6A 5C4XI 2OOXB 2JV7A 4RVDA 4XN9A 5IT9b 1ZB8A 4MD8A 5AENA 5HLTA 4HGYA 3JAMf 4MXUA 3J80b 2JA7I 3S1MI 3CZGA 3JT1A 3CCLZ 5FWQA 4XMWA 4ZQTA 3CCV1 2Y1GA 3Q44A 3QJXA 4NBGA 2NVTI 3G71Z 4S1TA 1MW2A 4ZQEA 3CZLA 1Y1VI 2F4MA 1VQO1 1W2BZ 4ZW6A 3CCUZ 4ZW7A 3G711 2PMZA 1WW9A 3S17I 5FLXb 4XNBA 1PFTA 4PW4A 3VMHA 3FU0A 3FUHA 4XN2A 3PUUA 1K8A1 3HOUI 2FFLA 5IT9f 2JD2A 1R9TI 2OTJ1 1DL6A 3J80f 4XN1A 2R93I 1WIIA 3ANNA 2I3CA 3KIFA 4MD9A 3IIEA 2OTLZ 2YU9I 3G6E1 1X0TA 3GKQA 3TE5B 2QR1B 1I50I 4A3FI 3VVLA 2OTL1 3I4NI 1VQ4Z 3FUFA 4Q4IA 3S15I 2O7GA 5C4JI 2JA6I 5C44I 3RZOI 1QYPA 2V8JA 4R7LA 3IFUA 3I55Z 1VQ41 3HOXI 2W04A 3CZKA 4HH4A 1K731 1GW6A 2DQMA 1USPB 4RCVA 3CCJZ 2WZFA 3U50C 3CCE1 1TFIA 1VLAA 1ZH1A 3CHQA 3RZDI 3ANLA 2JCVA 3PO3S 3FTZA 2QLVB 3FQMA 3BG0B 4BY1I 2XPZA 1T1SA 3AUAA 1NJI1 4GAAA 3A14A 2JA5I 1YITZ 1Q0LA 2GTIA 4ZX5A 1I6HI 4RVBA 4XN4A 4CXFA 1VQ7Z 2Y1CA 2OZKA 2F4OA 2QEXZ 3CHPA 3FHEA 3B7TA 3GTOI 2E2HI 3D6WA 3WQSB 1NJI2 3T4NB 3ANMA 3CXCY 4NBFA 4Q4EA 1VQLZ 3S14I 1Z01A 1TWHI 5FLMI 4MONA 4XN5A 2JD0A 4BXXI 2IZ4A 2RJIA 1MW0A 3FU5A 4XO3A 3K7AI 4DPRA 2JUBA 1SG7A 3FKII 4NB8A 4ZW3A 2V8IA 1VQ91 4NBBA 3JAMb 3FTUA 2BJOA 5DULA 4NBEA 3VB9A 3B3BA 4ZW5A 3NDIA 1VQK1 3CC2Z 4XMZA 3GTLI 2VF1A 4NBHA 2PL5A 3FUJA 1SFOI 3CC21 4A3EI 1Z02A 3FTVA 4L2LA 3D9XA 5A2Qb 1M901 2VJ8A 1S721 2ZXGA 2Y1FA 1JJ2Y 4MKTA 4AYBA 3EBHA 4A3II 2GTQA 2QRDB 3CC4Z 4K5NA 3CCR1 4XMVA 2EGTA 3RC3A 3AU9A 1QVGY 4FLRA 2XQ0A 3B7RL 1VQP1 3CC41 3M3YI 2RT9A 4NBAA 1M902 3HOYI 3A06A 1ONOA 4NBDA 4R5TA 1T1RA 5IP9I 2JS4A 5JAZA 3MONA 3B34A 3CCVZ 1VQNZ 3CCQZ 2QVWA 4A3MI 1VQOZ 3S1RI 4LUPA 1VQN1 4Y67A 3CCQ1 3H3VJ 4AYSA 3MZLB 2Q4ZA 2QA41 1RO0A 1MW3A 1S7MA 5A2Qf 2R59A 3P5JB 5LL6f 2DE6A 5JBIA 4JNDA 3GTQI 1SC5A 2VLAA 2C82A 4XO4A 2OTJZ 4ARFA 4Y6RA 2NVYI 2R92I 4XNDA 3CHRA 3ESWA 1Q811 3EBIA 3S1QI 2E9HA 1L1OC 2R6MA 4A3LI 3GTJI 3G6EZ 4A3JI 2GTHA 2JMOA 3GTMS 1KC82 2VUMI 4E33A 2R7ZI 1USPA 4RVFA 5C3EI 4MRIA 4Y7NI 3CD61 2DQ6A 4ZW8A 3G4S1 3ZHXA 3OW2Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 I;  1NUI A;  1K83 I;  1I6H I;  4XX2 A;  1ZB9 A;  3H0G I;  2F4O A;  3I07 A;  2NVQ I;  1RLY A;  1WCM I;  4NBC A;  3GTO I;  3GTM I;  3PO3 I;  2AKL A;  3D6W A;  2E2H I;  1I3Q I;  1RO4 A;  2NVX I;  4NBF A;  2JR6 A;  4A3G I;  3S14 I;  1TWH I;  4A3C I;  5FLM I;  3VMI A;  1ML8 A;  3LUS A;  4A3B I;  5IP7 I;  4BXX I;  2HF1 A;  1TWC I;  3HOW I;  3K7A I;  3GTK I;  2E2I I;  3PO2 I;  2E2J I;  3S16 I;  1Y1V S;  5C4X I;  1N2F A;  3FKI I;  4NB8 A;  5CM2 M;  1ZB8 A;  4NBB A;  3S2H I;  1TWA I;  2BJO A;  4A3D I;  3VB9 A;  4NBE A;  4BBR I;  3EER A;  2JA7 I;  3GTG I;  3GTL I;  3S1M I;  4NBH A;  3HOZ I;  2P3Y A;  1SFO I;  2NVT I;  4NBG A;  4MH4 A;  4A3E I;  4NOZ A;  2F4M A;  1Y1V I;  2JA8 I;  1Y1W I;  2K5R A;  2DE5 A;  4A3I I;  1TWG I;  4BBS I;  1WW9 A;  3S17 I;  1PFT A;  2J6A A;  4QTT A;  3VMH A;  3GCF A;  3M3Y I;  1X3W A;  4NBA A;  2JNY A;  3HOY I;  4A93 I;  5IP9 I;  4NBD A;  3HOU I;  2RBL A;  2JS4 A;  3HOV I;  4A3K I;  1R9T I;  4A3M I;  1DL6 A;  3S1R I;  1LQL A;  1YUA A;  3CQZ I;  2R93 I;  3H3V J;  2YU9 I;  3GKQ A;  4NB9 A;  2B63 I;  1I50 I;  4X6A I;  4A3F I;  4QTU A;  3I4N I;  3M4O I;  3VMG A;  3I4M I;  2DE6 A;  3S15 I;  4Y52 I;  5C4J I;  2JA6 I;  5C44 I;  3RZO I;  1QYP A;  3GTQ I;  1TWF I;  3HOX I;  2NVY I;  2R92 I;  1USP B;  3ESW A;  3S2D I;  1X3Z A;  2PK7 A;  3GTP I;  3S1Q I;  1L1O C;  3U50 C;  1TFI A;  1VLA A;  3GTJ I;  4A3J I;  3RZD I;  4A3L I;  3GTM S;  2VUM I;  3PO3 S;  2R7Z I;  3Q87 A;  1USP A;  4BY7 I;  2KPI A;  5C3E I;  2DE7 A;  4BY1 I;  4Y7N I;  3S1N I; 
#chains in the Genus database with same CATH topology
 4ZX4 A;  1NUI A;  2P28 A;  1H19 A;  3Q43 A;  4RVG A;  1Q81 2;  2QRC B;  4XX2 A;  3CME Z;  3H0G I;  1HS6 A;  1Q82 1;  2NVQ I;  3CPW Y;  1NP6 A;  1RLY A;  5JNL A;  4NBC A;  2M48 A;  3CME 1;  3CCE Z;  2R70 A;  3FTX A;  1SQM A;  2C5Z A;  1Q7Y 2;  1KD1 2;  2RIQ A;  3EBG A;  1MW1 A;  5D1P A;  4XMX A;  2LFU A;  5JMP A;  4FLS A;  1R0K A;  3TDH B;  3VMI A;  1JJ2 Z;  1Z03 A;  1Q82 2;  5BPP A;  4HGZ A;  1TWC I;  4KP7 A;  1RQF A;  1YJN Z;  2E2I I;  3S16 I;  1Y1V S;  1YJ9 1;  2XPY A;  1YJN 1;  2A7O A;  3NH4 A;  5CM2 M;  3NDJ A;  4A3D I;  3FUE A;  3EER A;  3GTG I;  1Q0Q A;  4K5M A;  3UCQ A;  3CIA A;  4MS6 A;  4QME A;  5T64 A;  2P3Y A;  4XMT A;  4FLQ A;  4NOZ A;  4ZQG A;  3FTW A;  4XNA A;  1QF8 A;  4K5O A;  2PGG A;  2JA8 I;  3CHS A;  1Y1W I;  2QRE B;  3R0I A;  2DE5 A;  1YI2 1;  4AR8 A;  1TWG I;  1VQ9 Z;  2VPW A;  5T6B A;  2J6A A;  3GCF A;  2OOY B;  3FUI A;  1VQK Z;  1VQM 1;  1S46 A;  1X3W A;  5EV7 A;  2JNY A;  4A93 I;  2RBL A;  1FDO A;  3EED A;  4RVH A;  5HNH A;  2JIR A;  3IX0 A;  4K5P A;  4E2W A;  4XMU A;  2O4H A;  2R72 A;  4E32 A;  4J3B A;  1S72 Z;  1LQL A;  3B37 A;  3FUN A;  3FU6 A;  2B63 I;  3OW2 Z;  2K3R A;  3CCR Z;  3J81 f;  3BG1 B;  4X6A I;  2LEX A;  2HPO A;  4Y6S A;  4QTU A;  3FTY A;  3M4O I;  3VMG A;  1VQP Z;  1ONN A;  3I4M I;  2IZ3 A;  3CPW Z;  4XN7 A;  1VQ8 1;  1TWF I;  2B61 A;  3B2X A;  2JIQ A;  5DYF A;  3U9W A;  3NFZ A;  3RC8 A;  2QKD A;  3HKZ A;  4E2X A;  3S2D I;  4RSY A;  2PK7 A;  3GTP I;  3ZHY A;  3AU8 A;  2QA4 Z;  2H85 A;  2JIM A;  1JG9 A;  3I56 1;  3F3F C;  3Q87 A;  3F3P C;  4QHP A;  2KPI A;  2W03 A;  5HNF A;  2PUS A;  3NH8 A;  4FCA A;  4QPE A;  3ZI0 A;  1JVS A;  3FUK A;  4R5X A;  5D1O B;  1YJW Z;  2HPT A;  3B2P A;  4K5L A;  1KC8 1;  2MAO A;  1YIJ Z;  3JSZ A;  1Q86 1;  1YJW 1;  3FTS A;  4EWC A;  5T67 A;  3PO3 I;  3HW2 A;  3T0Y A;  3VTN A;  4PU2 A;  1YIJ 1;  1M1K 2;  3CXC Z;  2NVX I;  4NH1 C;  2JIO A;  3CCS Z;  1JGI A;  4ZQF A;  4A3G I;  1WZN A;  1RP3 A;  3CHO A;  2JIP A;  4E2Z A;  3CCL 1;  1VQ6 Z;  4NFR A;  3CD6 Z;  3CCS 1;  3G4S Z;  1P9N A;  1Q86 2;  2LIY A;  3FH8 A;  2AYD A;  1VQ6 1;  3FUM A;  4QIR A;  4MD7 A;  1Q7Y 1;  1KD1 1;  3CCU 1;  3NH5 A;  4E2Y A;  3B7U X;  3CMA Z;  1Q0H A;  1N2F A;  2RPR A;  4Y6P A;  3S2H I;  3QWU A;  1ZS2 A;  4GAE A;  1TWA I;  3CMA 1;  2Y1D A;  4NQW A;  1QVF Y;  3CXB A;  1KQS Y;  4BBR I;  2WZG A;  2GU2 A;  2IV2 X;  1G5A A;  3HOZ I;  1OR7 A;  5JC1 A;  2VPX A;  1ONP A;  4CL1 A;  4MH4 A;  4QUO A;  3IF8 A;  4ZX3 A;  3FH7 A;  2G2K A;  2YAD A;  3CCM Z;  1K8A 2;  4ZX6 A;  2K5R A;  1YHQ Z;  5AN9 F;  3CCM 1;  1YJ9 Z;  4BBS I;  4BKX A;  1YHQ 1;  4QTT A;  1QVG Z;  4OOE A;  1VQ5 Z;  1RO2 A;  4DK1 A;  5FLX f;  1K5H A;  4PVB A;  1N8R 1;  2RHB A;  3J7A 4;  1VQ5 1;  2QJ1 A;  2VPZ A;  3HOV I;  3I55 1;  4A3K I;  2WPG A;  1K9M 1;  2Y1E A;  1YUA A;  3UER A;  3CQZ I;  3T8V A;  1YUK A;  2KI7 B;  2Y0S A;  2V8K A;  4E31 A;  3CCJ 1;  1YI2 Z;  3J81 b;  4RV9 A;  4NB9 A;  4X2U A;  1N8R 2;  1W2B Y;  2JD1 A;  4AIC A;  1K73 2;  3WQR A;  3B7S A;  1KRL A;  2V3V A;  3WQQ A;  3CC7 Z;  1VQM Z;  1K9M 2;  4Y52 I;  2O53 A;  2WAQ A;  1YIT 1;  4R5V A;  3ZHZ A;  3CC7 1;  4DQY B;  3VVM A;  1VQ7 1;  4A03 A;  1MVY A;  4DGL A;  2QEX 1;  2HU9 A;  1JWH C;  1X3Z A;  4XO5 A;  3FUL A;  1VQL 1;  2JCX A;  4AR1 A;  4BY7 I;  3KED A;  2DE7 A;  2EGH A;  3D2L A;  2MAP A;  4RS4 A;  5DLL A;  2ZAE B;  3FQQ A;  3S1N I;  1K83 I;  2WB1 A;  1VQ8 Z;  2Q51 A;  1ZB9 A;  4TNU A;  1QVF Z;  4FLO A;  2VUG A;  3CZE A;  3RAS A;  3I07 A;  3FH5 A;  5D1O A;  3KIH A;  1KQS Z;  3FUD A;  4ZQH A;  1R0L A;  3UEQ A;  1WCM I;  2PM9 A;  3GTM I;  5JO0 A;  2AKL A;  4XN8 A;  1I3Q I;  3MZK B;  1RO4 A;  3I56 Z;  2JR6 A;  3FU3 A;  4OOF A;  4AR9 A;  4A3C I;  1H3L A;  1ML8 A;  2M6N A;  3LUS A;  4A3B I;  2JCY A;  5IP7 I;  1RNI A;  4E30 A;  2HF1 A;  3HOW I;  3GTK I;  1M1K 1;  5JMW A;  2E2J I;  3PO2 I;  4ZN6 A;  5C4X I;  2OOX B;  2JV7 A;  4RVD A;  4XN9 A;  5IT9 b;  1ZB8 A;  4MD8 A;  5AEN A;  5HLT A;  4HGY A;  3JAM f;  4MXU A;  1SIW A;  3J80 b;  2JA7 I;  3S1M I;  3CZG A;  3JT1 A;  3CCL Z;  5FWQ A;  4XMW A;  4ZQT A;  3CCV 1;  2Y1G A;  3Q44 A;  3QJX A;  4NBG A;  2NVT I;  3G71 Z;  4S1T A;  1MW2 A;  4ZQE A;  3CZL A;  1Y1V I;  2F4M A;  1VQO 1;  1W2B Z;  4ZW6 A;  3CCU Z;  4ZW7 A;  3G71 1;  2PMZ A;  1WW9 A;  3S17 I;  5FLX b;  4XNB A;  1PFT A;  4PW4 A;  3VMH A;  3FU0 A;  3FUH A;  4XN2 A;  3PUU A;  1K8A 1;  2NAP A;  3HOU I;  2FFL A;  5IT9 f;  2JD2 A;  1R9T I;  2OTJ 1;  3IR7 A;  2V45 A;  1DL6 A;  3J80 f;  4XN1 A;  2R93 I;  1WII A;  3ANN A;  2I3C A;  3KIF A;  4MD9 A;  3IIE A;  2OTL Z;  2YU9 I;  3G6E 1;  1X0T A;  3GKQ A;  3TE5 B;  2QR1 B;  1I50 I;  4A3F I;  3VVL A;  2OTL 1;  3I4N I;  1VQ4 Z;  3FUF A;  4Q4I A;  3S15 I;  2O7G A;  5C4J I;  2JA6 I;  5C44 I;  3RZO I;  1QYP A;  2V8J A;  4R7L A;  3IFU A;  3I55 Z;  1VQ4 1;  3HOX I;  2W04 A;  3CZK A;  4HH4 A;  1K73 1;  1GW6 A;  2DQM A;  1USP B;  4RCV A;  3CCJ Z;  2WZF A;  3U50 C;  3CCE 1;  1TFI A;  1VLA A;  1ZH1 A;  3CHQ A;  3RZD I;  3ANL A;  2JCV A;  3PO3 S;  3FTZ A;  2QLV B;  3FQM A;  3BG0 B;  4BY1 I;  2XPZ A;  1T1S A;  3AUA A;  1NJI 1;  4GAA A;  3A14 A;  2JA5 I;  1YIT Z;  1Q0L A;  2GTI A;  4ZX5 A;  1I6H I;  4RVB A;  4XN4 A;  4CXF A;  1VQ7 Z;  2Y1C A;  2OZK A;  2VPY A;  2F4O A;  2QEX Z;  3CHP A;  3FHE A;  3B7T A;  3GTO I;  2E2H I;  3D6W A;  3WQS B;  1NJI 2;  3T4N B;  3ANM A;  3CXC Y;  4NBF A;  4Q4E A;  1VQL Z;  3S14 I;  1Z01 A;  1TWH I;  5FLM I;  1QXF A;  4MON A;  4XN5 A;  2JD0 A;  4BXX I;  2IZ4 A;  2RJI A;  1MW0 A;  3FU5 A;  4XO3 A;  3K7A I;  4DPR A;  2JUB A;  1SG7 A;  3FKI I;  4NB8 A;  4ZW3 A;  2V8I A;  1VQ9 1;  4NBB A;  3JAM b;  3FTU A;  2BJO A;  5DUL A;  4NBE A;  3VB9 A;  1AA6 A;  3B3B A;  4ZW5 A;  3NDI A;  1VQK 1;  3CC2 Z;  4XMZ A;  3GTL I;  2VF1 A;  4NBH A;  2PL5 A;  3FUJ A;  1SFO I;  3CC2 1;  4A3E I;  1Z02 A;  3FTV A;  4L2L A;  3D9X A;  5A2Q b;  1M90 1;  2VJ8 A;  1S72 1;  2ZXG A;  2Y1F A;  1JJ2 Y;  4MKT A;  4AYB A;  3EBH A;  4A3I I;  2GTQ A;  2QRD B;  3CC4 Z;  4K5N A;  3CCR 1;  4XMV A;  2EGT A;  3RC3 A;  3AU9 A;  1QVG Y;  4FLR A;  2XQ0 A;  3B7R L;  1VQP 1;  3CC4 1;  3M3Y I;  2RT9 A;  4NBA A;  1M90 2;  3HOY I;  3A06 A;  1WJ2 A;  1ONO A;  4NBD A;  4R5T A;  1T1R A;  5IP9 I;  2JS4 A;  5JAZ A;  3MON A;  3B34 A;  3CCV Z;  1VQN Z;  3CCQ Z;  2QVW A;  4A3M I;  1Q16 A;  1VQO Z;  3S1R I;  4LUP A;  1VQN 1;  4Y67 A;  3CCQ 1;  3H3V J;  4AYS A;  3MZL B;  2Q4Z A;  2QA4 1;  1RO0 A;  1MW3 A;  1S7M A;  5A2Q f;  2R59 A;  2E7Z A;  3P5J B;  5LL6 f;  2DE6 A;  5JBI A;  4JND A;  3GTQ I;  1SC5 A;  2VLA A;  2C82 A;  1FDI A;  4XO4 A;  2OTJ Z;  4ARF A;  4Y6R A;  2NVY I;  2R92 I;  4XND A;  3CHR A;  3ESW A;  1Q81 1;  3EBI A;  3S1Q I;  2E9H A;  1L1O C;  2R6M A;  4A3L I;  3GTJ I;  3G6E Z;  4A3J I;  2GTH A;  2JMO A;  3GTM S;  1KC8 2;  2VUM I;  4E33 A;  2R7Z I;  1USP A;  4RVF A;  5C3E I;  4MRI A;  4Y7N I;  3CD6 1;  2DQ6 A;  4ZW8 A;  1Y8C A;  3G4S 1;  3ZHX A;  3OW2 Y; 
#chains in the Genus database with same CATH homology
 4ZX4 A;  1NUI A;  2P28 A;  1H19 A;  3Q43 A;  4RVG A;  1Q81 2;  2QRC B;  4XX2 A;  3CME Z;  3H0G I;  1HS6 A;  1Q82 1;  2NVQ I;  3CPW Y;  1NP6 A;  1RLY A;  5JNL A;  4NBC A;  2M48 A;  3CME 1;  3CCE Z;  2R70 A;  3FTX A;  1SQM A;  2C5Z A;  1Q7Y 2;  1KD1 2;  2RIQ A;  3EBG A;  1MW1 A;  5D1P A;  4XMX A;  2LFU A;  5JMP A;  4FLS A;  1R0K A;  3TDH B;  3VMI A;  1JJ2 Z;  1Z03 A;  1Q82 2;  5BPP A;  4HGZ A;  1TWC I;  4KP7 A;  1RQF A;  1YJN Z;  2E2I I;  3S16 I;  1Y1V S;  1YJ9 1;  2XPY A;  1YJN 1;  2A7O A;  3NH4 A;  5CM2 M;  3NDJ A;  4A3D I;  3FUE A;  3EER A;  3GTG I;  1Q0Q A;  4K5M A;  3UCQ A;  3CIA A;  4MS6 A;  4QME A;  5T64 A;  2P3Y A;  4XMT A;  4FLQ A;  4NOZ A;  4ZQG A;  3FTW A;  4XNA A;  1QF8 A;  4K5O A;  2PGG A;  2JA8 I;  3CHS A;  1Y1W I;  2QRE B;  3R0I A;  2DE5 A;  1YI2 1;  4AR8 A;  1TWG I;  1VQ9 Z;  5T6B A;  2J6A A;  3GCF A;  2OOY B;  3FUI A;  1VQK Z;  1VQM 1;  1S46 A;  1X3W A;  5EV7 A;  2JNY A;  4A93 I;  2RBL A;  3EED A;  4RVH A;  5HNH A;  3IX0 A;  4K5P A;  4E2W A;  4XMU A;  2O4H A;  2R72 A;  4E32 A;  4J3B A;  1S72 Z;  1LQL A;  3B37 A;  3FUN A;  3FU6 A;  2B63 I;  3OW2 Z;  2K3R A;  3CCR Z;  3J81 f;  3BG1 B;  4X6A I;  2HPO A;  4Y6S A;  4QTU A;  3FTY A;  3M4O I;  3VMG A;  1VQP Z;  1ONN A;  3I4M I;  2IZ3 A;  3CPW Z;  4XN7 A;  1VQ8 1;  1TWF I;  2B61 A;  3B2X A;  5DYF A;  3U9W A;  3NFZ A;  3RC8 A;  2QKD A;  3HKZ A;  4E2X A;  3S2D I;  4RSY A;  2PK7 A;  3GTP I;  3ZHY A;  3AU8 A;  2QA4 Z;  2H85 A;  1JG9 A;  3I56 1;  3F3F C;  3Q87 A;  3F3P C;  4QHP A;  2KPI A;  2W03 A;  5HNF A;  2PUS A;  3NH8 A;  4FCA A;  4QPE A;  3ZI0 A;  1JVS A;  3FUK A;  4R5X A;  5D1O B;  1YJW Z;  2HPT A;  3B2P A;  4K5L A;  1KC8 1;  2MAO A;  1YIJ Z;  3JSZ A;  1Q86 1;  1YJW 1;  3FTS A;  4EWC A;  5T67 A;  3PO3 I;  3T0Y A;  3VTN A;  4PU2 A;  1YIJ 1;  1M1K 2;  3CXC Z;  2NVX I;  4NH1 C;  3CCS Z;  1JGI A;  4ZQF A;  4A3G I;  1RP3 A;  3CHO A;  4E2Z A;  3CCL 1;  1VQ6 Z;  4NFR A;  3CD6 Z;  3CCS 1;  3G4S Z;  1P9N A;  1Q86 2;  2LIY A;  3FH8 A;  1VQ6 1;  3FUM A;  4QIR A;  4MD7 A;  1Q7Y 1;  1KD1 1;  3CCU 1;  3NH5 A;  4E2Y A;  3B7U X;  3CMA Z;  1Q0H A;  1N2F A;  2RPR A;  4Y6P A;  3S2H I;  3QWU A;  1ZS2 A;  4GAE A;  1TWA I;  3CMA 1;  2Y1D A;  4NQW A;  1QVF Y;  1KQS Y;  4BBR I;  2WZG A;  2GU2 A;  1G5A A;  3HOZ I;  1OR7 A;  5JC1 A;  1ONP A;  4CL1 A;  4MH4 A;  4QUO A;  3IF8 A;  4ZX3 A;  3FH7 A;  2G2K A;  2YAD A;  3CCM Z;  1K8A 2;  4ZX6 A;  2K5R A;  1YHQ Z;  5AN9 F;  3CCM 1;  1YJ9 Z;  4BBS I;  4BKX A;  1YHQ 1;  4QTT A;  1QVG Z;  4OOE A;  1VQ5 Z;  1RO2 A;  4DK1 A;  5FLX f;  1K5H A;  4PVB A;  1N8R 1;  2RHB A;  3J7A 4;  1VQ5 1;  2QJ1 A;  3HOV I;  3I55 1;  4A3K I;  2WPG A;  1K9M 1;  2Y1E A;  1YUA A;  3UER A;  3CQZ I;  3T8V A;  1YUK A;  2KI7 B;  2Y0S A;  2V8K A;  4E31 A;  3CCJ 1;  1YI2 Z;  3J81 b;  4RV9 A;  4NB9 A;  4X2U A;  1N8R 2;  1W2B Y;  2JD1 A;  4AIC A;  1K73 2;  3WQR A;  3B7S A;  1KRL A;  1VQM Z;  3WQQ A;  3CC7 Z;  1K9M 2;  4Y52 I;  2O53 A;  2WAQ A;  1YIT 1;  4R5V A;  3ZHZ A;  3CC7 1;  4DQY B;  3VVM A;  1VQ7 1;  4A03 A;  1MVY A;  4DGL A;  2QEX 1;  2HU9 A;  1JWH C;  1X3Z A;  4XO5 A;  3FUL A;  1VQL 1;  2JCX A;  4AR1 A;  4BY7 I;  3KED A;  2DE7 A;  2EGH A;  2MAP A;  4RS4 A;  5DLL A;  2ZAE B;  3FQQ A;  3S1N I;  1K83 I;  2WB1 A;  1VQ8 Z;  2Q51 A;  1ZB9 A;  4TNU A;  1QVF Z;  4FLO A;  2VUG A;  3CZE A;  3RAS A;  3I07 A;  3FH5 A;  5D1O A;  3KIH A;  1KQS Z;  3FUD A;  4ZQH A;  1R0L A;  3UEQ A;  1WCM I;  2PM9 A;  3GTM I;  5JO0 A;  2AKL A;  4XN8 A;  1I3Q I;  3MZK B;  1RO4 A;  3I56 Z;  2JR6 A;  3FU3 A;  4OOF A;  4AR9 A;  4A3C I;  1H3L A;  1ML8 A;  2M6N A;  3LUS A;  4A3B I;  2JCY A;  5IP7 I;  1RNI A;  4E30 A;  2HF1 A;  3HOW I;  3GTK I;  1M1K 1;  5JMW A;  2E2J I;  3PO2 I;  4ZN6 A;  5C4X I;  2OOX B;  2JV7 A;  4RVD A;  4XN9 A;  5IT9 b;  1ZB8 A;  4MD8 A;  5AEN A;  5HLT A;  4HGY A;  3JAM f;  4MXU A;  3J80 b;  2JA7 I;  3S1M I;  3CZG A;  3JT1 A;  3CCL Z;  5FWQ A;  4XMW A;  4ZQT A;  3CCV 1;  2Y1G A;  3Q44 A;  3QJX A;  4NBG A;  2NVT I;  3G71 Z;  4S1T A;  1MW2 A;  4ZQE A;  3CZL A;  1Y1V I;  2F4M A;  1VQO 1;  1W2B Z;  4ZW6 A;  3CCU Z;  4ZW7 A;  3G71 1;  2PMZ A;  1WW9 A;  3S17 I;  5FLX b;  4XNB A;  1PFT A;  4PW4 A;  3VMH A;  3FU0 A;  3FUH A;  4XN2 A;  3PUU A;  1K8A 1;  3HOU I;  2FFL A;  5IT9 f;  2JD2 A;  1R9T I;  2OTJ 1;  1DL6 A;  3J80 f;  4XN1 A;  2R93 I;  1WII A;  3ANN A;  2I3C A;  3KIF A;  4MD9 A;  3IIE A;  2OTL Z;  2YU9 I;  3G6E 1;  1X0T A;  3GKQ A;  3TE5 B;  2QR1 B;  1I50 I;  4A3F I;  3VVL A;  2OTL 1;  3I4N I;  1VQ4 Z;  3FUF A;  4Q4I A;  3S15 I;  2O7G A;  5C4J I;  2JA6 I;  5C44 I;  3RZO I;  1QYP A;  2V8J A;  4R7L A;  3IFU A;  3I55 Z;  1VQ4 1;  3HOX I;  2W04 A;  3CZK A;  4HH4 A;  1K73 1;  1GW6 A;  2DQM A;  1USP B;  4RCV A;  3CCJ Z;  2WZF A;  3U50 C;  3CCE 1;  1TFI A;  1VLA A;  1ZH1 A;  3CHQ A;  3RZD I;  3ANL A;  2JCV A;  3PO3 S;  3FTZ A;  2QLV B;  3FQM A;  3BG0 B;  4BY1 I;  2XPZ A;  1T1S A;  3AUA A;  1NJI 1;  4GAA A;  3A14 A;  2JA5 I;  1YIT Z;  1Q0L A;  2GTI A;  4ZX5 A;  1I6H I;  4RVB A;  4XN4 A;  4CXF A;  1VQ7 Z;  2Y1C A;  2OZK A;  2F4O A;  2QEX Z;  3CHP A;  3FHE A;  3B7T A;  3GTO I;  2E2H I;  3D6W A;  3WQS B;  1NJI 2;  3T4N B;  3ANM A;  3CXC Y;  4NBF A;  4Q4E A;  1VQL Z;  3S14 I;  1Z01 A;  1TWH I;  5FLM I;  4MON A;  4XN5 A;  2JD0 A;  4BXX I;  2IZ4 A;  2RJI A;  1MW0 A;  3FU5 A;  4XO3 A;  3K7A I;  4DPR A;  2JUB A;  1SG7 A;  3FKI I;  4NB8 A;  4ZW3 A;  2V8I A;  1VQ9 1;  4NBB A;  3JAM b;  3FTU A;  2BJO A;  5DUL A;  4NBE A;  3VB9 A;  3B3B A;  4ZW5 A;  3NDI A;  1VQK 1;  3CC2 Z;  4XMZ A;  3GTL I;  2VF1 A;  4NBH A;  2PL5 A;  3FUJ A;  1SFO I;  3CC2 1;  4A3E I;  1Z02 A;  3FTV A;  4L2L A;  3D9X A;  5A2Q b;  1M90 1;  2VJ8 A;  1S72 1;  2ZXG A;  2Y1F A;  1JJ2 Y;  4MKT A;  4AYB A;  3EBH A;  4A3I I;  2GTQ A;  2QRD B;  3CC4 Z;  4K5N A;  3CCR 1;  4XMV A;  2EGT A;  3RC3 A;  3AU9 A;  1QVG Y;  4FLR A;  2XQ0 A;  3B7R L;  1VQP 1;  3CC4 1;  3M3Y I;  2RT9 A;  4NBA A;  1M90 2;  3HOY I;  3A06 A;  1ONO A;  4NBD A;  4R5T A;  1T1R A;  5IP9 I;  2JS4 A;  5JAZ A;  3MON A;  3B34 A;  3CCV Z;  1VQN Z;  3CCQ Z;  2QVW A;  4A3M I;  1VQO Z;  3S1R I;  4LUP A;  1VQN 1;  4Y67 A;  3CCQ 1;  3H3V J;  4AYS A;  3MZL B;  2Q4Z A;  2QA4 1;  1RO0 A;  1MW3 A;  1S7M A;  5A2Q f;  2R59 A;  3P5J B;  5LL6 f;  2DE6 A;  5JBI A;  4JND A;  3GTQ I;  1SC5 A;  2VLA A;  2C82 A;  4XO4 A;  2OTJ Z;  4ARF A;  4Y6R A;  2NVY I;  2R92 I;  4XND A;  3CHR A;  3ESW A;  1Q81 1;  3EBI A;  3S1Q I;  2E9H A;  1L1O C;  2R6M A;  4A3L I;  3GTJ I;  3G6E Z;  4A3J I;  2GTH A;  2JMO A;  3GTM S;  1KC8 2;  2VUM I;  4E33 A;  2R7Z I;  1USP A;  4RVF A;  5C3E I;  4MRI A;  4Y7N I;  3CD6 1;  2DQ6 A;  4ZW8 A;  3G4S 1;  3ZHX A;  3OW2 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...