1X3WA

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
320
structure length
320
Chain Sequence
NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords peptide:N-glycanase
total genus 101
structure length 320
sequence length 320
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.90 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1x3wA03
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x3wA04
4BXXI 1ZB8A 2JA8I 3S2HI 4Y52I 2R7ZI 1K83I 1I3QI 3GCFA 1DL6A 1VLAA 4A3CI 1PFTA 3D6WA 2RBLA 1NUIA 3U50C 2BJOA 1X3WA 3GTMI 1TWCI 3I07A 4A3GI 2DE6A 2R93I 4A3LI 3GTQI 4NBGA 3PO3S 1N2FA 1TWGI 1L1OC 4QTUA 3FKII 2JA6I 4NBDA 4NB9A 3RZOI 4A3KI 1WW9A 3GTJI 2NVTI 1LQLA 4A3II 1R9TI 4A3BI 4A3DI 1RO4A 3VMIA 3S1QI 2JNYA 3HOVI 3GTPI 2AKLA 4BBSI 4NB8A 2R92I 4BBRI 3GKQA 3HOUI 2F4MA 1WCMI 3ESWA 5IP7I 2NVQI 3GTOI 5IP9I 2HF1A 1TWAI 3CQZI 3S14I 1Y1VS 4NOZA 2F4OA 2DE7A 4NBCA 4XX2A 3M3YI 3S15I 1YUAA 3HOXI 5C4XI 2E2JI 3VMGA 1X3ZA 4A3JI 3S16I 4A93I 1ZB9A 3S2DI 3S1NI 5C4JI 3GTMS 1RLYA 2KPIA 3HOZI 4A3FI 4NBFA 3VMHA 3PO2I 3HOYI 4NBBA 1SFOI 3GTLI 3S1RI 2NVXI 1TFIA 3LUSA 4NBHA 2JA5I 2P3YA 1ML8A 1USPB 1TWFI 4NBAA 2JA7I 2JR6A 1I6HI 3H3VJ 5CM2M 4A3MI 3EERA 3K7AI 3VB9A 5FLMI 1Y1WI 4BY1I 3I4NI 3S17I 3H0GI 2K5RA 3I4MI 2DE5A 2E2II 3PO3I 4BY7I 1Y1VI 5C3EI 3GTKI 3HOWI 1QYPA 2JS4A 4MH4A 3GTGI 4NBEA 3M4OI 2B63I 4X6AI 4QTTA 4Y7NI 2J6AA 1I50I 2VUMI 3Q87A 2NVYI 2YU9I 5C44I 3RZDI 1TWHI 4A3EI 3S1MI 2PK7A 1USPA 2E2HI
chains in the Genus database with same CATH superfamily
2AYDA 1ZB8A 4DK1A 3S2HI 4L2LA 4AYBA 2WPGA 3IX0A 3ANMA 1K83I 1VQNZ 3CCSZ 4Y6RA 1VLAA 1PFTA 2Y0SA 4XMTA 3FU3A 5AENA 2JV7A 1KQSZ 1T1SA 3CCQ1 3U50C 1K8A1 1Q7Y2 1KC82 4R7LA 3CHOA 1ONPA 3CCS1 3FH8A 1Q861 1P9NA 2ZAEB 1Q822 2DQ6A 1Q16A 2V8JA 2RPRA 2QRCB 3CHQA 5D1OB 3AU8A 1VQ8Z 4FLQA 4ZW8A 3TDHB 2A7OA 1TWGI 3I55Z 2C82A 1T1RA 3IIEA 1WW9A 2NVTI 3FQMA 2W04A 2WZFA 2VPXA 1VQMZ 2E7ZA 4R5TA 2QRDB 4RCVA 2AKLA 4MXUA 2IZ3A 2R92I 2JD0A 3UEQA 2PM9A 3ZHXA 3HOUI 3FTVA 1YHQZ 3JSZA 2F4MA 5IP7I 3CZKA 1R0KA 3CCJ1 2NVQI 2OTL1 5IP9I 4AICA 2OTJZ 1VQPZ 1JJ2Z 3IF8A 3FUKA 1YUAA 4GAAA 3CZEA 4MS6A 3VMGA 1JGIA 4ZX4A 1ZB9A 3CME1 1Z03A 3B7RL 3A14A 5C4JI 3GTMS 1RLYA 1SC5A 4ARFA 2Y1DA 4XN8A 4NH1C 4A3FI 1M902 4XN5A 3S1RI 2B61A 1JVSA 2FFLA 5T6BA 3CC71 3RC3A 1TFIA 4AR1A 4XMWA 3ZHZA 3B7TA 2JA5I 3KEDA 4DQYB 1TWFI 5A2Qf 3FUJA 3FUFA 3NH4A 4ZW5A 5JMWA 2JR6A 3CMA1 1I6HI 3H3VJ 3OW2Z 4NFRA 2XPYA 5CM2M 2RIQA 4A3MI 2RHBA 2QVWA 3K7AI 1Y1WI 4BY1I 2GU2A 2QEXZ 1VQKZ 3I4NI 2QA4Z 4AR9A 2C5ZA 3F3FC 2JIPA 2ZXGA 1MVYA 1M1K1 3WQQA 3PO3I 1K732 4BY7I 4ZX6A 3I551 1Y1VI 3UCQA 4E2ZA 2QEX1 1VQK1 4QPEA 2O7GA 3CHSA 1AA6A 3HOWI 5JO0A 2QJ1A 4NBEA 2HU9A 3NDJA 2B63I 4X6AI 5JMPA 4QTTA 2VF1A 2J6AA 5JBIA 4Y7NI 2HPTA 2IZ4A 2YU9I 4RVGA 5C44I 3S1MI 2JCYA 3UERA 4ZN6A 5HNHA 2LIYA 2VUGA 1YITZ 4XN4A 3G6E1 2QR1B 3P5JB 4E2XA 2JA8I 2VLAA 1G5AA 3CCVZ 2V3VA 4FLRA 4ZQFA 3CHPA 4HGYA 2EGTA 4XNAA 3JAMb 2EGHA 4XNBA 3BG0B 2R72A 3EEDA 2RBLA 1KC81 1X0TA 4K5OA 2VPWA 3I07A 3QJXA 4S1TA 3U9WA 5IT9b 3J80b 4A3LI 4NBGA 4Q4IA 3KIHA 1Q0QA 1YJ91 4NB9A 3CCR1 3ANLA 3F3PC 4XMXA 3FUNA 4A3BI 1RO4A 3VMIA 3FTUA 3FUMA 2JMOA 3D9XA 3HOVI 1VQ9Z 3FTWA 4JNDA 1RP3A 4BBSI 2GTIA 2JIMA 2H85A 5DLLA 1WCMI 4Y67A 2GTHA 4QMEA 3ESWA 1VQ4Z 3JAMf 3GTOI 2OOYB 1VQP1 4E31A 3J7A4 4R5VA 3CQZI 1Y1VS 4ZW3A 3EBHA 4NOZA 3RC8A 2F4OA 4HGZA 4XX2A 2HPOA 1WZNA 3Q43A 5DYFA 1X3ZA 1VQ5Z 4A93I 2R70A 3CCEZ 1YI21 1QVFZ 3CXCZ 3S2DI 3S1NI 4E2WA 3T4NB 3T8VA 1M1K2 3FH7A 1VQN1 3CC21 2JIOA 3G4S1 1S46A 3CCV1 2QREB 3IR7A 2OTJ1 4CXFA 1K5HA 4NBHA 4QHPA 4RVDA 1Q811 4K5NA 5EV7A 2QKDA 3FU0A 2VPYA 1ML8A 2IV2X 3AUAA 3FULA 4NBAA 2JCXA 1YJWZ 4XO4A 2JIQA 1Q0LA 3FQQA 2JA7I 1VQ81 2RT9A 3CZLA 5FLMI 2R6MA 4K5MA 3CPWY 1VQO1 4ZQEA 2E2II 2W03A 4DPRA 1W2BY 1ONOA 4AR8A 4QUOA 4DGLA 4OOEA 4Y6SA 1KRLA 1NJI1 1K8A2 3ZI0A 3CC2Z 3HKZA 4MH4A 5JNLA 4PVBA 3CCJZ 1MW2A 3WQRA 2Y1FA 4R5XA 2NAPA 1YJN1 2P28A 3MONA 4RSYA 3RZDI 1HS6A 1TWHI 4A3EI 3CD6Z 4E30A 3B3BA 2LFUA 5IT9f 4Y52I 1YIJZ 2K3RA 4CL1A 3FTSA 1DL6A 1OR7A 2JCVA 3B34A 4BKXA 1SIWA 1Q862 3RASA 1W2BZ 1RO2A 3GTMI 1TWCI 2YADA 5FLXf 2R93I 1QF8A 2RJIA 3AU9A 3MZLB 4ZQTA 3PO3S 2GTQA 1YJ9Z 1SQMA 4MRIA 1L1OC 4QTUA 3J81f 2JA6I 3RZOI 4Q4EA 4K5LA 3GTJI 4A3II 1R9TI 3CZGA 2Q51A 1YUKA 2JNYA 3G71Z 2R59A 3MZKB 3GTPI 3I56Z 3FTYA 3B7SA 4QIRA 4NB8A 4ZW6A 4BBRI 5T67A 4X2UA 1QVGZ 4HH4A 5JC1A 4RVBA 3PUUA 2MAPA 4J3BA 3CHRA 3FUDA 2O4HA 1QVFY 3S14I 3FHEA 1K9M2 5LL6f 3J81b 3B2PA 4NBCA 5D1OA 1VQ71 1K731 3CIAA 2MAOA 5FLXb 4A3JI 4FLOA 3S16I 1VQ91 4XO5A 2I3CA 2XQ0A 3KIFA 3NH5A 4XN2A 2KPIA 4NBFA 1VQ41 2PL5A 1RNIA 3GTLI 3FH5A 2NVXI 4TNUA 1YIJ1 3LUSA 2Y1CA 3QWUA 2QA41 2P3YA 1YJW1 2OZKA 1Z02A 1S721 1M901 1WIIA 1Y8CA 1VQ61 2V8IA 1VQ7Z 2G2KA 3NFZA 4FCAA 2M48A 1VQM1 3CCU1 3I4MI 1KD11 2DE5A 3TE5B 3VTNA 2V8KA 4AYSA 1YHQ1 2VPZA 3G6EZ 1Q7Y1 3FUEA 3GTKI 1QYPA 1MW1A 4XMZA 1YJNZ 5JAZA 1I50I 4E32A 3Q87A 2NVYI 2Y1GA 4GAEA 3CCQZ 1Q0HA 1QVGY 1USPA 3NDIA 2PUSA 3EBIA 4BXXI 3B2XA 1N8R1 3FUHA 2E9HA 3T0YA 1MW0A 3JT1A 3B37A 4XMUA 4EWCA 2R7ZI 4ZW7A 4ZX3A 3CC7Z 5HLTA 3ANNA 1I3QI 3GCFA 3CCUZ 4KP7A 4A3CI 3D6WA 1FDOA 2M6NA 3CXBA 2JD2A 1NUIA 3BG1B 4LUPA 4MONA 1NJI2 2BJOA 1X3WA 2LEXA 1MW3A 4A3GI 4Y6PA 2DE6A 5FWQA 3CCL1 3FUIA 3GTQI 1RO0A 4PW4A 4RS4A 2OTLZ 3B7UX 1N2FA 1KQSY 3OW2Y 3EBGA 1ZS2A 1ZH1A 3FKII 4NBDA 2VJ8A 3Q44A 4A3KI 1Q812 1LQLA 4XN1A 4MKTA 2Q4ZA 4A3DI 3ZHYA 3G711 3S1QI 1VQL1 3NH8A 3I561 1JWHC 5DULA 2WB1A 3IFUA 4A03A 2KI7B 1VQ6Z 3CC4Z 1NP6A 3CCRZ 3GKQA 1N8R2 4NQWA 3WQSB 5A2Qb 1VQ51 2WAQA 4XNDA 4MD9A 2XPZA 3R0IA 1H3LA 2HF1A 1TWAI 2WZGA 4FLSA 2DE7A 3M3YI 1YIT1 3S15I 4MD7A 3HOXI 3CCLZ 2PGGA 2O53A 5C4XI 2E2JI 1RQFA 4XN9A 2JD1A 5AN9F 1JJ2Y 4ZQHA 1JG9A 3VVLA 3CPWZ 3FU5A 3HOZI 1K9M1 3VMHA 4E33A 3HOYI 3PO2I 4RVFA 4NBBA 1SFOI 3FU6A 1QXFA 2JUBA 3CCM1 1Q821 3A06A 2DQMA 1VQOZ 1S72Z 1USPB 3D2LA 4XMVA 1S7MA 5D1PA 2PMZA 3G4SZ 1GW6A 4E2YA 2JIRA 4RV9A 3CMAZ 4ZX5A 3FTZA 1ONNA 1FDIA 3EERA 3VB9A 4OOFA 3S17I 5HNFA 1KD12 3H0GI 2K5RA 4XN7A 3FTXA 3VVMA 3CXCY 2QLVB 5T64A 2E2HI 5C3EI 4K5PA 3CD61 1R0LA 4MD8A 5BPPA 3HW2A 2JS4A 3GTGI 3M4OI 1Z01A 2V45A 2Y1EA 4XO3A 2OOXB 3CMEZ 1VQLZ 2VUMI 1WJ2A 3CCE1 1YI2Z 4ZQGA 3CCMZ 1H19A 3CC41 2PK7A 3J80f 4RVHA 4PU2A 1SG7A
chains in the Genus database with same CATH topology
1ZB8A 4DK1A 3S2HI 4L2LA 4AYBA 2WPGA 3IX0A 3ANMA 1K83I 1VQNZ 3CCSZ 4Y6RA 1VLAA 1PFTA 2Y0SA 4XMTA 3FU3A 5AENA 2JV7A 1KQSZ 1T1SA 3CCQ1 3U50C 1K8A1 1Q7Y2 1KC82 4R7LA 3CHOA 1ONPA 3CCS1 3FH8A 1Q861 1P9NA 2ZAEB 1Q822 2DQ6A 2V8JA 2RPRA 2QRCB 3CHQA 5D1OB 3AU8A 1VQ8Z 4FLQA 4ZW8A 3TDHB 2A7OA 1TWGI 3I55Z 2C82A 1T1RA 3IIEA 1WW9A 2NVTI 3FQMA 2W04A 2WZFA 1VQMZ 4R5TA 2QRDB 4RCVA 2AKLA 4MXUA 2IZ3A 2R92I 2JD0A 3UEQA 2PM9A 3ZHXA 3HOUI 3FTVA 1YHQZ 3JSZA 2F4MA 5IP7I 3CZKA 1R0KA 3CCJ1 2NVQI 2OTL1 5IP9I 4AICA 2OTJZ 1VQPZ 1JJ2Z 3IF8A 3FUKA 1YUAA 4GAAA 3CZEA 4MS6A 3VMGA 1JGIA 4ZX4A 1ZB9A 3CME1 1Z03A 3B7RL 3A14A 5C4JI 3GTMS 1RLYA 1SC5A 4ARFA 2Y1DA 4XN8A 4NH1C 4A3FI 1M902 4XN5A 3S1RI 2B61A 1JVSA 2FFLA 5T6BA 3CC71 3RC3A 1TFIA 4AR1A 4XMWA 3ZHZA 3B7TA 2JA5I 3KEDA 4DQYB 1TWFI 5A2Qf 3FUJA 3FUFA 3NH4A 4ZW5A 5JMWA 2JR6A 3CMA1 1I6HI 3H3VJ 3OW2Z 4NFRA 2XPYA 5CM2M 2RIQA 4A3MI 2RHBA 2QVWA 3K7AI 1Y1WI 4BY1I 2GU2A 2QEXZ 1VQKZ 3I4NI 2QA4Z 4AR9A 2C5ZA 3F3FC 2ZXGA 1MVYA 1M1K1 3WQQA 3PO3I 1K732 4BY7I 4ZX6A 3I551 1Y1VI 3UCQA 4E2ZA 2QEX1 1VQK1 4QPEA 2O7GA 3CHSA 3HOWI 5JO0A 2QJ1A 4NBEA 2HU9A 3NDJA 2B63I 4X6AI 5JMPA 4QTTA 2VF1A 5JBIA 2J6AA 4Y7NI 2HPTA 2IZ4A 2YU9I 4RVGA 5C44I 3S1MI 2JCYA 3UERA 4ZN6A 5HNHA 2LIYA 2VUGA 1YITZ 4XN4A 3G6E1 2QR1B 3P5JB 4E2XA 2JA8I 2VLAA 1G5AA 3CCVZ 4FLRA 4ZQFA 3CHPA 4HGYA 2EGTA 4XNAA 3JAMb 2EGHA 4XNBA 3BG0B 2R72A 3EEDA 2RBLA 1KC81 1X0TA 4K5OA 3I07A 3QJXA 4S1TA 3U9WA 5IT9b 3J80b 4A3LI 4NBGA 4Q4IA 3KIHA 1Q0QA 1YJ91 4NB9A 3CCR1 3ANLA 3F3PC 4XMXA 3FUNA 4A3BI 1RO4A 3VMIA 3FTUA 3FUMA 2JMOA 3D9XA 3HOVI 1VQ9Z 3FTWA 4JNDA 1RP3A 4BBSI 2GTIA 2H85A 5DLLA 1WCMI 4Y67A 2GTHA 4QMEA 3ESWA 1VQ4Z 3JAMf 3GTOI 2OOYB 1VQP1 4E31A 3J7A4 4R5VA 3CQZI 1Y1VS 4ZW3A 3EBHA 4NOZA 3RC8A 2F4OA 4HGZA 4XX2A 2HPOA 3Q43A 5DYFA 1X3ZA 1VQ5Z 4A93I 2R70A 3CCEZ 1YI21 1QVFZ 3CXCZ 3S2DI 3S1NI 4E2WA 3T4NB 3T8VA 1M1K2 3FH7A 1VQN1 3CC21 3G4S1 1S46A 3CCV1 2QREB 2OTJ1 4CXFA 1K5HA 4NBHA 4QHPA 4RVDA 1Q811 4K5NA 5EV7A 2QKDA 3FU0A 1ML8A 3AUAA 3FULA 4NBAA 2JCXA 1YJWZ 4XO4A 3FQQA 1Q0LA 2JA7I 1VQ81 2RT9A 3CZLA 5FLMI 2R6MA 4K5MA 3CPWY 1VQO1 4ZQEA 2E2II 2W03A 4DPRA 1W2BY 1ONOA 4AR8A 4QUOA 4DGLA 4OOEA 4Y6SA 1KRLA 1NJI1 1K8A2 3ZI0A 3CC2Z 3HKZA 4MH4A 5JNLA 4PVBA 3CCJZ 1MW2A 3WQRA 2Y1FA 4R5XA 1YJN1 2P28A 3MONA 4RSYA 3RZDI 1HS6A 1TWHI 4A3EI 3CD6Z 4E30A 3B3BA 2LFUA 5IT9f 4Y52I 1YIJZ 2K3RA 4CL1A 3FTSA 1DL6A 1OR7A 2JCVA 3B34A 4BKXA 1Q862 3RASA 1W2BZ 1RO2A 3GTMI 1TWCI 2YADA 5FLXf 2R93I 1QF8A 2RJIA 3AU9A 3MZLB 4ZQTA 3PO3S 2GTQA 1YJ9Z 1SQMA 4MRIA 1L1OC 4QTUA 3J81f 2JA6I 3RZOI 4Q4EA 4K5LA 3GTJI 4A3II 1R9TI 3CZGA 2Q51A 1YUKA 2JNYA 3G71Z 2R59A 3MZKB 3GTPI 3I56Z 3FTYA 3B7SA 4QIRA 4NB8A 4ZW6A 4BBRI 5T67A 4X2UA 1QVGZ 4HH4A 5JC1A 4RVBA 3PUUA 2MAPA 4J3BA 3CHRA 3FUDA 2O4HA 1QVFY 3S14I 3FHEA 1K9M2 5LL6f 3J81b 3B2PA 4NBCA 5D1OA 1VQ71 1K731 3CIAA 2MAOA 5FLXb 4A3JI 4FLOA 3S16I 1VQ91 4XO5A 2I3CA 2XQ0A 3KIFA 3NH5A 4XN2A 2KPIA 4NBFA 1VQ41 2PL5A 1RNIA 3GTLI 3FH5A 2NVXI 4TNUA 1YIJ1 3LUSA 2Y1CA 3QWUA 2QA41 2P3YA 1YJW1 2OZKA 1Z02A 1S721 1M901 1WIIA 1VQ61 2V8IA 1VQ7Z 2G2KA 3NFZA 4FCAA 2M48A 1VQM1 3CCU1 3I4MI 1KD11 2DE5A 3TE5B 3VTNA 2V8KA 4AYSA 1YHQ1 3G6EZ 1Q7Y1 3FUEA 3GTKI 1QYPA 1MW1A 4XMZA 1YJNZ 5JAZA 1I50I 4E32A 3Q87A 2NVYI 2Y1GA 4GAEA 3CCQZ 1Q0HA 1QVGY 1USPA 3NDIA 2PUSA 3EBIA 4BXXI 3B2XA 1N8R1 3FUHA 2E9HA 3T0YA 1MW0A 3JT1A 3B37A 4XMUA 4EWCA 2R7ZI 4ZW7A 4ZX3A 3CC7Z 5HLTA 3ANNA 1I3QI 3GCFA 3CCUZ 4KP7A 4A3CI 3D6WA 2M6NA 2JD2A 1NUIA 3BG1B 4LUPA 4MONA 1NJI2 2BJOA 1X3WA 1MW3A 4A3GI 4Y6PA 2DE6A 5FWQA 3CCL1 3FUIA 3GTQI 1RO0A 4PW4A 4RS4A 2OTLZ 3B7UX 1N2FA 1KQSY 3OW2Y 3EBGA 1ZS2A 1ZH1A 3FKII 4NBDA 2VJ8A 3Q44A 4A3KI 1Q812 1LQLA 4XN1A 4MKTA 2Q4ZA 4A3DI 3ZHYA 3G711 3S1QI 1VQL1 3NH8A 3I561 1JWHC 5DULA 2WB1A 3IFUA 4A03A 2KI7B 1VQ6Z 3CC4Z 1NP6A 3CCRZ 3GKQA 1N8R2 4NQWA 3WQSB 5A2Qb 1VQ51 2WAQA 4XNDA 4MD9A 2XPZA 3R0IA 1H3LA 2HF1A 1TWAI 2WZGA 4FLSA 2DE7A 3M3YI 1YIT1 3S15I 4MD7A 3HOXI 3CCLZ 2PGGA 2O53A 5C4XI 2E2JI 1RQFA 4XN9A 2JD1A 5AN9F 1JJ2Y 4ZQHA 1JG9A 3VVLA 3CPWZ 3FU5A 3HOZI 1K9M1 3VMHA 4E33A 3HOYI 3PO2I 4RVFA 4NBBA 1SFOI 3FU6A 2JUBA 3CCM1 1Q821 3A06A 2DQMA 1VQOZ 1S72Z 1USPB 5D1PA 4XMVA 1S7MA 2PMZA 3G4SZ 1GW6A 4E2YA 4RV9A 3CMAZ 4ZX5A 3FTZA 1ONNA 3EERA 3VB9A 4OOFA 3S17I 5HNFA 1KD12 3H0GI 2K5RA 4XN7A 3FTXA 3VVMA 3CXCY 2QLVB 5T64A 2E2HI 5C3EI 4K5PA 3CD61 1R0LA 4MD8A 5BPPA 2JS4A 3GTGI 3M4OI 1Z01A 2Y1EA 4XO3A 2OOXB 3CMEZ 1VQLZ 2VUMI 3CCE1 1YI2Z 4ZQGA 3CCMZ 1H19A 3CC41 2PK7A 3J80f 4RVHA 4PU2A 1SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX I;  1ZB8 A;  2JA8 I;  3S2H I;  4Y52 I;  2R7Z I;  1K83 I;  1I3Q I;  3GCF A;  1DL6 A;  1VLA A;  4A3C I;  1PFT A;  3D6W A;  2RBL A;  1NUI A;  3U50 C;  2BJO A;  1X3W A;  3GTM I;  1TWC I;  3I07 A;  4A3G I;  2DE6 A;  2R93 I;  4A3L I;  3GTQ I;  4NBG A;  3PO3 S;  1N2F A;  1TWG I;  1L1O C;  4QTU A;  3FKI I;  2JA6 I;  4NBD A;  4NB9 A;  3RZO I;  4A3K I;  1WW9 A;  3GTJ I;  2NVT I;  1LQL A;  4A3I I;  1R9T I;  4A3B I;  4A3D I;  1RO4 A;  3VMI A;  3S1Q I;  2JNY A;  3HOV I;  3GTP I;  2AKL A;  4BBS I;  4NB8 A;  2R92 I;  4BBR I;  3GKQ A;  3HOU I;  2F4M A;  1WCM I;  3ESW A;  5IP7 I;  2NVQ I;  3GTO I;  5IP9 I;  2HF1 A;  1TWA I;  3CQZ I;  3S14 I;  1Y1V S;  4NOZ A;  2F4O A;  2DE7 A;  4NBC A;  4XX2 A;  3M3Y I;  3S15 I;  1YUA A;  3HOX I;  5C4X I;  2E2J I;  3VMG A;  1X3Z A;  4A3J I;  3S16 I;  4A93 I;  1ZB9 A;  3S2D I;  3S1N I;  5C4J I;  3GTM S;  1RLY A;  2KPI A;  3HOZ I;  4A3F I;  4NBF A;  3VMH A;  3PO2 I;  3HOY I;  4NBB A;  1SFO I;  3GTL I;  3S1R I;  2NVX I;  1TFI A;  3LUS A;  4NBH A;  2JA5 I;  2P3Y A;  1ML8 A;  1USP B;  1TWF I;  4NBA A;  2JA7 I;  2JR6 A;  1I6H I;  3H3V J;  5CM2 M;  4A3M I;  3EER A;  3K7A I;  3VB9 A;  5FLM I;  1Y1W I;  4BY1 I;  3I4N I;  3S17 I;  3H0G I;  2K5R A;  3I4M I;  2DE5 A;  2E2I I;  3PO3 I;  4BY7 I;  1Y1V I;  5C3E I;  3GTK I;  3HOW I;  1QYP A;  2JS4 A;  4MH4 A;  3GTG I;  4NBE A;  3M4O I;  2B63 I;  4X6A I;  4QTT A;  4Y7N I;  2J6A A;  1I50 I;  2VUM I;  3Q87 A;  2NVY I;  2YU9 I;  5C44 I;  3RZD I;  1TWH I;  4A3E I;  3S1M I;  2PK7 A;  1USP A;  2E2H I; 
#chains in the Genus database with same CATH topology
 2AYD A;  1ZB8 A;  4DK1 A;  3S2H I;  4L2L A;  4AYB A;  2WPG A;  3IX0 A;  3ANM A;  1K83 I;  1VQN Z;  3CCS Z;  4Y6R A;  1VLA A;  1PFT A;  2Y0S A;  4XMT A;  3FU3 A;  5AEN A;  2JV7 A;  1KQS Z;  1T1S A;  3CCQ 1;  3U50 C;  1K8A 1;  1Q7Y 2;  1KC8 2;  4R7L A;  3CHO A;  1ONP A;  3CCS 1;  3FH8 A;  1Q86 1;  1P9N A;  2ZAE B;  1Q82 2;  2DQ6 A;  1Q16 A;  2V8J A;  2RPR A;  2QRC B;  3CHQ A;  5D1O B;  3AU8 A;  1VQ8 Z;  4FLQ A;  4ZW8 A;  3TDH B;  2A7O A;  1TWG I;  3I55 Z;  2C82 A;  1T1R A;  3IIE A;  1WW9 A;  2NVT I;  3FQM A;  2W04 A;  2WZF A;  2VPX A;  1VQM Z;  2E7Z A;  4R5T A;  2QRD B;  4RCV A;  2AKL A;  4MXU A;  2IZ3 A;  2R92 I;  2JD0 A;  3UEQ A;  2PM9 A;  3ZHX A;  3HOU I;  3FTV A;  1YHQ Z;  3JSZ A;  2F4M A;  5IP7 I;  3CZK A;  1R0K A;  3CCJ 1;  2NVQ I;  2OTL 1;  5IP9 I;  4AIC A;  2OTJ Z;  1VQP Z;  1JJ2 Z;  3IF8 A;  3FUK A;  1YUA A;  4GAA A;  3CZE A;  4MS6 A;  3VMG A;  1JGI A;  4ZX4 A;  1ZB9 A;  3CME 1;  1Z03 A;  3B7R L;  3A14 A;  5C4J I;  3GTM S;  1RLY A;  1SC5 A;  4ARF A;  2Y1D A;  4XN8 A;  4NH1 C;  4A3F I;  1M90 2;  4XN5 A;  3S1R I;  2B61 A;  1JVS A;  2FFL A;  5T6B A;  3CC7 1;  3RC3 A;  1TFI A;  4AR1 A;  4XMW A;  3ZHZ A;  3B7T A;  2JA5 I;  3KED A;  4DQY B;  1TWF I;  5A2Q f;  3FUJ A;  3FUF A;  3NH4 A;  4ZW5 A;  5JMW A;  2JR6 A;  3CMA 1;  1I6H I;  3H3V J;  3OW2 Z;  4NFR A;  2XPY A;  5CM2 M;  2RIQ A;  4A3M I;  2RHB A;  2QVW A;  3K7A I;  1Y1W I;  4BY1 I;  2GU2 A;  2QEX Z;  1VQK Z;  3I4N I;  2QA4 Z;  4AR9 A;  2C5Z A;  3F3F C;  2JIP A;  2ZXG A;  1MVY A;  1M1K 1;  3WQQ A;  3PO3 I;  1K73 2;  4BY7 I;  4ZX6 A;  3I55 1;  1Y1V I;  3UCQ A;  4E2Z A;  2QEX 1;  1VQK 1;  4QPE A;  2O7G A;  3CHS A;  1AA6 A;  3HOW I;  5JO0 A;  2QJ1 A;  4NBE A;  2HU9 A;  3NDJ A;  2B63 I;  4X6A I;  5JMP A;  4QTT A;  2VF1 A;  2J6A A;  5JBI A;  4Y7N I;  2HPT A;  2IZ4 A;  2YU9 I;  4RVG A;  5C44 I;  3S1M I;  2JCY A;  3UER A;  4ZN6 A;  5HNH A;  2LIY A;  2VUG A;  1YIT Z;  4XN4 A;  3G6E 1;  2QR1 B;  3P5J B;  4E2X A;  2JA8 I;  2VLA A;  1G5A A;  3CCV Z;  2V3V A;  4FLR A;  4ZQF A;  3CHP A;  4HGY A;  2EGT A;  4XNA A;  3JAM b;  2EGH A;  4XNB A;  3BG0 B;  2R72 A;  3EED A;  2RBL A;  1KC8 1;  1X0T A;  4K5O A;  2VPW A;  3I07 A;  3QJX A;  4S1T A;  3U9W A;  5IT9 b;  3J80 b;  4A3L I;  4NBG A;  4Q4I A;  3KIH A;  1Q0Q A;  1YJ9 1;  4NB9 A;  3CCR 1;  3ANL A;  3F3P C;  4XMX A;  3FUN A;  4A3B I;  1RO4 A;  3VMI A;  3FTU A;  3FUM A;  2JMO A;  3D9X A;  3HOV I;  1VQ9 Z;  3FTW A;  4JND A;  1RP3 A;  4BBS I;  2GTI A;  2JIM A;  2H85 A;  5DLL A;  1WCM I;  4Y67 A;  2GTH A;  4QME A;  3ESW A;  1VQ4 Z;  3JAM f;  3GTO I;  2OOY B;  1VQP 1;  4E31 A;  3J7A 4;  4R5V A;  3CQZ I;  1Y1V S;  4ZW3 A;  3EBH A;  4NOZ A;  3RC8 A;  2F4O A;  4HGZ A;  4XX2 A;  2HPO A;  1WZN A;  3Q43 A;  5DYF A;  1X3Z A;  1VQ5 Z;  4A93 I;  2R70 A;  3CCE Z;  1YI2 1;  1QVF Z;  3CXC Z;  3S2D I;  3S1N I;  4E2W A;  3T4N B;  3T8V A;  1M1K 2;  3FH7 A;  1VQN 1;  3CC2 1;  2JIO A;  3G4S 1;  1S46 A;  3CCV 1;  2QRE B;  3IR7 A;  2OTJ 1;  4CXF A;  1K5H A;  4NBH A;  4QHP A;  4RVD A;  1Q81 1;  4K5N A;  5EV7 A;  2QKD A;  3FU0 A;  2VPY A;  1ML8 A;  2IV2 X;  3AUA A;  3FUL A;  4NBA A;  2JCX A;  1YJW Z;  4XO4 A;  2JIQ A;  1Q0L A;  3FQQ A;  2JA7 I;  1VQ8 1;  2RT9 A;  3CZL A;  5FLM I;  2R6M A;  4K5M A;  3CPW Y;  1VQO 1;  4ZQE A;  2E2I I;  2W03 A;  4DPR A;  1W2B Y;  1ONO A;  4AR8 A;  4QUO A;  4DGL A;  4OOE A;  4Y6S A;  1KRL A;  1NJI 1;  1K8A 2;  3ZI0 A;  3CC2 Z;  3HKZ A;  4MH4 A;  5JNL A;  4PVB A;  3CCJ Z;  1MW2 A;  3WQR A;  2Y1F A;  4R5X A;  2NAP A;  1YJN 1;  2P28 A;  3MON A;  4RSY A;  3RZD I;  1HS6 A;  1TWH I;  4A3E I;  3CD6 Z;  4E30 A;  3B3B A;  2LFU A;  5IT9 f;  4Y52 I;  1YIJ Z;  2K3R A;  4CL1 A;  3FTS A;  1DL6 A;  1OR7 A;  2JCV A;  3B34 A;  4BKX A;  1SIW A;  1Q86 2;  3RAS A;  1W2B Z;  1RO2 A;  3GTM I;  1TWC I;  2YAD A;  5FLX f;  2R93 I;  1QF8 A;  2RJI A;  3AU9 A;  3MZL B;  4ZQT A;  3PO3 S;  2GTQ A;  1YJ9 Z;  1SQM A;  4MRI A;  1L1O C;  4QTU A;  3J81 f;  2JA6 I;  3RZO I;  4Q4E A;  4K5L A;  3GTJ I;  4A3I I;  1R9T I;  3CZG A;  2Q51 A;  1YUK A;  2JNY A;  3G71 Z;  2R59 A;  3MZK B;  3GTP I;  3I56 Z;  3FTY A;  3B7S A;  4QIR A;  4NB8 A;  4ZW6 A;  4BBR I;  5T67 A;  4X2U A;  1QVG Z;  4HH4 A;  5JC1 A;  4RVB A;  3PUU A;  2MAP A;  4J3B A;  3CHR A;  3FUD A;  2O4H A;  1QVF Y;  3S14 I;  3FHE A;  1K9M 2;  5LL6 f;  3J81 b;  3B2P A;  4NBC A;  5D1O A;  1VQ7 1;  1K73 1;  3CIA A;  2MAO A;  5FLX b;  4A3J I;  4FLO A;  3S16 I;  1VQ9 1;  4XO5 A;  2I3C A;  2XQ0 A;  3KIF A;  3NH5 A;  4XN2 A;  2KPI A;  4NBF A;  1VQ4 1;  2PL5 A;  1RNI A;  3GTL I;  3FH5 A;  2NVX I;  4TNU A;  1YIJ 1;  3LUS A;  2Y1C A;  3QWU A;  2QA4 1;  2P3Y A;  1YJW 1;  2OZK A;  1Z02 A;  1S72 1;  1M90 1;  1WII A;  1Y8C A;  1VQ6 1;  2V8I A;  1VQ7 Z;  2G2K A;  3NFZ A;  4FCA A;  2M48 A;  1VQM 1;  3CCU 1;  3I4M I;  1KD1 1;  2DE5 A;  3TE5 B;  3VTN A;  2V8K A;  4AYS A;  1YHQ 1;  2VPZ A;  3G6E Z;  1Q7Y 1;  3FUE A;  3GTK I;  1QYP A;  1MW1 A;  4XMZ A;  1YJN Z;  5JAZ A;  1I50 I;  4E32 A;  3Q87 A;  2NVY I;  2Y1G A;  4GAE A;  3CCQ Z;  1Q0H A;  1QVG Y;  1USP A;  3NDI A;  2PUS A;  3EBI A;  4BXX I;  3B2X A;  1N8R 1;  3FUH A;  2E9H A;  3T0Y A;  1MW0 A;  3JT1 A;  3B37 A;  4XMU A;  4EWC A;  2R7Z I;  4ZW7 A;  4ZX3 A;  3CC7 Z;  5HLT A;  3ANN A;  1I3Q I;  3GCF A;  3CCU Z;  4KP7 A;  4A3C I;  3D6W A;  1FDO A;  2M6N A;  3CXB A;  2JD2 A;  1NUI A;  3BG1 B;  4LUP A;  4MON A;  1NJI 2;  2BJO A;  1X3W A;  2LEX A;  1MW3 A;  4A3G I;  4Y6P A;  2DE6 A;  5FWQ A;  3CCL 1;  3FUI A;  3GTQ I;  1RO0 A;  4PW4 A;  4RS4 A;  2OTL Z;  3B7U X;  1N2F A;  1KQS Y;  3OW2 Y;  3EBG A;  1ZS2 A;  1ZH1 A;  3FKI I;  4NBD A;  2VJ8 A;  3Q44 A;  4A3K I;  1Q81 2;  1LQL A;  4XN1 A;  4MKT A;  2Q4Z A;  4A3D I;  3ZHY A;  3G71 1;  3S1Q I;  1VQL 1;  3NH8 A;  3I56 1;  1JWH C;  5DUL A;  2WB1 A;  3IFU A;  4A03 A;  2KI7 B;  1VQ6 Z;  3CC4 Z;  1NP6 A;  3CCR Z;  3GKQ A;  1N8R 2;  4NQW A;  3WQS B;  5A2Q b;  1VQ5 1;  2WAQ A;  4XND A;  4MD9 A;  2XPZ A;  3R0I A;  1H3L A;  2HF1 A;  1TWA I;  2WZG A;  4FLS A;  2DE7 A;  3M3Y I;  1YIT 1;  3S15 I;  4MD7 A;  3HOX I;  3CCL Z;  2PGG A;  2O53 A;  5C4X I;  2E2J I;  1RQF A;  4XN9 A;  2JD1 A;  5AN9 F;  1JJ2 Y;  4ZQH A;  1JG9 A;  3VVL A;  3CPW Z;  3FU5 A;  3HOZ I;  1K9M 1;  3VMH A;  4E33 A;  3HOY I;  3PO2 I;  4RVF A;  4NBB A;  1SFO I;  3FU6 A;  1QXF A;  2JUB A;  3CCM 1;  1Q82 1;  3A06 A;  2DQM A;  1VQO Z;  1S72 Z;  1USP B;  3D2L A;  4XMV A;  1S7M A;  5D1P A;  2PMZ A;  3G4S Z;  1GW6 A;  4E2Y A;  2JIR A;  4RV9 A;  3CMA Z;  4ZX5 A;  3FTZ A;  1ONN A;  1FDI A;  3EER A;  3VB9 A;  4OOF A;  3S17 I;  5HNF A;  1KD1 2;  3H0G I;  2K5R A;  4XN7 A;  3FTX A;  3VVM A;  3CXC Y;  2QLV B;  5T64 A;  2E2H I;  5C3E I;  4K5P A;  3CD6 1;  1R0L A;  4MD8 A;  5BPP A;  3HW2 A;  2JS4 A;  3GTG I;  3M4O I;  1Z01 A;  2V45 A;  2Y1E A;  4XO3 A;  2OOX B;  3CME Z;  1VQL Z;  2VUM I;  1WJ2 A;  3CCE 1;  1YI2 Z;  4ZQG A;  3CCM Z;  1H19 A;  3CC4 1;  2PK7 A;  3J80 f;  4RVH A;  4PU2 A;  1SG7 A; 
#chains in the Genus database with same CATH homology
 1ZB8 A;  4DK1 A;  3S2H I;  4L2L A;  4AYB A;  2WPG A;  3IX0 A;  3ANM A;  1K83 I;  1VQN Z;  3CCS Z;  4Y6R A;  1VLA A;  1PFT A;  2Y0S A;  4XMT A;  3FU3 A;  5AEN A;  2JV7 A;  1KQS Z;  1T1S A;  3CCQ 1;  3U50 C;  1K8A 1;  1Q7Y 2;  1KC8 2;  4R7L A;  3CHO A;  1ONP A;  3CCS 1;  3FH8 A;  1Q86 1;  1P9N A;  2ZAE B;  1Q82 2;  2DQ6 A;  2V8J A;  2RPR A;  2QRC B;  3CHQ A;  5D1O B;  3AU8 A;  1VQ8 Z;  4FLQ A;  4ZW8 A;  3TDH B;  2A7O A;  1TWG I;  3I55 Z;  2C82 A;  1T1R A;  3IIE A;  1WW9 A;  2NVT I;  3FQM A;  2W04 A;  2WZF A;  1VQM Z;  4R5T A;  2QRD B;  4RCV A;  2AKL A;  4MXU A;  2IZ3 A;  2R92 I;  2JD0 A;  3UEQ A;  2PM9 A;  3ZHX A;  3HOU I;  3FTV A;  1YHQ Z;  3JSZ A;  2F4M A;  5IP7 I;  3CZK A;  1R0K A;  3CCJ 1;  2NVQ I;  2OTL 1;  5IP9 I;  4AIC A;  2OTJ Z;  1VQP Z;  1JJ2 Z;  3IF8 A;  3FUK A;  1YUA A;  4GAA A;  3CZE A;  4MS6 A;  3VMG A;  1JGI A;  4ZX4 A;  1ZB9 A;  3CME 1;  1Z03 A;  3B7R L;  3A14 A;  5C4J I;  3GTM S;  1RLY A;  1SC5 A;  4ARF A;  2Y1D A;  4XN8 A;  4NH1 C;  4A3F I;  1M90 2;  4XN5 A;  3S1R I;  2B61 A;  1JVS A;  2FFL A;  5T6B A;  3CC7 1;  3RC3 A;  1TFI A;  4AR1 A;  4XMW A;  3ZHZ A;  3B7T A;  2JA5 I;  3KED A;  4DQY B;  1TWF I;  5A2Q f;  3FUJ A;  3FUF A;  3NH4 A;  4ZW5 A;  5JMW A;  2JR6 A;  3CMA 1;  1I6H I;  3H3V J;  3OW2 Z;  4NFR A;  2XPY A;  5CM2 M;  2RIQ A;  4A3M I;  2RHB A;  2QVW A;  3K7A I;  1Y1W I;  4BY1 I;  2GU2 A;  2QEX Z;  1VQK Z;  3I4N I;  2QA4 Z;  4AR9 A;  2C5Z A;  3F3F C;  2ZXG A;  1MVY A;  1M1K 1;  3WQQ A;  3PO3 I;  1K73 2;  4BY7 I;  4ZX6 A;  3I55 1;  1Y1V I;  3UCQ A;  4E2Z A;  2QEX 1;  1VQK 1;  4QPE A;  2O7G A;  3CHS A;  3HOW I;  5JO0 A;  2QJ1 A;  4NBE A;  2HU9 A;  3NDJ A;  2B63 I;  4X6A I;  5JMP A;  4QTT A;  2VF1 A;  5JBI A;  2J6A A;  4Y7N I;  2HPT A;  2IZ4 A;  2YU9 I;  4RVG A;  5C44 I;  3S1M I;  2JCY A;  3UER A;  4ZN6 A;  5HNH A;  2LIY A;  2VUG A;  1YIT Z;  4XN4 A;  3G6E 1;  2QR1 B;  3P5J B;  4E2X A;  2JA8 I;  2VLA A;  1G5A A;  3CCV Z;  4FLR A;  4ZQF A;  3CHP A;  4HGY A;  2EGT A;  4XNA A;  3JAM b;  2EGH A;  4XNB A;  3BG0 B;  2R72 A;  3EED A;  2RBL A;  1KC8 1;  1X0T A;  4K5O A;  3I07 A;  3QJX A;  4S1T A;  3U9W A;  5IT9 b;  3J80 b;  4A3L I;  4NBG A;  4Q4I A;  3KIH A;  1Q0Q A;  1YJ9 1;  4NB9 A;  3CCR 1;  3ANL A;  3F3P C;  4XMX A;  3FUN A;  4A3B I;  1RO4 A;  3VMI A;  3FTU A;  3FUM A;  2JMO A;  3D9X A;  3HOV I;  1VQ9 Z;  3FTW A;  4JND A;  1RP3 A;  4BBS I;  2GTI A;  2H85 A;  5DLL A;  1WCM I;  4Y67 A;  2GTH A;  4QME A;  3ESW A;  1VQ4 Z;  3JAM f;  3GTO I;  2OOY B;  1VQP 1;  4E31 A;  3J7A 4;  4R5V A;  3CQZ I;  1Y1V S;  4ZW3 A;  3EBH A;  4NOZ A;  3RC8 A;  2F4O A;  4HGZ A;  4XX2 A;  2HPO A;  3Q43 A;  5DYF A;  1X3Z A;  1VQ5 Z;  4A93 I;  2R70 A;  3CCE Z;  1YI2 1;  1QVF Z;  3CXC Z;  3S2D I;  3S1N I;  4E2W A;  3T4N B;  3T8V A;  1M1K 2;  3FH7 A;  1VQN 1;  3CC2 1;  3G4S 1;  1S46 A;  3CCV 1;  2QRE B;  2OTJ 1;  4CXF A;  1K5H A;  4NBH A;  4QHP A;  4RVD A;  1Q81 1;  4K5N A;  5EV7 A;  2QKD A;  3FU0 A;  1ML8 A;  3AUA A;  3FUL A;  4NBA A;  2JCX A;  1YJW Z;  4XO4 A;  3FQQ A;  1Q0L A;  2JA7 I;  1VQ8 1;  2RT9 A;  3CZL A;  5FLM I;  2R6M A;  4K5M A;  3CPW Y;  1VQO 1;  4ZQE A;  2E2I I;  2W03 A;  4DPR A;  1W2B Y;  1ONO A;  4AR8 A;  4QUO A;  4DGL A;  4OOE A;  4Y6S A;  1KRL A;  1NJI 1;  1K8A 2;  3ZI0 A;  3CC2 Z;  3HKZ A;  4MH4 A;  5JNL A;  4PVB A;  3CCJ Z;  1MW2 A;  3WQR A;  2Y1F A;  4R5X A;  1YJN 1;  2P28 A;  3MON A;  4RSY A;  3RZD I;  1HS6 A;  1TWH I;  4A3E I;  3CD6 Z;  4E30 A;  3B3B A;  2LFU A;  5IT9 f;  4Y52 I;  1YIJ Z;  2K3R A;  4CL1 A;  3FTS A;  1DL6 A;  1OR7 A;  2JCV A;  3B34 A;  4BKX A;  1Q86 2;  3RAS A;  1W2B Z;  1RO2 A;  3GTM I;  1TWC I;  2YAD A;  5FLX f;  2R93 I;  1QF8 A;  2RJI A;  3AU9 A;  3MZL B;  4ZQT A;  3PO3 S;  2GTQ A;  1YJ9 Z;  1SQM A;  4MRI A;  1L1O C;  4QTU A;  3J81 f;  2JA6 I;  3RZO I;  4Q4E A;  4K5L A;  3GTJ I;  4A3I I;  1R9T I;  3CZG A;  2Q51 A;  1YUK A;  2JNY A;  3G71 Z;  2R59 A;  3MZK B;  3GTP I;  3I56 Z;  3FTY A;  3B7S A;  4QIR A;  4NB8 A;  4ZW6 A;  4BBR I;  5T67 A;  4X2U A;  1QVG Z;  4HH4 A;  5JC1 A;  4RVB A;  3PUU A;  2MAP A;  4J3B A;  3CHR A;  3FUD A;  2O4H A;  1QVF Y;  3S14 I;  3FHE A;  1K9M 2;  5LL6 f;  3J81 b;  3B2P A;  4NBC A;  5D1O A;  1VQ7 1;  1K73 1;  3CIA A;  2MAO A;  5FLX b;  4A3J I;  4FLO A;  3S16 I;  1VQ9 1;  4XO5 A;  2I3C A;  2XQ0 A;  3KIF A;  3NH5 A;  4XN2 A;  2KPI A;  4NBF A;  1VQ4 1;  2PL5 A;  1RNI A;  3GTL I;  3FH5 A;  2NVX I;  4TNU A;  1YIJ 1;  3LUS A;  2Y1C A;  3QWU A;  2QA4 1;  2P3Y A;  1YJW 1;  2OZK A;  1Z02 A;  1S72 1;  1M90 1;  1WII A;  1VQ6 1;  2V8I A;  1VQ7 Z;  2G2K A;  3NFZ A;  4FCA A;  2M48 A;  1VQM 1;  3CCU 1;  3I4M I;  1KD1 1;  2DE5 A;  3TE5 B;  3VTN A;  2V8K A;  4AYS A;  1YHQ 1;  3G6E Z;  1Q7Y 1;  3FUE A;  3GTK I;  1QYP A;  1MW1 A;  4XMZ A;  1YJN Z;  5JAZ A;  1I50 I;  4E32 A;  3Q87 A;  2NVY I;  2Y1G A;  4GAE A;  3CCQ Z;  1Q0H A;  1QVG Y;  1USP A;  3NDI A;  2PUS A;  3EBI A;  4BXX I;  3B2X A;  1N8R 1;  3FUH A;  2E9H A;  3T0Y A;  1MW0 A;  3JT1 A;  3B37 A;  4XMU A;  4EWC A;  2R7Z I;  4ZW7 A;  4ZX3 A;  3CC7 Z;  5HLT A;  3ANN A;  1I3Q I;  3GCF A;  3CCU Z;  4KP7 A;  4A3C I;  3D6W A;  2M6N A;  2JD2 A;  1NUI A;  3BG1 B;  4LUP A;  4MON A;  1NJI 2;  2BJO A;  1X3W A;  1MW3 A;  4A3G I;  4Y6P A;  2DE6 A;  5FWQ A;  3CCL 1;  3FUI A;  3GTQ I;  1RO0 A;  4PW4 A;  4RS4 A;  2OTL Z;  3B7U X;  1N2F A;  1KQS Y;  3OW2 Y;  3EBG A;  1ZS2 A;  1ZH1 A;  3FKI I;  4NBD A;  2VJ8 A;  3Q44 A;  4A3K I;  1Q81 2;  1LQL A;  4XN1 A;  4MKT A;  2Q4Z A;  4A3D I;  3ZHY A;  3G71 1;  3S1Q I;  1VQL 1;  3NH8 A;  3I56 1;  1JWH C;  5DUL A;  2WB1 A;  3IFU A;  4A03 A;  2KI7 B;  1VQ6 Z;  3CC4 Z;  1NP6 A;  3CCR Z;  3GKQ A;  1N8R 2;  4NQW A;  3WQS B;  5A2Q b;  1VQ5 1;  2WAQ A;  4XND A;  4MD9 A;  2XPZ A;  3R0I A;  1H3L A;  2HF1 A;  1TWA I;  2WZG A;  4FLS A;  2DE7 A;  3M3Y I;  1YIT 1;  3S15 I;  4MD7 A;  3HOX I;  3CCL Z;  2PGG A;  2O53 A;  5C4X I;  2E2J I;  1RQF A;  4XN9 A;  2JD1 A;  5AN9 F;  1JJ2 Y;  4ZQH A;  1JG9 A;  3VVL A;  3CPW Z;  3FU5 A;  3HOZ I;  1K9M 1;  3VMH A;  4E33 A;  3HOY I;  3PO2 I;  4RVF A;  4NBB A;  1SFO I;  3FU6 A;  2JUB A;  3CCM 1;  1Q82 1;  3A06 A;  2DQM A;  1VQO Z;  1S72 Z;  1USP B;  5D1P A;  4XMV A;  1S7M A;  2PMZ A;  3G4S Z;  1GW6 A;  4E2Y A;  4RV9 A;  3CMA Z;  4ZX5 A;  3FTZ A;  1ONN A;  3EER A;  3VB9 A;  4OOF A;  3S17 I;  5HNF A;  1KD1 2;  3H0G I;  2K5R A;  4XN7 A;  3FTX A;  3VVM A;  3CXC Y;  2QLV B;  5T64 A;  2E2H I;  5C3E I;  4K5P A;  3CD6 1;  1R0L A;  4MD8 A;  5BPP A;  2JS4 A;  3GTG I;  3M4O I;  1Z01 A;  2Y1E A;  4XO3 A;  2OOX B;  3CME Z;  1VQL Z;  2VUM I;  3CCE 1;  1YI2 Z;  4ZQG A;  3CCM Z;  1H19 A;  3CC4 1;  2PK7 A;  3J80 f;  4RVH A;  4PU2 A;  1SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...