2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
1XRVA 1R87A 3MKKA 4NQWA 4CN6A 4QCEA 3D3AA 3GM8A 1VFOA 4Z2KA 2G3NA 1FH7A 5BROA 4QAWA 3TOPA 3CPUA 3M6DA 3WF0A 3CGTA 2G3JA 4OOFA 3WDPP 5F7UA 1WDRA 2OWXA 2WC4A 3DHPA 3EBVA 1OCQA 4MDOA 3M46A 1BF2A 2HISA 3VNYA 3PZTA 3EJPA 2VX4A 1BGAA 4JFSA 1B3XA 2CETA 3DECA 3OLGA 4C7GA 1Y7VA 3BMWA 1GVIA 1JF6A 2EPMX 1T1RA 1TUXA 2W62A 1CZ1A 5I6SA 1VF8A 1HJVA 1QNSA 4FLQA 3RDKA 2Y8VA 4D6IA 2WMGA 1VEOA 4EK7A 3AYSA 1TQWA 1E73M 4JZ5A 1MFUA 1IT0A 3A24A 3AHTA 3BUPA 3VD9A 3BUQA 4OJYA 4FNSA 3BUDA 3NIYA 4J3SA 3L4WA 2DSKA 1H49A 5JIPA 1KBBA 4NRSA 2XJ7A 2J47A 1GCYA 5FKYA 5M03A 1K9EA 2Y2WA 4UQAA 1ZBKA 5D8WA 2X09A 3ARVA 4LYQA 3VIOA 2EADA 1XSKA 3TV8A 2BVYA 2B31A 5ABFB 1SR0A 1UR9A 4GO8A 1OB0A 1FP9A 2J7FA 3PN8A 2JFEX 1HKMA 3DYOA 1XGZA 3F4VA 1T0OA 3L4UA 4WF7A 4PUDA 4RE3A 4W5UA 4ZENA 3EJUA 4E8CA 4AIUA 3VDCA 5A2BA 4J3WA 3VILA 4E2OA 1JYXA 2ZX5A 1G01A 1GHSA 4PEEA 1GPFA 1CNVA 5ABGA 3KL3A 4D6GA 3RCNA 3AI0A 3UG5A 3S2CA 1W32A 3AZSA 1WP6A 2FGLA 4AZ7A 4ZN6A 4JL2A 3NCOA 3NSMA 1GUVA 1O7DC 4W7UA 4PUEA 3ZI0A 3AJ7A 3RIKA 2E8ZA 3ZMRA 2F8QA 1CGVA 3S5ZA 1LL7A 2PBOA 3RJYA 3L4VA 1XH2A 2FHCA 3AU9A 1NWSA 3WN6A 1W3KA 3EJTA 1G9HA 1VENA 3ALFA 2WMJA 1EO7A 2WW5A 4J28A 1W91A 1TMQA 1ONOA 3VGDA 5D9OA 2J78A 3DX2A 4MB5A 1XH0A 1QBAA 1XV8A 4LYPA 1V02A 3SUSA 1UQZA 3W24A 3DYMA 4DWSC 2OWCA 2VRJA 4BQ4A 4P7QA 3PTQA 4MPKA 1CIUA 3VD7A 4GI8A 5ABHA 4RL3A 2J4GA 1LWJA 1ISZA 3VOCA 3WFLA 3NDZA 4PMUA 3JUGA 3WQSB 4FK9A 3DX4A 2ZXQA 4JFTA 2QF8A 1T1SA 1UKQA 1RD6A 2XFYA 1TCMA 1LJYA 2EO7A 1E0VA 5KEZA 1FHDA 5DF0A 3LPPA 4AD5A 4MADA 1HP4A 2DSWA 1HT6A 1LF1A 3BH4A 1V3LA 2C82A 1QI4A 1CXLA 4J7RA 4UR9A 4DUVA 5BCAA 1JZ5A 1MQRA 3VX1A 1E71M 1P6WA 3LPFA 2ESCA 4PMQA 3TP4A 1GOWA 1V3HA 1BPLB 3AICA 1WO2A 1NP2A 2WANA 3WQ4A 3WMCA 4AMXA 5JMPA 1V02E 2CBUA 2VT0A 3CUGA 1E4MM 4PRWA 3RJXA 2XGIA 4WK9A 2Y24A 3N18A 3A6OA 1GJWA 1DHKA 1ESWA 1EHAA 3OGRA 2XN2A 5EB8A 3WUBA 3BSGA 5I79A 4DWSB 1Q4NX 3AXIA 1ISWA 1QHOA 4AMWA 3BUBA 4P7LA 4PMXA 1JZ4A 1E3ZA 2WVUA 2F18A 4B3LA 1JYVA 1JI2A 1WDPA 1DWHM 2WB5A 2IUZA 5C71A 3AIBA 1K9DA 4A3HA 2VOTA 2X2IA 1HKJA 4ZQGA 2CIPA 5BRPA 1HJUA 3UG4A 2FGZA 1EQPA 1H41A 1V3MA 1V3KA 2QMJA 3G6LA 4GIAA 2W67A 3AZRA 4GXPA 4AD3A 4AZ6A 3U7BA 4CXFA 3CZGA 4UCFA 4MNJA 4UFJA 2BY0A 3T2QA 2DH2A 1IZJA 1UD5A 1ODZA 3LPGA 5AYBA 5D9MA 4H04A 3VD4A 4HOXA 3T0DA 4OOZA 5A2AA 1OM0A 1HXKA 1NM9A 4HOWA 5CQ1A 1OT1A 1OIMA 3LMYA 3T2OA 1GOQA 5DMYA 4BCEA 2YA0A 2WHKA 3GH5A 1CXIA 2ZUSA 3IJ8A 3VIGA 1AQHA 3QR3A 4JKMA 5D9NA 1US2A 4W8LA 4OGZA 1GQKA 3EDEA 4M1RA 2A3BA 1JZ3A 1SFSA 3PZMA 3EDFA 1B31A 3ARPA 2ZUVA 2J74A 4AD0A 3BAYA 3ZT7A 3WY1A 1GNXA 3FXYA 4IPNB 1SYTA 2ZX6A 1OIFA 3LX9A 4X0NA 4W7VA 4WKAA 5EFDA 4MJ4A 1KCKA 3ARWA 1ISXA 4HU0A 2ZXDA 4M81A 5BXSA 5D4YA 3N12A 4CU8A 1XD0A 2OLHA 2UY4A 1WB0A 6TAAA 5CPSA 4UOZA 2CYGA 1UR4A 2VMFA 1JAKA 3QHOA 1CGTA 5M5DA 2YJQA 4AIEA 3DDGA 3PZQA 2OYMA 2CHOA 2ZOXA 1UYQA 3MV01 1Q6DA 1UD3A 2DT3A 4DWSD 1V08A 3SIMA 1HL8A 1ECEA 3IIEA 3L4XA 1V0LA 1RP9A 3OIHA 3U7VA 2YL9A 3K46A 1PPIA 3D50A 1BSIA 3N17A 2WHMA 1CENA 1AQ0A 2WC3A 3BAWA 4PTVA 3RO8A 3AXHA 4W85A 1E70M 3CMGA 1WZAA 4K68A 3VNZA 4AEEA 2WLZA 3PZGA 1H4PA 1WNOA 3OB8A 2FH8A 2WZHA 2XVNA 4J3XA 2WCSA 1CTNA 1B2YA 2WMIB 1DWAM 1UA7A 1W3JA 2CXGA 5DT5A 4N0RA 3ARZA 1MYRA 3QGVA 3VPLA 2XM2A 1BVNP 5GNYA 2IXUA 2J7GA 3W6MA 1W1TA 3AUAA 3TTQA 4W89A 1ZBWA 2CPUA 2BHYA 1FFQA 1VB9A 5CG0A 2D3LA 1GJUA 3A4WA 3BVTA 3A14A 3AIRA 3MU7A 3AIVA 5JBDA 1VBUA 2CHNA 1JZ2A 1V6WA 1UWRA 2IGTA 6CGTA 1W1PA 3VGHA 4EE9A 1TA3A 3AXXA 1B3YA 4M29A 5A8QA 3EMQA 4NSBA 3K4AA 1JGIA 1KWGA 2YL5A 2PI6A 3SUUA 3U57A 1UH3A 1JL8A 3VSTA 3RM9A 3MS8A 1MWOA 3PZOA 3SCNA 1B3VA 3F5JA 2YKKA 1EXPA 4MNLA 2JALA 4D6HA 4AWEA 4KP7A 2ZIDA 1QW9A 4LQ1A 4EAMA 1UD4A 4MAZA 2JD1A 2J7HA 2Z1KA 3BAIA 1ONPA 3WY4A 1MW2A 1QVBA 2V3FA 2EPKX 2VCAA 1B9ZA 3VO0A 4U31A 1CECA 3FY1A 5HBFA 2QV4A 1DTUA 1GQIA 1TQTA 1KQZA 3W4RA 2ALWA 1CGXA 3AZTA 2YBTA 3KL0A 3WUEA 1XCXA 4AZCB 3OGSA 4BF7A 2GFTA 5JBIA 2DSUA 2CERA 3WEOA 1OGGA 1E0XA 4UQEA 4OUEA 4UFMA 3CO4A 1KWKA 4NI3A 2PC8A 3RM4A 1HJXA 5A6MA 3ZJ7A 3W6LA 2ZX7A 2EGHA 2G3IA 4UQBA 3ARSA 3CH9A 3ZSSA 1UWSA 4P8XA 1FH8A 2CKSA 1E6ZA 4DO4A 3AYRA 1JZ6A 2UY3A 4UQCA 4MAVA 4A3YA 1WPCA 2G4FA 1PIGA 1I75A 1KGWA 2VCBA 2JF6A 1E56A 1GQJA 1Q6CA 4DO5A 3RM8A 3WBAA 2V3EA 1GOOA 4AEFA 3WL1A 7CGTA 3UETA 4AIOA 2BHUA 4Y6SA 2VR5A 3D51A 1PAMA 1ZJBA 4R27A 1JG9A 1C3FA 1E6NA 3ZSTA 4LPCA 1CGYA 5A69A 4P7OA 3W81A 2XTKA 5E9AA 4ATDA 2PB1A 1UWTA 2QLYA 1MVYA 3WH8A 4AZBA 4HZ8A 3AHYA 4BQ3A 3MMDA 1ZL1A 4ACYA 4CUCA 3DHUA 3CZLA 1KTCA 2J25A 3GH4A 1NH6A 1JZ7A 1GQLA 4PSRA 2MAOA 3WSUA 1RP3A 3SCTA 4J3UA 1X6LA 3IJ9A 4GPNA 3ZOAA 1DWGM 4MTVA 4YHGA 3BGAA 3GNPA 2GK1B 3WQ5A 3PTMA 1DWIM 1UUQA 1E9LA 4KRTA 1QHPA 3ZO9A 2G41A 2EAEA 4UZSA 1R46A 2W61A 4HPHA 2DEPA 4KWUA 3VSVA 3MUZ1 1NQ6A 3OBAA 1LWHA 1MQQA 1OGBA 1BAGA 1QWNA 2VRKA 2ZUWA 2JE8A 3WD2A 4FNPA 1E40A 3NDYA 3N13A 4UFKA 4FF5A 3UERA 3GXIA 5E6YA 1SC5A 1SMDA 1NWTA 1HXJA 2VC9A 3WKZA 4B3KA 3BAJA 1VRXA 1WDSA 1ZU8A 2XPKA 3IGUA 1HN1A 3WH7A 3TONA 1CYGA 1W2PA 3PZVA 1JYWA 2DSVA 1U2YA 2WPGA 4IM4A 1VJSA 2V3DA 3D52A 4Y7EA 2FYVA 2CEQA 5I23A 3BVUA 3T0AA 3WQRA 2BY2A 1YQ2A 5CZKA 1JDCA 3EJRA 4U2YA 4TTUA 2BVTA 3LXCA 1C90A 4AICA 4ZE5A 3T08A 1C92A 5ABFA 3AIWA 1ZBVA 1W9BM 1KR1A 3N04A 2WHLA 3AHZA 2Y1CA 2WXDM 1TQUA 2J7CA 2E40A 1WE5A 5A6KA 3I3BA 4F9DA 4HZ7A 3F5LA 3WDRA 3CUJA 4HOZA 4Z2IA 3ZR6A 3EDKA 3ZQ9A 4N42A 3WENA 2BNJA 2EPNA 4H2CA 3ZHYA 1OT2A 3VIHA 4CGTA 3FNDA 2OWWA 1UD8A 2NT0A 2YA1A 3VINA 4Q22A 2Y1FA 4C7FA 1JFXA 4W88A 4PMDA 5BXRA 4P8UA 2BVDA 1JFHA 4UQDA 4E8DA 2OSXA 4TOQA 1RH9A 3K8KA 3WD3A 5FD0A 5A94A 2AMGA 3AHVA 1ZS2A 1J0KA 3GH7A 2XSAA 1QPKA 3H54A 3EMCA 3ZR5A 3A21A 2VX6A 4YHEA 3CZJA 4QLKA 4PTXA 5CLWA 2CBJA 4OBRA 2WSKA 1QNRA 5AY7A 1UQYA 1FH9A 2V3GA 1JYNA 1VFUA 1E1EA 2GUYA 1I1WA 1ZJAA 4EANA 5JNLA 1NOFA 8A3HA 2VL4A 4QLLA 1WZLA 1J01A 5CJ5A 3GZAA 1MQPA 3DDFA 1UD6A 1UWUA 3PZIA 1FP8A 1UKPA 4RCVA 1HWWA 2XIBA 1PJ9A 2VO5A 5BXTA 8CGTA 3APGA 2W5FA 2EPLX 4H8VA 1E55A 2BY3A 4WIWA 3VGFA 4H41A 1KR0A 2D3NA 5IXEA 4FLOA 3QHMA 2CITA 1TVNA 2JD2A 1L0PA 2WZIA 1TVPA 1UA3A 3KLKA 2DGAA 3EDDA 1H5VA 5KZ6A 1OBAA 1TFVA 4JKKA 5BWFA 4GQQA 1CWYA 1LLOA 3MANA 1H2JA 4L4OA 3GXMA 4Z2GA 3D4ZA 2J7DA 1BLIA 4URIA 2W63A 5BRQA 1FHLA 3POHA 2MANA 4W86A 5D9PA 5LA2A 3TA9A 3BAXA 2ZX8A 2FDMA 1R0LA 1A47A 3GXTA 3AU8A 1AQMA 3CHEA 4TVCA 3KEHA 2PWFA 1B1YA 3VTRA 4CD7A 1E6QM 3RMEA 2JCVA 3HG2A 1J18A 5JO0A 3TTYA 3AROA 4DUXA 1MXGA 5I24A 1G0CA 1XH1A 2DSZA 1R7OA 1RPKA 2O92A 5A6SA 2W92A 3VIKA 1R8LA 2F1AA 4NF7A 2E4TA 1JZ8A 1KGUA 2F61A 1WZKA 3GBDA 4LXFA 2DQXA 4F9JA 1Q0QA 4U33A 2EACA 1UG6A 2WBKA 2ZUMA 3WDJA 2EABA 1UZ4A 3MUAA 5D8ZA 1AVAA 4ZFMA 2XHYA 2F7RA 2D0FA 3UCQA 3WFZA 1NWRA 4MB1A 3MUIA 1VFFA 2ZXAA 5E0CA 2XFFA 5IFTA 4PMZA 1XYZA 4M24A 2UY5A 1ISVA 1J0ZA 1NWUA 3VU2A 2VR4A 5DULA 4U5IA 1UASA 3DC0A 3LRLA 1XYFA 3CC1A 2VVNA 3W29A 4D72A 4GKLA 3VDBA 2F7QA 2WYSA 1C91A 4HA1A 2WM0A 4XX6A 7A3HA 4AZCA 4AD2A 1ONNA 1BG9A 4QDMA 1UH2A 5A8OA 1TQVA 3LXBA 1F4AA 3HG4A 1FOBA 2D1ZA 1J0JA 4CCEA 3HJEA 3OLEA 3MMUA 3B9AA 4TTGA 3SURA 2BFGA 3PZNA 4FNTA 6A3HA 3WH9A 1OSEA 1W1YA 4LUPA 1V6VA 2JF7A 3WF3A 1Q6FA 3BVXA 4J3TA 4CVUA 3ANLA 1E0WA 3J7HA 3SEPA 2Y4SA 1M04A 3OLIA 3LXAA 3B9DA 4JKLA 5BYWA 3A5VA 1EH9A 1JI1A 4HU8A 5E09A 3BAKA 1TA3B 2F2HA 2CESA 3EMZA 4W87A 3WD0A 1O6IA 3WF2A 3ARXA 3EJSA 1JD7A 3AOFA 2WCAA 2XG9A 3UR8A 3BVVA 1UR1A 3KL5A 2O9RA 4W8AA 4NX0A 1N82A 1QI2A 2VX7A 3N11A 2GDUA 1UWQA 2XM1A 3VDAA 5CLTA 1E15A 1CXKA 1G1YA 3N1AA 4ZXLA 4AYSA 4PCTA 3AHXA 5JMWA 2J75A 5A1AA 3SCSA 1CLXA 5IHRA 1IV8A 5A6JA 3ZJ6A 3GYCA 4CN1A 3K8LA 2VNCA 2E0PA 1GOKA 1E4NA 5CSYA 1D2KA 4L4PA 2Y8KA 1I1XA 3VD5A 1LL6A 4PYSA 2OSWA 2A3HA 2XN1A 3K4DA 3ANNA 4Z2LA 3NSNA 4GQRA 2WSPA 1V0MA 3WQ8A 2QHAA 3IAQA 2OYKA 4D6FA 4A03A 5JC1A 2QPUA 3ARUA 3CV5A 2CBIA 4UOQA 1PBGA 4JAWA 5A8NA 4WLCA 4DO6A 2YFNA 1E6RA 1CGUA 1PIFA 2X2HA 3TTOA 4Z2JA 3GTNA 1U33A 2E8YA 1VFMA 4NZJA 3LRKA 2EQDA 5GNZA 1JNEA 3OZPA 4Y67A 1DWFM 2RGMA 2IXVA 3QOMA 1M03A 4CD6A 1C7SA 1R34A 1UKOA 3WELA 3RASA 1NP0A 2JEQA 5EMYA 3AMKA 2GSJA 3CZKA 3WDHA 3KE0A 4CKQA 1EIBA 1NOUA 1Q6EA 3I3DA 2Y1GA 2G3MA 2EXOA 3VIMA 3VM7A 2EPOA 2X2JA 1OGSA 3WUGA 3SCWA 2CKRA 3F5KA 3M7SA 4H8UA 3HU7A 4HMCA 4DWSA 3MMWA 4YPJA 4LYRA 2X0HA 3GDBA 1C7TA 3IANA 2GJPA 3WIJA 2DT1A 2XGBA 3GBEA 1WAWA 4WKFA 1R47A 4AD1A 2EEXA 3T0YA 1MW3A 3DX0A 5A6AA 2E9LA 1PX4A 1HIZA 1HVXA 3CZSA 3ZJKA 4FNQA 3MUY1 4ML4A 5CPQA 2Y1EA 4UTFA 3L4TA 7TAAA 1S46A 4C7DA 1HL9A 4S3KA 4KGJA 4FLSA 1HJWA 2ZWZA 1JXKA 5LA0A 5A8MA 4ATLA 1V03A 1UD2A 1V0NA 1Z32X 1JVSA 2GDVA 2O9PA 3BXWA 3W25A 1EO5A 2VZSA 2PF0A 1CEOA 4MB3A 3DX3A 4H8HA 3VMNA 5JUVA 2J62A 1Q0HA 3WQVA 2VZUA 5C70A 1QNOA 1JAEA 4FNUA 2GJRA 3SCOA 3SUWA 2X05A 1UKTA 3L2MA 2V5DA 1O7AA 1WDQA 4IPLA 2JD0A 3ZIZA 2XWEA 3DX1A 3ZT6A 4HP5A 4UFLA 3WEMA 1R7AA 1XSJA 1EGZA 2WMKA 4JIEA 3BLPX 3CUHA 4CU7A 2GVYA 3VMOA 1B3WA 2DDXA 3FHQA 1KXTA 2W4XA 3UESA 3THCA 2MAPA 1KGXA 1TG7A 3VKKA 2GJXA 3WQ6A 4M56A 1CLVA 1E5JA 5DFAA 4JHZA 3THDA 3AS1A 4GZIA 3BVWA 5HPOA 5I5RA 3W26A 3W27A 3FHAA 4W84A 2Y5EA 1PX8A 4P7NA 5CXPA 1W9VA 1EA9C 1D3CA 2D20A 4HMEA 4D6EA 5A6BD 1DWJM 4OZOA 2TAAA 9CGTA 2XSBA 4KMQA 2V38A 2YFOA 2QPSA 4JFWA 4BS0A 3VDHA 1J0HA 4GI6A 3ARQA 4MJ2A 3GNOA 3UR7A 1OWQA 3DYPA 1R33A 2VQTA 4KRUA 3GXFA 4E4PA 3RPMA 1BFNA 1VJZA 1XSIA 2YBUA 3VIPA 2WMHA 3KZSA 4HTYA 2J77A 4PCSA 2VTFA 5FOOA 3MSDA 4NXSA 2DIJA 5CGMA 4ATWA 4ZQHA 3D4YA 5IDIA 3AMCA 2YLLA 2YIHA 1TZ7A 1B0IA 1GVYA 5FCZA 2OW7A 3SCQA 1L8NA 4R5EA 1M7XA 5A8PA 3AIEA 4J27A 4JFUA 1H3GA 2C7FA 1LG1A 1J9YA 5HOSA 4KH2A 3ZT5A 4DM1A 2YLAA 4F8XA 2XN0A 4FMVA 2PBGA 1W3LA 4Q7NA 1MW0A 2NSXA 2C0HA 1BG4A 1E43A 1CBGA 5IFPA 3WEZA 2Q8XA 3MV11 2GJXB 2XYLA 3ARYA 2JEPA 1H0IA 3WDQA 3BLBA 1HJSA 4RE2A 2OYLA 1SMAA 1HKIA 3T09A 5JAZA 1E4LA 3OZOA 3RILA 1K9TA 4CD4A 3BCDA 3SCUA 1EOMA 3OLDA 3IAPA 1W9UA 1NARA 1UWIA 5I77A 2ZICA 2VJXA 3AIUA 3CMJA 4PMYA 4OOEA 3L2LA 4TX8A 1MXDA 5EFFA 4UOJA 1VAHA 3GXPA 1DEDA 4CVWA 2E3ZA 4LGXA 1HX0A 3IJ7A 4B9ZA 1GOMA 1EDQA 4F79A 1H3LA 4PBGA 1MW1A 1D7FA 5E70A 3G6MA 1UH4A 1KXQA 4MDPA 3D5HA 2WAGA 1LL4A 1CXEA 2YDRA 4XZBA 1OINA 4M80A 4S3JA 2NT1A 3IK2A 4BA0A 1E1FA 1W1VA 4FLRA 2BY1A 2ZUNA 3WNOA 3A22A 4OBSA 3WF1A 5HXMA 4MNMA 4CN4A 3ARTA 1R75A 5FL0A 4HA3A 5A6BA 5C8BB 1BYCA 2FHFA 2G8ZA 1LQ0A 3WY3A 2WVVA 3HN3A 2O9TA 2FE0A 3ANMA 4U3CA 3B8SA 2D0GA 3WD1A 2YDSA 1V6UA 5I2UA 2ZE0A 3W82A 3GXNA 1GONA 5GPRA 4V2XA 1VIWA 2WHJA 1KFWA 1KCLA 2FHBA 5AC5A 1J10A 3OGVA 4XZWA 1CXHA 2WK2A 3PBGA 1ITXA 3VIFA 1OR7A 3L4YA 2X2YA 1HKKA 2D0HA 1KXVA 1K9FA 3A06A 1FFRA 4M8UA 4MNKA 4ACZB 1UZ1A 2D22A 2NW0A 3TTSA 5M17A 3WUFA 2UWFA 3H55A 2VI0A 3EJQA 1GORA 2UY2A 3VGBA 2J7EA 4B15A 2BXZA 2DT0A 1QW8A 4AYGA 4ZEPA 3K1DA 4PMRA 3KLLA 2W91A 1AMYA 1TE1A 3N9KA 5TD4A 1K6AA 1QI3A 4DM2A 4EKJA 4W8BA 4OKDA 2Z1SA 3T2PA 1WKYA 4AXNA 1J11A 4ZQEA 4PN2A 1QNPA 2VZTA 4W7WA 5HNNA 2D23A 3VMPA 1IZKA 3CIVA 2WVSA 3L4ZA 1H1NA 4XUYA 3WBEA 3I3EA 3ZHXA 5BXPA 1QWUA 3AMDA 2VZOA 4IUGA 4PSPA 3OG2A 3CBWA 3BMVA 1HF6A 5I3DA 4TX6A 3MSGA 1C8YA 4CCCA 2J8GA 1C8QA 1EDTA 1JXJA 3CZNA 4AW7A 1EQCA 2F7OA 3S6TA 5I78A 1CPUA 5DT7A 4W5ZA 1XD1A 1E6SM 4ZE4A 3ECQA 4HPGA 3VUPA 3HZ3A 2VUYA 3SCPA 5E6ZA 4V27A 3K8MA 1V6YA 2ZUUA 2YDQA 5HDRA 3FAWA 3VX0A 2CNCA 5A6LA 2X1IA 4D1IA 5GNXA 4BZYA 3U5UA 1Q6GA 1QI5A 4HZ6A 5CPTA 1V0KA 4WJXA 1W3HA 1BVZA 3WNPA 3AMGA 1K5HA 2BV9A 4AZGA 2HVMA 3KWXA 1BQCA 1US3A 2GK1A 1R85A 4PTWA 5EBAA 3M07A 3S5YA 2BS9A 4DUWA 1U30A 4LX4A 1SZNA 4GAEA 4GI9A 2E9BA 5ECUA 2J7BA 3POCA 3E1F1 2RGLA 1QNQA 4TXEA 1KQYA 1MFVA 2WNWA 4MB4A 3VM5A 1EOKA 2PWHA 4D1JA 1KXHA 2WC7A 2CCRA 4QCFA 4B16A 1E6PA 2XIIA 4CCDA 2YA2A 3WH6A 4OOUA 3WNNA 1ISYA 4UFHA 4JHOA 4UQ9A 3VIIA 1BYBA 4U2ZA 3BC9A 4AD4A 3W28A 4BQ2A 3BCFA 1PS3A 2YL6A 2J8FA 4GINA 3AS0A 3O9NA 1PZ3A 3CHCA 5JIWA 3VIJA 1VEMA 5GQBA 4WSKA 4AMCA 1HVQA 4HMDA 2C8NA 3U5YA 3ZHZA 3H53A 3WH5A 3AMLA 2VURA 2CBVA 1M53A 4JL1A 2JCXA 1TQSA 1C93A 5ABEA 2PWDA 3LPOA 5A95A 1HTYA 5CSUA 3AS2A 4UZUA 4M82A 5DEZA 1W9PA 4CD5A 1HNYA 1GZJA 3NUKA 1ZB5A 3ZM8A 3PTKA 5HPCA 2XUCA 2WMFA 2ZUTA 2WMIA 1H0GA 1ITCA 1B30A 2F1BA 2DH3A 4YN5A 4A4AA 1V3IA 2VQUA 2O9OA 3WQQA 4GO9A 3WD4A 3O6AA 4PMNA 1F4HA 3ALGA 4Y6RA 2BXYA 2VRQA 1QHZA 5AC4A 1R86A 3QHNA 4GZEA 3CZEA 2DPEA 1W9XA 2JCYA 3GNRA 5E1QA 4WKHA 3HMCA 3CHFA 2XWDA 4JFVA 2A3AA 3VD3A 4ZQFA 2YL8A 3WMBA 2WKLA 4RE4A 3II1A 1H11A 2WWCA 2VCCA 5LA1A 4W93A 5I0DA 3NSXA 2ZXBA 1G5AA 1XCWA 4ACZA 3EDJA 1WCGA 1UR0A 4AC1X 2FH6A 1X6NA 3PZ9A 5IHSA 4X0VA 2XVKA 4NRRA 3WL0A 1BYAA 2E9MA 3WY2A 2OW6A 3WNLA 3HG5A 3T0BA 1CGWA 1ODUA 2XVGA 1UR8A 3WF4A 2VX5A 3WNKA 3VSUA 3NJ3A 2WKGA 1HP5A 2WLYA 4PMVA 3QOKA 1Q0LA 3R0IA 4QLJA 2WWDA 2WVTA 5M3WA 3MI6A 1EDGA 1BHGA 3UG3A 2A3CA 1HJQA 2BHZA 4Z2HA 1E72M 4JCLA 1PEZA 4D6CA 2J79A 1EHNA 3CUFA 4D6JA 2ZWYA 5A3HA 3A47A 1JF5A 1C8XA 3W37A 4Y6PA 3VVGA 1UR2A 3MO4A 1R0KA 3WDIA 1KBKA 5FL1A 1UKSA 3PHAA 3AIQA 4U3AA 4TVUA 1QX1A 5CGTA 3AQUA 2VVSA 1J0IA 3WMSA 4UNIA 2EBNA 1E5NA 3A4XA 1E3XA 2AOSA 4OIFA 1NOWA 3LRMA 4TUFA 3PZUA 5LYRA 4NXKA 1PZ2A 1X1NA 3WNMA 1JNDA 3AISA 1DP0A 3CUIA 3SCRA 3ARRA 3WQWA 5AYIA 3CZ8A 3VGGA 4QP0A 5DO8A 1M01A 2X8RA 3SUVA 1YHTA 3B9EA 4CU6A 1ZBCA 4CD8A 2JIWA 4D6DA 2Y1DA 3FW6A 4XB3A 4AZHA 4H7VA 2F7PA 4V28A 4F66A 1JD9A 2D24A 5FIPA 4AISA 4TVDA 5JBFA 4PMOA 5A2CA 1OD8A 3BLKA 1CDGA 2YOCA 1B90A 1VBRA 4P7RA 4FNRA 1VEPA 2DIEA 3FAXA 1BTCA 3GXDA 1UHVA 4AZ5A 4UFIA 2A3EA 4ZXOA 2D73A 4AZIA 1XC6A 1JDAA 3N15A 1CXFA 1KB3A 2WBGA 4P8WA 1JDDA 4XV0A 3SUTA 1JIBA 3SCVA 4PTMA 2W66A 2X0YA 3A23A 3O2LA 1TR1A 1QOXA 1GW1A 1OD0A 4QFUA 2D2OA 1RP8A 3A4AA 4J3VA 4JCMA 4NZCA 2AAAA 1GOIA 3A3HA 4B9YA 4HA4A 4WSJA 4AY1A 1GHRA 1E4IA 4KGLA 1B3ZA 2OSYA 1A3HA 2ZX9A 3W38A 2WZEA 1WZMA 3NYDA 3CTTA 1V6XA 1QBBA 2VZVA 1BGGA 3BUIA 3HG3A 1UOKA 2XFRA 4BQ5A 3AFBA 4U5KA 1QI0A 2JIEA 1W9DM 3CHDA 2PWGA 4D71A 1PX3A 3UEQA 1BYDA 3CLWA 3ZJ8A 3FN9A 3W0KA 4X9YA 2QMKA 1W2VA 1E6XM 2V5CA 2WCGA 3BSHA 4P8VA 4IISA 4GZJA 2WVVB 5JBEA 4NZFA 1LG2A 1KTBA 2PWEA 3VGEA 1J12A 1FA2A 1G94A 2EJ1A 3EYPA 1XHGA 2O7GA 3OA5A 3AS3A 2XVLA 3W53A 1J0YA 2DT2A 1V3JA 5E0FA 2XVPA 1H09A
chains in the Genus database with same CATH superfamily
2W60B 3W7CA 1XRVA 1Q8MA 1KM1A 3MKKA 1EP3A 2H2SD 4Y4KD 1RV8A 4QRPE 4YPGB 1H19A 2A0LD 5BJTA 4CN6A 3M0XA 3II2A 3UPWA 3NVQA 4IDLA 2NYKA 4P2QA 1KM2A 4YIQA 1YYLH 1WYJA 3HE7B 1G7UA 4DBDA 2A4AA 4M8QA 1K7XA 4A22A 5BROA 4H9UA 4MQ7B 3QRFM 1DL3A 3O45B 3MP4A 1SYSA 5EC2B 3CGTA 3WIAA 4OOFA 4F2FA 5EU9A 3AT0A 1DLHB 3JWOH 1G6RA 1C8VA 4H9VA 3QMSA 4I5RA 1US0A 5I19L 1TX2A 2B0MA 5FSEC 2NTSP 5D72L 1B0GA 5D2NB 3P80A 3UC0L 3CHQA 5LQBH 1XCFA 2ANUA 2NCMA 4PH8A 5IR1A 3EBVA 1EB3A 2QULA 3H7RA 3HVNA 3M46A 3LB0A 1ZHLA 1K5WA 3DENA 1JZIA 5CAYB 3B5GA 4EEEA 8RUCA 2A85A 1HL2A 5D2NE 2HISA 1FE8L 2ALAA 3PZTA 2PE4A 2VX4A 4LFHG 4JFSA 3GG1A 1BWWA 1S2EA 3E0GA 3MLRH 1R3HB 4G9DB 4L37A 4RLIA 1Q8AA 1MRAA 5ESAB 1VA9A 4QRRD 1UW9A 5T1KD 4LOUC 1Y7VA 3BMWA 2HG5B 4HKZB 3ZKXB 1T1RA 1K8XA 3CH1B 5DEFA 1LP9E 1HJVA 1LOLA 1JRHH 4WJ5A 4G6JH 2AL2A 3TEVA 2HVKA 1GAFL 3AQYA 5IB3A 4FLQA 4ONFL 4UWMA 4HXBL 3RDKA 3T0EE 1LP9A 1JBJA 5LGZA 2GVGA 3DFQA 1VEOA 4EK7A 4YYFA 1NGWA 5IF0A 4HJGB 4CC4A 5ABZA 3AYSA 1G43A 1E73M 2XTSA 3WFDH 4JZ5A 1ASOA 2HAZA 3FQXA 2FJGA 2MQ0A 2OQLA 2QGYA 5J1SC 1TWIA 2A2IA 3EO1B 4HJJL 5E24E 3OG4B 4MZRA 1JZFA 2DQUH 1E2WA 3A24A 2XY1A 1J5IA 3LCLA 3WK0A 5D93B 1IF2A 1ADOA 3BUPA 3KDMA 4N2FA 4PJBB 1BIIB 4UB0L 2V2TA 1WFOA 3DMMA 3LIZH 5DK2A 9PCYA 4OJYA 1JE6A 3I75B 4JFDD 3SOBH 5C0QA 2VCOA 3F5WA 1G87A 1NCCH 4LP4A 1PSCA 2VZ1A 2OXNA 5G5DA 3COTA 4GUHA 5DI8A 5K2ZA 2LR4A 3EYFA 4I7ZC 4H1LA 3AWGA 1EX0A 5FJTA 2XV6B 3FRPA 4PMFA 4ABUA 3NFSL 2ZOWA 2Y7QB 1B2WL 4NRSA 4LLWB 4N2BA 3D2UA 3AXLA 5ANHA 2J47A 2CLPA 1GCYA 2XJ7A 5FKYA 4DAFA 4ENZA 5M03A 3BW4A 3MHZA 1K9EA 2HH0H 3ABXA 3UWYA 2Y2WA 4B9PA 1RURL 2HX7A 4LPYA 3U2SB 5F7FA 1E4XH 3WLNA 4ODXA 4Q58C 4BI5A 3QBTB 2FDBP 3HIZA 3MRLB 4NC2B 4XCNA 5IBUB 2WXGA 4IOSD 4S1RL 3UBXB 3VIOA 3AXKA 2CNZA 2LU5A 3FUEA 4N20A 2B81A 2VXNA 3CDZA 2XINA 2B4CL 5HAOA 4YK4B 5HJGA 4KJPC 5LNRA 2CZEA 3FYOA 3KVDD 1FP9A 1HC1A 1B3IA 5I71B 1TT6A 1SUXA 2R0LH 1KBVA 3ZPDA 2A0NA 3THUA 1I2OA 4MCZA 2JKLA 4RXFA 1XGZA 4PGDB 2VITA 2CCLA 4U3SB 2WJ7A 4PUDA 1F07A 3WIFB 5F70A 5F0MB 4XX5A 2FYMA 1IKFL 4M7TA 3KPQB 4RE3A 5AYYA 3PV6A 1UZ8B 3G04A 2V2CA 3W7PA 2FX9H 3EGDA 4KHTL 1KV7A 1YY8B 2DQMA 4B5UA 3UGUA 1UXMA 3UEZA 1XBZA 2Y3AA 5JO5B 1GHSA 5I17A 1VCGA 4UMGA 1IXOA 3PXHA 2PP1A 1T0NA 3KBEA 2BIOA 3ABZA 4D6GA 3P7YA 3KZPA 4ZPVB 3HPFA 3AI0A 3HZVB 1T5WB 2HT4D 5HNFA 2OOFA 4K9EL 2AJUL 4MQXD 1WP6A 4JZNA 4OZIB 1MCDA 4JL2A 2B2XH 3TC7A 1O1ZA 4JJHA 3NCOA 3HB3D 3N41F 1TSRA 1YNTF 3C75A 3NSMA 1M1XB 2E27H 4PUEA 3BFQG 4ZODA 3M41A 3O3AA 2HSAA 3KS0J 3VCNA 3RIKA 3G6JE 3P1VA 3RB5A 2BW5A 2GSIB 1H7XA 4K39A 4ZW7A 1A7QL 4XNYL 2VGIA 1XH2A 3LNGA 2FHCA 4FF9A 2WXJA 3VAVA 3AU9A 1FVEB 1W3KA 3NSCA 1BVLB 4R0LB 1VENA 4FXKA 4U6VL 5DA0B 1DSFH 3IDNB 4R4ND 2WMJA 1UC6A 5TH2B 1DJXA 1SN5A 2BMBA 2EF9A 3W87A 3TA6A 4O0QA 3C5ZD 3C2SA 4DNLA 1ONOA 1UJ3A 3GJEB 5I19H 1O5KA 5D9OA 1GRWA 4LESA 3H12A 4V33A 3DX2A 4LDCA 1SFLA 1XV8A 4LYPA 4FXGB 4TYUA 1V02A 2CDFA 3DYMA 2E6PA 2JB5L 5I6XC 2OWCA 5KSBF 1R2SA 3R7QA 3QJTB 4IQHA 3JWNH 1Q0EA 3PTQA 1CIUA 1MG3C 1QWKA 3QR2A 2XTJB 4ZS6C 3RY4A 1O7DE 5D96B 2PR4L 3VD7A 1DLFL 3V4VB 3UJTL 4C56E 3QZPA 4GI8A 5ITFA 2X9ZA 4JDZB 1MDRA 3FOKA 1AGBB 4GABA 5ABHA 2J4GA 3VOCA 4OF6A 5C8JB 2YD4A 4NQCA 3NDZA 4FHAA 4PMUA 1H8LA 4IEFB 2H9AB 3HHSB 2KDYA 5FJRA 4Q8UA 3L12A 4H4NA 1ICPA 2E6AA 5KVEE 3ATAA 2X2GA 3A4JA 4E2DA 4HIIA 3PQYE 3ULSA 4FK9A 5FEBA 1O9WA 4WHTB 4Z7VA 4KK6D 4CILA 1M3JA 3MTWA 3PWVB 5IMKA 4YSCA 1T03H 1L3WA 1ZRQA 1T1SA 3UJJL 1RD6A 3SD2A 1TCMA 3I6GA 43C9B 3IDMA 1FGNL 2A6DB 2YSSB 3FCTA 4WEMB 2BDNL 3UO8B 4AQ8A 4LVOB 2CFFA 3NYZA 5D1QC 1GT8A 2F2KA 4PD4K 5IMKB 5KVGL 1HP4A 5LDSA 1HT6A 2C1GA 1QTSA 1V3LA 1NC4B 2EH8H 1TITA 1MWAL 1RJYB 2C82A 1DCLA 1CXLA 1QI4A 2R29A 1L3NA 3GIVA 3QNYA 4QTIH 1JZ5A 2A5HA 1FWNA 1F4YH 1HKVA 3GSMA 3TAOA 3UZEC 1F6AA 3VX1A 2A0LC 4JTHA 1IC4L 2WWOA 2Z31A 4UNUA 1GOWA 1BPLB 4WFFE 1XISA 3IJIA 1YEJH 3AICA 1I1CA 4MBOA 5DMJB 1T6VN 1WO2A 4N2KA 5IREA 1GYNA 5J56B 4I0PC 2KQNA 2BZ7A 3WQ4A 1AR1C 3SDYH 3WMCA 3HNSH 4ZMYA 4X8JB 5ERWA 1VHCA 1PU0A 1V02E 4S0TD 3H4HA 4OUUB 4GZ7A 2CBUA 4BK9A 2VT0A 1OAXH 1E4MM 3NCBB 2CO2A 1O68A 1RUPH 2E56A 3RJXA 1X8CA 3H9SE 5E56A 4OI9A 5ILTL 1RA0A 2CA4A 3ARBC 2WB7A 2Y61A 4IHCA 4WK9A 3K2UL 1QACA 4WENB 4PJHE 4KUCF 3O9WA 3EOOA 4WI5A 3IETA 1CLKA 4BFGA 4EDXB 1EHAA 1ESWA 5EZPA 1HW6A 1W72L 1EEXA 3U2OA 1I8KB 1SOSA 1T0PB 3F83A 4KU1A 1H6FA 4MLJA 4DWSB 1NSNH 3C4UA 3HPLA 4HJTA 3RUGA 3UTTB 2P46B 5HGDA 4AMWA 3IK4A 3NQFA 5FESA 3IDMB 3MW7A 3K3QA 3JZUA 4O50A 5U4NA 2WJ5A 4X0KB 1C1EH 2BFVL 4JMNA 5IV2B 3D0CA 1A4JA 2AKRB 2F18A 4X7DC 1DWHM 4PGLA 4OZHB 5J6SA 4TPRL 3QEGH 1KJMA 2IUZA 1U3HD 4ONVA 1XDJA 4OIAA 3AIBA 4XGZA 2R69A 4QRNA 4F15B 2NY1C 1L7TH 3QHZH 3W83A 4A3HA 4JG1L 3UXIA 1HTIA 1SSGA 1QBLH 3EBHA 2MOVA 2ZSVA 3DHJA 1H9VA 2A7BA 3UAJA 1GIGL 5JUEH 5BRPA 3T6XA 1HJUA 4CNTA 4YXGA 1ZV5A 3UG4A 1OQFA 4S3EA 2PURA 1A8ZA 3MRNA 4WEEA 1D6VH 3IVTA 4UC5A 4C1KA 3MUGA 1V3MA 1V3KA 2QMJA 4ODTL 3TCTA 3G6LA 1AH0A 1AGEB 2LTQC 4H7ZA 4KXBA 3SYAA 3OPZH 2R8SH 1ZS8B 4OVVA 5F6HI 3E96A 2KERA 4CXFA 4NP9A 4WK2B 3MYOA 4XSMA 4UCFA 4BUHA 5L2KE 1R3SA 3SR7A 4E6MA 3PJWA 4UFJA 2F8OA 2DH2A 1UD5A 1J5DA 2GAZB 4RCAA 1RZJH 1OVZA 1TYJA 3LPGA 4PJAE 3Q2CA 5AYBA 2XXGA 1H6UA 5HJYA 1NIAA 4ETQB 1CFSA 5L88H 4FTVE 5MENE 2OKMA 2VW4A 3D2UD 1JP5A 3PL6D 1CB7B 3L81A 2A6JB 4OOZA 1OAYL 5DZPA 4K3HA 2AERT 2VUKA 2AANA 2PU1A 2OJZH 3UAFA 1L9RA 3LSOA 1OM0A 1R0MA 2FL5B 2C3VA 2PW2A 4L0ZA 3NFUA 3NL2A 3CT7A 4NL1A 3W01A 1NM9A 4CC4C 5I09A 1TU2A 4QLRA 3GSRB 3Q5TA 4OD2B 3SB3A 1CFNA 1EEPA 1WAUA 1OM3L 1Z69A 3UBHA 2NW2A 5B7MA 4ZXBB 1T5WA 5D05A 1XF3B 2AITA 3JTSA 4V15A 4EAEA 1PLGL 1Q0YH 1IXQA 2XWBB 2IV9A 1JNJA 4FQIL 2VUNA 1XLBA 1BFSA 1NGXB 3UTTD 3GUWA 3FT3B 4KMTH 1GTFA 3F03K 2IVFC 4K3JH 2XN9E 4LLDA 4YSRA 1JWSA 2ZUSA 4KO9A 3GH5A 3KAOA 3ZVHA 4CNSA 1AQHA 2Y07L 1RK5A 2OCCB 3QR3A 3QTPA 1YYAA 4Y5XB 1O5QA 1H3VA 4GRWF 3QORA 2VLKA 4X5WA 4AVKA 4JQIH 3EDEA 4LOUD 3C2FA 2XIJA 1VFBB 2EZ0D 2A3BA 2LLEA 4M1RA 3G04B 2R23A 3O81A 1B31A 4OJAA 3ARPA 3WIFA 4OI7A 2I9TA 5LIXX 3DJTA 1BA9A 5DUBA 2UZXB 3NJFA 3RWEB 1E6OL 2PFHA 4UTHA 2DRUA 1JK9B 3QA3A 2J74A 3BAYA 4N2MA 2AEPL 4OAWB 1JCLA 2WY3B 2MQ3A 4PJ5B 1ONRA 3M1ZA 5HANA 5DS1A 3VG9C 3QUZD 1CE1L 5IROC 1SYTA 2VLRD 1T41A 2CLVB 3EEZA 5T26A 1OIFA 1XQKA 2QT6A 3QSRA 3JVGA 1W5OA 4X0NA 2CAKA 4PY7B 1BZ9B 4C56B 4XCNB 2P5WD 3UBXA 4HN8A 1R5IA 4F0SA 3T8XB 4KDTC 4NKDB 4P61A 3G5ZB 4G80A 2GGGA 3AHTA 3TCSA 3KP0A 5LGJA 5BXSA 5AKQA 4M81A 3BUVA 1JJKA 3N12A 1EWHA 3G08A 4PMEA 3TCLB 4R9XA 3WLJA 2DZUA 5AZEH 3VUAA 5I2IB 3T65B 1CGTA 2YJQA 1FORH 4JJOA 3DDGA 5MENA 3S37H 5IGXL 4HD9A 4OLZL 3WKNA 3F7JA 3FT4A 3NSJA 2R7EB 3LHPL 4KRPC 2CHOA 2V5KA 3DVGA 2Z24A 1COBA 5JHDD 1P1ZB 3MV01 4OD1H 4UQ2B 1BEUA 1UYQA 2EC9T 4X42A 1TIMA 3NK3A 1WC7B 4BWWA 5IFJA 3HBPA 1WFUA 2OR8A 3MCLH 1KCBA 3S3CB 5CCZA 4IIQA 2AS5M 3ES7A 2BSSA 4FFVC 1FO0A 4HUCA 1HWGB 1RP9A 3OIHA 5E8EB 4NJHA 2CO4A 5D2NC 4JMXA 1BSIA 2DLFL 4I89A 5GGRA 4PJGB 3G1AA 1AQ0A 1YEEL 2AV7A 4PTVA 1NCDH 1EA0A 4A6GA 3B4NA 4P2QB 3AXHA 2YD3A 4W85A 3KDPB 4GRWH 4RBPH 1E70M 4O12A 2XT1B 4PJ7F 3BP4B 3CMGA 1WZAA 1X5MA 4WUKL 1TPB1 4AEEA 2B61A 3PGDA 3C0SA 3PZGA 1RMFL 2KS0A 1QVOA 3IDXL 2ZNXA 3CSTA 4WU5A 1JPFB 2Y63A 1A3RH 3EADA 3U2SA 1WNOA 1BVNT 2WOQA 4DAGH 3HV9A 2XA8L 1LBLA 1T1WA 4F7TB 1C5BL 4F7EA 3OB8A 4PJXB 1HK6A 4OQ1A 4RMSA 2ZT9C 3HC4H 2WZHA 2VXQH 3W0WB 1E90A 1J05A 4IRJD 4QD2E 3SDXA 3UYRH 3WKPA 3P4MA 4JTSA 3EH4B 4U1IA 4XC1L 2I32A 4YHLH 1S2UA 3RPIA 1E9QB 5LAXA 3VPLA 5FACA 2IXUA 5KWYC 2J7GA 3W6MA 4GW4B 5EC1A 1TTAA 2UVFA 4Z7QE 3WHE0 5C3IA 3TTQA 3OHXA 1UYWL 4JCWA 4ZQOA 4FFZA 4JS7A 1TNNA 4R7XA 2BHYA 4LLUA 4PIBA 2SFPA 1FFQA 1NGPH 4LHUB 2A83A 5I3GA 4HK0B 5GGVL 2ITFA 2GITA 4Z7QB 1Z3GL 3GW3A 2AQTA 4YL2A 2BSLA 3UF9A 2D3LA 3C8HA 1YYML 2EIJB 3A14A 1NCOA 4P04A 3D39D 3P40A 3AIVA 1O5XA 3FMGL 1OTTD 3H3PH 4E9YA 1VBUA 4MQ7A 1QPXA 3U7YH 4BFRA 1W8OA 4ZUUA 1JZ2A 3JWNC 4HVXA 4QRQB 2IGTA 4ODUB 4ZFGL 4O1EA 2OYPA 4QJ1A 3T1GA 2BVUA 2EG6A 3VGHA 1AQDB 3RR4A 4LEEA 3R7RA 2I9LB 1B3YA 3MLVL 5F3HA 3EMQA 4LPXA 4Y5YC 3K4AA 3B7RL 2ZTBA 4NPJA 1G1CA 2YRZA 2VHLA 2ZRXA 3CAQA 3OKYA 3QCTH 3ZYOA 1UR3M 3NESA 3AT9A 1M1XA 1MZRA 4LFYA 4LSPH 4XE5B 2P8LB 4F3FA 1BZDA 3R11A 5LGXA 3B56A 1FNEA 3EWBX 1QTPA 1KENL 4GLRH 4MNQA 5EA0H 3VRJA 2LVEA 3BZJA 1KT2A 3CN1A 3QYNA 1CICB 1ADQL 3B83A 4CA4A 1SW0A 1GOGA 1ZLEA 3VKCA 2RAGA 3VRIB 1Z5YD 5ALBH 1NVMA 2Z92B 1J1PH 2JALA 3MC5A 5AHIA 4H40A 3VXTB 2ZAIA 2Q76B 3RRAA 4AL8C 2Y2YA 1BTMA 4L29A 5DMIH 2FAUA 4HYRA 1WZ1L 2EXWC 1T6BX 3QQ9D 3CMOL 3V4PL 4I2XB 3RJOA 4JX4A 4RV3A 4LALA 4LSUH 2VXSL 4ZUVA 5I15H 2EIMB 4QRRB 4M9OA 4TLSA 4ELMA 2Z1KA 4L61A 1IT9H 5BZDB 4X9SA 4JX0A 4Q6IB 3IDUA 2CDEB 3TBVB 4R5VA 4C57C 4DKFH 4N0FA 2R1MA 2A9BA 4R7OA 1VYRA 4JN2A 2RJMA 5D1ZB 3EAUA 2HROA 4QCIA 1I7TA 3KWSA 1XLFA 3BJTA 3QXDA 3QUMA 3CQ0A 5D2LE 1W0WB 3N6JA 3W4RA 4P5TD 1Q94A 1X5LA 3BPCA 1NBQA 5L9DH 3MRMA 3C3NA 3W1LA 3WUEA 4JO1H 3U8GA 5D1QD 2OB3A 4QXTA 4RRPA 4G1NA 1IAMA 3ILQC 1KV3A 4BF7A 3EOTH 3H9SB 3S1WA 1P6AB 4N90D 5D4JA 3V0FA 3B7TA 5JBIA 3NCFB 1IJNA 3WEOA 5JQIB 5DY2A 1X7FA 1A3LL 4LOCA 1TZOA 4G8GA 2E1DA 1CFVH 1DBAH 4IM8A 1IVLA 1N3NB 1FAIH 3PJSB 3LDBC 1KWKA 1JUBA 5A6MA 4WTXA 5I1JL 1U8KB 4WWNA 5CZXC 1C12B 4ELMF 2RUSA 1IM9B 4UQBA 5JOEA 4OJFL 1UC4A 1C5CH 5KSVA 4IHBA 4GVHA 4Q4IA 1KIUA 2GBTA 3ZSSA 4B7LA 2VABA 3W1RA 1UWSA 1FH8A 4ZDHA 4MAYD 4DO4A 2ZZ1A 4MAVA 3OJDA 2PNDA 4ISVB 3U0TB 2EDWA 4HNLA 5E08H 2VEIA 2IFGA 3J07A 3P0VH 4GJJA 1D5XB 3O6LH 4OLEA 3O3EA 3ZTCC 2C9UA 2YCJA 3FULA 3RWDB 3BD5A 3NURA 1BMGA 1ZDSA 1FLRL 3J27A 4EI0A 3Q8CA 2A1YA 4ICWA 3GKFA 1GVQA 2JF6A 4OV5A 1E56A 3O06A 4TSAL 5CEYB 4U1HA 3QZEA 1UJPA 1HL5A 3P0YH 1FUYA 4B5XA 2XX0A 3GRWA 3V0JA 1J79A 3DI0A 4JFHE 4F2ME 4AEFA 2WJEA 5FO7A 5DVMA 5EUOF 1BZ7B 3TZVD 5J3HD 1OV8A 5ELIA 1VS1A 2BHUA 8TIMA 4J8RB 4M9PA 2QDWA 2VYOA 4MYXA 5CBJA 4NENA 3D51A 1LTXA 3B8VA 2NVCA 1PAMA 1EPFA 1UXSA 4E9LA 1W1ZA 3MLSL 4R27A 3CK0H 3BP7B 5E5RB 3WAKA 3M9YA 5GRUH 4XWOC 2ZZ2A 5DT1H 4D2NA 1RK1B 5FGBA 1EJ7L 1UZDA 2ABBA 1CGYA 3GG7A 3QDMD 1A25A 4XNMB 4P7OA 4TV5A 4BA8A 1SF3A 1K8DA 2XTKA 1XBRA 1TZIA 3HFMH 1OF2B 5E9AA 4B9GA 3QMRA 3L7RA 2ACSA 5J1TC 4GJIA 5DANA 2AL1A 3JWNG 4XMPH 5IRPA 1MVYA 2O61A 5IK3A 3GR4A 4PTDA 4F48A 2ZPKH 1Y5VA 3UZZA 4AZBA 4Y2DC 3MRGA 1IAIH 2PLTA 2VERA 4HK3J 3G5VB 2FWLB 3QJAA 2NX5B 2F6AA 4HVBA 3L5WA 4P3DB 4Y4KB 2PZNA 3W0WE 3CZLA 1KTCA 2UWEB 1NFAA 3E49A 1QP1A 3NZPA 3IXTB 4NBXB 2W0FA 1T7LA 4PSRA 3GPEA 4P4KA 1AKJB 1I7UA 4X6CA 2PDQA 4GX8A 3TFXA 4BQCA 1X7TA 5FC9A 3R7MA 3ULVL 2QKIA 3HAEB 5FF7A 3W22A 4NQVB 4U6TA 4FABL 4F5CA 2GK1B 3K2GA 1Q4WA 1A6WL 1FUNA 4PJIE 3MJ9A 4LSQL 5JXEC 3R8HA 4I9AA 1KPUA 4IMKA 4ZTXA 1CICD 2EC9U 4XCFL 4KRTA 1TEYA 4CCDA 1MZYA 2GB2A 2JCWA 4YO0B 2F7FA 1SBBA 2PTZA 1D9KD 2EAEA 1MAKA 5C6TH 4Q56A 3B0PA 3N2JA 3NJLA 2QDHA 3MFFA 1BZ9A 4TSBH 4C56A 1EJSC 4KWUA 4RIRB 4RZ6A 3QUYB 3T6CA 3VFGL 4C6NA 1LWHA 1U3YA 1MQQA 3S8HA 1I7TB 5F6IB 2TRSA 5CIPB 1OGBA 4BF5A 4TVPL 3IMRA 3TZVB 2P80A 1VCFA 1Z8AA 3FGCA 5EDXA 5IW6B 4H2AA 4XUGA 3IVUA 4HEPA 3ETBJ 2JE8A 2O5ZL 4UT9L 1D5BB 2WSQA 1IGJB 3AYVA 1E40A 1XAKA 4M7LL 1A3QA 2GYSA 3IMSA 3N13A 4UFKA 4K9JA 3S2JA 4QSHA 1QOPA 1SMDA 3H8AA 4NKQB 2DTSA 2VC9A 2V9RA 3QXVA 3X1FA 3NMEA 4KCUA 4PJ8D 4GKTA 5IVXB 1CB4A 3DNKA 2V6AA 4D9PA 5GRZA 3NA9H 1EDYA 2BO0A 4HCHA 3WH7A 3WIIL 4OFIA 1W2PA 5E93A 4XXCA 4L4TB 4ZPTB 2J13A 3LB6D 3NPVA 3BE1L 4YDIH 4DJEC 5CAKA 3L3JA 3U25A 3L0KA 1VYPX 4KTDL 5C7ZA 1OADA 3KXFB 1BQHA 2NY4D 1VQTA 2VXVH 2CEQA 3TBCA 4EBQH 3KHDA 2XQ0A 1SXBA 5CC7A 5IHZB 3CFBA 2V33A 3WQRA 5FW7A 4M3PA 1N6VA 3GVRA 4XBKA 2AJYL 2WN2A 1CZ8L 5IMMA 2EJAA 1S9KC 1EHXA 4LC6A 3THAA 4IRZA 2IPTL 4IHOA 4NHVA 3LXCA 4RZBA 4QRPA 2WO4A 2B4CC 3D69A 1QVOB 5EO0A 1DBMH 3TBTA 3L95B 3PS6A 4I9XA 3CX5K 2AK1H 2OZ0A 3AIWA 4M6NH 4YXHL 1IC0A 3VXMB 1EP2A 1KR1A 2R1XB 1YPZA 1W9BM 2ESVB 3CV1A 1TQUA 3CXHK 4GWEA 3ARBB 5A6KA 3RLGA 3K4ZA 4EDXA 4QRSA 3T3ME 2X7VA 3AU1A 5HYEA 2BSRB 5EO1A 5HLTA 3EX4A 3F5LA 2AJXL 2J72A 1EJVC 4KUZL 2BX7A 1I82A 1F6LL 4Z2IA 2QSCL 3LMJL 1ZS8A 4N42A 2UY6B 3WENA 3BSZH 4WKZA 4E4UA 2BNJA 4M0XA 1VZWA 3V4UL 3BRGC 1Q7QA 4Z1AA 2AK4B 2NT0A 2C9SA 3RP1A 2F6KA 5FXCH 5IVZA 5CPOA 2YA1A 3FTGA 2X4OA 3VINA 2E77A 1AODA 2ADFL 1SJXA 2XG4B 3I50H 4QHNB 1E9PA 1OFAA 2IKGA 2TSAA 3BD4A 4H2HA 4LU5H 3GMOB 1JFHA 1TV7A 4LCIL 2HPTA 4DHGA 2R1PA 35C8L 2G5BA 3RYMA 5IHWA 4TOQA 5D55A 1M05B 2B0SH 2DF3A 1IGIL 2GY5A 3LZPA 4R7NA 4NM4L 4DCQB 3APNA 2NX9A 2AMGA 4P5TC 2OCZA 3U2EA 2WTOA 3D18B 3U7WH 5K5YA 1KM0A 3C8FA 1R5IB 1IWAA 4IP7A 4UNKA 4G6AC 4YX2L 4FCAA 2XJKA 3SSJA 5GXBB 3GT6A 4RISL 3H54A 2D3VA 4DGYH 2X4UB 1BQ5A 5CJ8A 2ICWJ 3NPZB 3SZ8A 4W9IC 5FV2A 2QCDB 1J8SA 4R7VA 4XXDA 3HVDA 4ZS7H 3AREC 3V7AG 3W56A 1KIQA 3A21A 3D7PA 4PJ9D 1PYFA 3LBCA 4JTCA 3MMTA 1J8HD 3MKGA 4PR5A 4Z0SA 3GX9A 3CZJA 5CKSA 3ATDA 2NY3D 2I9TB 3O6KL 1SO4A 1PG7X 4HW6A 5IBTL 1QFUH 1KBPA 2CBMA 4GAJL 4LK4A 3UP6A 1XRTA 1EEYA 1OE2A 1AZ1A 4NAEB 3KPSD 3X1NA 2RA1A 4D3CH 1UMLA 5AYUL 2V3GA 2NY0D 5IOKA 1GVFA 1KBLA 1RY7B 3CL6A 3WO8A 3QPQD 4IQEA 3MPCA 4MNHA 4G70B 3TYZA 3QDHA 1XL9A 3NRFA 3MROA 3Q58A 1S7VB 1R3LA 3DDFA 12E8H 5HBBA 1UD6A 3MYJA 4NKDA 5E4AA 3GMLA 3LQZB 4MZYA 3AITA 1BPVA 1UWUA 4RKAA 4PUBH 3VFUA 1UKPA 5DVLA 3VXOA 4OZ4A 4QGTA 4PAZA 4LMQE 3WHXA 1T80A 1XIHA 1OC5A 1RIUL 4AYID 3QJSB 4OH2A 4U3HA 5E2UH 4V2BA 3UGEA 3OKKA 4TNWK 3FSUA 1BSLA 1JGVH 4FQXB 8CGTA 5F1NA 2YZ5A 5B7FA 4H8VA 3HMJG 2X4TB 2BY3A 5E4EC 3VGFA 1L6WA 2N7SA 1YNLH 4PJIF 4JREC 1FNSL 1KR0A 3CASA 4H41A 2FVNA 4FLOA 3QHMA 1JK9A 3QA3B 4U3XA 5I1CL 1TPDA 4HNNA 1FH5L 3F62A 1DFBH 1F3TA 4IKLA 3MV7D 4QGCA 2JD2A 2WZIA 4ZTPH 4KRNA 4XNBA 1UA3A 4Y9FA 1SM3L 3KLKA 3WS6A 5ACZB 3OXRA 4L4VA 5L8LB 2DGAA 3GXUB 3RNDA 5C92A 1QTYT 1NC2A 3B40A 1MCPL 4UDUB 4AH7A 1CK0L 2IC2A 4PHXA 5KZ6A 4PBEA 2ADJB 1MIEH 1T0NB 2CH8A 4C6KA 4FG6D 3SYCA 1NDYA 2VW6A 4A37A 3DV6A 1LLOA 2IOIA 2PTVA 2IBZY 4GC4A 4U10A 4KI5F 4Z7UE 5D6CB 5GISH 4BK5A 4BM7A 1H2JA 5LHDA 5CF3A 3D4ZA 2NR6C 2DQIL 3GSRA 4OD2A 3ZY7A 4AEHH 1IEXA 1P5VA 3ZTJH 4I1NB 3CFCH 4GKZA 5H37H 4NUGH 3C5SA 3TUUA 4HYWA 5D9PA 3TA9A 2PR9A 3CVHL 1R5WA 1VACB 4L3CA 5AAMC 2BWQA 4BFIA 4HUUA 4BYHA 1F11B 1LNUB 3UPAA 4C47A 2FDMA 3S1VA 1A47A 1V7NL 5DXXA 4APQC 3AU8A 3AUWB 5AHLA 3GBLA 2D7NA 1AQMA 3QG7H 5AAWA 2CLRA 1P7QD 5DJZB 3KCJA 4OT7A 3S36X 1AD9A 5MHSE 2FBRA 3W2KA 4IRSC 4ZX5A 4OCMC 1MRDH 3Q1SL 2Q8AL 3LCFA 4CD7A 1WF5A 2Z8WC 3U0WL 2FGWL 2H26A 2PP9A 3LD8C 3S96A 3I68A 4GXWA 3T0TA 4FP8H 4N9CA 4JE0A 5F9JB 4R88A 1G7LB 4WV1B 2IH1A 1UB5B 4PB9L 4Q9CA 3HI5H 1JUEA 2Y5TA 4DCQA 3F2CA 1WD9A 3MJ6A 4FHJA 2IG2L 3PGFL 4P05A 3IU3A 5DR5H 5EU6B 1ESOA 5TDNA 1KKOA 3KYOB 5I8KH 4E3VA 4EI5C 1QK0A 5IFAH 3GGWB 2ZSVB 5J9PB 4YWIA 5A6SA 1ZGLA 3MRRA 4P2YA 3TT3H 2HTLC 2W92A 4MKMA 5GS0D 1Q9OA 1VKXB 1I0BA 1R8LA 1Y0LB 2HVOA 5HUPA 1S9XB 4F80A 1EFXD 5HI4C 3Q2VA 3CDFA 4ZRGA 3RVWC 1LXMA 1LBMA 1E6JH 1F1DA 4XRCA 2ISDA 3VI3A 4IDJL 4C6EA 3T3MB 5LBSA 4JO4H 1JZ8A 1KGUA 2IPUK 1JCYA 1XT5A 3OAWA 5BUGA 3H6OA 2DQXA 4UOW1 4AWJC 3IJSA 4U33A 3W0WD 1E9IA 1U91A 3WLPA 2EACA 3IJEA 3SKJL 2WBKA 2OR9H 3WDJA 3ME3A 1SGJA 4KPHH 3MUAA 1RZFL 2UWEE 3GK8H 5C0EB 2BH0A 2N56A 3KPOA 4M62H 5FFLA 1G7VA 1NWRA 2FEEL 4OFVA 3NCYS 4P3CL 4JFDA 2J44A 5ANMB 3EEGA 4N9OB 3CU7A 1AIFB 3AT8A 5C9KA 1QCWA 4LP5A 1LVEA 1S8DB 1J5OL 1HZYA 2VH5H 5LXEA 4XZNX 1VFTA 3DIDA 2C9VA 2VC6A 3TO4B 3K71A 3RK8A 2L7JA 3URQA 5IVXF 4L1SA 3VB8A 3I7RA 1AD4A 3KGTA 3UTPD 5GJMA 4DOHB 1NWUA 3P4OA 4F9PC 3ITCA 3T0EB 1XIDA 4LLWA 1P0KA 3JWOC 1G69A 4U5IA 5HDBF 4ZOBA 1A6ZB 4Y4HA 1BZEA 1O5PA 4D72A 4HYTB 1I8AA 3JQOB 1HHJA 4L0PB 4MMZA 3I02A 3MNZB 2V9UA 4GKLA 4X8JA 5ERWB 3NACL 1FNFA 5H35A 2Q87A 2V5BA 4QTHB 3VFSA 4B3EA 3CH0A 4I48A 2JVUA 3PNRB 4JRLA 3V4LA 3I7SA 2A6LA 3HBLA 2B1AL 2ILLA 1G4TA 4JO2L 1FRGL 3K2MC 3ULUD 3W39B 3SCMA 1GOHA 2V9QA 4AWSA 2YMXH 3KDMB 1BG9A 4XPFH 3N6YA 1UH2A 2V2TB 4OGXH 3ZKMC 2J2ZA 4Q0XL 2ATPB 1TQVA 1OAKH 5CINL 4WEBL 3VVLA 3KPMA 2QXWA 1MREH 1KTDB 2DMHA 3KBHE 3W7MA 3I7QA 3MNWA 3OKNA 5DYOA 4TTGA 2BFGA 1PYMA 2V81A 4LF2A 4WSHA 3SE8H 4QR7A 4DW2L 3GDRA 3PZNA 3Q8AA 1TTGA 1KIRA 1JWUB 1UCTA 5E7BA 5T5FH 3CEUA 1G6CA 2C26A 1IWBA 3VOJA 2PDMA 5D71L 4M8RA 5DFVC 4J4KA 3EFFB 3JTTA 5HHOA 1OP5H 1SFTA 5E5CA 5ADPL 4AENA 3UWZA 4KHXH 3D69B 4LUPA 3GZOA 4K15A 1IQ8A 1N64H 1X5GA 4OIBA 5E9XA 1IMHC 4YGAB 3V9FA 5GRJH 2BNQB 1XGYL 4R4BB 1GYLA 3I74A 3ANLA 1E0WA 4YDNA 2DZSA 5MERB 5I1HL 4TLUA 3J7HA 2R1NA 3HN5A 1TPC1 3CV2A 2ODOA 4R53A 4Q8QA 3DBPA 2Y4SA 3SKOB 3N2MA 2X7WA 4OSUL 1JSYA 5EBGA 3SQBB 3OLIA 2VDKB 1T83A 3LRSB 1QOKA 4NHUB 4PVBA 1R5VB 3B9DA 3SM0A 3T05A 4ZW3A 4B5NA 4DLFA 3A5VA 3WN5B 4DZ8A 2FFLA 1TVHA 4CSSA 1TJ2A 1JI1A 4HU8A 2GI7A 1I45A 1PHQA 1MFCH 4UTKA 2CKBL 1Q0XL 3GMNA 1Z9SA 4RXGA 3SPCA 1LLZA 5E09A 2RB8A 4C6QA 2CESA 1DQDL 2X7LB 3P81A 2QQLH 1AXTH 3BWZA 2A2QT 1ND0B 3NCXA 4JG5A 4WDTA 3PNZA 4XD6A 5ICXB 3ARXA 4PS7A 4UAOC 3EJSA 3SBWC 3IDNA 4H88L 4KZDL 1U83A 2QR6A 2ZBTA 1IEBA 3T0ED 2EG8A 3AOFA 4ODWA 3ITVA 3UR8A 3CB8A 3QCUL 3UZ5A 2HFEB 2XU9A 2P4AB 3BKMH 4K4KA 4QAIA 2B14A 1U5JA 1EXUB 3CVIL 4OLVH 3DCPA 4AR8A 2E67A 3QM3A 1F9CA 4LNRA 1JUFA 4WI3A 3IXAA 4N1CA 1NDWA 1YPZE 2X10A 2JWYA 1U1JA 1N8OE 7ODCA 4GKNA 5D1QE 2XWXA 1FIEA 1VSCA 1BG1A 4G8TA 5DTFA 1H7WA 5EU6D 3PAJA 2E74C 4CQ9A 5SV3A 4PRID 1G1YA 4DBUA 4Z3GA 2FMOA 3FJ4A 5DA4A 1N0XH 5LZLA 2FZ3A 4D7BA 3GS0A 4HHMA 4RCXA 4Y96A 3CZFB 2FLBT 3GSNB 4G9FD 3NO5A 1D3HA 2PDNA 2MMXA 2P5EA 15C8H 3GSXB 1BMZA 3VABA 5IHRA 4AV5A 4BJLA 2VFHA 1NCHA 3QRGL 3HMWH 1PCWA 4X6CB 3SQOH 5CLZA 3IGFA 4CN1A 1Q45A 2VNCA 5KANG 4NRXA 1UWEH 3DFTA 2DWDB 2FIRT 2YHGA 5DCCA 2WXQA 3F12B 1D2KA 4PJBF 3UPCA 1KCSH 4RFOL 3VVWA 5ITBH 1Q85A 4OZGA 5C0DB 3VD5A 2VMCA 4Y90A 3RX2A 1RFDL 2I07B 1LL6A 4KI1A 4N0UB 4GUOA 3BZFA 4MKVA 3WFHA 4EIUA 2E7FA 4IJCA 3SDXE 1G7JB 2X28A 4NQ1A 2ATAA 1ML0A 3ARFD 4M1CD 1MNUL 3UZVB 3HQ1A 3GHPA 3C09C 3GSWB 3GSUB 5AB0A 2NDGA 1OD9A 2PD9A 3HTWA 3QDMB 3RRQA 3WG7B 2J24A 2QHAA 4D6FA 4BKSC 1OP3K 3FGCB 2A7NA 3H9YA 3VXRA 2FO4B 3CFJA 1S5IH 5FO9B 4LUSB 4WTQA 3PWUA 5EMLA 4DPPA 1ZVSA 4DQOL 2EDKA 3IDGA 1YIXA 4AJWA 1U92A 1W15A 4NQDE 4BFEA 2X2HA 1E6RA 3ULVE 1TSIA 4GG6E 3GH4A 3TTOA 2KPWA 5J6GB 2IFFL 5GJSH 1VFMA 1D2PA 1Z6KA 4KCVA 3CC5A 5IESH 1RQBA 4CMHB 1O6SB 4AYMC 1I60A 4FEZA 4P5KA 2V7HA 5J6HA 2CUIA 3HG1D 3CMFA 4HU3A 1MRCL 4Y67A 4JRFA 3MRLA 2JSFA 4TQIA 3C12A 3FSVA 1C7SA 1R34A 3RASA 4KOBA 2Y6SC 5I9QB 1D8CA 1YE6A 4WHCA 2R4RL 5I7GA 3AMKA 5G1TA 3O8AA 5GZND 3RC8A 3KE0A 4PJIA 5IQNA 3WDHA 1EIBA 1FWJC 3LBMA 3W7DA 1F00I 4QM1A 1MCWM 2G3MA 5DUPL 1NEUA 2P0IA 2EXOA 3QC0A 5K39B 1GEQA 4C58B 2CJUL 2W9MA 3VXSD 2X2JA 1OGSA 3IDJA 3ES6B 3U2ZA 2UXVA 2FATL 2ZOUA 3TN0A 3FJLA 3M7SA 2NUPA 2FVMA 2PWUA 3TW7A 1PS9A 3NZ8A 2PMZA 4HGKC 3HU7A 3G3DA 2DI8A 1RBAA 4XBPB 4L2LA 1TTJA 4NJ9L 4LYRA 2ZOOA 3TBVA 4MJ5A 2X0HA 5AECA 1P1VA 4HK3N 4WW1A 3FQNB 2BMKA 4ZUSB 3VXSA 2PLCA 2QF8A 3L5HA 3WIJA 2XGBA 2BOCA 5IUCA 2X4SB 4AY8A 4W70A 1H60A 1NGWB 5IF0B 4PV8A 3RWHB 1YEGL 1S7WB 3MMEA 1AHWC 4FULA 1GVSA 2EEXA 2OZ3A 1KJVB 4K71C 2QHRL 3R4IA 4LCUB 1NDGB 5A6AA 3B2UD 3ZZSA 1KY6A 4RGMC 1WRFA 1HIZA 1A9BA 1YDPB 2I7OA 1CVSC 1PKLA 3APYA 3QDGB 1OQOA 4I13B 3GNNA 1I8LC 3QQ1A 3MUY1 1Q63A 1DQXA 1NCAL 1KYAA 4UTFA 4P5TB 4WDUA 2C9RA 3UWUA 2BP8A 3QB7C 1RY8A 4RX4D 4JKWA 3VQLA 1HL9A 1N10A 4RRPG 5DVKA 2WAQA 2LLGA 3HBZA 3ZYZA 4N3UA 1UWXH 4ZAKA 5I1KL 2VJ8A 2J1XA 2UZIL 2Z6IA 3RRXA 3STEA 3TW6A 2BM3A 1MCEA 3BJ91 1GGCL 4I3GA 3RF9A 3MSYA 1T5XB 3MGOB 3QCVL 3H24A 1TZAA 4KNSA 5A8MA 1V03A 4H6RA 3WK2A 4ATLA 3GIZH 3IU4H 2H1PL 3PP3H 1UD2A 3GSQB 1V0NA 4DIXA 1FF5A 1BQLL 1JVSA 4WWKB 1KCUH 2ZYRA 1F45A 3RWIA 2QCCA 3BXWA 4OZHE 4EZMA 2XH2A 4JX5A 2VZSA 2I85A 2DYPA 5D7IB 4M48L 2ENSA 4LVAA 4Y2LA 1BQGA 1UC5A 2Z0IA 1NCAH 3V0IA 1Z5LA 4JK0D 3X1GA 5L7XL 4XTDA 1ASPA 1F7BA 4R3SB 3H70A 1EAPB 3HBQA 2XWTB 4JNDA 1BM7A 3LQAC 2NR6A 4Q7BA 4NKIH 2ZP0T 2VC2B 4E41D 2PUZA 2MJWA 1KULA 5F7WC 4Z1CA 4P9HC 4PI0A 3S97C 3WBYA 5HJDA 3XINA 1EEZA 1FCQA 1Z44A 1U8OB 3SCOA 5EBUA 2X05A 3SUWA 1WCQA 4NEHB 4Q52A 1TZGH 3L2MA 1J9CT 1MHPH 1S7XB 1O7AA 3CIXA 4QHRA 4GBXB 3F05A 1IU1A 1WDQA 2F54A 1YMHA 4E0CA 3N40P 4KX7A 3ZIZA 5AAWC 4E9SA 3DX1A 1BQRA 4HZLA 1T8XA 2NTFB 5J4MA 3DA0A 4CC0A 3L5XL 2ZCKH 3FU5A 3ZT6A 4QNWA 1XMEB 3EYOA 3MNDA 4HP5A 4LC8A 1VZGA 2Q8LA 3RN6A 1S7XA 2J8UB 3P93A 1XSJA 3VI2A 2Y06H 4Y2OA 1XIJA 4U1MB 2C16A 5D2WA 3H85A 3NTCL 3EFDH 3MNWB 3UO1H 3UCCA 4ZFQA 1J7VR 3PYCA 4CU7A 1T4KA 3AYTA 3PWLA 1JWUA 3VMOA 3IGLA 1EFZA 2DDXA 3RWHA 2YR1A 1KXTA 4L23A 4G7FA 2X4SA 3VACA 5BZXA 1KCWA 1VLIA 3NDOA 4QBXA 1WT5C 3VKKA 2W94A 3CAFA 1ORQA 4M56A 2HEJA 2CO1A 2X4PB 3N3EA 1E5JA 1MPAH 4M3JA 5BZWA 4IGNA 1FJ1A 1HINH 2FQDA 3BVWA 4GZIA 3W26A 1U8PA 4NM8L 1NIFA 1DORA 3DRTA 1NCTA 2VDMH 4O15A 3SCMB 1L7IH 1YEHL 5E1HB 2QBWA 3QXUA 5CEXA 2G2PA 4WU7B 4H4IA 4OCXH 1F41A 4BRVA 5C55A 4IIFA 1O75A 5FWQA 1FNEB 3UACA 4QF1A 2ZD0A 4ZAKB 4DSYA 1X4YA 2IF7A 4W9TA 3I6RA 1AW1A 1T1WB 2ZF9A 1J0HA 3IV8A 4GQGA 4XMZA 4DYEA 3MCMA 4MJ2A 1FQ9C 3UR7A 4UQ3A 3BLFA 4E4FA 5DCBA 3OZMA 1J05B 3SDXB 4TNFA 2I17A 1LUCA 2FTAA 1TZHB 5BOEA 3KPSB 1KO0A 3DYPA 1W0MA 1R33A 4Q4PA 2FJFA 1UIPA 1L0QA 1U4FA 5I5IA 3ILEA 2QJHA 3R13A 5JOPE 2E59A 5EZLB 5ANMA 4AJ0A 1IIKA 1AR1B 4Y1SA 4HX1B 1KM5A 4ZW5A 1SM9A 2N0KA 4G6KH 3G6DL 3KDNA 2R6OA 2WOYA 3S3GA 2CLLA 3KW7A 2YN3A 4PCSA 1ZLWH 2DWYA 3CVHB 3L3GA 2F6XA 4JTLA 3HMWL 4KX9A 5FF2A 3P3TA 5EF3A 15C8L 4IGSA 4B9JA 1HZHH 4NXSA 5TGBB 2DIJA 5CGMA 1ZNNA 1WA2X 2LHAA 4ATWA 4K2SA 1JN6B 4NIKB 3V16A 2FMNA 1EGVA 2YLLA 1RJQA 3QFJD 4LSSL 3GPSA 4PRPA 1GVYA 2OW7A 2FSDA 1BEXA 1HDMA 3BP5A 4KROD 4PTUB 4QDWA 4FJZA 3RCYA 4WUUB 3CFTA 4BEUA 2OEKA 3VFTA 2E5CA 3EOSA 3R5EA 5A8PA 1CGSH 3V5HA 1MI3A 3NZHH 3LQAH 3IFNH 3TWYA 4ECLA 4NO0A 5B21A 3FDKA 3DSFL 3FRPG 5CGQA 3FT3A 2DI9A 3IS4A 5E03A 5D7JD 4X6EA 4DGWC 3G5YA 4XWGH 5D2VA 4CJ0A 2X0UA 2M1KA 3QPXH 4Q7NA 3ZQWA 1V10A 2HVBA 4KZDH 1AZNA 2NSXA 1EZVY 3US9A 1BG4A 4O58H 3H6AA 3AWOA 2P8MB 2VSMB 3O6MH 3EWUA 1DQDH 3TQPA 3WEZA 3VZXA 5IFPA 1E0TA 2DY2A 2FSEB 3JWNE 3P3YA 2CKBH 3ARYA 3E1ZA 2XZAL 2AV7B 5KUKA 2RKXA 3KOYA 3LZOA 4W1TA 3HPSA 3BLBA 1L9PA 2R1WB 2JFCA 4RA0C 1HJSA 4RX4A 3ABLB 1A3XA 3PWUB 3LQLA 3ESOA 2HKHL 4PJ7B 3QZWA 4HWEH 3OZOA 1YLBB 4GSXA 3PHSA 5BRZA 3FK3A 3IJEB 2GPZA 1FC1A 3MA7A 4OQTL 3CBKB 4NRZB 3X12A 3O7UA 5E4OA 4YSPA 3IAPA 1YJDL 4MQXC 4FD0A 1WS8A 1NARA 1FWEC 4RNRB 1UWGH 3ESMA 4YUEH 4F57H 1B6UA 1OD7A 3KJ6H 1OE1A 4CDGC 1NMAH 1OWWA 1A22B 3NVTA 4EOWH 1RQEA 5C0DA 1EC8A 4OOEA 3L2LA 4JYFA 1JPMA 4TX8A 5EFFA 2J9XA 4UOJA 4OFPA 3GXPA 5I8OH 2B7OA 1DEDA 3PUCA 4LGXA 3CAWA 4PRIA 3LAFA 1ERNA 5EU6A 1SOQA 2WWNA 2KT6A 5C07D 2I9EA 2UV8G 4IZGA 3K6NA 4JQ3A 1BD2A 4GFTB 3PXJA 1ZLVH 3LSCA 4PBGA 1D7FA 5E70A 3G6MA 1UH4A 5CKAA 5J5EA 2Y7EA 3RX7A 2N59A 4N68A 5BNXD 3TJXA 1OQXA 3FB6B 4AF0B 1VFLA 1IBFA 3U6WA 2C3VB 5EOCJ 4AY7A 5AVQB 1PGRB 2YDRA 4OCRH 3HAEG 4JPIA 4JDTH 3V55A 2TRHA 1V05A 4FLRA 3VGAB 1SBSH 2BY1A 1FRGH 3WNOA 1UEYA 2B1AH 2YB1A 5AYXA 4PGBB 4DJMA 4LSVH 1H0DB 5E8NA 1XG3A 3W2JA 4ZK8A 2MNRA 1BRLA 1C5DA 2EH7L 1VLXA 4L5FE 1ZDQA 4OM0H 5EG6C 4D8OA 4UM9B 3QPEA 2B9BA 3IPEA 1ROWA 4PE8A 4FQXA 3GTXA 4NZ1A 1FVDB 2QGEA 5EORL 4JS3A 3PIQB 1F73A 3QUZB 1MCNA 3CPLB 3IKCB 3MGTA 4ZMWA 3DUGA 2REQB 4NWTL 2MPVA 1EVTC 2J6EL 1XLJA 2PCPB 3U3HA 3ISYA 1DDTA 1NBZA 2O9TA 4TUJB 5FUZH 3HA0A 3IEAA 4WW2A 4OWGA 3L16A 4U3CA 2J6VA 1YDOA 1ZT7B 3NQ7A 2K3TA 3H2OA 1OCOB 3VNIA 3F6LA 3NJIA 1LJMA 3BW3A 4GXUM 3S6DA 4EXBA 2VDOB 4N5ED 4HNTA 2XQBL 1XS2A 4MNHB 5EF1A 5E0KA 2HT2D 4IBLT 2ZE0A 1WBZB 3EPNA 3W82A 3HR5A 3OXRB 3FOLA 3GXNA 4L4VB 4G7VH 4P3CH 4ZMVA 5CLYA 2H3NA 3UT0A 5L0QB 3BQUD 2WHJA 3UJSA 1KFWA 2EDOA 4M62L 1KCLA 4O8AA 3VI3F 2ZYHA 3P69A 5MERA 4X5RA 1OSPL 2R70A 3AQDA 5E5UB 3SAZA 2H3BA 3L4YA 4J35A 3TO4A 4UXDA 2EDXA 5GZNC 3NL5A 3SDDB 1HKKA 4GFIA 1L6GA 2HFTA 2D0HA 3S34H 1ZPLA 4XCCL 2PN5A 3FLUA 4US5D 3U30C 2R1LA 1UVQB 2YD9A 2ZZ5A 1QG3A 4MMYA 1NPNA 5K1NA 4GW1B 3S9DB 4XPBL 1IBHA 1S2AA 2D3JA 3K30A 4YDLC 4ANXA 1O94A 2UWFA 5HNRA 3PL6C 3H55A 2JKTM 3HS9A 4WI6A 4RFEA 5B3JE 4HALA 1U91B 4A7GA 1YHPA 4N1EA 4OLUH 2OMYB 4ACTA 3PDOB 2OR2A 2UY2A 5FA3B 1G7IA 4KRPB 1SFHA 2OM5A 1F6PA 4PZVA 4S3KA 3MNVA 3NIDB 5KJ4A 5I1GL 1CDHA 1QSED 2BXZA 2J7EA 3RO6A 4B15A 3JVGC 4MD5B 4WHDA 4IMCA 2X4OB 2OXHB 4GXFA 3ZHNA 4N2DA 2FZ8A 5LHEA 3FFCD 2FD6H 3KLLA 3A67H 3PDOA 4LRIA 1T40A 1WKFA 2D7QA 1IC5L 5BQ7B 4F1SA 4HN4A 2R2HB 2L8AA 5TD4A 3QXTA 3KPNB 2QFRA 5D7IE 3UDWC 4W8BA 4UUJB 3ZE0F 2R51A 4OKDA 5BUAA 2FGBA 1I1YB 2EDNA 3P4OB 2PZ0A 2GI0A 1WKYA 2BK8A 2LW3A 2Z2BA 4XI5C 4Y5VC 1AGDB 2VZTA 1PZAA 4XPAH 4W7WA 4YWGH 4ALAC 2H7WA 3FQ1A 4L8SB 1G9MC 2Q2LA 5FI8A 5HNNA 4JAMA 4FS0A 3OZ9L 4YSOA 5B1JA 4AYEC 4YHML 5T1JA 2D23A 3C56A 4P2AA 5FHBH 4L8CB 1A7BA 2MCMA 3O4LB 1BFOB 3ZK0A 1A7NH 4FFWD 5HGBA 3FT9A 1PTAA 3O8XB 3V4PB 3ZHXA 2VKXA 3C0JA 4JHMA 1AZ2A 3LTYA 4IUGA 3NPXA 3W7IA 1CK0H 5AOJA 2DUZA 1CL7H 1JHLL 3F84A 3RVTD 2DAVA 3W2MA 2WXIA 32C2B 4WSGA 4YEFA 1X1OA 1YEWA 4QWWC 2PABA 4TX6A 5AVXB 2CM6A 2Z1PA 3CDCA 5HGHB 2AXWA 2CO3A 4UV7H 1DFBL 2J8GA 2YXXA 1C8QA 3B2VH 3WYRA 3FQRA 3QXAB 2WINA 4YC2C 4YR6A 4QYAA 4BDVB 5I1CH 4A2GA 5IQMA 2GFBA 4GYFA 3MJ9H 3C87A 3UXKA 5C0AB 3MNVB 4U4IA 1JCNA 3FC8A 4PTNA 3PP4L 2B7QA 3VUPA 2OLAA 5M95B 3K6SB 3NP4A 1S2CA 3Q6GH 5D7KE 3S3JA 4AYDC 1FRBA 3V0HA 1FJ1B 1PKNA 4IMDA 4B96A 3K8MA 2W61A 3LKOB 4LEQA 3R58A 1RIUH 2P7TA 4UV4L 5A43C 2YPIA 3FAWA 4HCFA 1HFBA 4K5OA 3W76A 4HIHA 4F7MB 5A6LA 4P2CG 4PUBL 3MBEC 5KZCD 5GNXA 2ADGA 3LMZA 4YTUA 1Q6GA 1A1NA 1QI5A 4UTIA 5D7LA 4DO7A 3QPZA 1FVEA 3W07A 1PZUB 3ZR4A 3W1MA 2Z25A 2VEKA 4G8EB 1W3HA 3ECVA 1B9BA 1MFDL 1K5HA 1MEHA 2BV9A 3PP4H 4WY0B 3V5CA 1NDTA 4BWUA 4XVTL 5C0BD 3QTGA 5MF5A 2NY6C 4G1MA 3KWXA 4OLYH 1US3A 4JY8A 1FG2A 2R0WL 4DP1X 3UBXI 4O2EB 1MQKL 5CR1A 3B2VL 2BS9A 2J71A 1N8WA 1TV5A 4HZLB 4KFMA 3KYKL 4RIRA 1K85A 1QA9A 2Z1XA 2E9BA 1K5NA 5EIIG 3L5AA 3HNTL 5ECUA 1USQA 2EDRA 1AP2B 4IYKA 4Q6KA 1KQYA 1NIDA 3CXDH 1I2RA 1RZJC 2VQ1A 1V54B 3DX8A 4XVOA 2P88A 1EOKA 2GJ6E 4ZS7L 3KS0H 3RFZC 1ZEAH 2FQFA 3C2EA 1KXHA 3AXLB 2FWSA 2B16A 2YEZB 1AFVL 4W9EC 1QJWA 1DZ0A 3W11C 3WNJA 3MRBA 4EKXA 2GWNA 2F38A 1S6NA 1UPPA 4YNGA 4HPYL 3QIUC 3RHWK 3TT1H 4POZC 3M1BA 1YZZA 4G6FB 3FU0A 1ITUA 3WNNA 2W65B 1M6JA 1RZMA 1YTKA 4OOUA 3MA7B 1ISYA 1QDSA 3VIIA 3DIFB 1U21A 4JHBA 4KUCD 4U2ZA 1J9TA 2ATKB 5F9DC 1G4PA 3R0UA 2DQHH 1ED3A 2F1EA 3BCFA 4D9RD 4JGDA 4LVEA 1PS3A 1N26A 5J12B 1EV2E 4FXTA 4HPJA 5TFSL 2Q7YA 5C7XL 5CC6A 4FXRA 4WI0B 1BFVH 4G8AC 3O9NA 1PZ3A 3FQ4A 1MFMA 4OFYD 3U4BH 3FKKA 4LUTA 5DCEA 5JIWA 1AZVA 3UZQB 1G9NC 1VEMA 1YDNA 1VPOH 2WN3A 1MIMH 5EMUA 5KS9B 2UXFA