2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
3CZEA 3LPFA 2WMHA 2X2YA 2UY5A 1SFSA 1T1RA 3GXDA 2X2IA 1XD1A 3L4UA 3VINA 5JUVA 4P7NA 4A03A 3UESA 2XSAA 1M03A 2DT0A 2IXVA 1MXGA 3VIIA 3WUEA 4AC1X 3WMSA 2OYLA 3K8KA 3OA5A 1QNOA 3ZHYA 2Y1DA 3WQRA 3CUJA 4TXEA 9CGTA 3W29A 2B31A 4PUEA 3L2LA 4LYRA 3DX1A 1W9VA 3SCPA 5E6ZA 1V0KA 5JBIA 3VDCA 4JAWA 5D8WA 3WQ4A 1TZ7A 1XH0A 3PTQA 3BH4A 2UY4A 1CLXA 1W3LA 3LPPA 5HOSA 4WF7A 1UKOA 2VX5A 1UR1A 1GUVA 1H3GA 3DX2A 1AMYA 3RM9A 3PZVA 1R8LA 2ZWZA 3CHFA 4HA1A 2D1ZA 2YLAA 3VILA 2VR4A 1J0IA 3D3AA 4PMNA 4RL3A 3T09A 3VGDA 2WW5A 3EJPA 4ATWA 1FOBA 4U2ZA 4HMDA 3CMGA 4Z2GA 1WP6A 1ITCA 1XHGA 2J7DA 3MV11 4OGZA 1VFUA 1GHSA 1HKKA 3EDJA 4P7OA 4Q7NA 3M46A 3ANMA 1H0GA 3GNPA 1VEMA 1ISWA 3W4RA 5A2BA 1SMAA 3EJQA 2WC4A 4GINA 3F5KA 3EBVA 3RASA 1F4HA 2X1IA 3CV5A 2VCAA 4PMOA 1EQCA 1B0IA 4OBSA 4UOJA 1BVZA 4FNUA 1XH2A 1JFHA 2NT1A 4DWSD 3WQQA 1UA7A 3GXTA 1XCWA 1TUXA 1QI2A 2YL8A 2DSVA 4NRSA 1W3KA 2VZVA 1UQZA 1ZJAA 3BCFA 4ZN6A 3IAQA 1Q6DA 1TCMA 2J78A 4MTVA 5M3WA 2ZUSA 4B9YA 5HBFA 1LWJA 1GQKA 1US2A 1EA9C 2NT0A 1JF6A 1H3LA 3UERA 1PX4A 3VGEA 3R0IA 4Y7EA 2BHYA 1WAWA 2CHOA 1IZKA 2YJQA 1BYCA 3B8SA 1UKSA 2PC8A 3PHAA 4W8BA 1HL8A 3G6LA 2YLLA 3B9AA 3CZJA 1BAGA 4MJ2A 2YFNA 1E3XA 4A4AA 4W88A 4W8LA 3TP4A 3K8MA 3AS2A 4IPNB 1KTBA 4AZCA 2OSXA 4LX4A 1B31A 3WQWA 3OB8A 3U57A 5EB8A 4NX0A 3VIJA 4Z2KA 3T0DA 2JF6A 1RD6A 3WNMA 2XSBA 4PTVA 3WDQA 5CZKA 5A1AA 1QHPA 4LGXA 2W4XA 3OLIA 3L2MA 1J10A 1H49A 3RDKA 3IJ7A 4MAVA 1GJWA 1CWYA 2WLYA 2WBKA 1OGSA 3MANA 4DUXA 1Z32X 1JZ4A 5AY7A 1V0MA 4UFJA 3VNYA 4AICA 4LYQA 3VX0A 2MANA 3HN3A 4UOZA 1KBKA 2EPKX 3GH4A 5A6BA 5JBDA 1UD6A 1HIZA 2ZOXA 3AZSA 5JMWA 1IV8A 5CGMA 5JBFA 2JALA 3W25A 4W84A 3ZR6A 2Y8VA 1F4AA 4CGTA 1ZJBA 3IAPA 2XFFA 4Z2LA 4PMVA 1MQQA 4BZYA 3H53A 4AW7A 3WEOA 1OIMA 4DWSB 3EDEA 4LQ1A 1K9TA 1BG4A 1H41A 3PZQA 3VD9A 1S46A 1V3LA 3BMVA 1W1YA 1WCGA 2WVUA 1E5NA 2JEPA 3N1AA 1D3CA 1WE5A 2O9OA 4Q22A 1Q6GA 2BVDA 1LL7A 4JFUA 5FL1A 3L4WA 4GQQA 2J77A 2QPSA 4U3AA 3EJRA 1WPCA 3I3DA 1M53A 3AS0A 3OZPA 2MAOA 3ARSA 4CN6A 3WF2A 4CD5A 2WXDM 4PMZA 2BV9A 1CLVA 2YDQA 1TFVA 2PBOA 3D4ZA 4M1RA 1QOXA 3WENA 1KCKA 3T08A 4UZSA 4EE9A 2XGBA 2D20A 1ZB5A 3APGA 3RJYA 1B30A 4QLKA 1R87A 2YOCA 4HA4A 2JCYA 1HKJA 3VD3A 4U2YA 3ARWA 1I75A 3WN6A 1QBBA 1XC6A 3CUIA 1VBUA 1E1FA 1ODUA 1GQLA 2PWEA 3ZMRA 3WBEA 5A6JA 3T0BA 5E70A 5I2UA 3U5UA 1E73M 4W7WA 1AQMA 3A21A 2EPOA 3AS1A 2V5CA 1MFVA 1FH9A 3WD4A 3H54A 2A3AA 1PAMA 4AZGA 1UD3A 1UWTA 1GQJA 3AHVA 3L4TA 1W2PA 2GDUA 2JFEX 1G9HA 4Y6PA 3OLGA 4BS0A 1NM9A 3AZTA 3BVXA 1E71M 4RE2A 5DF0A 4J3WA 1K6AA 1UKQA 1CEOA 1CENA 2XVNA 1ZBVA 3W53A 4DO4A 1MVYA 4S3JA 5JIWA 4AD2A 5CPSA 3IJ8A 5TD4A 5I3DA 3WF3A 1EDQA 1W91A 2VUYA 4W5UA 4E2OA 4ZENA 3VD7A 1TG7A 4W8AA 5LA0A 4RCVA 1K9DA 2G8ZA 3B9EA 1KGWA 5FOOA 4MB3A 3O6AA 3VMOA 1PS3A 3BVTA 4D6GA 4H8VA 3AIQA 3QGVA 4HP5A 3ZSTA 1CZ1A 2WMIA 3WNOA 3WF4A 1R7OA 3BCDA 3AXHA 3WUBA 2G3MA 2ZUWA 2EAEA 2W66A 4W93A 2J47A 4XX6A 1W9UA 1JIBA 4B9ZA 4MB4A 4MDOA 3SURA 2Y5EA 1V02E 3CZLA 3N18A 4WSKA 3OLDA 1XD0A 2DDXA 1UR2A 3ANLA 1VFMA 3CUFA 2IUZA 3BVUA 2WKGA 5CGTA 5A2CA 3WQ6A 2WC7A 4W5ZA 2F2HA 4IPLA 4AD0A 2VX7A 1QNPA 1KQZA 2QV4A 2CBJA 1V03A 2A3BA 1EDTA 1R34A 4AISA 4AMCA 2JD1A 2ZUMA 3FHAA 4KGLA 1B2YA 1OGBA 2XVKA 4M29A 3BMWA 4HOXA 1W9XA 2ZX5A 3KL5A 2OW6A 2XWEA 4FLSA 1VF8A 4ZXLA 1HJVA 1WDSA 3CZSA 3MI6A 2F18A 3BSGA 4CKQA 4NF7A 3W26A 5DULA 5JMPA 4HPGA 3E1F1 2E4TA 3QR3A 2ZUTA 2HVMA 3ALGA 3ZT7A 3S6TA 1W3JA 2JEQA 4AMWA 2J25A 4PMQA 1UD5A 1QI4A 4MPKA 1CPUA 2EADA 2DEPA 2DPEA 3QOKA 1B3YA 1BPLB 5M5DA 3AU8A 3DHUA 1SMDA 1Q6EA 4UR9A 1MW1A 3CHEA 4JKKA 4YN5A 3UEQA 3A4WA 5GNZA 3QHNA 1ITXA 2F7QA 2XVPA 1BGAA 2YDRA 5C70A 4PSPA 2WCAA 2XG9A 3AHXA 4CVUA 2OYMA 2YA2A 3AFBA 2YIHA 4AZHA 3RJXA 3ANNA 1E72M 1WDPA 4OZOA 5M03A 1DHKA 3LPGA 3PZIA 2XIBA 3UR7A 1DWJM 1V6VA 3OGRA 4GO8A 4E8CA 3SCTA 3W6LA 2X09A 4J27A 5CG0A 4NZFA 3UG5A 3MS8A 2ZX8A 5JC1A 3DECA 1HWWA 1Q6CA 1VENA 3LRLA 1E6NA 1XSIA 5ECUA 3VKKA 3ZO9A 3W0KA 1J0KA 3VSVA 2VO5A 1CXKA 3AIUA 2Z1KA 1HKIA 5C71A 3ZJ8A 2J7CA 3LX9A 4PEEA 2F8QA 4R5EA 4B3KA 1UWSA 2E8ZA 3WIJA 2GK1A 3WH7A 2J7GA 2Z1SA 2E9MA 2QMKA 1E15A 1W9BM 4LPCA 5CPTA 3ARYA 1HP5A 2XVGA 4CD7A 3FXYA 2J7BA 1H11A 4F8XA 3WL1A 2EEXA 3GBEA 2WCSA 3GXFA 1G1YA 3A24A 3S5YA 1W1PA 4AEEA 4PMDA 2FH6A 2YL9A 2BY2A 3THDA 1CXEA 1J01A 1D2KA 3NCOA 2WVVB 5A8OA 2VQUA 4WJXA 2O9RA 4PMRA 4UQDA 3EDFA 2NSXA 1YHTA 3GXMA 4NQWA 2GUYA 2GJPA 2WHLA 3GM8A 1B3ZA 4H04A 4MAZA 3WDIA 1C8QA 3ZHXA 5I0DA 1EHNA 3N13A 4D6HA 2OW7A 1R85A 3A6OA 4J3SA 1V6WA 1KWGA 4HZ6A 3BGAA 4Z2IA 1KXVA 5ABGA 2VZOA 4PRWA 2YL5A 5GQBA 3RILA 1A47A 3ARQA 1KGXA 1JAKA 2GDVA 1B3WA 4GO9A 4J28A 3NSMA 1JYWA 1UOKA 1KR1A 4JFTA 4OIFA 3BXWA 4YHEA 5A69A 3TV8A 1J0ZA 2WKLA 3RCNA 1R33A 3AMGA 2D73A 4PMUA 4RE3A 1E6RA 2Y1GA 1JXJA 2X0HA 2QHAA 1QWUA 1PBGA 3I3EA 4JFSA 4GZJA 1KXQA 4FNSA 3NSXA 4ACZA 1C7TA 2CKRA 4JCLA 2CITA 3CPUA 2XN0A 1H2JA 3PZ9A 3A06A 1V6YA 1TR1A 2J8FA 1DWIM 1AQ0A 1WB0A 4JKLA 3W37A 3WMCA 4A3YA 4UQBA 1FP9A 2W63A 4JIEA 1UWQA 4B16A 2V3DA 5BXPA 2D0HA 3HG5A 3POCA 1BTCA 5IXEA 2ZXBA 4QLJA 4DWSC 1CBGA 2BVYA 3OIHA 1UD8A 3WNNA 1JXKA 1WDQA 3WD0A 5DFAA 1LJYA 4J3VA 2F7OA 3WEMA 4B15A 3IK2A 1OCQA 3VGGA 5D8ZA 1NP0A 4C7FA 4TTUA 4IUGA 5FIPA 1BLIA 5HDRA 1HX0A 2WAGA 5IHSA 1HF6A 3VM7A 4D6DA 1HNYA 3CTTA 1KGUA 4FLOA 3BUQA 1HL9A 4NXKA 3HZ3A 4OJYA 3EYPA 5I6SA 1XH1A 2OLHA 5A6BD 4BF7A 1CGVA 4EKJA 5DO8A 3QHOA 4HZ7A 4D6CA 4UTFA 2PB1A 4N42A 2VZTA 4UFHA 1W9DM 2FDMA 8A3HA 1GCYA 4RE4A 3BAXA 3WEZA 1MYRA 3S2CA 2ZWYA 1U2YA 3FHQA 1NWSA 3SCUA 2BVTA 1UA3A 3PZOA 1CECA 4AZ7A 2D0GA 2WWCA 1EOKA 1UD2A 3OLEA 3A47A 1SZNA 4OOUA 3D51A 4HTYA 2WBGA 3SUUA 3GXNA 4HA3A 1E55A 1KXHA 3GXPA 1E4IA 2AOSA 1J11A 4KP7A 3OGSA 2WVSA 4H7VA 1JYNA 5E9AA 1JD9A 1UH2A 2E40A 1PEZA 2Y1FA 3WELA 1UZ1A 1V02A 3UG4A 5A6MA 1GHRA 1UR0A 2ALWA 2DH3A 4AZCB 2D3NA 3GYCA 5DT7A 2Y24A 3VMNA 1K9FA 2WANA 1WNOA 2E8YA 5FKYA 1W2VA 4V28A 1KB3A 3BVWA 5A8QA 1C3FA 2D22A 3BAKA 1JI1A 1JVSA 2CBVA 5DT5A 3GH7A 2O9TA 5IHRA 2CBUA 3K4AA 3HG4A 4NSBA 3VSUA 3ZJ7A 1LF1A 3T0AA 3WY2A 1TQSA 1E6SM 1FA2A 3VDBA 3GH5A 3FNDA 3POHA 3SUTA 4PN2A 1CNVA 5D9PA 2VMFA 3BAIA 4CD8A 5A6AA 1V3HA 5LA1A 3EJUA 3AYSA 3H55A 1DWGM 4UFMA 4P8WA 3ZHZA 2GJXA 1C7SA 2ZIDA 1VRXA 1WZKA 2VVSA 3CMJA 4J3UA 3MUIA 1EOMA 1XSKA 2EPLX 2OSWA 4ATLA 3U5YA 3ALFA 3SIMA 3WSUA 1ZBKA 1VEPA 5DMYA 4Z2JA 1E43A 4NZJA 4TX6A 4BQ2A 1E56A 4Y6RA 2ESCA 3LXBA 4MB5A 3D5HA 3SCOA 4ZQEA 4X0NA 1XCXA 3MUY1 3VUPA 1WZAA 4JCMA 2BXYA 1OGGA 4TVDA 4PMXA 3WH8A 3HG3A 3N17A 2YBTA 4M81A 3W28A 1HJXA 1CGUA 3AIBA 3AU9A 5D9MA 1FHDA 3WDRA 2EO7A 2VC9A 3TTQA 5LA2A 5FL0A 3DX4A 4KMQA 2QPUA 3W82A 4P8VA 1E9LA 3O9NA 4MJ4A 2DSUA 1MXDA 1RP8A 1E70M 1VJSA 2JD2A 2ZXQA 1HJWA 1TQUA 2VTFA 3BUIA 3FAWA 5HPOA 1KQYA 1HVXA 1DWFM 4NI3A 4MDPA 1R47A 4LYPA 2OWXA 2XWDA 3HG2A 1PJ9A 4AZIA 4GZIA 3ZIZA 4PTWA 3F5LA 3DDFA 3SCWA 3WD2A 1QW9A 1U30A 2QLYA 3CH9A 4TTGA 3EDKA 1B90A 1ISVA 5GPRA 4PCSA 2ZX6A 3FW6A 1G01A 3SCNA 5GNXA 1UD4A 1OT2A 5HXMA 1DWHM 1XRVA 3ZR5A 4AIOA 2VI0A 5E6YA 1C8YA 4HZ8A 1ECEA 1H09A 4OOEA 2WMGA 2PWDA 4J7RA 1HKMA 1UQYA 1ONOA 4DUVA 1FP8A 3BVVA 2VR5A 2VT0A 4QDMA 4M82A 1BVNP 3MMUA 3NSNA 2W61A 1MFUA 4CN1A 3G6MA 1G5AA 1EHAA 2BHUA 1E4NA 1O7AA 1QHOA 1VFOA 4P8XA 3N12A 2V5DA 4UQEA 2JD0A 2WC3A 1VBRA 3PTMA 3S5ZA 3EMZA 1TVPA 1E0XA 4M8UA 3PBGA 2RGLA 2E0PA 3L4VA 4L4PA 4CU8A 5CJ5A 3VGFA 4AD3A 3A5VA 2WMIB 3VIOA 4K68A 1L0PA 2ZX9A 2D0FA 2D3LA 3VNZA 3PZMA 1LQ0A 1ONNA 1OD0A 3ARUA 4XUYA 3MMDA 4AEFA 1HJQA 1E5JA 4ZEPA 3J7HA 2GJRA 4D1JA 1M7XA 2EABA 2XJ7A 4ACYA 3RO8A 2VQTA 3L4YA 2NW0A 1QWNA 1J0YA 5HNNA 1ZBCA 2RGMA 1DEDA 1WZLA 2A3CA 1V3IA 2XM1A 1CXHA 1X6LA 1NP2A 4XB3A 3CZKA 3T2OA 4X0VA 3N11A 4ZXOA 3VVGA 3CUHA 2YBUA 1W1VA 1CXFA 1HP4A 1UWRA 1KR0A 3VGHA 3EJSA 2DSWA 1UHVA 4CD6A 4D6IA 1GNXA 5CLTA 4W7UA 4PYSA 1B3VA 3NJ3A 2AAAA 1C91A 1GOIA 1V0LA 1EGZA 4YHGA 4GKLA 1GOQA 2J7EA 2W62A 5A8PA 2VRKA 3DC0A 1R86A 1XGZA 4C7GA 1OM0A 2BNJA 4BQ5A 1QI0A 3PZGA 5CSYA 1MW0A 3LRMA 1R75A 5BXRA 5ABFA 4JL1A 2Y2WA 3IIEA 3ECQA 3M6DA 1TA3B 2WHKA 3IGUA 2O7GA 2EACA 4D1IA 3LPOA 4W7VA 3WQVA 3DYOA 3CHCA 4U3CA 1J0JA 3WY4A 1CXIA 1OINA 1FFRA 1CDGA 2ZXDA 3UG3A 2FGZA 3SUVA 1OIFA 2ZUNA 2X2HA 1H1NA 3VIFA 1UZ4A 5A95A 1VB9A 1US3A 3WBAA 3W81A 3AMLA 4CCCA 3AIEA 1DWAM 5D4YA 3WKZA 1BQCA 1OR7A 2WMFA 3WD3A 4GQRA 2PBGA 3ARXA 1ODZA 2FE0A 1GZJA 4F79A 5A6SA 1RH9A 1WZMA 3WH5A 3MUAA 2CETA 5BXTA 1Y7VA 3RIKA 2XIIA 7CGTA 2E3ZA 2IXUA 2DT1A 4AYSA 3LXCA 1MW3A 4JHZA 1E6XM 2CCRA 4FF5A 3CLWA 3MSDA 1TVNA 4D71A 2E9LA 2FYVA 2VZUA 1B3XA 4CCEA 1P6WA 1SYTA 3AHZA 4CN4A 2WVTA 3OG2A 4CUCA 3PZNA 4PBGA 2JE8A 2WCGA 1E6QM 3NDZA 3T0YA 3W38A 1ONPA 1QW8A 2E9BA 1DP0A 3A23A 3WFLA 4KRTA 4MNJA 2CXGA 1BGGA 1EH9A 2WK2A 2GK1B 1TQWA 3VIPA 1UASA 4QCFA 3K1DA 2FHBA 5F7UA 2XGIA 3WDPP 3CUGA 4KWUA 4MB1A 1XYFA 3EJTA 1QNSA 2D24A 2XFRA 3BUPA 4U5IA 1OWQA 5AYIA 2CYGA 1JNEA 3T2PA 3ZJKA 4U5KA 2WZEA 4ZFMA 3L4XA 3WF0A 3AMKA 5IFTA 4FNRA 1Q4NX 3A22A 3U7VA 5E0FA 2WMKA 4JZ5A 3TTOA 4LUPA 2YA0A 6A3HA 1UWUA 3WNKA 3IANA 1V0NA 1T1SA 3KWXA 4TX8A 3VDAA 2WVVA 3TONA 5I79A 1JZ2A 2J4GA 4HMCA 2VCBA 4E8DA 1GOWA 3PTKA 4AXNA 5A6KA 1U33A 1PX8A 5A2AA 2G3JA 1V3MA 3ARVA 3QOMA 7TAAA 1VAHA 3UR8A 1MQPA 1MQRA 5AC4A 4V2XA 3OBAA 1J12A 2F7PA 2C8NA 5M17A 1GORA 1UH4A 4DO6A 1O6IA 1ZBWA 2BY1A 5IFPA 2GSJA 3AROA 2YKKA 1KXTA 1M04A 4IISA 5E0CA 2JIWA 2WNWA 2EGHA 4JL2A 1CGTA 2FHFA 3SCVA 4AZ5A 4GI6A 4PUDA 1CXLA 4CVWA 2VURA 3N04A 3D50A 4PTMA 2J75A 1Q0HA 4H8UA 1V08A 1E4MM 3AIVA 2CESA 4OOZA 4BCEA 3SEPA 4P8UA 1LG2A 3CC1A 3A14A 1WKYA 1HN1A 4UQCA 2JF7A 3VD4A 3PZUA 2F7RA 1ISXA 4AZ6A 1OBAA 2ZE0A 2OSYA 4EAMA 1IT0A 3GNRA 2X05A 5GNYA 3UCQA 2V3EA 1E0WA 1R0KA 3BAJA 3ZT5A 4M80A 1JL8A 1X6NA 4GZEA 1FHLA 4NRRA 3D4YA 4AZBA 1CYGA 1O7DC 1CTNA 2VVNA 3EMCA 1E3ZA 3KLLA 5JBEA 2G3NA 3WQ5A 1NOUA 3TTSA 2GFTA 1MWOA 1EIBA 3VTRA 1ZS2A 2EQDA 1DTUA 1JFXA 3BSHA 2DIJA 3VIMA 4D6FA 3N9KA 3MUZ1 1KWKA 1JAEA 2VX4A 1E0VA 1OT1A 3BAWA 1CGWA 3LMYA 1QI3A 1VJZA 3BLPX 2C82A 1UUQA 3AXXA 1AQHA 3AISA 2YA1A 3VGBA 2XM2A 5D9OA 2UY2A 3WQSB 1Q6FA 3VX1A 3VU2A 3ZSSA 4BQ3A 1ZL1A 2BS9A 1QPKA 4UZUA 3VM5A 3EMQA 4AIUA 4WKHA 4GI8A 3ZI0A 1V6UA 4UFLA 2BXZA 3OGVA 5A3HA 4UQ9A 4PTXA 1C8XA 1R46A 3WF1A 4CU7A 2UWFA 3DYPA 3A4AA 2TAAA 1VFFA 1W32A 2CERA 2CHNA 2AMGA 1PIFA 4D6EA 1Q0LA 1HXJA 1E40A 1I1WA 2ZXAA 5E1QA 1E1EA 5D9NA 2XFYA 1JDAA 1V3KA 2D23A 4DM2A 1G94A 2YL6A 2EBNA 1HJSA 4UNIA 2WMJA 3OZOA 3LXAA 4HOWA 4ZE5A 4F66A 1BFNA 1JDCA 4TVCA 4FLRA 2WZHA 4U31A 4ML4A 4HOZA 2C0HA 3DHPA 3NUKA 4CU6A 3HMCA 4JHOA 3WFZA 1XYZA 3WNLA 1JYVA 3HJEA 3CGTA 2PWFA 4TUFA 4AD1A 4QLLA 1HVQA 5ABEA 3GNOA 1C90A 5BYWA 2X8RA 1UWIA 3QHMA 3WY3A 5BROA 2ZICA 3TTYA 3GBDA 4UFIA 4WK9A 5E09A 3KL0A 1BYBA 1QI5A 1XV8A 2JCXA 1VEOA 3AOFA 1KCLA 1J9YA 3FN9A 3GTNA 1J0HA 2EPNA 2A3EA 4WLCA 1LLOA 3WMBA 1R7AA 6TAAA 4FMVA 5CXPA 2OWCA 4AWEA 2XPKA 2BY3A 2GJXB 2WHJA 2GVYA 4AIEA 2W5FA 3ARTA 3D52A 2J62A 4FNQA 4EK7A 1NARA 5EBAA 5CQ1A 2VRJA 4FNTA 1Q0QA 2XN2A 4H2CA 2OYKA 5BCAA 5I77A 1KBBA 4XV0A 1PX3A 4QP0A 4AY1A 4H8HA 4HPHA 1JZ5A 5IDIA 4DWSA 5JO0A 4AD4A 1B9ZA 1BG9A 2A3HA 4QAWA 2DT2A 5ABHA 1ISZA 1T0OA 2J7HA 1GONA 3W24A 1JD7A 1PIGA 2ZUUA 4UFKA 2QF8A 1TQTA 3ARZA 4CD4A 3DYMA 5BRPA 3K8LA 1V6XA 1JZ7A 3A3HA 3PZTA 4HMEA 1JI2A 3VOCA 2Y1CA 1W3HA 3CIVA 4WIWA 1JG9A 2HISA 1E4LA 3AS3A 3F5JA 2VNCA 3II1A 4LXFA 4DM1A 1GPFA 2V38A 4W86A 4S3KA 5KZ6A 5JAZA 4M24A 1HJUA 1JYXA 2DSKA 5CLWA 1EDGA 1NWRA 5DEZA 4OOFA 3ARPA 4F9JA 4HU8A 2FH8A 3MKKA 1N82A 4J3TA 1L8NA 3WD1A 3UETA 4P7RA 1SC5A 2QMJA 2DT3A 4KGJA 4L4OA 1BYDA 1OD8A 1G0CA 4MNMA 4TVUA 4CCDA 4BQ4A 3TA9A 2ZUVA 4GI9A 2DSZA 3WQ8A 4UOQA 1KTCA 1NWUA 2X0YA 1SR0A 2CKSA 3FY1A 3T2QA 2J8GA 3WH6A 4Y6SA 2WLZA 5BXSA 2YDSA 3ZJ6A 4ZQHA 3SCRA 2G41A 3ZT6A 4P7QA 3BUBA 3VSTA 2Y4SA 3AZRA 3AIRA 4GAEA 1UKPA 1FH8A 4CXFA 4B3LA 1LWHA 5AYBA 4E4PA 3VIGA 1X1NA 2FGLA 3HU7A 2DIEA 5I5RA 2XUCA 4XZWA 2V3GA 4PMYA 3SUWA 3M07A 1NQ6A 1BSIA 1PZ3A 3AMDA 2PF0A 1JZ8A 2CBIA 5A94A 5CSUA 1MW2A 3GDBA 2Q8XA 1TE1A 1ZU8A 4FLQA 1C93A 4X9YA 5HPCA 2WSPA 3GZAA 4HU0A 4C7DA 1E6PA 4URIA 5EFFA 2BFGA 1EO5A 3GXIA 4GIAA 5AC5A 3DDGA 4AD5A 1GOKA 1GVIA 4PSRA 3WUFA 3PN8A 1M01A 2CPUA 3WH9A 2WWDA 1R0LA 4J3XA 2DGAA 1NH6A 4N0RA 1GQIA 4PCTA 2WPGA 3MU7A 5JIPA 1LL4A 3A4XA 1B1YA 3AHTA 2XVLA 3WY1A 3SUSA 4A3HA 3VIHA 1KFWA 3LRKA 1H5VA 1C92A 1UH3A 3U7BA 5CPQA 2VOTA 3WUGA 3RM8A 2EXOA 3KE0A 3N15A 2VZSA 5I23A 1E6ZA 3BC9A 4W87A 4UQAA 3DX3A 3EDDA 1WDRA 3JUGA 3THCA 6CGTA 1OB0A 3NDYA 3IJ9A 4XZBA 2CEQA 3SCSA 1JZ3A 3BUDA 2PI6A 3AHYA 2X2JA 3I3BA 2JIEA 2CNCA 2D2OA 1GOMA 4ZQFA 4OBRA 1IZJA 2YFOA 2OWWA 1TMQA 4DUWA 4YPJA 3VPLA 5ABFB 2XTKA 4UCFA 2UY3A 4AYGA 4JFWA 4W85A 4U33A 1UYQA 4ATDA 1OSEA 2O9PA 1GW1A 4FK9A 4JFVA 1YQ2A 1H4PA 3BLKA 4OKDA 4D72A 3BAYA 2W67A 1TA3A 1I1XA 1BHGA 3M7SA 3WL0A 1UR4A 3F4VA 3KEHA 3KL3A 2C7FA 3NYDA 3VO0A 2F1BA 1QBAA 4ZE4A 1ESWA 8CGTA 4MNLA 3RM4A 3ZOAA 2JCVA 1JNDA 4W89A 3WDHA 3RMEA 1K5HA 1JF5A 1NOWA 3AMCA 4GPNA 5BWFA 3CZGA 1CGYA 1GJUA 4BA0A 1UG6A 3MSGA 4D6JA 5LYRA 1QX1A 2J79A 1VIWA 3NIYA 1PPIA 2BHZA 1CGXA 5FD0A 1QNRA 1W9PA 1NWTA 1CIUA 2WZIA 1JZ6A 4FNPA 2PWGA 4ZQGA 3CHDA 2O92A 2VRQA 3ZM8A 1XSJA 5A6LA 2BY0A 3RPMA 4IM4A 3VD5A 1QHZA 1UR8A 3AI0A 3SCQA 1EO7A 5JNLA 2VL4A 1PZ2A 1D7FA 2W91A 3K4DA 3B9DA 3WNPA 2F61A 5C8BB 1EQPA 1NOFA 3VMPA 2G3IA 4TOQA 1H0IA 1J18A 5I24A 4NZCA 2CIPA 4Y67A 2WM0A 5I78A 5BRQA 3AJ7A 2EPMX 4H41A 1JDDA 1W1TA 4GXPA 4M56A 4AMXA 2PWHA 3CZNA 1HTYA 3AICA 3AYRA 1A3HA 4DO5A 2DQXA 1RP3A 2FHCA 4QFUA 2MAPA 2F1AA 4F9DA 1FFQA 1LL6A 2WHMA 4WKFA 3ARRA 2Y1EA 4WKAA 4EANA 1GVYA 2WSKA 2WYSA 4P7LA 2ZX7A 3TOPA 1QNQA 1LG1A 4NXSA 3L4ZA 3CBWA 4Z2HA 5A8MA 2IGTA 1ISYA 1JGIA 2XYLA 1RPKA 2EJ1A 1UR9A 1WO2A 5EMYA 3CZ8A 2VX6A 3MV01 1EXPA 3VIKA 1UKTA 1QVBA 4KRUA 4OUEA 5EFDA 3CO4A 3WDJA 3KZSA 1HT6A 3K46A 4MADA 3MO4A 1V3JA 1K9EA 2J7FA 3AXIA 4KH2A 2W92A 3BLBA 1FH7A 4JKMA 4V27A 1GOOA 2J74A 1RP9A 2Y8KA 3AIWA 3AUAA 3W6MA 5FCZA 4MNKA 2XN1A 4WSJA 3MMWA 3FAXA 3W27A 1HXKA 1BYAA 2WB5A 2DH2A 1BF2A 2VJXA 4QCEA 2XHYA 3VDHA 4R27A 5KEZA 1TQVA 5A8NA 3ZQ9A 3O2LA 3DX0A 2G4FA 2VCCA 4ACZB 2V3FA 3KLKA 1AVAA 7A3HA 3AQUA
chains in the Genus database with same CATH superfamily
4MAUL 5MENA 1EO8H 2WMHA 2RDXA 5BU9A 1F3JB 5D5MA 1PF3A 1AXTL 4H88L 2NYYC 4UBDD 1ZV9A 1BQUA 3GVWA 3U9IA 1A3QA 1T1YB 3MACH 2VC2L 4K23L 1ZLWK 1X98A 2C15A 4ZGYA 3WIFB 3TBWB 1FWIC 5LQBH 3NJLA 3CC5B 1Q0YL 3EO9L 4MMYB 4GYJA 1W9VA 3KFTA 4MFDA 1AZBA 3CFIC 3GSWA 1OZQA 3P0YH 3REVA 1H3GA 3MC0A 4U3XA 3NL6A 3GWQA 1OSPL 2QKIC 1SG7A 3VGDA 4UQ2B 3VTAA 3ZZLA 4HMDA 1VFUA 1G7VA 1ISWA 5HVHB 4B4FA 3F5KA 2OYPA 2CIIA 3ABKB 1LJMA 1E2WA 1AHMA 4ELDA 1XB8A 1JXDA 1TVBA 1NBVH 4WW2F 2HT4C 2DSVA 3P9MA 1A3XA 4PRIB 4RAHA 1Q6DA 1A5NC 2WPBA 5HBFA 2PLKA 1EA9C 1XDTT 3DU0A 1AS6A 3OG6B 2VUNA 3R0IA 4JYEA 1WV2A 1XKJA 2B2XL 5GS1C 4LF3A 1HWGB 3OO2A 5EO0B 1HL8A 4LL1A 3C08L 3NN8A 4GEIA 3RX2A 1OD7A 2R1YB 1T20A 1DVFD 3CX5J 5DGQA 1HFBA 1XLHA 2H1XA 4NX0A 3GIYA 2JF6A 2WLMA 3W1QA 3GHRA 3H26A 3UPMA 3GSOB 3CL8A 3PUEA 1UB5B 4RGNB 3NQ7A 1I7RB 1OAQL 4GS7B 2ETWA 2R72A 1I85C 3QXUA 1NAMA 3DI3B 2HPMA 5CGMA 5KSVA 3WKPA 1TU2A 3ZVVA 1WA0X 1HKWA 1XR9A 5LB1A 5D33A 4DWSB 1OIMA 3QSRA 1H41A 1W54A 1S46A 2JNZA 4YWSA 1TTCA 3BDYH 4UV7L 4W9KC 5C0AE 2GPZA 1N5AB 4IBQA 4QRRE 1M53A 1S7UA 4Y9CA 5BZZA 1A7OH 3ZXWA 3CV2A 3APNA 4G6JH 3RZCC 3LN9A 4UZSA 4EE9A 4JO3L 3APGA 1HKVA 5CF3A 4KWSA 2JCYA 3AM8A 3SN1A 1I75A 4WNQB 3IB4A 2RGSA 1YEKH 3CWHA 4DJDD 1T99A 2Y88A 4KU1A 4AXWA 4KESA 1FH9A 2CA3A 2VLKA 3T3PE 2VSDA 3IGFA 5JZ7D 5ITBH 4XD3A 2VN7A 1M9SA 2PFHA 1RURL 4YL9A 4FXRA 1YNLH 1RU9H 4Y6PA 5B1AB 3HZYA 5FYLE 1Q7QA 5I1HH 3GB6A 2KL6A 3GSVA 3QIBC 2VDGA 1MEHA 4KO5A 3MQTA 2GITB 3MR9A 3RURA 1U6AH 4CSPA 1WYIA 2X2UA 1RSFA 5HR6A 4XVEA 1NC2A 1FWHC 5J9PA 2Y1VA 4MB3A 5DD5H 4NAFB 2OLAA 4HKJA 2H47C 4MG4A 2Q02A 5DS8B 2BPBA 1TMLA 2DQCL 1MLCA 3SQOL 3KP0A 1NGPL 3AXHA 1T66C 4JGMA 3BG5A 4F92B 3LH9A 1LMKA 5C0EB 4DYKA 3S46A 4Q9QL 4PJ9A 1WWWX 1X3ZA 2QKSA 4QHLA 3DX7B 3NAVA 5ABAA 1QNPA 1R5IB 2HX9A 5HGHB 2IAMD 2V7NA 2JLPA 1E6OH 2R8SH 3HC4L 3QE5A 4NC0B 1XYCA 1VF8A 4ZXLA 3FMGL 4LL9A 5J8LA 3T9WA 4MJJA 3F7QA 4IRZH 1JPGA 4NF7A 3CN1A 4ZFCA 2ZUTA 3RWFA 1YXDA 1HZYA 2UX7A 1CCWB 2EADA 3GBNH 4F24A 5DUBA 1EZ2A 3HBGA 1SY6A 2CRMA 4IIQB 2DTMH 2F7QA 3AALA 1YIXA 2XWBB 2AQTA 2YIHA 3IGAB 4AY7A 2HG0A 1JULA 3ANNA 1FHGA 1V6VA 3HZVA 2PUSA 2HLFC 2PCFA 1A21A 5JC1A 4F7PA 1ZJHA 2HZGA 2CRIA 5FKPB 2OO0A 3REQA 4AM0Q 4XNQA 3AIUA 2C4FT 3GGWB 5C71A 3HMXA 2OZ4H 4YSAA 1ZEAH 3IBEA 3WIJA 4FL4C 2E9MA 1W9BM 3ARYA 4B9PA 1G4MA 3QEGH 2MRYA 3GBEA 3GMRB 4C90A 4Y2LA 5ENWB 5T1LD 4KI5D 3ZIMA 4JY6B 4LFHG 4R7NB 1K4HA 4KAQL 3ILPA 4Y9EA 2NSXA 5CLYA 2PDXA 2BOLA 4MAZA 3O8AA 2WYZA 2IG2L 2JKJA 4UBDC 1XGYL 1TJ0A 5IY5B 5LNWA 3HURA 4QHUA 4PR5B 2QAFA 4KZ0A 2R23B 4WI3A 4GMTL 1LT8A 5DMKB 1JNLL 4LEOA 5AHEA 3C6CA 2QDHA 3NSMA 1UOKA 4DXVA 3CVHB 4WU5A 4ZO8A 1DQQB 3Q7JA 5IB5B 4YBLB 3PWUB 4LVDA 4Z7UB 4NU7A 1Q4WA 2J8FA 3IJHA 1BQ5A 3V35A 4A3YA 3ZZ1A 1UWQA 4HGWA 4MJMA 3D48R 5IXEA 4JDEB 1DBAH 3ZUCA 4BE6A 1YEWA 2GJNA 3SDAC 1BM7A 1G9NL 3EHBB 1SJXA 2DJMA 1SQMA 3SRDA 3SKMB 4TTUA 3NL5A 3KZ8A 4MKTA 4N1HB 2HCVA 5IV2B 2HMID 3Q4DA 2FNWA 5G1TA 1NGZA 2FJFB 4L1LA 2VAAA 3WGVB 4HFUL 3JRKA 2FDMA 4LUSB 4RE4A 3IEBA 1KKOA 3MRLA 3GNDA 2A7RA 2HNHA 5D7JB 2G96A 1FGVH 3X12A 1K6QL 4RMRA 1WOBA 3SUUA 2XWXA 4F5CE 3BVNA 3OGSA 5HYQB 4ZSOA 4EPSA 2JELL 5DQ9A 4AQ8A 1UZ1A 2UV8G 1RXOB 2BSRA 2ALWA 1E5AA 1I1CA 1IFGA 1RR2A 1SXBA 4N2MA 1MFBL 1I9IL 3RFAA 5JOFA 1C3FA 1IIGA 5H94A 1AKPA 1A6VL 2A77L 4HC1A 2GLKA 5IF0B 2CBUA 3HG4A 3AU0A 3QHZL 2OQJB 4HULB 1FA2A 1A4BA 3BWWA 2XPYA 1CC3A 4CD8A 2UWEA 5E6IB 4FFYH 4XAGA 5FEBA 4GG6F 3BLDA 2F53E 4XD5A 3SDXA 3CUPB 2GEEA 4M03A 5KYYB 3KCPB 2HB0A 1EOMA 3FOLA 2FD6H 3RA7H 4B7IA 2E7FA 5IR1B 4MZYA 1P0SE 3CV1A 5C2UB 3QPQC 1QLEH 4DJDC 4DZBB 5L6YH 1O6SA 3UJIL 3ZS4A 1Q6QA 4N6RB 5JZ7C 3OXRB 4LFHD 3JWDL 3WIHH 4KWOA 3CZFA 1ZT1A 5LA2A 1BSLA 1MEXL 4Y4KC 3HA1A 4KMQA 3EKZA 4LVAA 1YNYA 3ZHFA 1T83C 1TZ9A 2YQ2A 2JD2A 1HJWA 5FUCC 3P93A 3DSFH 1HYSD 1JPHA 2BCKB 2XV6B 2UZXB 3T77A 4TTGA 5AUMB 2EG8A 4O02A 1NWOA 3SCNA 1YEFL 4JTUA 1ASQA 3PP4L 1YVLA 4U1HB 4AIOA 4RSYA 4B3ZA 3FSAA 4FA8A 4DLFA 3UBXA 3KYMA 1A6WL 1RK6A 3RDJA 3TQPA 1AP2A 2XACC 4BR1A 1LP6A 2W61A 4ZMZA 1KUMA 2INZA 1MAML 2WWNA 1A4KA 2JD0A 2CGRL 3IDMB 2ZRYA 2IAMC 5EZIH 4CU8A 2Z2UA 4JUTA 2G3FA 3E1ZA 4US6A 1I4FA 2MPAH 2J5LB 1A3WA 5B7ZA 2EJAA 3GINA 5JYMA 4AEFA 1E5JA 5GS0H 3P0WA 2XJ7A 2AERT 5C2GA 3KLHD 2EDWA 1X6LA 3ZDXE 3WJLC 4OJCA 2RR3A 2YBUA 3IFLH 3MRNB 1HP4A 4ZR8A 3VFWB 4Q9RL 3T4CA 5IT2H 3FB5A 1XX9C 4QTIL 4DGVH 4AYEC 2VH5H 2UWEE 4JE4B 5FEPA 4JQXC 1R86A 4EN3C 1BEYH 1KM0A 4LUJA 2ZOTA 1SN0A 5BXRA 3SDXE 3QAZB 2P5WD 4IU3A 5K9JH 3LQAL 3VAEA 1HWHB 2NY4D 4XB7A 4CLMA 2AV7A 3WQVA 1FWXA 5DJCB 3B2UD 2XV2A 1FFRA 2IQ9L 4OFQA 2PETA 1SO6A 1OIFA 4FTVD 5A95A 3AIEA 1DWAM 3K2UL 1ODZA 3U6XS 4F79A 1KB9K 1F3TA 2HEJA 4E6MA 3EGDB 2W07B 3OVPA 3NTYA 4KI5C 4Z5RB 2DT1A 1MW3A 1TVNA 3MV9E 3RY5A 2IPUK 3N6YA 4Q4EA 1QFUH 4W9HC 2X9WA 1P4UA 1OCCB 3H3PL 4LANA 4L1XA 3EYUH 4E5XB 1LEKB 1HK6A 5IBTH 3EWDA 3R7RA 2QR6A 4ZMPA 3P4OB 2ADJB 4OTKA 5I73B 4XWOD 2HRLA 3K5RA 3LVTA 2DDQH 4ZI8A 3L4XA 4POZD 3OZMA 4XTRD 2YCIX 3ITXA 4OIAA 4NN6B 1PFOA 2JJUA 4FPSA 3QJXA 1V0NA 2GYSA 3KCWA 4BE5A 3TONA 1JZ2A 5FYLD 2NX5A 4J2QA 4UINL 2WNXA 4NZUH 5C6TH 4GUCA 5ENLA 1IC4H 3QEUA 3BT2H 1GORA 2BY1A 5IFPA 4L8DB 4JFHE 2O4MA 1BZEA 1R24A 4U1MA 3P73A 5TTRA 3S35L 5H8UA 5F89A 4GFSA 3TWAA 4HBCH 2QAPA 2WJ7A 3QRFM 4S3GA 4KX9A 2HMIC 3SEPA 4V1DA 3SYAA 5RUBA 3ORJA 3T8VA 1R0AL 3L21A 4GACA 2FQGA 2OEJA 2OSYA 1Q2SA 3UIZA 5GNYA 1HHKA 2X4NB 2PURA 4RFEB 3B6SA 5DRNB 5J13C 1W16A 2RCSH 3Q1SL 3DN5A 7FABL 1AQFA 4TXVB 4MMWA 1RJLA 3KPMB 3SOBL 3IGLA 3N19B 1WD8A 4PJ8B 5KVEL 1DQDH 2OK0L 1P4LA 4JLRA 1EXUA 2P5ED 4ODWA 4IRSA 3ZSSA 4BQ3A 4RRPM 4X6CB 4WVXA 4OUOA 4KHXH 3UGRA 3SE4A 1AS8A 2AITA 4LUTA 3WF1A 1UADC 1JK8A 3U1PA 2UWFA 4YE4L 3FPXA 4DCQA 1JCJA 2AJYH 5EIIA 4ODUB 1E1EA 4C5YA 2BX7A 1G94A 1XIHA 4OIIL 4WQOA 3LM7A 8FABB 3H0TA 4NN5B 5GGSA 5J12C 2GCYA 4IP5A 4C6LA 1BOYA 3BK0A 4N9GA 4L9ZA 2QXWA 4IGHA 4M62H 2WTRA 1KRBC 3I6RA 4G8EB 2PE4A 3D6NA 4QKTA 4JTSA 1PD6A 4M9OA 2VDIA 2WXFA 1VEOA 5JXAH 1N9PA 4TULL 2HK0A 3GB7B 4NWTL 5AKTA 3TVAA 4FMVA 5B7FA 4AWEA 2NX5E 2YLKA 3D52A 2WJEA 1YECH 2LGNA 1FDYA 4AR8A 2F08A 2Z0BA 2HJKB 5D93C 2QCNA 5CC6A 3THQA 2BSTB 2QELA 1MJUL 3N9SA 4JXCA 1X9LA 3VFTB 2A3HA 4PGJA 3HNSH 3WEXA 1NCDH 3TA3D 4FQIL 4XXWA 4KCVA 3PGFH 4GP8B 3ERXA 3IXTA 1TNNA 1QT1A 4OF0A 1YYLL 4NO0D 4V1DE 3H85A 3PABB 2VNCA 1GPFA 5EZPA 3HPLA 3R06B 4P2RA 2DSKA 1LO3H 1MRCL 3EOTH 2AJVH 2K8QA 5C0BA 3N4AA 1T03L 4Q3MA 3ZN6A 4RJEA 4P7RA 3HBQA 2AK4E 2PZ0A 1HQ4B 3WUWB 3HHSA 3ZQWA 3TA9A 1OC6A 4HWUA 1R3KB 2WLZA 1THFD 2ZONA 3TW7A 2HXAA 1ONXA 1QFHA 5FFLA 3FDWA 2BVQA 1RIHH 5I5MA 1IMHC 3QRLA 2XWJA 3VFLA 1P7BA 4WRLA 3TEYA 1FFPA 4JN2B 1U83A 4FG6D 3GDBA 5ICYA 4WUUE 4E9LA 1OK8A 4R90H 4FLQA 4XRCA 1UT2A 1KV7A 1IM9D 3QNYA 2WSRA 1KCUL 5D7IB 5EFFA 2HVKB 3DX5A 4AKQA 2NTSP 3M1BB 2EILB 1YC8A 4N0RA 5JIPA 4R3SA 3QPXH 1QOPA 3VIHA 4HQQH 2NQ3A 3PHOB 4N2AA 3THUA 2QVTA 3D0CA 3M8OH 2VZSA 1IGWA 3RUGA 3EUDA 3GLCA 2BJML 3R0NA 3SPCA 3EX3A 3G0XA 3WQOA 5I30H 5FK9B 2QUTA 3PBWA 4M1GH 4WDIA 1JVNA 1IZJA 1B5TA 2OWWA 5DVPA 3DDMA 4QBXA 5DSCB 3FSUA 3GK0A 4P2YA 4OM1L 3UYRL 3QM3A 3TJ4A 2HVOA 2QGCA 3WTVA 3C86A 2EUWA 4XTDA 4IDJL 2F53D 3W3OA 4G2AA 3BWUF 1UR4A 4LEFA 3KEHA 4UQ3B 4PJ5B 1AOHA 4FZ8H 2OTPA 1RIUH 3PJWA 3NA9H 3E38A 3HFMH 5BWFA 4AQEB 1WBXA 4XWOC 4FYSA 3B7SA 4MA1B 1IEQA 4POZC 3QTGA 1A4AA 1NEZB 2NXZC 3CHSA 1NDZA 4S0SD 2B1AH 3GE7A 3FCTA 2XZAL 4HHPA 5AVYB 2X3CA 3UBXG 2G3IA 5ERWB 1FZKA 4QXTB 4JQAA 3ZLGA 1LYXA 1EK3A 4EEEA 4GP4B 1FAKT 4CMMB 1WFTA 4Q7BA 4QWWC 4MASA 4K5NA 1A3HA 1LL6A 4WKFA 3Q37A 3IWPA 2EICA 2F54B 3WXWH 4RUBA 5DHVB 4BFFA 3HJ0A 3FO9A 3CJPA 3PK7A 2VX6A 4C91A 4XPGL 1EXPA 2COQA 3GZKA 5EG6C 3GO2A 3S2JA 3F7VB 4D0BA 2ZDSA 5CJXC 3UTTB 5IQMA 2C9XA 4C6NA 1GH7A 3TJXA 3HPZA 4G72B 4TSCL 3FPYA 1H15B 4LLYA 3LEPA 3MNZB 4TTDD 4IJTA 2CDGA 1XRFA 1VZIA 1ZTXL 3W27A 4H01A 2VENA 3EEGA 2VJXA 2NX3A 2BP5M 5TE7L 4M8QA 4OQ1A 4Y5YA 3QJAA 3ZQ9A 2G4FA 1IL1A 1Z5LA 4XP9H 5FGCB 5GRZA 3KCJA 1HS6A 4I77H 4NJ9H 3U2CA 4OVVA 4M3HA 3T40A 3RUGE 5JQ6H 4G7VL 3U0HA 1E0TA 4OZGA 3PP7A 1QNOA 1WXYA 2E27L 2Z24A 2P49B 3W29A 2K3TA 3CM4A 5E6ZA 3OKKB 1SF3A 5EOTA 1SOXA 1DQIA 5HMSA 1IAKB 2ED9A 2H3XC 1PZCA 1TPXB 2PP0A 3AWOA 2WXHA 1MFEH 4ZMGA 4PBVC 3TMLA 3EJPA 2YPKB 4Z2GA 4QCIB 2E5DA 4P7OA 3NEXA 1GOXA 3FTUA 3E5PA 3AM8C 3R8BB 1N6VA 3R8RA 4HIIB 1B0IA 2AQPA 4QRPA 2Z7UA 2QCFA 4R5VA 4X4ZA 3FLUA 5HD8C 5G5DB 3F64A 3MCLH 2CJTA 3DIFB 1JF6A 4U6VL 4MUZA 4S3CA 3B37A 3CXBA 2NSMA 5KYUB 3WFDH 3SBFA 2BHYA 3DX6A 1FBIL 3MV9D 5F3FA 1K77A 1W0VA 4F2ME 4ERSH 3CZJA 2PP9A 1E3XA 4YFDB 5G4MA 5E03A 1I2RA 3X13A 1LP9B 4ZOEA 5T1DH 5C0CB 2XCMC 3P3BA 4C6MA 3PAUA 1EGJA 2QVNA 5A2LH 2RJHA 5F9DC 2PS2A 3JWOH 3STPA 4KQ3L 3EYQD 4H1ZA 4XMZA 3G1YA 3OQEA 4M4PA 3F2LA 1GCFA 4AG4H 3HN3A 2R2HB 2GW5A 3DGRA 4JUSA 4OLWH 2J43A 2C1GA 1OK0A 4LF1A 2ICEA 2PLTA 5JMWA 3PY9A 4TO8A 1FWDC 4HUNB 4NRZB 2HUEA 2Z8RA 4W84A 4ONHB 3BESR 5FB8B 5IJVA 1FWEC 4LCWA 1MNNA 3N34A 3N44B 1NGXB 4BH8B 2G3ZA 2Q01A 2F58H 4AL8L 4XMVA 4FQCH 3ANVA 4R85A 3QC0A 4JFHD 1PZ0A 2BVDA 1RZFH 1RV8A 1A25A 5J3HD 5DQJB 2FZ9A 3AS0A 1MCWW 3RX4A 2NZ9C 1KXQE 4WEUD 1KLZA 4ZQCA 3VFSA 4Q74A 3WENA 5JXQA 4DXXA 4NJAL 1CI3M 1RERA 4YDNA 1OY3B 3W11C 3DV6B 3BJLA 1KRAC 3OKMA 3CUIA 1VBUA 5MHSE 4CVZB 4OB5H 1D5ZA 3ESPA 3IE9A 5T3ZL 3QUXA 5DK0B 2EC9T 3WD4A 3HGJA 2A3AA 1BWMA 5EIIG 4MAYB 3TPUB 3TZFA 1UBSA 4GLRH 2YRBA 1DUYA 3O3RA 3Q6GL 4BQ6A 2EO1A 2BO0A 4S3JA 3PNRB 1M4KA 4QRPE 3WOVA 1XFBA 2L04A 5CIPB 3LERA 1KFAL 3EJCA 3G6AA 1JGEB 2EH8L 2ORBH 5D1ZI 1B3OA 1A9EA 3GKZA 3G5XA 3WHE0 1LQSR 2CKNA 3FU7B 3NIGB 2G4EA 2DD8L 2FT7A 1XB6A 4H8WH 1B9BA 3CQHA 3ANLA 2AQQA 4KY1L 3L3IB 1SJMA 1OZMA 1DLHA 1WFNA 1WHOA 5AOZA 1XYBA 4MZRA 1R34A 2XBTA 3H2QA 4PLOB 4G70B 1AGBB 3C8KB 4QXGL 2AFNA 1MJJB 1XL6A 1GPWA 4IRZA 2YXWA 3MRQA 1AO7A 3MI6A 4PRRA 3LCGA 1T22A 1IC5L 3NQ8A 3HBZA 4UTBH 2CPCA 2DBLL 4EWJA 5DULA 3ECVA 4ZUTA 3IJQA 1OHLA 1BM3L 5EMMA 3S6TA 4Y9FA 2J25A 4LCWE 4QMEA 1B3YA 3THMH 5C9ZA 4L1GA 2MCG1 1H7RA 3ZHDA 2FT6A 1RMFL 2GZXA 1XL4A 2Q3XA 4LDLB 5T1MA 4PJ6A 2HT3D 4O9HL 5AL8A 2YA2A 4P59L 1F6FB 5T33H 2EIMB 4H6QA 4A39A 3PM6A 1VACB 4LT9A 3S6CA 3HR5B 2IV8A 5TNVA 5LLIC 2X4PB 5FJPA 4MQ7B 1FE8H 3D46A 4V1DD 2XYCA 2VGIA 4FO4A 1A8JH 2OZ4A 3P80A 4EVNA 2BP3A 1MFDH 1NMCB 2PDFA 3ZJ8A 5J6HB 3AZUA 5MEOA 2AK4D 1F1DA 2WOQA 2W0FA 3V79C 2BY2A 3THDA 4N24A 5GGRA 2R1MA 3NCOA 2DQJH 2HSIA 4Z7VE 2AXGB 4KKAD 3ME0B 1H7NA 1PLAA 3ZY7A 3BEVB 4RR4A 4UQDA 1EERB 4LSVH 4XNXL 3C8NA 1EDHA 3T2NH 2CR3A 4AQ8C 2R94A 5F0LB 4Y4FA 1IEVA 1KNWA 4V1XA 4J3SA 3P3TA 2MCPL 2QDVA 4NSKA 2CUHA 4N02A 5KUMA 4N9EA 1KPRA 4WUUD 3WFHB 4GO9A 4J28A 3NRPA 4I9MA 9XIMA 2PTDA 4AWJC 1KR1A 2Z7WA 1MI5A 4YDKL 2D73A 4K9EC 2PO6A 1S2UA 2QHAA 1VJIA 3GNMH 3L23A 1WFJA 4FHAA 5CEYB 4JFEA 4M6MH 4ACZA 3QQ9C 2XTSA 3O8XB 1BBJA 1FYTE 1UPPA 4M3PA 3QO1B 5M2FX 3ZE0F 3WD5H 3HBLA 4YDVB 2W63A 1SDYA 2OOGA 2G30A 4QOKA 3H9SA 4LGPB 4PW3A 3TLLA 4DP4X 1BF6A 2QCDA 4L3EA 4RZKA 3IU4L 3SJNA 1M2OA 2YW3A 3S36X 4L9DA 3FOMA 4YX2L 1JJKA 3VUSA 1KGUA 1SYSB 3X11B 3TH3T 3EJZC 4DWHA 5FYKE 3GHBL 2RFXB 3L3JA 4NUWA 1CUOA 5IQ9A 4YSUA 3P6LA 4HZ7A 1NOLA 1CFSB 5SWSA 4G42B 4OCRH 2R7EA 3QY7A 2XTJB 2V8MA 4KXDA 4Z7QF 4K0OA 1AZ2A 4DP9X 4Y19A 4GRLB 4OOUA 2CUMA 4TNGA 2DUXA 1T0NB 1JYNA 4M6VA 3RTQA 3UG4A 3LS9A 3RX5A 2WP3T 2D2JA 2D3NA 5DT7A 1R0MA 5XIMA 3NABH 4X8JB 4A66A 4H20L 4B9GA 4FOMA 2DQGH 4MCZA 1AZVA 3P2TA 2YWZA 1FZJB 4FFYA 4WHBA 3UC2A 3VDBA 1CICB 4ZFOB 3OL2A 3GXUB 1V3HA 1HCFX 5EBGA 4UILL 1YY8A 5HGGS 3SSJA 3G5YA 2CBQA 4XK2A 1C7SA 2P9RA 1OF0A 4G8IA 5JW4N 4Y8EA 1CGSL 5IK3A 1H19A 4M7JH 1V7NH 3B4YA 3SIMA 4BQ2A 2WXQA 3L1GA 2OAAA 4PJHF 5GSRA 3TVMA 2EDBA 3WIHA 2E25A 4HK0A 1MI5E 4GNVA 4UMGA 1AZ1A 1IM3B 4YVNA 1KYFA 4Z9KB 3AIBA 4JFEE 1AAJA 3TTQA 3L3OA 2BOBB 3PGCB 1XGEA 4HPNA 4B96A 3TESA 3S6DA 2QJDA 5BNXD 1E9LA 1Z7JA 1BOGB 2UV3A 3QSTA 1F61A 5IWLA 3VFCA 3E0WA 5HULA 2V8LA 1G4PA 1EZVY 2VTFA 1JCVA 3BUIA 5L6UA 4GBXB 2OWXA 3ZIZA 3INUL 2G5UA 4PTWA 1X5HA 4F2TA 3LHUA 3MCMA 3SGUA 1OZUA 5TH2B 2IIJA 3QSKB 3GZOA 4OLXH 3ZTNL 3L95B 3VFVA 1R3SA 1XRVA 3WLQA 1XQLA 1E8XA 3BP7A 1T0MB 1C8YA 4GQ9H 5DWUL 3B9KB 2E28A 3O4LA 3FA4A 1HKMA 4I9XA 5DHXB 5SWSE 5BUGA 3UO1H 1JDFA 4B4HA 1W3NA 3NSNA 5T8IA 1KA9F 3ASNB 2OMUB 3EWXA 3V6FB 2HWZH 2Q6WA 3N12A 2B0MA 4PJEA 4GIYA 5HHNA 2ZA2A 4G43B 4AD3A 4B41A 2BOEX 5HP5A 1L0PA 3S3GA 2ZX9A 2HK1A 5DFTA 5L9FA 3ZE2F 3PZMA 4Q89A 1T8XA 4O0QA 5FF3A 1SJEA 4FQQA 4WHCA 4FKHA 4X8XA 3LS4L 3W73A 2VQTA 3FOKA 5H37A 2ZF9A 3VDGA 3NSCA 3UC0H 2HRWA 4IRJB 1I8JA 2FZBA 1C8VA 3KOZA 3VGHA 1TMHA 1JZGA 4XAWH 5I71C 4ZS6D 1M6JA 4X8CA 1C91A 2A6DB 1I1FA 4ODHH 5I00A 1THCA 4HG4K 3PZGA 4JFXA 1T66D 1XSOA 1VFLA 4W7VA 2EE9A 4JM4L 3OODA 4OLEA 5DJZA 1CDGA 1I9CB 4XNMB 1UM6H 3CFDB 3VIFA 1US3A 3MCYA 1IWAA 1BQCA 2GBAA 3VXSB 2Z7GA 2I07A 2OG9A 2EDXA 1XLBA 1FJ1A 2R1LA 2WQAA 4B5EA 4DF1A 3EZ8A 3LZ5A 4XC3H 2H3BA 3BZGA 5F2FA 4YR6A 4JJHA 2FYVA 1B3XA 1HUVA 3UROR 4XCFL 5KZCD 1FX6A 4O2CA 4IRSC 2XIMA 4B7LA 4A55A 4QE4A 3QC6X 4ZAKB 1MCPL 4GSQA 4W9TA 3SE4C 3WDPP 2E59A 4ODVL 4TRPL 2UY6A 4R7LA 2V5BA 3WO8A 3VNDA 3FQRB 4Y5XA 2IPJA 3MTXA 5AWNH 2XIOA 2QF7A 4N8VA 4YAQB 3KWXA 1KZYA 1TXKA 1A50A 4AXNA 2SEBA 3PDOA 3PUDA 2ZC1A 3T0CA 3GDLA 5AC4A 5EYWA 4PJEE 3M0MA 3UZVB 3NAAL 1VFTA 4YXGA 2JGYA 3AROA 1L7TH 1P0NA 2APSA 5DJ0A 4AEHH 4H2HA 1MFNA 4QRTA 2NUYA 1H6EA 3GS7A 5IFJB 1R17A 4WUKH 4KDTA 4KMTH 5H2BB 3PF2A 4F7CB 3WE1A 1I1YB 4Q8PA 4KUCF 2CWNA 1E4MM 3AIVA 2DJ4A 1Y5XA 1SFLA 3CC1A 3A14A 4UQCA 1F3JA 3MJYA 2F7RA 1ISXA 4DBWA 3ECUA 1X39A 3V0WL 1T1YA 2GOKA 2PEVA 4YHIA 2K4AA 5E95B 3WIFA 3FA3A 5FKAB 5GS2D 1DKWA 4D2NA 4MMYA 4XOAA 4Y96A 1EP1A 4XXWC 1U2HA 4RX0A 1H7WA 1X8CA 4NWUH 4HWBL 4OT1L 1JAEA 2B4CL 3HN5A 3PREA 4PBEA 5XIAA 1AQHA 2XM2A 3KOYA 2D7TL 3OKYA 1WDDA 2R82A 2X0UA 4F58H 3L5XH 2Y6ZA 1R46A 3AREB 3P60A 2H3NA 1RJCA 2WM1A 3QH3A 4PRIA 3NZHL 3SDAD 1QUNA 2G9HA 2I26N 3WFBL 3K4WA 3F6LA 4WHYG 4GW4A 2YCLB 1HJSA 1NMBL 4JS3A 2FPVA 1BFNA 4LYKA 3PAJA 1Q9WA 5EO0A 3C6LD 2BODX 4G6ML 1OJXA 2R1YA 2OMWB 4F2BA 3U0PB 2Z1WA 5I75C 1V51A 3RY4A 2NW3B 5BROA 5CSSA 1TZHA 3EBAA 3KL0A 4AGNA 4H5SA 2I5YL 2WN3A 4FN0A 1I7RA 3MLTA 3OJVC 2WHJA 2GVYA 5FO7B 1VYRA 5AKQA 1A2YB 3O41A 3QO0B 1B0RB 5E4IA 4DWSA 8PAZA 5JO0A 4AD4A 1B9ZA 1PG7X 1BG9A 3N2TA 5EMJA 1RZ7L 5TFSH 3OP2A 3R12A 1U3HB 2DLFH 1ISZA 4APXA 3KJ6L 4LHUB 2DJLA 3DCPA 43C9A 2OPCA 3W24A 2QADB 4KO6A 3NOIA 1W3HA 1I1AB 3MBWA 1JG9A 4PS4H 3JTTA 2P76A 2V8ZA 5I0YA 5MENE 5D2NA 2P80D 2R2CA 1TJGH 5D5ME 4KKLD 1NWRA 3FDGA 1FYTD 4NHCH 4YFLI 3UETA 3HI5L 3U1SL 1ZHBA 4WNQA 3UO8B 3RCYA 4JTAA 3RDTB 2WQ8A 3QPQD 2PLCA 1OAUL 1TZIA 3VZYA 2X0YA 1SR0A 3VZZA 3FY1A 3T2QA 3W7IA 2F38A 2Y07H 3GJEB 2ZFAA 4L8SC 5FO2A 1THAA 5KMYA 3ZT6A 4DFIA 3AWGA 4PAZA 1Z9LA 4ZL1A 2PDQA 1HINH 4Y4KD 1NZRA 5FYKD 2DIEA 3LNHA 4OZIF 3QDGB 2HYMA 1PW3A 1IC7L 1CBVL 2NSOA 2AW2A 1BVWA 1ORQB 2CBIA 1NBCA 1ZU8A 1RUPH 1R9ZA 2V5MA 4ZS6C 4NAFA 2PTUA 1FDLH 2E77A 4HZLA 3T4AA 2IDFA 1PYMA 2VO8A 5CIPH 1QR7A 2R24A 1OGAD 5JO5B 4OJFH 1A5LC 4PTTB 1NGWA 4IW4C 3QMSA 2FL5A 3IGKA 4K38A 1OY0A 3UY8A 2XDHA 5I1GH 1UACL 3W87A 3QEHA 3C61A 5I23A 5EOQH 4UQAA 4FXTA 1SGJA 1C9SA 3D85D 3DGGB 1R5IA 3KWWA 3U2SB 1D3GA 3WMQA 5HGHA 1DVXA 1U8NA 4Y5YC 5DJ8B 3M6YA 5ABFB 2H2PD 3ICJA 4QKXB 4YHOH 2YGYA 1UOZA 3OMIB 5FM5M 4Y2WA 3L1OL 3VQMA 3M7SA 1ZD6A 4FNLH 1PZSA 2A6JB 4X22A 4MNLA 2EUVA 2ONEA 1I3UA 2KBGA 2ZCKH 5I2IB 1AI1L 3T81A 5J11B 2IGFL 2WZIA 1I6NA 4F2FA 1R5WA 4EN3D 1UR8A 1BA9A 3T42A 3JVAA 3UJJL 1SFHA 1D7FA 2W91A 3WNPA 3V4PB 1XMWA 5KJRL 2J8UA 4YSOA 2F6KA 4UAOC 3CQIA 1Z5YD 4M6OL 5I24A 2R56H 4NNXA 4E42B 4AMXA 2PWHA 3MRMA 4Q97A 4EANA 4I88A 3W01A 4GQBA 4W9EC 4ZD3H 5BMWA 2VLKE 4Z2HA 2VLJB 2EYSA 2BNQB 1OADA 4AT6B 4LE8A 3MVIA 5ENWA 4OF8A 1Z9AA 3L7EA 3EGSB 1PNCA 2C5ZA 2YKLH 4A6GA 4HIEB 3H56A 3K71B 5H37G 2Y8KA 3ILQC 3IS1X 3E2HC 2XG4A 4DKEL 2R23A 1G9ML 1SLXA 1O7VA 1K02A 3W7NA 3IVKA 3GMMA 1U93B 4HWZB 1JNJA 2WZTA 3QDJB 7A3HA 2VXTH 1GGBL 3LKPA 5TDNB 2ICEC 5D9SB 3S37L 2F6UA 1C1EL 2OJZH 3PWUA 2ZQKA 5IVZB 4OCYH 4Z7UA 4XNZB 3N40P 2YEZA 2VERA 4JFDA 5FUZL 4RMTA 3Q8BA 2ITEA 2J20A 1PY0A 3C2SA 4R5TA 3QBUA 3LSBA 2VQ4A 1DIKA 4JDEA 4LARH 1ITUA 4B5TA 1W3LA 3K0WA 5IOKA 1Q72H 4WW1B 2ZVIA 3LUTA 3F2BA 2X4SA 2ACUA 1F6KA 2YLAA 1QSVA 1P84J 2WW5A 1N8OE 3HFTA 2VC6A 5F9JB 3T6QC 1AIFB 5JNYB 4X3ZA 3C6LC 3QIWB 1ZLEA 1MCRA 3L9YA 4WEMB 2OMYB 1E4XH 1J7VR 3DFQA 2Z93B 4LU5H 2DVUA 3GU2A 1TETL 3GIQA 4LUSA 3Q05A 4B95C 1CL7I 4QHMB 3QUXC 2O61B 2L5HA 4NO3B 3SGJA 3BWSA 3QNZA 1S2TA 3LPWA 5AHIA 5IFAL 1MIEL 1PX4A 4XPAH 4OD3L 4N2DA 5G1YA 3CIXA 2J8UE 1L5GA 4JTDA 4DB7A 5HYQA 4N8VG 3B8SA 1VGEL 2ZSWB 5B21A 2YLLA 1LVEA 3E80A 3ZDYE 2XH7A 5CBBA 1VS1A 2OBGA 4NT6B 2OSXA 4KROC 1LO0H 2WQXA 5HK4A 1J5HA 4F9PA 4NKDB 3KX6A 4I3RH 2PLMA 1HI6A 1QTYT 3EFDL 5IGXH 3R43A 2GI7A 1GW0A 4M7TA 5JIHA 3QV8A 3RCMA 3G3LA 4F48A 4KW2A 2DN7A 2N0MA 4TUKL 5E6IA 4BZ1A 1BRLB 2EPKX 1AW5A 3ZVHB 3NCJL 4KKLC 3FXGA 4LSRH 4PCYA 4KX7A 1IGCH 3IAPA 4O8AA 1QFEA 3CSYB 4AKOA 3VI4B 2BVUA 4BZYA 3H53A 5L88L 4BSVB 4XD4A 4Q4RA 3PZQA 5BOJA 1W37A 1W1YA 3W9EB 1LL7A 1XF1A 2QQKL 1OC5A 5EEVA 1EJSC 4N6RA 3Q44A 3TC3A 5JIIA 1JV2A 2ZNWA 1UJ3A 5G2HA 3GQYA 3C09C 3NPZB 1KCKA 2BNRB 1P53A 1ETZA 1ZB5A 4JFDE 1SYVB 4JDTH 4N0UB 4GXVL 3X3FH 5CR1A 4NO2B 1BJ8A 3MLPA 3BOLA 3C6EA 1QZNA 3IJLA 4AZGA 4FQXD 2DBJA 2LLNA 4U1HA 5JW3H 1EWEA 3QWNA 1RPQA 2Y7LA 4N2LA 3CXDH 4UT9H 1EIXA 3BKJL 1GTFA 3IJ8A 3STZB 3WF3A 1NIEA 1W72L 5D71L 3UZYA 1WWBX 2HN7A 4R4ND 4AJVA 3QW4B 4F33A 3CPRA 4H9UA 3FFOA 1PLBA 4LLDB 3MZTA 1ECZA 1KM1A 5CC7A 4WHTA 2R29H 5E4EB 2OKTA 3NWRA 2BZDA 4ONGL 3S1WA 4PJBB 4JN1L 1H5BA 3Q5OA 4KPHH 2H2PC 3QZWB 1QNZL 2VR6A 3C60A 1GYCA 4ZSOE 4BY3A 3QISA 2QKFA 3BLEA 1E5ZA 4FMKA 1CB4A 4LAOA 2IKHA 2H0EA 3GW0A 1IX2A 2WIMA 1K1DA 1HOEA 4AD0A 3ZKMD 2VX7A 1NL0H 1D9KB 4ES8A 1WC7A 5E6UB 4N6EA 3ZYJA 1A4LA 2ZUMA 3MRNA 3VFWA 1P1MA 1XGUB 4N90E 4UTBA 1BDYA 4WWKD 4I48A 3RGTA 5HDBB 3LIZL 1AD9A 2PO6C 2Q9OA 3UPAA 2F18A 3IUHA 3VXNA 5JMPA 4MFEA 5JTWA 1EGVA 5ANHA 4XSLA 1FC2D 5D1XB 5GISL 2DPEA 4O5LH 5CAKA 4Y2OA 1EUUA 1MW1A 4U1GB 4K8RL 2FIQA 4AQAA 3A4WA 4G7YL 4I18B 3IVSA 2VE6B 2XVPA 4MD5A 5B1JA 5C70A 4XH2A 2ESVA 5KW9H 1R1CA 4KZDL 3RLHA 2AJXH 1E4HA 4IBLT 2QQQA 1ZT4B 2W07A 1N0LA 5E8OB 5C0AD 4ZJ9A 5HNUA 5DD6A 4QRRD 5MEND 1B4KA 5D1QB 1E6NA 4MKNA 1FL3A 1CL7L 3VSVA 2XH4A 5E2VL 3DTXA 4MXVE 4NDMA 2VABB 2I56A 3B5GA 5FV1L 3TYZA 4FG2A 1H9DA 2Z1SA 5CPTA 4CGUB 3R8GA 2P0OA 4LSQL 2J7BA 5I8CB 4MYWB 2NY6C 2HFGH 2CU0A 3QQ1A 4QEGA 1F97A 3OBEA 1DE4A 3KWUA 2GK0A 4XHQA 3PPGA 3WLHA 4YDLB 4GUHA 5A8OA 2ADFH 5F8RC 5AVRB 5AVZB 3RTQC 2NXZD 3W1RA 4JO4H 3GM8A 4KNTA 3L3GA 3WDIA 3ZHXA 3C12A 2KHAA 1ZENA 4ABUA 3QZEA 1I8KB 5C0IA 1PL3A 3AQZA 1QLRA 2Q8LA 2VZOA 4QWWD 2YL5A 3CFKA 3RLUA 4L8DA 4J3OH 4HEPA 3M0IA 4JREC 3C4UA 4Y9NA 4PMUA 4JFSA 1N19A 3R5EA 4GZJA 3AWEA 2OTUB 5IDZA 2GIYA 2ISDA 3UAJA 1DIOA 3VRIA 5TQ0H 2VGFA 1WTLA 2A4AA 1S7SB 1TR1A 1FZOB 1I60A 5H8DA 1KLUB 4JMXA 4LVNB 3TVMC 2BVYA 4IKIA 3H8NA 5DRNA 4OCLC 3ZL4L 2IDCA 3LYRA 4ZFFA 5KVGH 3D9AH 1KDJA 5CPMA 1BLIA 5INCA 3L3OC 2PDIA 5T1JA 4PJ8A 3MCKA 3QFGA 2YX0A 3GPSA 4XBJA 3H1ZA 3LN3A 3VI2A 1HKLL 4XIAA 3BISA 3ZHNA 5EU9A 1NCAL 4HCRL 1HILB 3FUHA 3VG0L 3F12B 4U6HB 3IF1B 3TA4D 2ESVE 2X9YA 4GKNB 3S2CA 2ZC8A 5F6IC 5EUOB 3TNBA 3OLEA 1EZSA 3ARGA 2A7PA 1QMUA 2KPNA 3W7KA 3ZTCC 4GBDA 2RDUA 1GHRA 2QZRA 4X7TA 4RFNC 2E76C 2Y24A 4PJGF 3VMNA 3H2MA 2MJWA 2ICWA 3FQXB 2D22A 3LMZA 3FJLA 3BAKA 1F8TL 5F6HI 1V5XA 1R3LA 1T4WA 4HNTA 5FM8A 1RUKL 3SY8A 1YYML 1KTLB 5HD8D 4M61A 2CK0H 4S3DA 2HRPL 3M0VA 1TLMA 4PN2A 1OP3K 2VLKD 2YSTA 3S36H 2J5WA 4JO5A 4K2UL 3UWWA 2FZDA 4NNAA 3W7HA 4Y9MA 1P0BA 1PYWA 1UJQA 3G9AB 5F7BA 1XF2B 4B2DA 1RPUA 2WXRA 2HJKA 1P7KA 4K55A 3VCLB 1XSKA 1I2QA 1NKGA 1VEPA 4Q4QA 4TX6A 3QMRA 3KPRA 1NC2D 2AQ3A 4TNEA 2PTWA 1RVFH 4X6DF 1DBBH 1NPUA 2VXQH 4YXHL 3N17A 1GG0A 2K6ZA 4AMAA 4M81A 5G1MA 1IVLA 3FKKA 4MWAA 4FQXC 2EO7A 2NXYC 5LWYH 2SFPA 1YUHA 3MRPB 1AH4A 2YXVA 1IKNA 1RP8A 1E70M 1BVKA 4MJIA 4PJ9D 5D96C 2QQ6A 4XBSA 2R70A 4P2AA 4HUXA 2H8PB 1N64H 4NZTL 5A2IH 4R4NC 2TPSA 1C5BH 4PTUB 4A7QA 1PCXA 3EOEA 3CPLA 3KW8A 2AQRA 3SCWA 3CH9A 2QLYA 4A21A 1JOIA 4KTDL 1PCSA 4C5ZA 5I0WA 4BI5A 1EDYA 2NZ9D 4PV8B 4M00A 3MROA 3QUZB 3APDA 1R3RA 3ZKMC 2BHUA 3W11D 1MCCA 2PF6A 5EOCJ 1I8MB 3EWUA 4ZW5A 3L17A 1RUAL 3FC8A 5I06A 3BGJA 3A5VA 4WWKC 5FLVA 5TF0A 1NICA 4Q8OA 4NQUA 4XZ4A 4Y5XC 1AANA 1VFBA 3FONB 3F8UB 5FYJE 2I25N 4ZEPA 4G82A 4ACYA 3WU1A 4L5FL 4XD6A 2AQWA 3PHOA 1F6YA 3U30B 3SKJL 1G1CA 1AYOA 4JNMA 1QA9B 1YEJL 5DUPL 4MXWL 3CEPA 3WTUA 5I1JL 4XTIA 4JAMB 4BF9A 4RESB 2Z31A 1GOIA 3SO3B 4TVSa 1DVJA 4KDTC 2GAZB 3NRFA 5A8PA 1L9TA 5HI5C 3QQXA 3QCUH 4C7GA 5DSCA 1LO2L 3ECQA 5ACLA 5ECJE 2O7GA 2BNUA 4F8OA 3DO7B 1MQKH 4LSDA 4NPJA 3BE7A 3OJGA 3L5AA 4YFLF 4IMEA 2H5UA 5C9JB 3AMLA 1G4RA 3KPRE 2XOTA 5GRXG 2WMFA 4PJ5A 2ARJQ 5EZLA 2BWGA 1OM3L 2FE0A 4DN1A 1RD5A 3SDYL 2ZE3A 3FEMA 4MWAE 1PWMA 3Q5TA 4Y5VA 3MODH 2V9TA 4U0QB 1RLBA 4AYSA 1KJ2L 4HJJH 1UM4H 2I9UA 1SYTA 4YIWA 1CFNA 4P2RE 4MJIE 4FE9A 2JE8A 5F7AA 5BNKA 4JIRA 3QWRA 3CU2A 5C0BE 4JFDD 1OAZL 4QCFA 1L6YA 4CMMA 3V4PH 2BIHA 3ATEA 4K8GA 4KWUA 3T0XA 3BUPA 1H8LA 4XX1E 3U82B 3N2MA 4HJ0D 1VBGA 3CVBA 4Z7NF 1OCWH 2YA0A 2B3IA 4RDBA 2HS6A 3DX8B 3FVDA 3F7VA 1X5ZA 3SE9L 3PTKA 3SB0A 2VDOL 1NQKA 1X7QB 5A2AA 3ARVA 4HHLA 2JKLA 5FW8A 1TWSA 3OBAA 1UH4A 1BZ7B 2R1WA 5D7HA 1XINA 3TURA 4ZVJA 3ZR4A 4HPJA 1VCVA 1CE1L 3UWZA 1V7MH 4X9SA 4HIBA 5DMIL 3ZHLA 4HJEA 3ZMNA 1TJHL 5KYNA 1QATA 1TIWA 3PFQA 4PTMA 4X42A 3DROA 1L7IH 3B0YA 1CI1A 3VD4A 4LVFA 4L4VB 3CVHH 1BXNA 4KOBA 3SBWA 2Q7NA 3VD2A 4TOYH 1KEGH 3QUHA 3GLZA 4V33A 3DVIA 2DAVA 5CMAA 3HI1B 1PQZB 1FLTX 4I87A 2FB2A 3RB5A 3IDUA 3VNJA 2GSGB 3QKEA 1WFUA 4IP4A 3WQ5A 4N90D 2GFTA 4P4KA 5HHME 3QNXB 2EQDA 1N2RB 1GKEA 5KVFH 5D2NC 1BYPA 4ANVA 1X7IA 3ITOA 4JX0A 1VJZA 1UWXK 5ESVA 3KR3L 1UUQA 5BVPH 5EF1A 5D9OA 3QQ9D 1QO5A 4QCIA 3H9HB 1BKHA 3L7FB 1ILUA 4P2QA 3FCPA 5IM51 4ZW8A 5B1BB 4DIXA 4LH8A 2NUPB 4P5SA 2OQLA 2ZYFA 2A83A 4D9PA 3SPVB 5G5DA 2A9CA 5HI3C 1E40A 4MOZA 4Q33A 3R1GH 4A2GA 1T41A 4HOWA 2G2PA 5FSEC 3EJZD 2WZHA 4IK7A 4U31A 3U2JA 1YAZA 1M68A 4ETQB 5AB3A 4REQA 3ZLHA 5LNEA 4B60A 4JDBA 2FMOA 5C0CA 1CK0L 1W1B1 3MOBL 3GNOA 1S7RB 3LNIA 2HDJA 3BP4B 4JRXA 1ZXQA 3FK3A 1TENA 2QULA 2VL5B 4KCTA 1BV8A 3T4AC 2UYLA 4HEPG 4QRBA 2XX1A 1N59B 1KZQA 2L0DA 2YMXH 1PDKB 3CNYA 1AHWB 1XIWA 1IGFL 3LKSB 5GGQL 2PW1A 4N8UA 4R6UA 1KT2B 1EMTL 1VC4A 3H24A 3AG2B 4NRZA 4H2CA 2XN2A 3AVEA 4AF0A 4PJ9C 1A7QL 1BFOB 3ISWA 5FB8A 4PRDB 4NIYE 4BH8A 3WBDA 5A6TC 3NZQA 3RVWD 3HHMA 3U8GA 3LKOA 1QRNA 2ZUUA 4OJEH 1N8ZB 5B3JE 2VITB 4JIIX 4GBUA 3RWEA 2WXIA 3DMMA 3A3HA 3GRBA 2QL1A 4ZW6A 3NCBB 5DJDA 4RX4A 4S3KA 4PRHB 1AKJB 3NCWA 3TH4T 3UZEA 1FVDA 2CJSA 1N82A 4OZGE 1JVKA 3KHDA 1GGIL 2DT3A 1OWWA 4Z0BH 1CB7B 4TVUA 4JFYA 2F8OA 5AVTB 2CLPA 4N20A 5F93C 4JYFA 4KF1A 4DEFA 2A0LC 4CVZA 3IDGA 3VFPA 3I9PA 1JNNH 4P7QA 2AQ2A 4GUIA 3V4VB 4C6JA 3TPUA 4ZUSA 4M1DL 4P2QE 1FWJC 4XMPL 4PMYA 3SADA 1QSEB 2CSPA 3SUWA 2I60L 5CSZB 3IN0A 4GX9A 1PG7H 4S3BA 5J04A 2CBPA 2ESVD 1FGNL 4ESKA 4J5VA 4WJ8A 5IHUH 2TYSA 3CFNA 4ZS7H 3M45A 3GXIA 4GIAA 1JGEA 4D8ZA 3MCG1 2I32A 2ATPA 3EH4B 1R0LA 4J3XA 3UJTL 1XGRB 3P9WB 3SUSA 2BVOB 4Z7OB 5C0RL 1OV8A 4GXUN 1UWAA 3S8HA 4M9PA 1F1AA 2EXOA 3DTUB 4IXHA 5REQA 3N15A 1R19A 4X5WB 2ICSA 4KY2A 2E6JA 3IFNL 4JRXE 3N1QC 1G84A 1KPVB 1L2UA 4IMAA 2BERA 3C8KA 3UWYA 5CILL 2W9LA 4WGKA 4OBRA 4HDIB 4QRQA 5FECB 5IB4B 1QYGL 3Q6FB 3CHQA 1G1OA 1P9MA 4OV5B 4HNNA 1OKEA 1WX0A 1ZNNA 3CL7A 3MREB 2YRLA 4KFMA 2P3ZA 1OALA 2OL3L 5I6OA 1SJDA 2IPTH 4L6HA 2NX5D 1OD9A 3WL0A 3VAVA 5MKGA 1T7WA 1LBFA 5G2WA 3MNMA 1S38A 3OGCA 2BMBA 1EJ8A 5LYRA 1PHQA 5K9CA 3V6ZA 4HJ0C 3FH5A 2APXA 4XX1G 1QNRA 1WKDA 5DYOB 5DZ9A 1UZHA 4CADA 5ISZA 4WNJA 4WDTA 2P28B 2VDPB 1E5YA 4NY2A 2JKIS 5JHLL 4GVFA 2CIPA 1F6AB 1J86A 3OW1A 3JV4B 5LGJA 1UCWA 2KLTA 2EPMX 3HI6H 4AOFA 3PJUA 4N2HA 4O1AA 2A4EA 2EDTA 4FQLL 5G2IA 4OV6F 2JJSA 3MLWL 2JGQA 1CF8L 3H7BA 2J6EL 1NIAA 3SGJC 2HPOA 2VN6A 5EEYA 1RZKC 4PRAB 3OR7B 5D7LB 2HA1A 1JXGA 1IAIH 2KLRA 3OVQA 2ZCZA 4YSDA 1ICQA 3QF0A 3QXWA 2IMNA 3V5HA 3C5ZB 1F86A 4IRSD 1UT9A 3TCTA 4U3SA 2KZHA 3JWOC 5IJBC 2IW0A 4F9PC 4ZB5A 4OUIA 1FCBA 3GHEH 4FJZA 4YHKL 3VDHA 2CM5A 4R27A 1ND0A 3WFHA 1YEGH 1AQDB 1AJ7L 1MRAA 1BIIA 1KN4H 2HQAA 1G43A 3GVGA 4PUUA 3DX0A 3TX4A 1GS8A 1G6RL 1CTMA 3E0GA 4JQ1A 4KCWA 1EBPA 5FYJD 1EZUA 5CEYA 3VINA 4RDQG 5FYLL 3GI9L 2I57A 3FT4B 4MGGA 1C5CL 2FNBA 5FGRA 2OYLA 3C56A 2IADA 3E6FB 4YDVA 2JCCB 3CUJA 5BMFL 3GFYA 4Z17A 2PDPA 1U8CB 3GBLA 1AO7E 3EF7A 4Q8WA 1JVOA 3BPCA 4JM2B 3V3WA 1DO5A 2VR4A 3D3AA 1UJ3C 1FOBA 3U4AA 4OD1H 5KANG 2RFXA 4Q7NA 2F19L 2LOEA 1NCGA 3GNPA 3QUMB 3IE4A 1JPFA 4G42A 4PJDF 5FF2A 3AABA 4FXKA 1JFHA 2FX7H 4XPHH 2UXVA 4UTLA 4ZN6A 4LAJH 2J78A 2GSIB 5LNVA 3RVVC 5ISZE 2FJGA 4MWAD 2V17H 3QCTL 1NLBH 4H9ZA 1V8HA 4QRFA 4MM1A 2FKPA 4LCCA 3I84A 1TV7A 3KXQA 4P2RD 4RXFA 5GHWH 3LZLA 1LROA 4LX4A 1PZ5A 2CLVA 2XFXA 5C0BD 3WNMA 3DHMA 3RVWC 5A1AA 4K73A 1QHPA 4X8JA 4R97C 4F8QA 2QVKA 3QRGH 3BGFB 1J10A 3HG1A 1XPGA 3RDKA 6XIAA 2EEDA 1FZJA 5LIYX 4G7RB 4H0IA 1PVHA 1OGSA 4K7FB 1H5BC 3CHOA 2J5LC 2O6PA 1O7SA 3C60C 2XETA 3K72B 4QS6A 4TV3A 3QORA 2PTYA 3EJYC 2H26B 1KCVL 2Z8VC 4LOFA 5DA0B 1C12A 2ZZ4A 5HPMB 3Q8AA 3L65A 3VKBA 1BG4A 1TPC1 3G5ZA 1F41A 2SODB 3R13A 4L9LA 2JEPA 3D25A 1QO3A 3FTZA 1FL6B 1SJCA 3W7EA 2QPSA 5AYXA 2O56A 5I15H 1IM3A 3O6KL 4XZHA 1KF9B 2PBOA 3L81A 5LNRA 5DRZB 3GDKA 2BOBA 4UOW1 4ZFGH 1INQB 1BOGA 3CAWA 1B30A 2WZ0A 3IRPX 1EX5A 1Z3GL 2DZBA 5B1JC 4QOKE 3MBXL 3H9SE 3C8DA 4WJKB 3GG8A 1GT8A 3KPNA 4PRNA 4L3EE 4DQOH 1UCBH 2V2HA 3E96A 4G7QB 5TH2A 4UT9A 3HPFA 3RWDA 2IBZY 3MVSA 1KKRA 5HHMD 5HYJB 5INDA 3TQ0A 1RAKA 5GGTL 1T0MA 1KCZA 1ONQB 4CCZA 5DZOA 1EDQA 5EC1B 3U2ZA 4ZENA 1GS7A 2R29A 1RVKA 3RC8A 2WYHA 3V6FA 3B9EA 3QJFB 1PIIA 1VLIA 2RAGA 1P7QB 4Y19E 1HHGB 1PY9A 4DERA 1RIVH 1KBJA 4K3EL 5AKSA 4G43A 3AIQA 2LAGB 1BYOA 1TKKA 1AODA 4JPKL 2HNEA 4M6PA 4YDIL 3CDCA 2NY3B 2J47A 1IILE 2X4OA 2X89A 4H83A 3OLDA 4YTTA 3T8MA 3DGDA 3QWRD 4HXAH 2WKGA 3ZE1F 4LCRA 2F2HA 1CFQA 1HH9A 1SN2A 2EIJB 4IRJA 3W2JA 3HG1E 4AISA 2OCJA 3KPSB 4EX4A 3O11B 3IS4A 3M4HA 2PCEA 3BUYA 4CKQA 2FB4H 2X1XR 5C6MA 2WTPA 3QR3A 1RJQA 1UD5A 5ILTH 4ZTPH 5TE6H 2Y7OA 3BYYA 5F0JB 1SMDA 4ZK8A 4UTCA 4HJTA 1TTGA 3QYQA 3CFDA 1SEBB 3B2VH 3T8XA 3R6IA 1D5IL 1Q3NA 3VXSA 4ODTL 1O5DT 4OTXL 3GU1A 1HNFA 4N5EC 4OZOA 3V0UA 3GSNL 4UR7A 2FO1A 2XGZA 3UR7A 3QJHA 1EZLA 4M48L 3MS8A 2ENSA 1J5OH 4E4FA 4QNWA 3VKKA 5BJTB 3W0KA 3AXMA 4B53A 2VJ8A 5LGHH 5LAXB 1AG6A 1U