2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
1R47A 4PCSA 1Q6GA 3TTYA 4GO8A 4R27A 1E1EA 3HJEA 3ZSTA 3WMBA 3VVGA 3O6AA 2VX6A 3D4YA 2EPKX 3N1AA 1CWYA 1QNPA 3EDKA 1TG7A 1VEPA 3VSTA 2WHMA 4U33A 1G5AA 1GQJA 2GK1B 3GDBA 4GQQA 4QCEA 3BAKA 4GO9A 3UCQA 2XVPA 2YA2A 5E70A 2FH6A 1ITXA 3WNKA 3IAQA 3WH5A 5D9NA 1EQCA 1XYZA 3AHYA 1XSJA 1BF2A 4CD5A 3CUJA 2CPUA 1YHTA 1E43A 4WKAA 5CGMA 3AIVA 3ARTA 3LXBA 2VRQA 4ATDA 2UY5A 2ZXQA 3CZLA 2BY3A 3IJ9A 1SZNA 2EPMX 3AU9A 1AVAA 1CNVA 1M53A 5JO0A 3K8KA 3VSVA 3W25A 3T0YA 2NT1A 2BVDA 3WF0A 1DTUA 5M17A 6CGTA 1WZAA 4HZ6A 4UQDA 1R75A 3W4RA 2J7EA 1QWNA 3AQUA 5IHSA 2D3LA 5DEZA 4BQ5A 1SC5A 1V3KA 1I1XA 1H11A 4XB3A 3ZJ6A 2Y5EA 3L4ZA 3BGAA 2E40A 1BVNP 4OOEA 4AZCB 2WB5A 1E3ZA 1U33A 1HP5A 2WCAA 4BQ2A 1BAGA 1B30A 1EQPA 5M03A 2A3HA 1G94A 2PWEA 4MJ4A 2WLZA 4B15A 1OGSA 1FHLA 1BHGA 1XH1A 1E1FA 1JXKA 1H5VA 2QV4A 5CQ1A 2YIHA 1GHRA 1HP4A 3DX3A 2Z1SA 5A1AA 3I3BA 3W24A 4UOQA 1FFQA 1XD0A 3ARVA 1UR0A 3M7SA 3BXWA 3B8SA 2ZUUA 1R85A 1E6QM 2VCCA 1X1NA 4N0RA 1UH4A 4JFVA 4MB5A 2X1IA 4OOFA 5D8WA 3IK2A 2FHCA 3PZNA 5DT5A 4P7LA 1H3LA 1XD1A 2VQUA 2XTKA 4MPKA 1WDRA 4YPJA 1G9HA 1M03A 3VINA 4FLRA 5E0FA 3FN9A 1MXDA 3H53A 3A23A 4MB4A 1V3LA 4NI3A 2V38A 2E9MA 4LYQA 1B31A 2XGIA 4PTWA 4Z2KA 3BVVA 3VDBA 3WF2A 4HZ7A 4A03A 1JAKA 1GQLA 2W4XA 3PTKA 1K5HA 2O9RA 3CHFA 3CV5A 4JL2A 2WVTA 3WNNA 1VEOA 2F1BA 1BLIA 4UNIA 3AXHA 1GOMA 3OLDA 2YJQA 1FH8A 4J3TA 4U2ZA 5JMWA 2JIEA 1UZ1A 4NZJA 3VIIA 4U2YA 3VGFA 1OINA 1UH3A 1XH0A 3THCA 3L4XA 1KR1A 3GXNA 4HU0A 4URIA 2X2HA 3BUBA 2WAGA 1UD6A 2ZUMA 3M46A 1BGAA 4P8XA 1W3HA 2VCBA 1PZ2A 1WAWA 3AMLA 1ZBCA 4AXNA 1Q6EA 2GJXA 4CN1A 4WK9A 1PS3A 2XIIA 2O9OA 1UWSA 1W1PA 2Z1KA 5I0DA 1FHDA 3O2LA 2WMIB 3PTMA 4OUEA 1BYBA 5AYBA 2CBUA 2J77A 3NUKA 3MU7A 4Q22A 5BYWA 1GOOA 2F7OA 3PZGA 2WLYA 2CBIA 3OLEA 3T2OA 2D24A 2CKRA 3AOFA 3WY3A 1ONPA 2RGMA 1LG1A 1J10A 3HG4A 3VDAA 3OIHA 1HWWA 4RCVA 4AW7A 3GM8A 2J47A 1JF5A 4CCCA 3WUFA 3ZT6A 3AZRA 1AQ0A 2J7DA 1QNQA 1VFFA 3KLKA 1B3ZA 1E5NA 4H8VA 1QI5A 2WMFA 1HTYA 2GFTA 2D22A 4AIUA 1Q4NX 1EDTA 3EMQA 3WKZA 5DF0A 4KMQA 3UR8A 2WZIA 4AMWA 3WFLA 3WSUA 4MJ2A 4W86A 2F18A 4PUDA 1W9DM 1V6UA 1MYRA 1LWJA 3PTQA 2JEPA 1B2YA 2J7HA 3NSXA 2BVTA 2WZHA 5IDIA 3ARZA 5A6KA 1GJWA 5A2AA 1GOKA 4UFJA 4J3SA 3BSHA 2XGBA 1D3CA 1WZKA 2WCSA 4ZEPA 2E4TA 1DWHM 3PN8A 2WBGA 2WVUA 4AICA 2D20A 1WDQA 2ZUTA 3AS1A 4A3HA 5BXRA 1UD8A 4DWSA 5HPCA 1CTNA 4CD7A 4OJYA 1W9UA 1PAMA 1US3A 4RE4A 5JBFA 2QF8A 4AZBA 4ZN6A 1NP2A 3U7BA 3CUHA 2EPOA 2G3MA 1AQHA 2JCXA 1W3LA 3WD4A 5D9MA 4ZENA 1EDGA 5E0CA 4H2CA 2BVYA 3MV11 3MUZ1 2NSXA 1SMDA 1E9LA 1VEMA 1B90A 1JFXA 4P7RA 1CGXA 1QNSA 3CHEA 1C3FA 3ZQ9A 2WSPA 3LXAA 1JZ5A 2UY2A 1HT6A 1OIFA 4ATLA 5IFTA 2W61A 3RMEA 3BUDA 1BFNA 1M04A 3CUFA 2W91A 1W3KA 1PZ3A 3PZVA 1Q6FA 3MANA 3T0DA 1UQZA 1E56A 3NDZA 1JYXA 3ALGA 3RPMA 1EHNA 1V0NA 2W66A 3T0BA 1RP9A 2EQDA 1DWAM 5IHRA 3K8LA 3AXIA 4A3YA 4ACZA 1E4NA 1V6WA 4QLJA 3ZIZA 1ESWA 3ZT7A 1GNXA 3AIUA 3BMVA 3DX0A 2WMKA 3POHA 3CZKA 1GQIA 3DYMA 3CHCA 3PZIA 2ZOXA 3QGVA 1HN1A 4AMXA 1VRXA 4XZBA 5LA2A 1JXJA 3RJXA 1QHZA 3OLGA 4KGLA 2FE0A 2WWDA 1TQVA 3DECA 1WE5A 3EMZA 1J0IA 2XM1A 3QOKA 3WMCA 1UOKA 3GBDA 3SUVA 3VM5A 4TXEA 1CXEA 5BRQA 3THDA 4HOXA 2CERA 3WH7A 1HJXA 4HP5A 4F9DA 3MO4A 1UD5A 2X2YA 2XVGA 4OBSA 3CH9A 1TA3A 3QHMA 1E3XA 2GUYA 3EJTA 2YFOA 4AY1A 3ARRA 2WKLA 4JFSA 3SCWA 4F79A 1CLXA 2EGHA 4OBRA 3HG5A 3RO8A 2V3EA 3EBVA 2EBNA 3WDIA 2WHKA 2WHLA 4WLCA 2IXUA 3OZPA 1X6LA 2XVNA 4W8BA 1GOIA 1VB9A 4PSPA 1HF6A 4CGTA 3WQSB 5HDRA 1UWRA 3CMGA 4MTVA 3TTQA 2JF6A 1OT1A 2ZXAA 1Q0LA 2ZXBA 1Q0QA 2DIEA 3T09A 4FNUA 3D5HA 3DDGA 2J7BA 3MUIA 1JZ4A 1JYNA 1G0CA 1V03A 3VTRA 1XH2A 3A21A 1W9PA 4QFUA 1HJQA 2F2HA 3EJUA 4Z2GA 3SIMA 2CNCA 3VKKA 3DX1A 3A14A 2DH2A 4MNLA 3ZO9A 4D6DA 2E9BA 1WNOA 1D2KA 3WUEA 4AZ7A 5A3HA 3A24A 4HPHA 3DX4A 1NOFA 4UZSA 1E4MM 3GH5A 4PCTA 3AHZA 5BRPA 3TOPA 1KBBA 4JAWA 3AJ7A 3ZI0A 4H7VA 7A3HA 1KCKA 4AEEA 4AYGA 4CU8A 3BH4A 5HBFA 3A06A 4ZQGA 5CPTA 3H54A 1ZBKA 3E1F1 2A3CA 2UY3A 1UQYA 3W37A 1V3HA 3AYRA 4M80A 5D9OA 1V0MA 4DUWA 1JZ3A 4GIAA 2W5FA 5CLWA 1MFUA 4PTVA 1HXJA 2FHBA 5A6JA 3WL1A 2GK1A 2WMIA 3LRMA 4MAVA 2CBJA 1JIBA 3A22A 1CYGA 2BXYA 1C8XA 3LPGA 2ZX9A 2EABA 1ZJBA 1SYTA 3VIKA 3KE0A 1NWUA 3RM4A 3ZR5A 4LX4A 4TOQA 1Q0HA 1GCYA 3WY1A 1E71M 3PZUA 2YOCA 2GVYA 1UYQA 1LQ0A 4WKHA 4P7QA 3MUY1 3BAXA 1QI4A 2WANA 1XV8A 1KR0A 4UQ9A 5JIWA 4PTMA 4HZ8A 1HIZA 4OOUA 4UFLA 1NP0A 1KXVA 1BQCA 2WKGA 1GOQA 3SCSA 3NSNA 4Z2LA 1TR1A 2ZX6A 5HPOA 4HMEA 1FP9A 6A3HA 4JFTA 1HJUA 1HJVA 2XPKA 1J01A 2AOSA 2YDRA 1UD3A 3VIOA 3K46A 4XZWA 2ZIDA 5LA1A 5A6BA 1DHKA 2OW6A 1E70M 1IZKA 1K9EA 4NZCA 3AU8A 3H55A 3LXCA 1J0KA 4X0VA 5BCAA 1GZJA 4CD4A 2V3GA 3SUTA 3S2CA 2E3ZA 1T1RA 2DSZA 3VX1A 4KWUA 1MW3A 4PMDA 3VGBA 4AEFA 1Z32X 1IV8A 3MMDA 1VIWA 3N17A 4AD4A 1VJSA 1EA9C 2ZXDA 2WC3A 2NT0A 1UG6A 1KXTA 3LPPA 4V27A 4AD1A 1EXPA 3N15A 2CITA 2PWDA 1KTBA 5I77A 1UUQA 5ABFB 4JIEA 3LRLA 2QMKA 2WZEA 4TTGA 3KLLA 5DO8A 1R46A 4W7UA 5I23A 1KFWA 2Y8VA 1DEDA 3M07A 4GPNA 3WF3A 4S3KA 4B16A 3BLKA 1OGBA 2CKSA 2YL6A 2EO7A 1VFUA 1JYVA 2DIJA 2VUYA 4D6JA 4LPCA 3B9DA 1VJZA 1UA7A 1QWUA 1W2PA 3MUAA 2JIWA 3SCOA 3CPUA 2GDVA 1J18A 4JFWA 4OGZA 2YL5A 1ZB5A 4MB3A 5I78A 3IJ7A 1HJSA 1TVNA 2VNCA 2BHZA 1A47A 2BY1A 1QW9A 1DWIM 1GUVA 4U5KA 3W28A 4BA0A 1CPUA 4TX8A 1H41A 3POCA 2BFGA 1JDCA 1J12A 3HN3A 4CCEA 2GDUA 4D72A 3OGSA 3S5ZA 2WVVA 2W63A 3WUBA 1BSIA 4ACYA 5E9AA 2OW7A 1K9DA 3AZTA 5KZ6A 1ITCA 3KL3A 2Q8XA 1JD9A 1M01A 1VBUA 1TZ7A 4AZHA 2VRKA 1JVSA 1TQUA 2FGZA 1ZBWA 3CO4A 3VIFA 1UKOA 1TA3B 1HXKA 4PMXA 2G41A 1KQZA 3B9EA 4U3AA 4IPNB 5LYRA 4B3LA 4X9YA 4UR9A 9CGTA 1W2VA 4WJXA 3DYPA 3S5YA 1KXQA 3APGA 3MSGA 1C93A 4F8XA 4W7VA 3BVXA 2WVVB 3FW6A 1KB3A 3ALFA 2W62A 3K8MA 1QNRA 4W7WA 3GNRA 1QI2A 3WEMA 3VILA 5C70A 1XRVA 3FNDA 4FK9A 2VT0A 3CLWA 2Y4SA 4J3XA 1QW8A 4AD3A 5A8NA 4B9YA 1EO5A 1WKYA 4H8HA 1QI3A 3W26A 2BV9A 3ZMRA 4AMCA 2J74A 2Y2WA 3MKKA 5GQBA 1UR4A 2XN1A 1GHSA 5JMPA 4M82A 1V6XA 8A3HA 1KBKA 3A5VA 1UWUA 3ARQA 4YHEA 5M5DA 2F61A 4P7NA 3TP4A 3MI6A 3BAJA 2XN0A 2XVKA 1I1WA 3VNZA 5D8ZA 4HU8A 3VIJA 2JD2A 4W93A 2JCYA 3BUQA 3J7HA 1E55A 5E1QA 3WQWA 3VGGA 5I24A 4HTYA 4OOZA 2YA1A 1CECA 2FDMA 3GYCA 4UFHA 1R33A 4WIWA 4Y6SA 4MADA 4FNQA 1MFVA 3AIEA 2ZX7A 4GINA 4AIOA 2WM0A 4LXFA 1MQQA 2XFRA 4M56A 1DP0A 3CMJA 2PC8A 2QPUA 3VO0A 2TAAA 4E2OA 4Q7NA 1X6NA 5ABHA 4JCLA 3LX9A 1XC6A 5CSUA 3AYSA 1LF1A 3HG3A 5FCZA 1T0OA 2JEQA 4W88A 3AROA 5EBAA 4HA4A 2YBTA 1HL8A 1E15A 4D1JA 2BS9A 3BLPX 4OIFA 3EYPA 3KWXA 4CCDA 2J7GA 3WQRA 4TVUA 1CLVA 2D1ZA 2IXVA 2MANA 2WSKA 2DSVA 2FH8A 1JZ7A 3QOMA 3HG2A 5C71A 3ANMA 1LL6A 1W1TA 4TX6A 1UWTA 4W84A 1O7AA 1PIFA 1UR9A 2HISA 2WVSA 2XWDA 5I79A 2XYLA 7TAAA 5JC1A 4J27A 4PMUA 2XSBA 4F66A 3L4TA 5I6SA 1EOKA 4OKDA 1EDQA 3AIRA 1H49A 2AAAA 2VZUA 2VX4A 5EFFA 4ZFMA 5JBDA 3NDYA 4C7DA 1C92A 4D6GA 2BNJA 3FHQA 3WEOA 3AIBA 3BUIA 3LPFA 2OWXA 4MB1A 1W91A 2UY4A 4WF7A 1JZ2A 1C90A 3ARWA 4HOWA 4EK7A 1CXIA 1OGGA 3ZSSA 3ZR6A 2Y1FA 4PBGA 2V3DA 4AD5A 2G3IA 1V6YA 3SCQA 2VO5A 1EH9A 1H3GA 2J4GA 3NIYA 4Y7EA 3GXFA 1UR2A 1S46A 1T1SA 5CPSA 4FNPA 1KCLA 4KGJA 2D2OA 1SR0A 2C8NA 2HVMA 4BQ4A 3PZTA 2D0GA 5D4YA 4IUGA 5FIPA 5E09A 2X8RA 4LGXA 1JD7A 1KGWA 5IFPA 3UG3A 3VUPA 2A3BA 3VD9A 2GSJA 4BS0A 4C7GA 1XCXA 1ZBVA 3PZMA 2WC4A 1RD6A 1LG2A 1V02E 3GBEA 3JUGA 3BAWA 1BTCA 3IANA 1OSEA 1WPCA 1BGGA 1MQRA 2OSWA 4QCFA 3PHAA 4RE3A 4W87A 4S3JA 1WDPA 4AZCA 8CGTA 3LMYA 3OZOA 4AWEA 1KXHA 4PMYA 4XUYA 4GXPA 1TMQA 3VD5A 3I3DA 4IPLA 3AMCA 5ABGA 1BVZA 1CXLA 1TQTA 3TONA 3VMOA 3AFBA 1JAEA 3VIMA 2JFEX 3GZAA 3RIKA 2VX7A 1ZS2A 1ISYA 1HKJA 4DWSC 5BWFA 2ZWYA 2WK2A 3DHPA 2DT0A 2VTFA 1PBGA 4FLOA 4Y6RA 2JALA 2J78A 1JDAA 3ECQA 3MSDA 4D6FA 2EADA 1CEOA 1BPLB 5I3DA 3KL5A 3WDJA 1R8LA 2Y1DA 2PB1A 3CZJA 4KRTA 3ANLA 1KWKA 3CC1A 3VD4A 1Q6DA 3IJ8A 3LPOA 2V5CA 1W3JA 2X2JA 1B1YA 1ONNA 1R34A 2YA0A 2WBKA 4W8LA 3II1A 2VVNA 2ALWA 4GZEA 1OT2A 2B31A 3ZJ7A 3N9KA 1NWTA 4EANA 1K9FA 1EOMA 1BG9A 4UQAA 2XN2A 4W89A 1UZ4A 2JE8A 3VM7A 3AIWA 4U3CA 2D3NA 2VZOA 1J0YA 3BC9A 5C8BB 4TVDA 1CXFA 1JNDA 3WL0A 1K6AA 2XFFA 2MAPA 5CLTA 5JBIA 2CHOA 2WYSA 1Y7VA 1UWQA 2J8FA 4UFKA 1E6RA 1HKKA 4V2XA 4UQEA 4DO6A 1GONA 1E6XM 4UTFA 4DUVA 3EDDA 3W0KA 4CD8A 1JG9A 4GAEA 4LYPA 4A4AA 3WY4A 2GJXB 2PBGA 2BY2A 2O7GA 3GH4A 1UKSA 3EJPA 3CZEA 7CGTA 1GJUA 1WZLA 1HNYA 2WNWA 1O6IA 4UQCA 1FH9A 3AHTA 2WWCA 2X09A 2ZE0A 4M24A 1UASA 3GH7A 3ZHYA 3SCUA 1HKIA 1CENA 1E5JA 4NQWA 5DMYA 5EB8A 3PBGA 3KZSA 1QBAA 4CU6A 4BQ3A 3WF4A 1PIGA 3SCVA 3N12A 2MAOA 3VX0A 3AMKA 2J62A 3GNOA 2X2IA 1IZJA 2W92A 2DT2A 3UG5A 4HMCA 4NXSA 3D51A 1MW0A 4H41A 1WB0A 5ABFA 4ZE4A 5JBEA 2WMJA 1LWHA 3EDEA 2J79A 3FXYA 3ZHZA 4CXFA 5BXSA 2EACA 2YFNA 5BXTA 2ZUSA 4PMZA 4LYRA 4W5UA 1YQ2A 3GXPA 3RASA 1E0VA 2EJ1A 5AC4A 1E0XA 3U57A 4U31A 1PPIA 5A6BD 3L2LA 3CUGA 4NZFA 1ZJAA 3AMDA 3U7VA 5FL0A 3GNPA 4LUPA 5GNYA 4ZQHA 3D52A 4M29A 1NWSA 1ONOA 2GJRA 3RM8A 5IXEA 1V3MA 1EGZA 4HPGA 3WDQA 5D9PA 2WC7A 3N11A 4PTXA 2DQXA 3UR7A 1M7XA 4CN6A 2YDQA 4UOJA 2G3JA 3OB8A 5I2UA 4DM2A 1XGZA 2QMJA 3ZM8A 4D6HA 3K1DA 1OBAA 2PI6A 1W1VA 3MV01 5DULA 2E8YA 2EPNA 1TFVA 2YL9A 1VBRA 1ECEA 4JKMA 4Z2HA 1XSIA 2WCGA 2JD0A 4JKLA 1V02A 4UCFA 4OZOA 4MNMA 4ML4A 5JAZA 4CU7A 2VQTA 1L8NA 3AHVA 1UR1A 3NSMA 1UKTA 3IAPA 2XSAA 1NOWA 4DO5A 3FHAA 4ACZB 2E0PA 3IGUA 2VVSA 2C0HA 4XX6A 2D0HA 2D73A 3W82A 1C8QA 5ABEA 1VFMA 3AS0A 3CGTA 1JI2A 2X0YA 1DWGM 4K68A 4UOZA 4GI8A 1CZ1A 3VD7A 4JFUA 5GPRA 1OCQA 2VC9A 2EAEA 4GI6A 1DWFM 2GJPA 1OR7A 4FF5A 5FL1A 3A47A 5GNXA 2PBOA 1JI1A 1N82A 3ARPA 1B9ZA 3AI0A 3UESA 2D0FA 4CD6A 2Y1CA 3WQ5A 2VOTA 1KWGA 4UZUA 4KH2A 2BXZA 3TA9A 3ARSA 5AYIA 1V6VA 3RCNA 2OSYA 3MMWA 2WPGA 2F8QA 3VIHA 1MW2A 4FNSA 3KL0A 3TV8A 3OG2A 4P7OA 3A6OA 3VNYA 1B3VA 4DO4A 4D6CA 1V0KA 1ODUA 3VD3A 1GVIA 1OIMA 4R5EA 2F7PA 4IISA 2W67A 1P6WA 3TTOA 5E6ZA 3F5JA 3NCOA 3L4UA 5A94A 2XUCA 4GKLA 3OGVA 4KRUA 1AMYA 4GI9A 1E6PA 4PN2A 2VJXA 5JUVA 2VL4A 2YL8A 2DPEA 4H04A 3QHOA 1BG4A 1UD2A 4D1IA 1J11A 3WD0A 1UD4A 3EDJA 3F5KA 3SUUA 2DSUA 3GXTA 4NF7A 2G3NA 1XYFA 1E40A 4UQBA 1QVBA 3FAXA 3ARUA 3S6TA 1JZ6A 2XM2A 5M3WA 3D50A 2Y24A 3AHXA 1WDSA 4E4PA 2Y1GA 3HMCA 1VENA 1UKPA 3LRKA 1K9TA 1KQYA 2E9LA 4AC1X 4CKQA 1HVXA 5CSYA 4LQ1A 3W38A 3WNMA 1F4HA 3F4VA 3G6MA 3WQ4A 1JNEA 5A6LA 5A6SA 4CUCA 3WELA 4PYSA 3UETA 1CGWA 1W9VA 5A2CA 3BCDA 3KEHA 2DSWA 4YHGA 1OD8A 3OBAA 3SCNA 3EJSA 4Y6PA 3L4YA 4PSRA 3A4AA 3WF1A 1UH2A 2VRJA 4QDMA 3T2PA 4D6EA 1R7OA 1V0LA 2ZX8A 1QHPA 4WSJA 4ZE5A 4PMVA 2J8GA 4Y67A 4H8UA 4WSKA 4WKFA 1MVYA 1JGIA 3WH8A 1CGUA 4X0NA 1E4LA 4MDPA 3L2MA 5DT7A 4FNTA 1QX1A 3GXIA 1SMAA 3NYDA 1GW1A 4P8WA 3K4DA 1CGYA 1NM9A 1OD0A 2DT3A 5A8PA 1WCGA 1JDDA 1TVPA 1U2YA 1R0LA 4AZIA 3WFZA 3ARYA 3SCTA 1TE1A 3AXXA 4AZGA 4MAZA 1JL8A 2G4FA 1UA3A 2YLLA 3ANNA 3G6LA 4J7RA 3DC0A 2WXDM 4TVCA 4XV0A 3EMCA 4M8UA 4QP0A 1J0JA 1EHAA 5A8QA 4AD0A 1HX0A 2J7CA 2YDSA 1V08A 5HOSA 1ZU8A 1PX4A 4FNRA 3PZ9A 3ZHXA 3WD3A 2Y1EA 4JHOA 3VMPA 3NJ3A 5EFDA 3GTNA 3VIPA 4DM1A 2VZTA 4DUXA 4CVUA 3O9NA 3WDRA 5CXPA 1GPFA 2RGLA 2CEQA 2DSKA 3CZ8A 1RP8A 2XIBA 4D6IA 2OYKA 5F7UA 2ZUVA 2CCRA 4IM4A 1AQMA 2OLHA 1SFSA 4FMVA 3R0IA 3L4VA 3MS8A 3EJQA 3AIQA 1CDGA 3IIEA 5FKYA 5JIPA 1FFRA 2J25A 3VGEA 2J7FA 5CPQA 3D3AA 3VPLA 3WENA 1E6SM 4BF7A 5A8OA 3A4WA 3WNPA 3VIGA 3PZQA 1H09A 1FH7A 3N13A 5CGTA 3ZOAA 1QNOA 3D4ZA 4HA1A 3WN6A 2IUZA 1DWJM 3VU2A 1LJYA 4V28A 3UEQA 1BYAA 1ZL1A 2XHYA 5A2BA 4P8UA 3CHDA 1OB0A 4N42A 2J75A 3DDFA 1CBGA 3OA5A 3SUWA 4ZXLA 3WBEA 2E8ZA 4PRWA 3OLIA 3DX2A 2VR5A 1QBBA 1OWQA 3WDPP 3VOCA 4DWSD 2JD1A 4TTUA 1KTCA 5BROA 1MW1A 1R7AA 1ISWA 2EXOA 5AY7A 3N04A 2PWHA 3WUGA 2FGLA 1NH6A 1XSKA 1LLOA 5A95A 1E72M 2DEPA 2ESCA 1CXKA 4J28A 1WZMA 3UERA 5A6MA 1WO2A 1WP6A 4QLLA 2QHAA 2CXGA 3CBWA 3PZOA 1B3YA 3WBAA 4F9JA 3VSUA 2CBVA 1GVYA 1TUXA 1E4IA 2FYVA 4D71A 3WH6A 2VI0A 1RPKA 3RJYA 1C7TA 1C8YA 2Y8KA 4CN4A 2OYLA 2X0HA 1J0HA 4HMDA 4MDOA 3EDFA 4B3KA 4ZQEA 4NRSA 1UWIA 3A3HA 1BYDA 1EO7A 1NWRA 5TD4A 1RH9A 2QLYA 1QHOA 1FA2A 3BAIA 1VF8A 4ZXOA 4PMQA 3VDCA 1L0PA 1W32A 3WIJA 3EJRA 2F1AA 3CZSA 1MWOA 1US2A 3SUSA 2X05A 2EPLX 1QI0A 3VGHA 1NOUA 1O7DC 3N18A 3OGRA 3WQVA 1UR8A 3WQ6A 3AZSA 2JCVA 2WMHA 3T2QA 3WY2A 5LA0A 1H2JA 2DH3A 3GXMA 5E6YA 1GORA 3BVTA 3WH9A 1UKQA 2CYGA 4HA3A 4JL1A 2XG9A 3F5LA 2AMGA 3K4AA 1ISVA 3AICA 4J3UA 1PX3A 2O92A 2YBUA 3T0AA 4E8CA 1H4PA 1CXHA 3GXDA 3RDKA 3BUPA 1KGUA 2C7FA 2PWFA 3WMSA 1G1YA 1OM0A 3BMWA 3L4WA 5GNZA 1HL9A 5A6AA 1TQSA 1V3JA 2CHNA 3U5YA 4AISA 4W5ZA 5FOOA 1R87A 3BVUA 1W9XA 2VMFA 2PF0A 5I5RA 3HZ3A 1TCMA 2DGAA 1TQWA 3W6MA 4EKJA 5ECUA 5HNNA 3ZT5A 4QAWA 1B3XA 1NQ6A 2V3FA 1HKMA 2EEXA 2WHJA 1QPKA 2ZICA 3WQQA 3CUIA 2VZVA 1UHVA 3WEZA 1JFHA 1H0GA 2YLAA 2CETA 4PUEA 6TAAA 4PMNA 4RE2A 1ISXA 5DFAA 3CTTA 3W53A 2YKKA 2CIPA 1NARA 4JKKA 1V3IA 4U5IA 4AD2A 4GQRA 5EMYA 2VZSA 3B9AA 3VDHA 4J3VA 1B0IA 4NX0A 1LL4A 1QOXA 2WW5A 4M81A 2O9PA 3ARXA 4JZ5A 3QHNA 3AS3A 5JNLA 4UFIA 2OYMA 1JZ8A 2F7RA 5A69A 1J9YA 4PMRA 1H0IA 3DYOA 4AZ6A 1CGTA 4C7FA 5BXPA 5KEZA 2C82A 1XHGA 1F4AA 4CVWA 3BVWA 3WQ8A 2VCAA 4L4OA 1XCWA 1G01A 1GOWA 1ODZA 3SCPA 5AC5A 4ZQFA 3SEPA 3TTSA 4NXKA 3VGDA 3UG4A 1E0WA 1Q6CA 1R86A 2BHUA 3HU7A 4PEEA 1I75A 3FAWA 2QPSA 4QLKA 3WD1A 2BY0A 4AYSA 3SURA 1E6NA 1A3HA 1LL7A 4KP7A 1C7SA 2ZUWA 2VURA 3W6LA 4HOZA 5CJ5A 1PEZA 3CZGA 5FD0A 2O9TA 3WNOA 1J0ZA 3CZNA 3M6DA 3VMNA 2V5DA 2OSXA 5A8MA 4AZ5A 2DT1A 1PX8A 4PMOA 4Z2JA 2F7QA 4MNJA 2OWCA 4B9ZA 2WMGA 3SCRA 1H1NA 2NW0A 1W9BM 1IT0A 3WD2A 1JF6A 4AIEA 4EE9A 1MQPA 1B3WA 3WDHA 1D7FA 5CG0A 2D23A 2BHYA 4JHZA 3AMGA 3CIVA 3BCFA 4P8VA 4TUFA 4Z2IA 4E8DA 1E73M 3W29A 1HVQA 1JYWA 3MMUA 3BSGA 2G8ZA 1FOBA 4FLQA 2ZWZA 1U30A 1KGXA 3T08A 4NSBA 5HXMA 3FY1A 5CZKA 1CGVA 3I3EA 4UFMA 3ZJKA 4L4PA 2PWGA 2OWWA 4W85A 1HJWA 2A3EA 1BYCA 4GZJA 1FP8A 1PJ9A 1EIBA 2ZX5A 4W8AA 3AUAA 2XFYA 2XWEA 1W1YA 3BAYA 4YN5A 1ISZA 4M1RA 4ATWA 4BZYA 4EAMA 3W81A 3ZJ8A 3A4XA 4FLSA 3RILA 2XJ7A 4MNKA 1C91A 3DHUA 4NRRA 3U5UA 2JF7A 1VAHA 4GZIA 3RM9A 2FHFA 4BCEA 3QR3A 2XVLA 1R0KA 2CESA 2DDXA 1MXGA 1GQKA 1RP3A 4RL3A 1VFOA 1E6ZA 2ZUNA 2IGTA 3W27A 2VR4A 4JCMA 3AISA 2VX5A 4J3WA 4DWSB 1CIUA 2A3AA 3AS2A 3WNLA 3BLBA 2UWFA
chains in the Genus database with same CATH superfamily
4PCSA 3QJRB 3QN3A 5AOKA 2YSSA 3PQYA 3O4OC 2NY6D 4R27A 1JVKA 1Z9NA 1WTGT 3IKCB 1XLFA 4WEVX 4DLMA 5BMXA 3SB0A 4M5SA 5DSCB 2BNUB 3IDGB 3D4YA 3MJ9A 4BCXA 2EPKX 2IWGA 3ROOB 1D3GA 3L5LA 4S0HA 1CVSC 1QNPA 4N86A 3RAJL 1BM3H 3MLTB 3MN8A 1CU4L 4X5WA 3CH0A 1L2QA 4HD9A 3GUTA 4P5TC 2WINA 1CB7B 3MGAA 2F6UA 2WHMA 4KHXL 5K9CA 2GBTA 4UNUA 3R25A 2IAMD 2CJUL 5I8KH 1GQJA 2OMVB 3GDBA 3KYNB 3BYYA 3V79C 1FL3B 3QEQA 3CLEL 3FOLA 3VGAC 4QCEA 3BAKA 2NY1D 4GO9A 3UCQA 3UTSA 2CNZA 1GYMA 1LK3L 5DTFA 3TVMB 4FXRA 4R34A 1NIUA 4X80H 4AH2B 4DIXA 3C4UA 3DX7A 4G7EB 4XNDA 2AABL 3OJGA 2KBGA 4XXDB 2B61A 2VM9A 3ME3A 3HNSL 3QARA 3GSUB 5H91A 3UZYA 1H6TA 4W87A 1UZ8B 1XSJA 4UOW1 1YEHH 5D2LB 5DZAA 2CPUA 3AHYA 1FG9C 3RI5K 3BQ6A 1YHTA 1CL7H 2ZSWA 1JZEA 3US1A 1GA2A 2X0VA 4QXTA 4TTDD 4ZTEA 2GT9B 2Y1VA 3IJSB 3SO3B 4MWAA 3U6WA 3ARTA 1MFEL 5IB4B 3N40F 4XCNA 1P4LB 1AS6A 2J13A 1URLA 1M1SA 3MJ6A 1RZFL 3KW3A 2DQEL 4KDWA 4HAFA 2UY5A 2ZXQA 4ZMLA 1D5ZB 3P80A 1OB1A 3FO0H 4UUJB 3U25A 2BB0A 3U1PA 1XR8A 2FATL 3TSMA 2GYSA 1Q0YL 3KLAB 1U0QA 3MTXA 4GAGL 1AVAA 4O58L 4X5WB 3RGVC 3TCLB 4O5LL 1E51A 4IQLA 4EXAA 3K8KA 1J5HA 4A6YL 3T0YA 4R7NA 4XO4A 2W0UA 1QFOA 5M17A 3MFGB 3X14A 5DD6A 3TW6A 4OZFG 1FNSH 1VJIA 4WFHD 3ZUNC 1N8IA 5B4MC 3W4RA 3WEAA 4ZD3H 2QZRA 5IHSA 3IYLW 2FIRT 5G4EA 3HFFA 3BLDA 2DL9A 2OSLA 3H7BA 4XTRD 4WHTA 5DEZA 1SC5A 4LVEA 3V9FA 4US5D 4WKZA 4W4OA 1DCEA 1LO3H 5T3ZE 3VFUB 1JGDA 5J6HB 4JFZL 3DZ1A 3NSYA 5JHLL 3OBKA 5GGVH 3V2AR 5D2LA 1MVUB 2XQBL 3NDZE 3MLUL 4KRPD 3BGAA 4NDMA 5BZWA 3TO4D 4TOYH 3NCYS 3DVNB 2J73A 4G2DA 4JQ4A 4FB7A 1GZPB 3W1QA 1ZIAA 4AJWA 1BM3L 3H6OA 4X63A 3RKDC 4OFCA 2CGRL 1FVPA 4GMTH 4ZMPA 4I4WB 4OJEH 4ZW3A 4KJYB 4L29B 3P77A 4QO1B 4W9JC 5EA9A 3S88H 1S7XA 2DBLH 4NHUB 3WO3B 1B30A 3TN4A 4IGBC 2DZPA 2A3HA 3W84A 3HPLA 1A1NA 1G94A 2PWEA 4MJ4A 4XI5C 4B15A 5F1SA 4R85A 3GMOB 1OJXA 1MCWM 1OGSA 1KXTB 1FHLA 3TZVB 5L2KE 4AIBA 1E1FA 1EVTC 1TFPA 3D33A 3MDJA 3U2JA 1ROWA 2HX9A 2R23A 4JQ1A 3V0WH 2OL3A 2PCFB 2CKBL 1A4MA 1NBVL 3WXWH 3HFML 1QZNA 5FAGA 1RA0A 4LRIA 4UOQA 4KKZA 5DD6B 5AW6B 5KYUA 3P7YA 3FB8B 1FBAA 2VEMA 3AUWB 1QA9B 2XGZA 3CN2A 4XCFL 2K4AA 3B8SA 5AZ0A 2ZUUA 4N0YL 3Q0HA 4NQSA 5MHSD 3BIKA 4DJEA 4YL2A 2VCCA 3LKSA 1DLFL 4EN3C 3JVFC 2Y61A 4WHTB 2YBGA 4RMUA 3FB5A 3V4PH 3HZKB 4YSUA 2EGZA 2CLPA 2QGYA 3NCJH 2MNUA 3DX6B 3QQ9C 1HQRB 5L4IA 2W59A 4GNKB 3W72A 4C5ZA 4D3CL 3VZXA 4C6MA 1WISA 3WIHA 3OZKA 1SDYA 3GHRA 2LVCA 1AE6H 4O54A 2I26N 2OMNA 3OXRB 4EAEA 5J12B 3U2SB 2I7GA 5F6IB 5DT5A 1Q0YH 4PW3A 5DVNA 5FO7B 3KZ8A 2VQUA 1DORA 1CD1A 2XTKA 1BIIB 5C2CA 5IIEA 4R7DB 3Q2WA 3VXUB 3P77B 2R7EA 1Q7ZA 1M03A 2VLJA 1QD0A 3HHSA 4KK9C 1KTJA 1MXDA 5TGBA 1Z2KA 3CN4A 3MV8A 4MB4A 2COVD 2B20A 3H9SE 4APQC 4G7VL 2V38A 4PJIA 3A13A 1K6QL 4HN8A 4KESA 1MREH 1B31A 5DK0A 2JI3A 3BVVA 5DJYA 5IB1B 1KPRB 4A03A 4Y19B 1AJ7L 3D47A 3ZVHB 4QAMB 1MIEL 1BTMA 1YN7B 2J88L 3STZA 3QA3A 1R17A 4NVTA 4HW6A 2VP8A 1HHHA 1WCBA 2F1BA 2W0PA 2WSYA 5BS0E 5HYJB 5IGXL 1EZUA 2BRRL 2EDYA 3L9YA 4GQ9L 2DQIH 3D25B 2DJMA 4TUUA 1PKMA 2MOGA 3BV7A 4UU9A 2UZYA 1VPQA 2VR2A 3M5ZA 1MELA 1RZIB 5DURD 2D2JA 4XC1L 4J3TA 2ZOKA 1J1XL 3WX7A 4GMTL 2WYIA 4ELDA 1IE7C 1CICB 4NLAA 3VIJA 4TLSA 3IFPA 2X3CA 2DLFL 5AB0A 3KM8A 1KIQB 2OULB 4I77H 2OXGB 4PHZA 1REIA 3FGCB 4DWDA 1XR2A 2X41A 3V55A 2EVJA 2PTDA 3STFA 3THCA 4PRIE 3WLNA 5I1LB 3SCMC 3H4FA 4LRTA 1U21A 4HULB 1BCIA 1DVTA 2Z35A 4OZHA 4PJGF 4HG4J 2X2HA 2F54A 1LLWA 3MRPA 5T3ZH 4RZ5A 3M46A 4NZRL 1F56A 1GGYA 3V4VB 1BGAA 3MLWH 2XINA 4FXSA 3QRBA 2BGSA 5IW6A 3TCSA 1DO5A 3G3DA 3HAEH 1EHKB 4CAGA 2PW1A 3OZLA 1PG7X 1QPXA 3M1CA 4PRHA 5GGQL 2AV7A 4YX2H 1AR1B 3QH2A 3B6SA 4Z3TA 4KAQL 1BG1A 3WLPA 2C3XA 1V27A 2O9OA 1W1PA 3OYXA 2ZWSA 1E7UA 4OLVH 1HWHB 5HYQA 2WMIB 4OUEA 1WBJA 3BLFA 4KRLB 5D7JD 3M7WA 2IFFL 4Q22A 4O5LH 1TUPA 3OAUL 4C47A 4IGHA 2OOGA 3ABMB 4IJ3C 3QUKB 3ABGA 4RDYA 1P5VB 4AVHA 3LIZL 1ZS8B 2AJUL 3MV7B 3OLEA 2OTPA 4MQ7A 4P04A 4TTDC 1E5AA 3T2OA 2D24A 3AOFA 5AC8A 2IAAC 5LVEA 4PGBB 4X6DA 3T0VA 1WAAA 4NP9A 3E80A 4NN6C 4PG9A 2NR6A 8FABA 1A9VA 3WLBA 1LOSA 1PAZA 1O68A 1QRQA 4RDWA 1HWWA 4OH2A 4OZGA 1OF8A 3UU0A 4S10A 5B3JE 1X7FA 1ZZMA 1XPGA 2ABBA 5E9DA 4L3EE 4RV8A 3GM8A 2AEIT 3CBRA 3AZRA 3WZ0E 4AUBA 5IMKB 1BIHA 1UUNA 1GW6A 1DR9A 1MFDL 3BP4B 2BIQA 4G7VH 3DETC 1MWAL 3VXMB 1I0BA 1QNQA 3ABXA 1B3ZA 3KOYA 4HHPA 4LS1A 4LOVA 5FO9A 2G4EA 4P4KA 1N0XH 4XNQB 3OX8B 3UT0A 1XO8A 1S5TA 1IB5A 3GO1L 3ZHFA 1R5YA 4UT7H 3CSGA 3WN5C 2WMFA 2D22A 3ORWA 2GBAA 3O6KH 3IMRA 4LKXB 4WI0A 5EF2A 2WLHA 4NJGA 1ZVHA 5LNGA 1A3ZA 2UVEA 3KCWA 1QFWL 1FQ9C 1E0TA 1PKLA 3EMQA 3LY0A 5IGXH 3RVVC 1IM9B 3QXTA 5AL8A 4KMQA 1G7HA 3ZO0A 3OPZL 1IEHA 5FEZA 3SY8A 1Y1UA 3LQAH 4OFQA 2JCWA 1XF1A 2WZIA 5DZVA 4DF9A 2FQFA 1CK0H 3T2NH 4I0CC 1TJ1A 2QS8A 4W86A 3L6FA 3VFRB 1VLXA 3GR4A 2C1HA 3V4BA 3TO4C 3VQMA 2YXOA 4XBGB 1ZAIA 5D37A 1V6UA 3ME0B 1LWJA 4S1FA 2J7HA 2DZUA 3B04A 3UR2A 4MXWL 3ARZA 5DJ6B 2J6EL 2Q87A 1GJWA 1K2DA 1GOKA 4J3SA 3BSHA 3D09A 1VHPA 1EWEA 3H3KA 2I14A 2XGBA 1WZKA 3MYJA 3CU1A 2FD6L 2CLZA 1A1MA 2WCSA 3FONA 3FZUC 5GRZA 1JDFA 3NIFF 2E25A 3PN8A 5TE6L 4RZCB 2WBGA 1FP5A 4YXKH 4AICA 1WDQA 1BQKA 3G6JA 4MMZB 1HFBA 3NIDE 4Q8PA 2RHEA 1VHCA 4QG9A 5A40E 4A3HA 3PUUA 2FQGA 2X0WA 4HUXB 4RNFA 1UD8A 1KKRA 4IIFA 2O5NA 1QRNE 3JTSA 3LEVH 4MHHG 2IKGA 3MJ7B 4OFYA 3VI4E 3O0LA 3GO2A 4XTIA 2GJZA 3CYVA 2MMXA 3DSNA 15C8L 3VWJC 1KBJA 3G77A 5KVEE 1VZIA 3GFXA 4Z8FL 2HXAA 3VA2C 2XTLA 2DKMA 4ODUA 3HMXL 4R90H 4C56E 2WTRA 3SPVA 2LLGA 3GS7A 3S3JA 3QNZA 2KMWA 5LCVH 3TV3H 4XMWA 1C9DA 1F90H 5D4IA 1FFOA 4NSKB 3VYOA 4BFGA 4O02A 5IG7A 4U7SA 1OK6A 1W2KT 3GKWH 4NPYB 1A7RH 2DBJA 4AX6A 4BQ8A 1S3KH 5IEKA 3MV11 1LNUA 4H2CA 2V5LA 2NSXA 2QIIA 3BVDB 1OF2A 1SMDA 1G6RH 3ULVF 1XLJA 3L7FB 4P5TA 3FH5A 2IMMA 1VEMA 3CH1B 4OQ1A 1MFDH 2Z93A 5EC1A 2WQRA 2R2HA 4MQXC 4XBJA 2BK8A 1QNSA 4X80L 3A3WA 3VFNA 1C3FA 4WCJA 2BRRH 2IBGA 1KM4A 1VR6A 2WSPA 2AJ3A 3MYJB 1JZ5A 3DPBA 2PP3A 1DJSA 2UY2A 2YRBA 4ATLA 4F5CE 3NFUA 5DHVB 3DHFA 1QNZL 5DY2A 3WCYA 1XGTA 5IFTA 1AW2A 4PTNA 1HHKA 1NGQH 2GEEA 3U1SH 2Y7FA 3NL3A 3G6JB 3A9BA 4P2RD 5I9QB 1W3KA 3CX5K 3TJ4A 1F2QA 5F9WB 3T0DA 3QSKB 4JFPA 1E56A 1CC3A 3NDZA 2RDXA 5HD8C 3SRHA 1UACL 3RPMA 3ZU8A 3CAFA 1MEXH 4B9KC 3B06A 3OVQA 2DQEH 1V5XA 3B05A 5EO1A 1N8FA 2XIMA 1AGCA 2AW2A 4K8RC 5EO9A 1X39A 2DVXA 2WYZA 3F7VA 4MMXC 1A6TB 2DN7A 4L8BA 5T3ZD 1JHLL 3K8LA 3AXIA 4GXVL 4P06A 4A3YA 1E4NA 2V33A 4ACZA 4L4VE 4K3EL 1UPPA 5EN2B 2JWYA 1V6WA 4YDVA 4QLJA 5FM4A 3U0PB 3O2DL 3WS3A 1WFUA 1T6WA 5MHSE 2QDVA 3BMVA 2IPJA 1E4WL 2HTMA 2NY4C 5KW9L 2VSCA 4QR6A 3URNA 4YEEA 3RWJA 4GRSA 1OAXL 3POHA 3W7KA 3IGAA 3NFNA 2IOIA 1G7QA 3IIXA 4QRPB 3ORJA 3ULUH 3PZIA 2R2HB 2QTVA 1VRXA 4Y5YB 4Z7UB 1LQAA 4PBFA 3W73A 4LANA 2EXWC 5E8OA 1C08A 1RIUH 2DQTL 5D1QA 1QHZA 4RIRA 4YL9A 3OLGA 3IUIA 3SQBA 4JFZH 1MZHA 1J0IA 1T89A 4I9WD 2YLKA 5E8PA 2H3KA 4PRPA 1CI5A 5MEQB 2EDXA 7PCYA 5KG9B 3CN1A 2DUZA 2ZTJA 1IBYA 1CXEA 1FCCA 1JWUB 1CZ8H 4OUUA 2Y5SA 4ZO7A 3VXUD 1HJXA 3MNVA 3KNBA 3PU7A 2DQCL 2Y5TB 1XKJA 5EEZA 2GY5A 2X2YA 4LVNB 1CFSB 4OBSA 3CH9A 5FYKL 2XH0A 2IKIA 2A6JA 2A9ML 2YAHA 3UBHA 1TA3A 2Q1EA 1Y8BA 4KDVA 3FVMA 3QHMA 2J1WA 2YFOA 4AY1A 1S7XB 5B3SB 5MEND 2RJMA 3RA7L 3SDDC 1VFAB 5DHXB 5JYMA 1SJAA 2HNHA 3PPCA 4F79A 1NCUA 1OV8A 2CA4A 3U8GA 4HUMB 1TJPA 4XHJC 2J4WH 4L1LA 4OBRA 2IGLA 1NBVH 1ZAGA 4LU5H 5AYTA 3RNQA 4EXPX 2CZVA 2WLNA 3V7AE 1KGJA 1O7VA 3O2WH 5DUJA 2YUXA 1MHEA 3UBXB 3W39B 5JORB 3QJHB 2GGEA 2Q8ZA 4UTLA 2WTPA 4BY3A 3D46A 3OWRA 2XVNA 4ARFA 3V0AC 4C57C 4W8BA 1GOIA 1VB9A 2PU1A 4HU2A 2YS4A 1T5KA 5FB8B 1TMHA 4POZD 4CMMB 1UWRA 4MCMA 4JFEB 4NQSB 2NYYC 3TTQA 4C4UA 2JF6A 2ZXAA 3C0SA 1Q0LA 3PJWA 3OM3B 4IMEA 1PKQB 1HO4A 1BBJB 2FWOB 1H3XA 4IJCA 3FJ6A 1TZGL 2VLRA 2XKSA 2NTSP 5JDSA 4ETQB 3QHTC 1V03A 4FI8A 2J7BA 4LV4A 1KJ2H 3DX5A 5IUCA 5CSBA 4PRIA 1ZAJA 2HT3C 4XNAA 1XIWA 5I07A 2WMPA 2G5UA 2WQPA 3KFTA 3N5AA 3FFCA 4LB3A 1HOEA 4A35A 3N43B 1FWRA 1RZKC 2LHAA 1D6EB 4OVUA 1FWNA 4IICA 3V0VB 2E9JA 1NEYA 2QJGA 4G1MB 4X4KA 1B3OA 4S2CA 3V0EA 3HHSB 3ULUL 3GNDA 3KWVA 5DD0H 1GT8A 4ODHH 4TS6A 2F7IA 3DX1A 4PB9L 2BZCA 5LCVL 3D3FA 4H6KA 3HC4L 3C2VA 4OQVA 2A1YA 3NM1A 1D9KA 2XPGA 2J88H 4D9LL 5KUKA 3K30A 3WE6A 3QV8A 1KPRA 1R4XA 5EU6E 2DVUA 3M16A 2I60L 4D6DA 1RPXA 1L0XA 3A9IA 3R2GA 2ODIA 3VFPA 2VDPB 4G8GE 2B7DT 5ALCH 4PJDB 3IU3A 1WFNA 3DX4A 4UZSA 4Q33A 2A2QT 3UO8B 1K77A 1NGWA 4PJGA 3DUHA 4E38A 5J6SA 4J4PA 3WFCL 1V7AA 5KANI 1FCUA 1WAAE 3BKJL 4TVPL 2QQKL 2PLKA 4B3ZA 4R7JA 3H0TA 4NNCA 4QYOA 4W9GC 3OKOB 1HSAB 1TF4A 4UIKH 4L3EA 4HMNA 1NF0A 3B40A 4AYGA 2AL2B 4ELME 3BP7A 2W0LA 5DR5L 1LVEA 3JRKA 3QZPA 2WXHA 4F2BA 5HBFA 5AAMA 4NP4L 3A06A 3GRGA 3VQ2C 5CPTA 2GITA 3H54A 1ZBKA 2HN7B 3RLHA 2WP3T 2PPGA 4DZIA 4M80A 4NUQA 3APMA 4J23A 2HBXA 5ITFB 2ISDA 3CDFA 3PHQA 4GIAA 3OZYA 3PFUA 5IOKA 4L8DA 5E9XA 4DEPB 1Z9OA 5DJDA 4XTRC 3S4TA 4K23L 5FYLE 2NXIA 3CL6A 1FSKC 3QFWA 3EYUH 3QCTL 4M93B 4UXDA 4N0UA 2XZ9A 4WDTA 4F7PA 1TR7A 3U9PL 3ZDZE 3QEQD 3WS6A 1PY0A 3HOGA 2C79A 3WL1A 1BYNA 3B1TA 5A6JA 3WUZA 2DMGA 5F1KC 5JA9A 3LRMA 1ACYH 4P4KD 5KW9H 2F5AL 4LTSA 1Q9WA 3SKNA 3LGDA 3CXOA 5DWPA 2I27N 5F0JB 4BKLA 3MV7A 4ZR8A 4PJHB 1FZMB 2PCPB 4NG3A 3WBXA 4FAMA 5AB3A 5GSRB 1NWUA 1WA3A 1DXEA 4JY8A 3BQVA 1U2CA 4YHOH 3QAZB 4YBLC 5ECJE 1Q0HA 1GKEA 2Z8SA 3UAJC 3S6DA 1VF5C 3WD5L 2HRPL 2YOCA 3R13A 3QDME 4OCSH 3EKLA 1LXMA 4C60A 1HSAA 4XBEL 3TFKC 4Z0BH 8RUCA 4DAGL 3QRFM 1QI4A 2KX9A 3IWPA 3WO4C 1XV8A 3TBTB 5I1HH 2Z4TA 3SDXF 43C9B 4JY9A 5JIWA 2YD6A 4N6QA 5ADOL 2YXMA 2YOAA 5T33H 4OOUA 2YD1A 3QYNA 1QRNA 1E30A 1KXVA 2MTAA 1BQCA 2WKGA 2X1PA 4OLEA 4JZNA 1OB1B 5DRXB 1F6AB 5AW3B 3U7WL 4DJEC 3NPZB 1EC8A 1R3WA 5I6LA 1XLHA 3FU8A 3O8XD 4X4YA 2GLKA 4IH3A 2OR8A 4IIEA 1IEVA 2R4SH 2ZX6A 3CMOH 1OCBA 2P28B 3N43F 1PUDA 3BW3A 1DQIA 4JFTA 2XPKA 2AOSA 5ANHA 3WSQH 2HEJA 1UD3A 5EZLB 4ZFOB 1SW3A 1QASA 4XPTH 3NGJA 4H3DA 3KAOA 2ZIDA 3IUHA 4H0IA 4Z3JA 1PNDA 4Q4MA 4X99B 4ZX3A 2QVTA 3H1ZA 3KG5A 1DJQA 1BD0A 1E70M 2O5YH 3AUVA 3NZHH 3OHXB 4LL1A 5CKAA 3VI2A 1BLNB 1IZKA 1S2AA 3HI1A 4NZCA 2HG5A 1I4FA 1LK2A 2IGFH 2PR4H 1JK8A 4AYFB 4ZMYA 2EDKA 1H5BC 3GIVA 2O30A 3H2EA 1RZKH 5BCAA 1DIOA 5JHDE 1RHFA 2ITFA 3BN3B 4TV5A 4IIQB 4YVUA 3D4GA 3MV9B 1T1RA 2MCG1 4DQOH 1B2WL 3PCYA 3RYSA 2MQ0A 3H4WA 1QUNA 1QZ1A 3UJJL 4O1EA 5D7LB 4XOBA 3W87A 5BW6A 3GG8A 3TFXA 4ERSL 3GSRA 2CBQA 3EYUL 4X4ZA 5K9KA 4U1LB 1Q63A 3I6GB 1R3LA 3MMDA 3G6AA 4BFBD 3VFOA 1S7TB 1VJSA 2ZXDA 4PTUA 3QKEA 4M5PA 4I0PC 1IBFA 4F57L 5IVZB 4K3JH 3ITCA 4EOWH 3HBQA 4B0MB 2H2PD 3N15A 2E6AA 4GO6B 4AKQA 2Q86A 2HXTA 3A6CL 4JN1L 3UBXI 2P8BA 2AJYH 5ABFB 2QJDA 4JANA 2WZEA 4HD5A 4TVSa 3EUDA 3QLLA 3S1XA 4POZC 5HLTA 1R46A 4N8CL 3WUWA 1EUAA 1PD0A 4RBPK 4W7UA 1KIRB 2YAPA 1M7PA 4RMBA 1DEDA 5I0VA 1WAUA 1KYOK 2PUSA 5HQLA 3NXLA 1D2PA 1IC4H 4R83A 2C71A 1TE6A 1ZWIA 1EEZB 1O6TA 4KBXA 3EEGA 2PYED 1O4UA 4C6EA 5I1CH 4O52A 3MRKA 2Z64C 3NZSA 1KYFA 3HPSA 3GUGA 4J2QA 3V8CA 1H9VA 4XCYA 1F4XH 3BDYL 4UILH 1O95A 4KQ3H 1FYTD 4HIQA 1BECA 4BK9A 4KPHH 3PP4H 2ENQA 1ZLSH 5F3BA 5D7LA 1DUZA 1KXVC 4WFEE 2I9UA 1NGPL 4IRSB 5AB9A 5JW5B 3C2RA 1QWUA 4PRPE 1W2PA 2QVWA 1H3PL 3QUXB 1T1YB 2EXTA 2H9GB 4WQOA 5DR5H 4AX3A 4PJ5A 3WIFA 4NQCD 3ULVH 2NXGA 3QC0A 4KO5A 4GX8A 4NI6A 3V5OA 1R3TA 3UGVA 1T8QA 1J18A 3KDNA 4JFWA 4Q4QA 3MXVL 5B1CA 4GY1A 4MMYA 4OT1H 1HO1A 3W0WD 1GG1A 5IESL 4JNZA 1IL1B 5F44A 3B7YA 4NZTL 4DKEH 1K3IA 4DN4H 3GB6A 4LCRA 4UTWC 5I78A 1OF0A 2C6QA 3IARA 4I0KA 3T3PE 1ZVSB 1M5WA 2NZ9D 4NO3A 1T1XB 2BHZA 5HVWA 1A2YA 2ZQKA 5JOEA 1DWIM 2VENA 3LV6A 1BFTA 3FPXA 5J04A 3FU9A 3BESR 3LMJH 1GOFA 2IWFA 5HGDA 3MLSH 3JT2A 3NQIA 3R06A 1N5YH 4TX8A 5L2KB 3POCA 4LLQB 2OZ0A 2JK2A 1NFDA 3WN5A 4XMPH 3EH3B 4XBPA 5F0LB 4KOCA 1AANA 1ZWIB 4LEBA 4D72A 1X8FA 5CC3A 3SPIA 4ICMA 4XAYA 3S5ZA 4Z7VB 2YD2A 2W63A 1BSIA 1EP1A 2PDLA 2VDKH 2PPFA 1CR9H 4ACYA 5KSVA 3FLUA 3X1FA 2Z92A 4Z7QF 3V6ZB 4DKFH 5BNXD 1K9DA 3RF9A 5KZ6A 4AFYA 3ULVC 1JNJA 3QUML 1MRQA 1RKRA 3VKDA 1JGLH 2OKMA 3CLFL 3W7GA 1RSCA 5FW8A 1T3FA 4ENED 4QXUL 2ICWB 5FF6B 3DO3A 5FYLL 4QAIA 1JVSA 4HNUA 2CH8A 2FSEA 3ZDZF 1JK9A 4NN6B 2DQWA 4G6MH 1R1CA 5SV3A 4MY9A 3BO9A 1UKOA 2XACC 1HXKA 1LDSA 1IC4L 3T6CA 1SRDA 4PMXA 2ZADA 3CH8A 4ZFQA 1NIAA 3B9EA 1BZ9A 3OXSB 4FYQA 4IPNB 4Z1AA 3E1ZA 1E8YA 2WHVA 5D4JA 4UNKA 5TBOA 4B3LA 4X9YA 1CIDA 3KYOA 2KQMA 4OIIL 3MRBB 1EK3A 5AZ2L 1RALA 9CGTA 1I2QA 4WJXA 1B0RB 2N3JA 1KXQA 2WXGA 2OS7A 4PW4A 2NYYD 3O2VH 4WU7B 3S5YA 1CVRA 4ZUTA 2W0FB 3FYYA 4Z7IA 3NZHL 1DSYA 4N2LA 3G1HA 5HJXA 2B2XH 1E8WA 4OZGB 2HJLA 1TCRB 2A3LA 3AALA 3TBWB 4M93C 4XP1L 4FXFA 3FW6A 5CCKL 5BROA 2ZRXA 3TZFA 3CAVA 5TF1L 4F7KA 4Y8AA 3MLRL 3ZPDA 2OG9A 2NNAA 1YTDA 1AQDB 4JO1L 1YPZE 2HG0A 2E5DA 1TYEB 1WBHA 1GS6X 2V9QA 4DY1A 4KNTA 2QQLL 4JRFA 4BKTC 3F7YB 5IV2B 3MO1A 3VILA 1AXSA 1UBSA 5TDOA 3M5XA 4FK9A 2AGJL 2VT0A 4QX4A 2HROA 2WQDA 4H2HA 4EXQA 4I5BB 3LMJL 4R4BB 4A2DA 1NL0H 4X6FA 4IBQA 4XGZB 1R3JA 4WV1C 3W26A 4YDKH 3GIQA 1ONQB 5DD0L 2QHLA 1DIEA 5HSFA 4LB4A 2J9XA 4HCLA 4L3ED 4HDIA 1UR4A 3HTWA 1O9ZA 2HX8A 3MZTA 1XR9B 2YSWA 2W80C 1DBMH 1ICQA 4RZ6A 4R5VA 1MG3C 4L9LB 1TOXA 4ES8A 3WJWA 1I8JA 1R5WB 3MBDA 3IBEA 1Q13A 2EAWA 3FUNA 5E00A 2XPGB 4B9GA 2BWIA 3NJFA 4W9IC 5ALCL 1TJ0A 3VDGA 2E7FA 4P7NA 1FLRL 4LP5A 4JDTL 3VI3B 2NPLX 2XN0A 3TN0A 4NNXB 3WFCH 4QRRA 2APFA 2XVKA 1EAPB 1QLFA 2IH9A 1AQFA 3QTPA 1J5OL 2R0LL 1HAWA 3MV7E 4QF1B 1S9YA 2AS5M 3D3VA 3QEUB 4GUPA 4JY5H 3SKOB 5AHNA 3MWCA 1NBYA 2NXYC 2WXJA 3SY1A 3UFIA 2WKJA 3J7HA 4B0MM 3JXAA 5E94B 3WQWA 12E8H 1QBML 5I24A 3ABRA 1BD2A 1EX0A 5BUAA 1Q90A 3PP4L 3IU4L 4Z3IA 4U1NA 5MENE 2A0LD 5EEYA 2FDMA 4ZNEE 4Z95H 3UYPB 2HDJA 4KIRA 3FNKA 3RHWK 4Y4HA 4ZS6C 2XH4A 1PZSA 2VXUH 1FWTA 1DVZA 1QFHA 3UZQA 1RZJH 1MFVA 4FNQA 2Q6WB 2XPYA 4BKSC 3KGRA 3NRQA 1YC8A 3QFEA 4OV6F 5BVJA 2WM0A 4G8FB 3IGKA 2HN7A 2XFRA 4JREC 3PB0A 3EOLA 3CMJA 3DHJA 4XO6A 2PC8A 1E4KC 2QPUA 1T1WA 1C5BL 3C08L 3IDNA 4JRYA 4TF4A 1M7DA 5EULV 5AALA 5I73C 4R4ND 1MZRA 2BMBA 4WEBL 4WUIA 4X7EC 1RK6A 3WLOA 3NH7H 1EBHA 4ODWA 1AL8A 2YPLD 3OWEA 3LI1A 4C6NA 3STLB 5GJSL 2HRHA 2ZF9A 4MD5B 3FO2A 3RDTC 1DVFC 3D6NA 5BV7H 4LLDA 3DI1A 5CJXA 3TROA 3QUZC 3HG3A 1SHXA 5K39B 4E41D 3VFNB 1A1OA 1W3IA 3AROA 2E46A 3GKZA 1OANA 4AVIA 4W88A 1VADA 1XLDA 1CF8L 1V7ML 1CFBA 3BLPX 3D18B 4HC1A 4GJ1A 2XIJA 4OIFA 3C8DA 1XGTB 4JPKH 1S5WA 5CILH 2YQGA 3WQRA 4TVUA 4BD4A 2ZNXA 1CLVA 2WIIB 2TPSA 3FYPA 1I7TA 3HZMA 2FNBA 1MXSA 4KKLD 1YEYA 4KK8D 1MSPA 2R4RH 5CKSA 1BF5A 5HMEA 1M3JA 5K1VA 1GGOA 3WBDA 2K1MA 4KTGA 3GTVA 3QXDB 4DK3A 5D7IB 3X17A 1J88A 2FKPA 3NJIA 3EXTA 3ANMA 3EEZA 2OT0A 2BDNH 3NVTA 4IIQC 1YYLH 5KYXB 3ZKXB 3QUYD 5C7HA 4FTVA 3E12A 4W84A 1O7AA 3CFBB 5AHIA 2Q6WA 2HISA 5HVGB 2NV1A 4PG2C 3S48A 4Z76B 5E4EB 4BSVA 1P6FA 5C0RH 2OJZL 1YBQA 1NFAA 2XWDA 4IMGA 4YDVB 7TAAA 5JC1A 5IMMA 4BFEA 2XSBA 3DFOA 5DRXA 1K1DA 2JXMA 3L4TA 4PS4L 4DZ8B 4UTTA 2YPVL 1O0VA 3KZPA 1EOKA 1B4KA 4QROA 1J9TA 4L37B 1UXSB 2VZUA 2LTQC 3NBNA 5EFFA 3DJ9A 2Y23A 4KK6C 4Z1CA 4U4MA 3STLA 3TZVD 4AQ8C 1TKWB 4H5SB 4OD1L 3VCLA 4UMGA 3FUKA 3WJLA 3H2NA 4C7DA 2VDLH 1BXAA 4PWGA 3FDKA 2GFBB 3MT1A 1RFDL 2IAMA 2H2SC 2I07A 3HNTH 4JR9H 4PUBH 5E8OB 5J89A 5C0NC 3FHQA 3WEOA 1XI3A 2BNJA 3UWUA 1PSCA 1COBA 2C26A 3LPFA 2NWRA 4G56A 4GIYA 4MB1A 3ZL2A 4B9CA 2APSA 3BURA 1VPYA 2A9NL 3N1MC 1C90A 3OGOE 3GU2A 3P82A 1JK8B 4HOWA 1MRDL 3JWNE 4Q6KA 3GSUA 4FQXC 4RNIA 3IDJB 3MRNA 2Y1FA 1TTQA 2C3ZA 1DVUA 2PRHA 4PBGA 4Q8UA 4A3QA 1YEIL 5RUBA 1SO3A 2YPLB 2ZDRA 4MJIE 4KEZA 1SM9A 4FG6D 2DMKA 3P0XA 4M62H 3EOSA 4LCCC 4H7ZA 2AGJH 3NH7L 1YJDH 4NNBA 5B7MA 3QDHA 3AY2A 4FNPA 2ON3A 5DRNA 3WIIL 4OLWL 4Z76A 5I18H 1K4CA 1CBVL 5DBTA 3TT3H 3FSUA 3W9ZA 1G87A 2XSXA 1F11B 4JO8A 1TTBA 3C5ZD 1XLCA 4BZ1H 2ARJB 3W2UA 3SFWA 4IUGA 1E8XA 5K1JA 3TLLA 2R0ZH 2ZG3A 4LGXA 1JD7A 2QADC 3KJ6L 3MUJA 1S9XA 2VZ3A 5EV7A 1KGWA 1PU0A 1FYTA 3BWZA 3MNMA 4MDIA 5IQ9A 2C14A 2P1FA 2BP3A 2H0JA 2Z91A 3GLDA 3LSOB 1OVDA 2FYMA 3WOVA 4ZUVB 3VUPA 3MRLB 5DHYA 1UPMB 3U82B 3VH8A 2QJHA 1LDPL 4F1SA 4I7WA 1XCXA 3WE1A 1ZBVA 4A2SA 3X14B 1WEJH 5BU9A 2NX5B 5IDZA 4EPKA 4LP4A 2D9QB 2YK1L 2OX1A 4DP9X 4RNRB 3EGSB 1DIDA 4HS3B 2O1AA 1V02E 1PLCA 3HV8A 1JPSH 2X3AA 1F05A 3HGJA 1BZQK 4WW2B 3MO7A 5CPOA 3C75A 3BAWA 3PAOA 4QRPE 4XZHA 4OV4A 1FNSL 4O53A 4U0QB 1XYCA 3IANA 3ECBA 4X98A 2QLVB 3IPBA 3IJHB 5BZWB 1TPVA 3I7SA 4TMBA 3X3FH 3IJQA 3B9NA 1PFOA 2ABAA 1ZNNA 1OAYL 3GLZA 4QHLA 2AI0H 2IKJA 3RTQB 1YEWA 43CAA 1LO3L 1E5BA 1WDPA 4XMXA 1JPTL 2HRGA 3KVDD 4UDUA 8CGTA 1W1ZA 4F7TB 3FA4A 1MNNA 4PC8A 5GGVL 4Q58C 3C8KA 3KM2A 4FHBD 3OZOA 1FWXA 3FQTA 5IVOA 3T3MF 3MJYA 4GKSA 5GRUL 2VEGA 4XUYA 1KM1A 3A67H 2J57A 4PRPD 4HEME 4D94A 4AVNA 2QUUA 5I6OA 4JX6A 5ABGA 5IF0A 3CFUA 4P2OC 1TVLA 3G5VA 1CXLA 1W1A1 1TQTA 3EF4A 3VMOA 4K15A 1HIML 1JAEA 1N59B 4WEBH 4KMLB 1II4E 2ICEC 2YUZA 3JZ7A 3MLSL 5TDPB 5JNYB 3GZAA 1XKYA 3RIKA 2VX7A 2CO7B 3UYIA 3GI8H 4NCC1 5KTEL 4FI4A 2OTDA 1I0DA 2X1QA 2WWKO 1ALDA 2FZMA 3L12A 2BH0A 1ULVA 3LEYL 2VERN 3BZ5A 1SBBA 1ADSA 1YNLL 2IH1A 2Z6FA 3CFCL 3MRHA 4OLZL 3RB7A 3X1GA 4FLOA 1YJDL 4O9HH 4HJJH 3GBML 3WMQA 5T3XH 3PBGA 4PS3A 3VRJA 3WTVA 1DANT 3T44A 1Q1JH 1D5MB 1OAQL 4UT9H 4I87A 2HX7A 1ZHLB 2XICA 3MV8E 1JDAA 3MSDA 1F6YA 1OP3K 1YPZA 2AV1A 2EADA 4O0KA 1CEOA 1AP2A 1BPLB 2CM5A 3KL5A 1I8IB 3CV1A 3E0FA 4JTKA 3NG5A 4ICNA 4IZGA 3MSRA 1H7RA 1T1ZB 2O56A 4FQLH 4QT5B 3SBWC 4NYUA 3CEUA 4PMJA 4OVXA 4WTWA 3DVGB 1GJIA 5L2JA 2X53A 3L3KA 3QJTB 1XEUA 4L8DB 1C16B 2ZOLA 4NYLB 3LZ3A 4A8LA 1W3JA 2OJZH 1TTAA 4KKCD 3WKQA 2AQOA 1Q9LB 4R84A 4W8LA 4O4YH 2PP9A 4YSSA 3FQYA 4PRID 1WF5A 3Q9PA 3UAEA 1TENA 2VVNA 5GJPA 3TXZA 4G6JL 4JIIX 3B4NA 1SEBA 3T8MA 4C4KT 4LLUA 4ZQTA 4D9RE 1FWIC 5C0AD 1TV3A 3NEXA 4EI5B 1LBMA 3N9KA 5ESVA 1A3LL 3E38A 5A5WA 1AH0A 4JPIB 3TUUA 1KJ3L 2CJTA 4UQAA 5F1NA 1OXYA 3UPRA 3W75A 4WWNA 4DW2L 2WSRA 3LHVA 4BCZA 1UZ4A 5AVHA 4GUCA 4ABQA 5BS0D 4FX7A 3GUWA 3AIWA 4OZHE 3QORA 1KB5A 4PMEA 1M41A 4MZ8A 1FNLA 2VZOA 4FALA 1P6AB 5GS0D 1YMHA 5C8BB 4I5XA 1CXFA 3V95A 3AU1B 2XA3A 2XFFA 2A9NH 4FL4B 4K07A 1GC1L 1S7RA 2AXHA 1NANH 3M41A 4NEHB 4AUYA 2A7PA 4TPRH 3TA4D 4QRNA 5DMLA 3IFLL 1H50A 3KLSA 4WW2F 3TBTA 4HUNB 4ERAA 1NFIB 4GSXA 1IQDB 5F7EH 3VXOB 4DKAA 3CK0H 4XAWH 3FIGA 2YGVA 3N3EA 1E6RA 4HYVA 5INCA 5D71H 3DC8A 1OP4A 4DXKA 3CXDH 3F7YA 4ZSOB 3GHEL 2UWEF 4JDVB 3W9EA 4DUVA 4LSDA 4UTFA 4WWKA 5BOEA 4O18A 5IW6B 4ELMB 1X8CA 2NY4B 4Z7WB 4A4AA 1UUSA 4I18B 4HNOA 3WY4A 2GJXB 1IF2A 2BY2A 4F7CB 1H19A 1ZFJA 2PBGA 3P0GB 4TV3A 4N90E 3VD1A 1UKSA 3EJPA 5BOZG 2WQ8A 3DEQA 3OG3A 3V0TA 4TQTA 4Y4KA 3ZDXE 1DXFA 1HW6A 1HNYA 3EPOA 2YXXA 2PAJA 4X7CC 1GZQB 2F19H 4UQCA 1ZA6A 2FJUB 5I6KA 1FH9A 4M7SA 1R9FA 3EA1A 1ZPLA 3DBXB 2WWCA 2HE8A 4HSOA 4F8NA 4OLVL 4A7VA 4AQLA 3UFYA 1HXMB 3B7TA 3BGJA 4F3HA 3ZHYA 2DLIA 8FABB 3BVNA 4NQWA 5DMYA 1SZEA 1B4TA 3O1NA 4NO0D 4FOUA 5EB8A 2JKLA 1XINA 3AU1A 4EZMA 3IT8D 4MD4A 4PP1D 4CU6A 4I2XE 3KZSA 5LBSA 2OZ3A 1MEWA 3FJNA 5EZOL 4L61A 4ISVB 2OELA 3S9YA 3N12A 2HMCA 1WV7T 2OV0A 5MI0B 1QABA 2LR4A 5FO8A 1SHWA 4C56B 4Q9CA 3VX0A 5IB2A 2WV8A 3ATDA 4KF1A 4TNFA 3O3EA 1R2SA 2Z31A 2VDGA 4LBUA 3M5YA 3V52H 1ZCRA 4CJ0A 2F15A 5E1GA 3UG5A 2HUEA 4HCRH 1A3LH 5KYWB 3GXUB 1UWFA 5JUEL 3KLAA 4WW1B 3TCLA 1OSPH 3IJEB 3ZY7A 4Z42C 5F97E 2DZWA 1C5BH 2B08A 3C08H 2Q86B 3RE0A 1YNYA 4ZE4A 5ABFA 3IAGC 4MKVA 4PJXE 5JXEA 3FTXA 4XOCA 1IKFL 5GRJH 1LWHA 3TYFB 4GS7B 3QF0A 2ZCHL 3HI5H 3V0FA 3UCCA 2HKFH 3ZJAA 1LLAA 3EXJA 2FYYA 3OG6B 3T0EC 3NESA 5LNEA 4DK6A 1FH2A 1P5BA 3NZ8B 5BXTA 1JZGA 1U8PA 2PYEA 2ZUSA 4QRTA 3V0WL 3P67A 1XCQA 2OXHA 4LYRA 4A2GA 3QULB 1FCGA 3GI8L 4P2OA 2WNZA 3GXPA 4W5UA 2OP4H 3JWDH 4ZZFA 1FWCC 3KPSA 3VG9C 1V93A 4XWOC 4HS8H 4APQD 3NJJA 4JPWL 4E5XG 1E0XA 2X2UA 1S7VA 1KIUA 4PB0H 4U31A 5ALBL 4J3OG 5C0CD 3GWJA 1VFTA 4ODVL 3F8UB 4N6RB 4BSWB 3CUGA 1ZJAA 4GW5A 4R53A 5IHBA 5CZRA 4HFWA 1D6VH 3BIBX 1XWYA 1CO1A 3VTAA 3Q1SH 4A04A 3GVRA 2JIXD 1S8DB 2Z31B 3H9ZA 5JXAH 3ANYA 4JEGB 1EXUA 4D3CH 5IVXB 2M8XA 3WNIA 3L2NA 1JHLH 4APQA 4M29A 2CO6B 5BPPA 3FT2B 1V7YA 3ILDA 2VLLB 3BKML 4WRLA 3ZVHA 1WICA 2EDHA 1QSEB 2QCEA 5AC7A 5IXEA 1PG7W 3D8MA 5LNDA 1QSFD 2R23B 4EIUA 1AXTL 2OL3B 2OQJA 4FIRA 3DGBA 3HR5A 2WC7A 3DLQR 1GAFL 1GCFA 2YPVH 4GY7A 1T1XA 4HFUH 4KO7A 2F53D 2D31B 1QK0A 4O02B 1B4LA 5F88B 1M9WA 4E9TA 1ET5A 1OBAA 6PAZA 1JV2A 2QKSA 1NFDB 1N10A 2KZWA 2AQQA 1U8PB 2PYEB 2K9FB 3CFKB 5EH1A 1LEIB 5FS5A 2JSFA 7FABL 2P8LB 2EPNA 5C2BH 2GSMB 2J2ZB 1TFVA 4G8TA 1QSFA 3SFKA 1VBRA 4KOBA 1SXCA 1Q1PA 5H2ZA 2XDHA 5T1KA 3S34L 5I6XB 1XB8A 4V1YA 1TITA 3V52L 5D30A 4Z2HA 2NDGA 1BVLA 3DPBB 3NK4A 4GG6A 1C8XA 2JD0A 1JXDA 5H94A 3VGAB 2CIKA 2X4SA 4BV1A 1DTNA 2WLJA 1A7PL 4DGUA 3NIDF 3PGCA 4UCFA 4ZTOH 3EXLA 5JUEH 1ZCOA 4WZHA 1WIUA 2COQA 4GLRI 3QJFA 3QUZD 1NC2B 2TRHA 4R7DA 4CVZA 3SKMA 1SFLA 4ML4A 3TJLA 1NAL1 3HIZA 3RTQD 5G4HC 3BK0A 1CFVL 1UKTA 4NAFA 2X4OA 5I6MA 1FSKB 3LDVA 1J5IA 1DQKA 2XSAA 4PJIB 1NGZA 1T2QH 1SU5A 1MH5A 2WJFA 4WOQA 1F2XK 2A85A 1JZFA 3FHAA 1N4XL 2IBZX 4ACZB 5KVDE 1NWPA 3OAZH 1F97A 4TNEA 3C5QA 2D0HA 5JMOC 3BAEH 4X9GA 1C8QA 2DF3A 4YVXA 4NWTH 4GH1A 1YIXA 1W72A 2HSAA 3CGTA 5D1QE 4WW2C 2GVJA 3H26A 3HE7D 2F9BT 1UENA 1JI2A 4GXVH 3LQZB 4LHQB 3QR1A 3TH3T 4BQCA 2X0YA 4OUOA 1WCQA 1YNPA 2XBZA 4UOZA 1Z7JA 5LGJA 2QCDA 4M0XA 4FFZH 1OKEA 3DJRA 2FUTA 4YBQD 5FJTA 4UB0L 1BREA 4H9XA 3BOFA 4OZFA 5IQ7L 4GKNB 2Q09A 5GPRA 3PAJA 2XLLA 3TYUA 4JTQA 4GG6B 5EPMA 4IJBA 3SE8L 2WAHA 4I1RA 1LT7A 1DWFM 2Z35B 1W0VA 4XPAL 4LBAA 1BVKB 4LEXH 5FW7A 4NILA 2GJJA 3KBEA 3DSFL 3SKMB 4NQEB 2XIOA 4M7ZB 2RAGA 3K6SB 2PN5A 3IRPX 1TRDA 2EKJA 1WSST 3ARPA 2PDFA 3AI0A 4IMKA 3ID7A 4WTQA 4JEJA 3THMH 1S3TC 5I06A 3ETBJ 4I5BA 4R4BA 3ILQC 2Y1CA 4HZAA 3SDAA 3WJYA 4OCXH 3OJMB 3EIFA 4KKQA 3A67L 4EZJA 5I76A 4KPLA 3DURB 1OSZA 3VXUE 4NASA 4PVBA 3CCHB 1CZ8L 3ARSA 4X9FA 1CJYA 4Z7OE 5AYIA 5AVVB 1V6VA 3RCNA 5I71B 1XJBA 3BPWA 5JPMA 1T6VN 4C1KA 2C4FU 3RY6A 2CGYA 3ATZA 2AEPH 4JQIH 4MA8H 5H37G 2Y1YA 4KK8C 2FZ3B 3NPSC 2VWEC 1GZHC 4U6YB 2MQGA 4OCNC 1YE4A 1UT1A 4PGBA 5A6TC 1BQLH 4QHKI 1ZGLP 4D6CA 1YN6B 1HKVA 5KTEH 2XG4A 3L5WB 1W17A 1EAPA 1BFVH 3BQUD 5IHZB 3CIWA 1MRFH 2BOLA 1IIIA 3Q2VA 4TUKH 1YNLH 2E67A 1TQCC 4P9HH 5T91A 4PLNC 3OB0H 1OIMA 1DJXA 3JV6A 1WUFA 1ZALA 4Y9CA 5ID1B 4XKMA 4XCEA 1UWGH 3MCNA 3TTOA 3TH6A 4I3RH 3CL8A 4NP4H 4DGYH 3NCOA 4EN3B 3FT1A 6REQA 5EBWB 1YDVA 2EUVA 2I57A 1AMYA 1DBBH 4GI9A 4U6TA 3RDTB 4XVTL 5ISZE 1JCMP 4DHGA 1RZFH 2VL4A 4PJFE 1IGJA 4U7KA 4B9FA 5AHEA 3EOAB 3O8XA 1MMFA 5I1DB 1FL6B 4Q97A 2Y7QA 3QHOA 1BG4A 5DLCA 4YSOA 5EU6A 5FOJA 2A74C 3B2VH 3NJHA 1RJYA 4LOUD 1J11A 5DVKA 4O4YL 3WD0A 3GJEA 4G8GA 3RVWC 3PREA 3HQOA 4EN2A 1PHWA 1FHNA 4UQBA 4KK5C 3NEOA 2DTMH 1CE1L 1LD9B 3FQRB 4MCYA 1R5IB 4OSUH 4QCIB 4U6VH 5FV1L 4R9XA 4LLDB 3S6TA 4L65A 2Y25A 2OMTB 3C86A 2XM2A 5M3WA 4LUTA 1HZYA 3AHXA 4IX2A 1WDSA 1GYUA 1RR2A 2G0LA 5HA7A 3MUGB 3GKWL 3MRMB 4E4PA 1JV5A 3LNIA 1S3KL 4Y4FC 4HKZB 1FV1A 4KC3B 3LRKA 4CEXC 1M3IA 1K9TA 1LO4H 3IS1X 1K5WA 1KM2A 1NGWB 4WO4C 6ENLA 3RU8H 4DP6X 4G6FD 3PLYA 4J5NA 1BWKA 2VDQH 3MRQB 4WSHA 1X3ZA 2I60H 3Q6GH 2Z26A 4NBYB 1KF9B 3PPHA 1KW1A 1G7UA 4GRLB 4OFYD 1NC4A 1FRGH 3T0EB 2EVFA 1NCNA 1TTIA 3R4RA 4ZTOL 3H4GA 3GHPA 3HMWH 1WOAA 3BJ91 2CGRH 1S7RB 4G7RB 4PY8I 5IT2L 2NQ3A 2EE9A 1ETA1 2AK1H 1PKYA 5D71L 3F4VA 5CBBA 3G8EA 2VLKB 1WVZA 3U1SL 4HWEL 4HXBH 1CFVH 3VXME 3CWNA 2HPTA 2PDHA 5ILTL 5D2NA 5E5MA 4HHWA 1XL9A 1Q8AA 4QRSA 3QYSA 3R58A 3L23A 1BW8A 2Q0ZX 1OFDA 4PYSA 3TX9A 3UETA 5MKGA 3VFSB 1FORL 1CE6B 2BSCA 3MOAH 2AQPA 3BCDA 5A2CA 1VFHA 4Q9QH 3AGWA 4L8CA 4AIXA 5J9PB 5FLUA 1OD8A 4C4BA 1A6VL 2JCCE 1CCZA 2OMYB 2KYIA 1ZTXH 3UZEC 4F2MA 3R5EA 5KTLA 3SQRA 2X0UA 4QG6A 4JO5A 1CFNA 1LZOA 5F7NC 3O6LH 3QJZA 4WNSA 4QDMA 4IMAA 3WS6C 2FX7H 1TTUA 1D8CA 4FFVC 5AW1B 4D6EA 5C0GA 3IIZA 3CO8A 3VFTB 1V0LA 1W5MA 4CVXA 4I6VA 2A74B 5FOBA 3SJVB 5EYWA 1FVCB 4H7CA 4PGZA 1Z9MA 4PMVA 4BEUA 5EB9A 4Y67A 5GSRA 4ZQPA 4FQIL 2TRYA 2RQ8A 3H3PL 1IEXA 1QTSA 2GW5A 2OMBA 3SGKA 3TLRA 1NSJA 3S5OA 5AW7B 1CGUA 5BO1H 1E4LA 5A16B 5BZDA 3BTNA 3G3MA 2UZPA 3LSBA 3SGDI 3RU6A 3AM8A 2R39A 3L2MA 5AVZB 4BK5A 1NJJA 2J66A 4L9ZA 4V1DE 3GXIA 1BP3B 3EX6A 2X1RA 4UTWA 1SMAA 1A7QH 2A7OA 2OODA 2FJGA 4UWQB 1OM3H 4P8WA 3K4DA 4RLDA 3LZNA 2BNQD 1CGYA 1YUHA 3PP3K 1NM9A 5IQOA 1Z89A 3DFNA 2X87A 4ZQNA 1OTSD 4OKVA 1OD0A 1NICA 4B95C 4XPGH 4U6XA 2F74B 2V0TA 3LHYA 2I69A 2VHLA 3CVIH 3UG8A 2AJYL 1NOLA 3WFZA 1AFVL 3KWUA 1E9PB 2BFVH 3IMUA 1TPH1 3RN6A 2X1UA 2F38A 3AXLB 4ZDHB 2CALA 1D5RA 1H6EA 1TVBB 1JL8A 4MAZA 4QHPA 1OCRB 4U4BA 4FTVD 3JR2A 2YLLA 4PLOB 3ANNA 5J3HC 2FFIA 4U1SA 3VVVA 2AEPL 4JQIL 1G4PA 3KRBA 4PB5A 1ELSA 3NL5A 3UJ2A 5CCZA 2YQ3A 4JHWL 5C9UA 3GBNH 2R4SL 4ALAL 5IROC 1L6YA 4YQXL 4H6EA 2QGEA 4Y16A 3L3IB 5HULA 3IDXL 2JH2A 3SQBB 3TNMB 5IT2H 2J6XA 3O2WL 4PRHD 2YDSA 1AMXA 4QRPD 1V08A 4DF1A 1PX4A 2X7LB 4GB9A 4TUKL 2AKRB 1AZNA 1FXPA 4CC1A 5JH1A 2OK0H 5GGSB 1IIKA 5KYYA 3PXJA 2OCCB 1EGJH 2ZZ5A 1H5BA 4JQIA 4EIGB 4H9YA 2H6OA 1M68A 3SAZA 3TEVA 1SBSL 3G1FA 4NIYE 4MXVF 4YGVB 2QR0B 2R72A 4KDTC 5DWUL 3Q1SL 1IAII 3C2YA 2ALRA 1IVLA 1QLRA 1TU2A 3O9NA 3WDRA 3H9SD 3UWVA 4AZ8A 1P4LA 2DM3A 1OGTB 4L1DA 4KX7A 5T1JA 2GEQA 2RGLA 5I8EB 2B7NA 1UWXK 3S3BB 1RP8A 5C9RA 4A63A 1SJHB 1J7VR 4MZ2A 2AQWA 5JIHA 1XDLA 2WXNA 5DMKB 2JKNA 1NDGA 3E7JA 1R19A 4WTXA 1XPYA 4IM4A 3RAOA 3MKGA 3P1VA 2HB0A 4NKQB 4D8OA 3IJLA 2DW7A 1JGUH 3EJQA 1CLYH 4IU3A 5JIPA 3IIEA 5JORA 3AIQA 3OZMA 4JCWA 1N12A 1NCAL 2J25A 5EA0L 2FZDA 2V5JA 1BM7A 2PDNA 2EKCA 3VGEA 2VXVH 5GRVK 5DYFA 1E6SM 1ZE3C 2UYLB 4HIHA 4BF7A 1L6XA 4JLRA 5J6GB 1KENH 4U6VL 2HMIC 5A8OA 3VIGA 5E8EA 3PZQA 4LRNH 4R7LA 1FH7A 7FABH 4Y2OA 4LUJA 4WFGD 1Q5MA 4DP4X 4IFOA 3T1WA 3NQ7A 2PPCA 2PDJA 1D2OA 4MNHB 3LCIA 3B37A 4FQJL 1LJYA 3UEQA 1PBYA 4UTAH 1IX2A 5JMRA 1ZL1A 3O9WA 3F4NA 3WK0A 5CP7A 2XHYA 4G9FD 4BF9A 5J5RA 4EZKA 6ALDA 1N8OE 2HVKA 4HCGA 5A2BA 2Q7NA 1FRGL 1AGEA 1OB0A 2CIKB 3QXAA 5E5UB 2WXQA 2V2CA 4WI3A 2ZP8A 1HE7A 1I1AD 3CXFA 2J75A 4UINL 3HC3L 4ANKA 2KS0A 3O6FA 3U2EA 2B4CH 1MN4A 2JQXA 4KROC 1XDJA 3OA5A 2BODX 3QR2A 4OU1A 3SUWA 2CU9A 2G0KA 2HFFB 3MGTB 4NHUA 1ZRQA 4NFBA 4Y1AA 4IRJC 3W00A 3NN8A 4PCKA 3DX2A 5I0ZA 4FQXB 1HXYB 1S7QA 4YC2C 1F8TL 4G9FA 1I1CA 4NM8L 4FQ1H 3N91A 4OM0L 2X4UB 1X5XA 5AB1A 3TLQA 4M8VA 5IJDC 3H42H 4X5RA 4JGUA 4TTUA 4ZPTB 1D7DA 3VFWB 1QVOB 5T1LB 3PWVB 5HJBA 1XL4A 3QI9A 1WOBA 2YCEA 1MW1A 1KV3A 1G7LA 2R2EA 3BWUC 5J6GA 1US0A 3M4HA 4AXWA 3RB5A 1QPNA 4Y2NA 3R06B 1XL6A 2DYPB 5GJTH 3N41B 4IQEA 4HHMA 3EFFB 4IOIA 5EOCH 2W79A 3RJOA 3LQZA 2NY6C 1OE2A 5BQ7A 1M57B 4V15A 2PWVA 2PDCA 1CDYA 3SN0A 2KZBA 1EZLA 3ZTEA 5A95A 1E72M 2J7LA 5DJ0B 1BVWA 1LCOA 3JWOC 1INEH 2YD4A 4MS6A 3HAEA