2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
b'SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
2MAOA 2XFFA 4NSBA 4RE3A 2WKLA 3FHQA 2DT2A 4J3XA 1DWJM 1XHGA 2CITA 2J74A 4BA0A 2Y2WA 2Y24A 2Q8XA 1KBKA 1PX8A 1NOFA 1EHNA 1KQYA 1Q6GA 2JD1A 3GH7A 2DSVA 5A3HA 3FXYA 1O7AA 1GONA 2BHZA 3CUHA 1E73M 3ZSTA 3CZEA 3RDKA 3WN6A 4AMCA 4U31A 2WHJA 3VD5A 4NX0A 3VIGA 1CXEA 1XH1A 1W1PA 4Y67A 2ALWA 4W89A 3WY1A 2O9TA 4TXEA 1UUQA 1QHPA 3DC0A 3QHMA 3SIMA 1LL4A 3IJ9A 1OR7A 3PZOA 1E0WA 2QF8A 4HA1A 5AY7A 3T2PA 3VDBA 3AMDA 3RPMA 4NZFA 4D6DA 1F4AA 4J27A 1DWAM 3CMGA 3GM8A 2EO7A 2RGMA 2FGZA 1VENA 5BROA 2WMFA 1ISXA 4Q7NA 1GOWA 4UFKA 1IZJA 5A8MA 3AHYA 3WNLA 3WD3A 5DULA 4NXKA 3ARUA 3VIPA 3BVVA 3AU8A 4DO4A 1KWKA 1E6XM 3GNPA 4V27A 5I5RA 1E3XA 3HG4A 1E4MM 3ZIZA 3OLDA 1KR0A 3VIFA 2A3HA 3BUQA 4D6FA 4PMNA 1AQHA 5IFTA 2WVVB 1FP8A 3DHPA 3KWXA 1GQIA 4W8BA 1Q0HA 4OZOA 4U5IA 2X2HA 1HJUA 1TMQA 1OCQA 3AUAA 2WBKA 4AYGA 4JL1A 3AOFA 2W62A 3WH5A 2GFTA 1BG9A 1CIUA 4DO5A 2DSZA 2Y8VA 2Y1EA 5D8ZA 2CNCA 5ECUA 3CV5A 1E1EA 2X05A 3SCRA 4ZE5A 5A6JA 3LPPA 2NT1A 1Y7VA 3GH4A 3W38A 3L4WA 4GO9A 4OOFA 1B30A 3OZOA 3EJQA 2ZXBA 2XUCA 4W7WA 3AHZA 1PEZA 2ZUWA 5A6AA 3WBAA 1OWQA 3MUAA 3CTTA 4ACZB 1JF6A 2JCYA 3W28A 3W27A 3PZ9A 3OZPA 2G41A 2VVSA 1TZ7A 3MV01 3EDKA 1HKMA 1SC5A 2EPOA 4P7QA 1W91A 1WB0A 2ZUVA 2VX6A 3A5VA 3MMUA 1EH9A 1XH2A 3DYPA 1ISYA 1Q0LA 2PI6A 1UASA 3TTYA 4UCFA 1V03A 4MAVA 3BAWA 2OYMA 4WLCA 5TD4A 3CHFA 2W4XA 1JZ2A 2G3NA 2OYLA 3RM8A 1SR0A 1J0HA 2YLLA 3WDQA 2WHMA 4R5EA 2D23A 4BQ3A 2CBVA 4BS0A 2VOTA 4A03A 4LUPA 4W85A 1U33A 4YN5A 3EDJA 3ZJ6A 2CERA 3VU2A 5I24A 1K6AA 3M6DA 4EAMA 3N04A 1RP8A 1CGYA 4PMQA 3A4AA 3EDFA 3VDHA 1AVAA 4P8UA 5EBAA 3A47A 3GBEA 1ISWA 4GINA 3A3HA 3A4XA 4MNKA 4C7FA 5E0CA 3AIBA 5A6BA 2PF0A 4BZYA 1FA2A 2CIPA 2J7GA 3CZGA 1GOIA 4UQ9A 4ATWA 1UKSA 5CJ5A 3IANA 1MFUA 1FP9A 1Q6DA 1R8LA 2W66A 4CKQA 2D0FA 4PCTA 1BYDA 1PX4A 4XV0A 3UR8A 2XGBA 3U7BA 4CCDA 4AXNA 1CZ1A 1E4LA 2YDRA 2F1AA 4NZJA 4P7RA 3D51A 4KWUA 4QDMA 5BWFA 3D4ZA 3HMCA 1BG4A 2DH2A 3AHXA 1E56A 1M03A 4CCCA 3WF3A 2ZE0A 2OW6A 1UYQA 3AROA 3W53A 2DEPA 2FE0A 1AMYA 4PTMA 1PZ2A 2YDQA 1QWNA 3OLEA 1J01A 3BLPX 4UOQA 1B3VA 1W3KA 4E4PA 3BCDA 3AS3A 4GZIA 2BXYA 3HG5A 1R86A 1K9FA 1W3HA 2J25A 4LPCA 1C8XA 3U7VA 3LMYA 3II1A 2JEPA 1JGIA 1QW8A 1ZU8A 1E5NA 3OBAA 2VRQA 1E72M 1JNEA 4C7GA 1H4PA 1PJ9A 2D0HA 2V3DA 4LYQA 3VVGA 3CLWA 1G5AA 4JZ5A 4W8LA 2OWXA 1UKOA 4QCFA 5DMYA 4IPNB 1V08A 2W91A 2D20A 1KXTA 2E9MA 2Y1CA 3TONA 1J9YA 2J7EA 1GQJA 2UY5A 1OD8A 2ZUSA 4PMYA 1HNYA 3BLKA 1QHOA 4MTVA 3LX9A 3WH7A 2D2OA 4PMUA 1J18A 2PWGA 4EANA 4MJ2A 3POHA 5JIWA 3WFZA 4D6IA 4B3KA 1UWSA 2O9OA 3ALFA 4JKMA 3D3AA 2FH8A 4U3CA 2OSWA 1EOMA 1UH3A 2UY2A 4DO6A 4M1RA 5CZKA 4PUDA 4Z2JA 3MUZ1 2VX7A 1E3ZA 1QNRA 4UZSA 3NYDA 1E0VA 3WSUA 3BVXA 3VIKA 2BVDA 5A69A 2EACA 4NZCA 5FD0A 3NUKA 2JALA 4ZENA 3WF2A 3SCNA 4P7NA 4AYSA 1HP5A 3OG2A 3FW6A 4J3SA 1JZ7A 1Q6EA 2DT3A 4MADA 3NSXA 1JD9A 4HZ8A 1SMAA 1JNDA 5C70A 1K5HA 2YKKA 3ZHZA 3HG3A 1WDPA 2WWDA 4FLQA 4HOZA 3WKZA 3ECQA 4E8DA 1CXHA 2PWDA 3GNOA 3BSHA 1V3LA 3ARRA 4ZEPA 1MQPA 3RJXA 1HJXA 3AHTA 1VBUA 2VZVA 2XVPA 1UWIA 1BSIA 2BFGA 1E1FA 1K9TA 2CHNA 3F5LA 4TTUA 5FL0A 3H55A 3LPOA 2YOCA 5GNXA 1R7OA 4B15A 2CBJA 4CN1A 5CLWA 1HJQA 1EO5A 4N0RA 2WPGA 5JMPA 2VR5A 5A6LA 1JD7A 1HTYA 4H8UA 5A2BA 4M82A 2W67A 2VO5A 4D6HA 5D9NA 1UKPA 1DTUA 1DWHM 4PMDA 1JYVA 4M8UA 2X0YA 4MB3A 4UQEA 1BYAA 2GSJA 1XSJA 3PHAA 4UOZA 1WPCA 3TTOA 4CD8A 4B16A 2VCAA 1TVNA 4PMZA 3RASA 1H2JA 1OT2A 2WBGA 3MO4A 1GUVA 1BGGA 1WP6A 2BV9A 1KQZA 4PSRA 1JYWA 4JCLA 1V6WA 3AZTA 4PCSA 3PZMA 2D0GA 1WZAA 4AC1X 1VBRA 4W7UA 4D72A 5CGMA 1GVYA 1FH9A 4JAWA 3ZR6A 3BAYA 4ACYA 3VX0A 4W7VA 7CGTA 3CHEA 1XD1A 2EPKX 3HG2A 1OIMA 3LPGA 3BVTA 4AD4A 2CYGA 5DEZA 3LXBA 1LF1A 2G3MA 4H8HA 3VMNA 5E09A 5JIPA 5E0FA 1NOWA 3D4YA 4FF5A 1BFNA 5I79A 4OOZA 4J3WA 1UZ1A 1W9BM 2TAAA 1GORA 3UR7A 4MNLA 3PN8A 3NCOA 5A8PA 4H7VA 2ZX7A 3B9EA 1UA3A 3ARSA 3K1DA 3UESA 5BXRA 1V0MA 1UR4A 4D6JA 4MNJA 1XYFA 1I1WA 1KB3A 3DX0A 5DFAA 4NI3A 1V3HA 4JFTA 4XB3A 4QLLA 3WQ6A 5JC1A 4Z2LA 2MANA 1VF8A 3SEPA 3TTSA 5E1QA 3W6MA 1BYCA 3CZ8A 1VFOA 3MMDA 2E8ZA 1GPFA 1TR1A 2WVTA 2YBTA 2WMHA 4BF7A 3SUUA 3BSGA 4X9YA 1JFHA 1LWJA 2E9BA 2UWFA 4KRUA 3VMPA 3WDRA 3WDJA 1GQLA 2XYLA 1UD3A 4JCMA 4E8CA 5ABFA 3WD1A 1LL6A 2GK1B 2WMJA 2EAEA 3WMCA 4PMRA 3QGVA 1W9DM 2J47A 1FOBA 1GHSA 3WMBA 4GI6A 3ZI0A 1V6UA 1J11A 3S6TA 2C7FA 5D9OA 1RPKA 3WFLA 4RL3A 4PYSA 2Z1SA 3VUPA 1EQPA 1NWTA 1US3A 1WZLA 1JZ8A 1ITXA 1QVBA 4J3UA 3TA9A 5FKYA 3DX3A 5E70A 3DECA 4UFLA 4JIEA 1X6NA 4FNUA 3W82A 4CU8A 3WBEA 2F1BA 4GO8A 2XVGA 3ZSSA 4CD6A 2PBOA 4LYPA 1C92A 1AQ0A 3VDCA 3GH5A 2EBNA 2DDXA 4KP7A 3ALGA 1TVPA 3BUDA 1HN1A 2DIJA 3VIIA 1UD4A 5IXEA 3VGFA 2UY3A 4HPHA 1L8NA 3WEMA 2ZXQA 4GIAA 4URIA 2WZIA 5HOSA 1V6VA 1T1RA 3WD0A 3PTMA 3DYOA 3G6LA 3AYRA 5A8QA 2V38A 2E4TA 1CDGA 4FNSA 2B31A 1EDGA 3WNOA 3DX2A 2O9RA 4KGLA 3EJUA 3N17A 4Z2GA 4GI8A 3VIHA 3L4VA 4F9DA 2BNJA 4XZWA 1WKYA 4OBSA 1MW0A 3F5KA 4CU7A 5CSYA 4ZXLA 1HKKA 1JYNA 4F9JA 3CUJA 3AZRA 3EJSA 5D9PA 8CGTA 1NARA 1NWUA 6TAAA 1B2YA 5ABHA 1B3ZA 1OBAA 5M5DA 2CXGA 4U5KA 2Y1FA 4AZ6A 1ISZA 3UG3A 2XJ7A 4AD3A 2WHKA 1TQSA 4QCEA 5A6SA 3CZKA 3WENA 1EHAA 4Z2HA 2HVMA 3MUIA 3CZSA 2W5FA 4M24A 3EDEA 1BPLB 3KE0A 4OBRA 3T0AA 3W25A 3PZVA 3AIQA 4TX6A 4HP5A 1ZJBA 3BAXA 2ZX6A 2WXDM 1A3HA 3L2LA 3GXFA 2XPKA 3UETA 4UFIA 2X1IA 2WVUA 2ZX5A 1HL9A 2DT1A 2IXUA 1LL7A 4JFUA 4MB5A 3L4UA 3A21A 5A8OA 1M01A 1JFXA 5AC5A 4JHOA 1UD2A 3OGSA 4M29A 3BVUA 1BGAA 3SURA 5ABEA 1VIWA 4B9ZA 2GJPA 4AD2A 3RILA 2EGHA 3HU7A 1HF6A 5C8BB 1H1NA 1GQKA 1AQMA 2X09A 5CSUA 1ITCA 2VL4A 1H3LA 3AIUA 3VGDA 1UR2A 1NH6A 2XHYA 3QHOA 4HA4A 3CPUA 1UA7A 1VRXA 3WY3A 1R0KA 1BTCA 3CZJA 1WE5A 3GXNA 4CVUA 4LXFA 2E3ZA 3ZO9A 3WQ5A 2VJXA 3EDDA 1C90A 1MWOA 2XWDA 5AYBA 3UG4A 1ISVA 1J0ZA 2BY0A 1OT1A 2DH3A 1H0IA 4TUFA 2BHYA 2AOSA 4AD1A 2YFOA 1UWTA 1JXJA 4AIOA 1MFVA 2WLZA 1ECEA 5JMWA 5FIPA 2PB1A 1B31A 2OYKA 1UR1A 3MI6A 5CPQA 1KFWA 4MDPA 5I23A 1NQ6A 1EIBA 2C0HA 1GHRA 4WKFA 4YHEA 2CKRA 3ARWA 1V3JA 3K8KA 5BCAA 1VFFA 1YQ2A 1E55A 1CXIA 3GXTA 1OGSA 4PN2A 2A3EA 3FN9A 1I75A 4LGXA 5IDIA 1ZBKA 3AISA 4AZCA 2QMJA 3WNNA 5I6SA 1NWRA 2NSXA 1LWHA 4AICA 4HMEA 4ZE4A 1JIBA 2GJXA 4CUCA 2QHAA 3VSTA 1DP0A 1PS3A 2VRJA 2WLYA 3BAIA 5CG0A 2Y8KA 4U2ZA 1U30A 2VCCA 2JD0A 1MXGA 2VTFA 4H8VA 3B9DA 5FCZA 4F66A 1E4NA 2W61A 5D4YA 1R75A 4OJYA 1WNOA 2J62A 4DUVA 1HT6A 3PZUA 1XV8A 3MSDA 3AU9A 3GZAA 1XD0A 1US2A 2NW0A 3CZNA 4GI9A 1BF2A 3I3DA 2PWFA 4Z2IA 2G8ZA 4AWEA 1CENA 3B8SA 4AISA 4CD4A 3WUGA 1E6PA 1UD8A 3EMZA 2E9LA 1TA3A 1KGXA 4MDOA 5FL1A 4NRSA 2ZX9A 3NIYA 4GZEA 1D7FA 3ZT6A 5DT5A 4AIEA 1D2KA 5M3WA 5EMYA 1QI3A 4DWSA 3H53A 5D8WA 3OLIA 4GZJA 3SCUA 1GJWA 1HVQA 3TP4A 3VD4A 3F4VA 1KGWA 4JHZA 5E9AA 2EPMX 4ZQGA 5A94A 5JAZA 3CBWA 3WD4A 1SYTA 5M17A 3WEZA 3S5YA 5GQBA 3ZT7A 3K46A 2F7RA 1E71M 3ZMRA 3BMVA 4LQ1A 2XG9A 2IGTA 1A47A 1CNVA 1NOUA 2JIWA 3M7SA 1JDDA 3AFBA 1WDSA 5A95A 3ZT5A 1BVNP 1WDRA 4FMVA 1EDTA 3T0DA 4M56A 4ML4A 2BVTA 3D5HA 3VPLA 3BGAA 3LXCA 3U57A 2D1ZA 1B3YA 4FK9A 1E0XA 3BUPA 3OIHA 2X2JA 3O2LA 2XSAA 2MAPA 4XX6A 2DSKA 3QOMA 3SCQA 3MANA 1JF5A 2X2IA 2JIEA 3T0YA 4CD5A 2D3LA 2OWCA 1J12A 5CXPA 4Y6SA 1P6WA 1G94A 4MPKA 1VB9A 1CLVA 3WY2A 3MMWA 2W92A 3VNYA 5A8NA 2BVYA 4DM2A 3PTQA 2J8FA 1CYGA 3VD7A 3SUVA 1B0IA 3T2QA 1GW1A 1CGWA 1JG9A 4PTXA 4RE2A 4HA3A 3R0IA 4ZFMA 1E43A 1Q4NX 1JAEA 2C82A 1B9ZA 1ONOA 5HBFA 2VZOA 7A3HA 1W9UA 3KL0A 4AY1A 1EO7A 2DGAA 1QI5A 4CN6A 3FNDA 4Y6RA 2YL8A 5EFDA 3WQQA 3VNZA 1R33A 4TX8A 5GNZA 3GXIA 3VX1A 5DT7A 1CXKA 3BVWA 3W6LA 4JFWA 4M81A 4U2YA 2FH6A 1MW3A 2J75A 1ZS2A 1XSKA 1TG7A 1HXJA 4GQQA 2YIHA 2YA2A 2BS9A 3AIEA 3UG5A 1E4IA 3QOKA 4XZBA 3SUSA 3EJTA 2YL6A 4AMXA 3ZR5A 1R87A 3CGTA 1TQTA 4JKKA 2OW7A 1MW1A 3KLLA 1E6QM 3WH8A 1V6XA 3VIJA 3CO4A 2JF6A 3AXXA 1MQRA 5JO0A 2W63A 4P8XA 3CH9A 4NRRA 3AMLA 2Y5EA 4WSJA 3D50A 3CHCA 1PIGA 2PC8A 2ZWZA 4EE9A 2J7FA 3GNRA 1IT0A 2WMIA 3B9AA 1FFRA 3NDYA 1WZMA 2GDVA 4D1JA 1DEDA 9CGTA 2JCVA 4Y7EA 3AS0A 2BY1A 3VTRA 3WQWA 2FHBA 1ESWA 3IAQA 1O6IA 1H09A 1OB0A 2Y4SA 3L4XA 4W88A 4LYRA 4ZN6A 3SCTA 3WF0A 3ARVA 1R0LA 2WVSA 3IGUA 2WSPA 1CXFA 1H5VA 1X1NA 3N13A 3ANNA 5EB8A 5IHRA 2X0HA 3WL0A 1TUXA 4JFVA 2HISA 3VGHA 2JD2A 1JDAA 2WHLA 3S2CA 1QOXA 5CQ1A 2J8GA 2V3FA 2JE8A 1KXQA 2CBIA 2EPLX 4ZXOA 1QBBA 3T2OA 4E2OA 2EABA 1BAGA 2VR4A 5EFFA 2J79A 4UFMA 3WH9A 1E15A 2F2HA 3DDGA 1UD6A 3WNKA 3I3BA 1KXHA 4K68A 4FNQA 4UQBA 4ATDA 4IUGA 4UR9A 1OD0A 1BHGA 1VEPA 2PWHA 2CEQA 3VO0A 4WKAA 3RMEA 3W0KA 1O7DC 1JL8A 3L2MA 2G3IA 2WZEA 2YLAA 4AZ5A 2DIEA 1MVYA 3MS8A 2A3BA 4WIWA 4EK7A 5A2AA 3AMKA 3WIJA 1UWQA 3GBDA 1XSIA 1FH8A 3MKKA 3AMGA 3HZ3A 2J4GA 1KTCA 1M53A 3BXWA 1VEMA 1WDQA 1DWGM 1CXLA 3AZSA 2JF7A 1J0KA 1NP0A 2UY4A 3VD9A 1BLIA 3BAKA 1UR8A 4UFHA 2BY2A 2VURA 4W86A 1MXDA 6CGTA 1TCMA 1SZNA 1JZ6A 2A3AA 1J0JA 2DSUA 4J7RA 4AZHA 2A3CA 1H3GA 5I77A 1N82A 4R27A 2ZUTA 3ARTA 1CWYA 3N15A 3GYCA 1UKQA 2X2YA 3WQSB 2WM0A 2GUYA 1CGXA 2OSYA 4ZQHA 4FNTA 3ZOAA 1OSEA 3VOCA 3VM5A 1XGZA 1HL8A 1EOKA 1HIZA 6A3HA 1HJVA 2QMKA 2ZIDA 2F7QA 4U33A 4LX4A 2FHFA 2ESCA 4GXPA 5A6MA 3N18A 2CKSA 5ABFB 4DUWA 1HX0A 1Q6FA 3AJ7A 1QNPA 2CCRA 1V6YA 1E9LA 3PTKA 1B1YA 3WUEA 3K4AA 4AD0A 4HMCA 5JBIA 1QNSA 2VCBA 4NF7A 1JI1A 3QHNA 3AIVA 1UH4A 4MAZA 3HN3A 1MW2A 1GOOA 5AC4A 3KL5A 4N42A 1TFVA 3BC9A 1ZB5A 2AMGA 2O9PA 1XYZA 1UR0A 1KCKA 3EYPA 3LXAA 4J3TA 5HDRA 3W4RA 1G0CA 3SCWA 3WF4A 2RGLA 2D3NA 4F8XA 2YDSA 2WNWA 2XGIA 1CEOA 1C3FA 5M03A 1ZBWA 4AD5A 3LRLA 5CPSA 1V3MA 2EJ1A 2ZXDA 1T0OA 3G6MA 5IFPA 3W81A 3WL1A 1OGBA 3IJ7A 2Z1KA 4WKHA 3IIEA 1HJWA 5A6BD 1IZKA 4BQ5A 4FLOA 4KRTA 2F8QA 3IK2A 1VEOA 1OGGA 1QNQA 5JBDA 3VIOA 4H2CA 3CHDA 3KEHA 3TOPA 4OOUA 1PX3A 1R46A 1WZKA 2ZUUA 5BXSA 2D73A 1QBAA 4M80A 2YL5A 4A3YA 4IISA 4FLSA 2FYVA 5F7UA 1C7TA 3CZLA 1OINA 1CTNA 3JUGA 3SUTA 3UCQA 4YHGA 4S3KA 4ATLA 1JYXA 2XFYA 1X6LA 2CPUA 1LG1A 4HU8A 3WELA 2NT0A 3PZIA 3AICA 3THDA 1EQCA 5AYIA 1UG6A 5CGTA 4Y6PA 4PTVA 1QNOA 3VSVA 1V0LA 3WY4A 1BYBA 2WYSA 1R34A 4WK9A 2OWWA 1ODUA 5KEZA 3CUFA 3U5UA 2FHCA 4RE4A 1NM9A 1OIFA 2V3EA 1JZ4A 4AZBA 3PBGA 1B3XA 1PPIA 3GXDA 4GAEA 2WVVA 2G4FA 2WANA 4GPNA 1UZ4A 2CHOA 2GJRA 5BRPA 1MYRA 1LG2A 4DWSD 3J7HA 4D71A 4DM1A 1C8QA 1XH0A 4AZGA 3W29A 1YHTA 1GOKA 4FNRA 3MSGA 4H04A 1J0IA 2C8NA 1HKJA 1QI0A 3L4YA 3ARQA 2YA0A 4CXFA 3GXPA 4UQAA 3MU7A 3SCVA 1PAMA 1E6RA 1K9EA 1M7XA 2J7DA 1VFUA 3PZTA 1TQUA 4UNIA 1UQZA 2ZWYA 4ACZA 1KTBA 2VZSA 4W93A 2VT0A 1KBBA 3RJYA 1H41A 1KGUA 4MNMA 3VIMA 5BYWA 3WDHA 3H54A 1OM0A 3WUBA 1ONNA 2EPNA 1C91A 2F7OA 1UHVA 5LA0A 2XVKA 4D6GA 4WF7A 4D6CA 2XSBA 1I1XA 3N9KA 1QW9A 5DF0A 1UH2A 2CESA 3VD3A 2XVNA 5JBEA 4P8VA 3NSNA 3VDAA 2CBUA 4XUYA 3EJPA 3VSUA 5A6KA 3WQ8A 5GPRA 4BCEA 4QLJA 3BUBA 3MV11 3PZGA 4AMWA 1H49A 4TVCA 1QX1A 1QI2A 3SCPA 1PZ3A 1XCXA 4W5ZA 1ODZA 4HZ7A 4A3HA 4JL2A 1LJYA 3AS1A 2VVNA 3AQUA 4ZQEA 3PZQA 2QLYA 1FH7A 1WO2A 2WMKA 2ZX8A 1VAHA 2O7GA 2GDUA 4X0NA 2VNCA 1HVXA 5GNYA 2QPSA 3RO8A 4AZCB 1BVZA 3FAXA 5LYRA 4UQCA 3ANLA 2EADA 1R47A 1V3KA 3THCA 1HWWA 2DQXA 5I2UA 1JI2A 2J78A 2GVYA 3ZJ7A 1ZBCA 1W32A 1V02E 2GJXB 4RCVA 5E6YA 1H11A 2IUZA 1H0GA 1VJSA 3OA5A 5BXPA 4Q22A 1RH9A 1TQVA 5ABGA 1JVSA 1IV8A 2WKGA 1GVIA 3A24A 4KH2A 3APGA 1B3WA 1HJSA 1RP3A 1W9XA 4W84A 3WQVA 2VI0A 4BQ4A 2BY3A 2WMGA 7TAAA 4TVUA 1BQCA 1ZBVA 2ZUMA 3VINA 4L4OA 1UD5A 4OIFA 3ZJ8A 2F7PA 5HPOA 4AEEA 3NJ3A 3VGBA 3KZSA 1C8YA 4FNPA 3GDBA 2PWEA 1CGVA 3N1AA 2YBUA 4AIUA 4UZUA 2IXVA 3W24A 1TE1A 2OLHA 4AEFA 3AXIA 1JXKA 2VQUA 1E70M 4F79A 4GKLA 1E6SM 1TQWA 3BAJA 4OOEA 2BHUA 1TA3B 2DPEA 3WDIA 4HTYA 2WC4A 3NDZA 3IAPA 1MQQA 5I78A 5BRQA 2AAAA 3MUY1 4CU6A 1HXKA 3VGGA 4IPLA 3WMSA 3OGRA 4PRWA 2EQDA 2X8RA 2J7HA 4DWSB 2QV4A 4X0VA 2D24A 3T0BA 1RD6A 3N11A 3OGVA 3IJ8A 3T09A 3K8LA 3VILA 1RP9A 1R85A 3VGEA 3ZQ9A 3W37A 3UEQA 5A1AA 1CLXA 1C7SA 3WH6A 3EBVA 5BXTA 1GJUA 1J10A 4UOJA 2WB5A 4YPJA 3EMCA 3WEOA 1W2PA 2Y1DA 3EMQA 3ZHXA 4WJXA 4PMOA 4NXSA 3RIKA 2XTKA 8A3HA 3L4ZA 5LA1A 3CUIA 4PEEA 2XFRA 1WCGA 3OLGA 3L4TA 1ONPA 3FHAA 1W3LA 1W1TA 3BCFA 2CETA 2ZUNA 3ARZA 1UR9A 4Z2KA 1DHKA 3BH4A 2XIBA 5A2CA 1W3JA 1CGTA 2E8YA 4CGTA 1R7AA 3AMCA 2EXOA 4WSKA 2D22A 2VZUA 3CIVA 1SMDA 1C93A 1GNXA 1VFMA 4CCEA 3U5YA 1E6NA 5HNNA 3FAWA 1XCWA 3SUWA 4BQ2A 2ZXAA 3CC1A 3AIWA 4CD7A 3DYMA 1GOMA 2VQTA 2XN1A 3N12A 4HOWA 5JBFA 3A14A 2VMFA 3AI0A 4W87A 4A4AA 3VKKA 5KZ6A 2XN2A 2F18A 3CUGA 4MJ4A 4HOXA 1FHDA 5IHSA 2WK2A 1Q0QA 2EEXA 4HU0A 1DWIM 1LLOA 5I3DA 2E0PA 1KXVA 3AHVA 4U3AA 1ZL1A 1GCYA 3M07A 1WAWA 2O92A 4EKJA 1J0YA 1D3CA 4UFJA 4FLRA 1EA9C 3DX1A 3BMWA 2Y1GA 2XWEA 1QI4A 1HKIA 4OUEA 2ZICA 1V0NA 1FFQA 3WUFA 3TTQA 4TOQA 2WAGA 4V2XA 4W5UA 3VMOA 4OKDA 5I0DA 1JZ3A 1B90A 4KMQA 2WWCA 1EDQA 3ARPA 4B3LA 5DO8A 3T08A 1S46A 2WMIB 1F4HA 1GZJA 1CPUA 2VZTA 4CN4A 2WW5A 2V5CA 1EXPA 5CLTA 2YA1A 3K4DA 1L0PA 4JKLA 1PIFA 4P7OA 3O9NA 1UWRA 2ZOXA 4S3JA 1NP2A 2WCAA 4B9YA 1CGUA 4CVWA 4D1IA 4W8AA 3UERA 3GTNA 4PMVA 3M46A 4PTWA 3EJRA 2FDMA 3AYSA 3NSMA 3TV8A 3LRKA 4AW7A 1UQYA 3QR3A 1KR1A 3A23A 3KLKA 1E40A 4IM4A 4PBGA 4V28A 3PZNA 5CPTA 2VUYA 4H41A 4D6EA 3POCA 3E1F1 5HXMA 1T1SA 1V0KA 4NQWA 4TVDA 2OSXA 3WF1A 2JCXA 3WD2A 2WSKA 1W1VA 2E40A 3AIRA 2J7CA 5D9MA 2WC3A 1FHLA 3LRMA 3D52A 3RM4A 3SCOA 3LPFA 4HZ6A 2QPUA 4GQRA 1V02A 1HP4A 3I3EA 3WQRA 3HJEA 3ZJKA 4PUEA 1UKTA 1CECA 2V5DA 1M04A 5C71A 1G9HA 4QLKA 1KWGA 1V3IA 3OB8A 3WNPA 2XVLA 3A06A 4HMDA 2VC9A 3A6OA 1E5JA 3O6AA 2VRKA 3SCSA 1JAKA 1JDCA 4AZ7A 3DDFA 4QP0A 2WC7A 2XIIA 4JFSA 4TTGA 3A22A 3GXMA 5JUVA 1LQ0A 4P8WA 4UQDA 2VX5A 3ANMA 2XM1A 3F5JA 3RCNA 1QWUA 2WZHA 1JZ5A 4QAWA 3ARYA 4KGJA 1CBGA 1DWFM 2F61A 2XM2A 2V3GA 4C7DA 5FOOA 2YL9A 2GK1A 5HPCA 4J28A 4UTFA 3K8MA 4DWSC 2VX4A 3W26A 3AS2A 1W1YA 3WQ4A 3BLBA 2DT0A 1UOKA 2FGLA 1XRVA 3AXHA 1NWSA 4PSPA 4L4PA 4ZQFA 3BUIA 1Z32X 1K9DA 3WDPP 3WNMA 1GOQA 1Q6CA 1QHZA 2DSWA 1W9VA 2WCSA 1UWUA 2J7BA 1W2VA 2WCGA 3S5ZA 1VJZA 3DHUA 3A4WA 3ARXA 1G1YA 3DX4A 1EGZA 1W9PA 1ZJAA 4AZIA 2BXZA 3CMJA 2YFNA 1SFSA 5LA2A 4DUXA 5E6ZA 1XC6A 4OGZA 3ZM8A 4PMXA 1PBGA 2PBGA 4P7LA 4QFUA 2G3JA 1U2YA 1G01A 2J77A 2XN0A 4MB4A 4J3VA 3KL3A 3RM9A 2YJQA 1QPKA 3ZHYA 3FY1A 3VM7A 1KCLA 4MB1A 2JEQA 4HPGA 2JFEX 1E6ZA 5JNLA
chains in the Genus database with same CATH superfamily
1CR9L 3QC0A 4EXKA 4RE3A 1D6EB 1T80A 3WSQL 3KAAA 4HK0A 1DWJM 1I3RB 2Q8XA 2F7IA 4YVPA 1BJMA 3EB2A 1H19A 5EOQH 3L48A 1W3IA 5FGRA 3X3GL 2IDUA 1XQ4A 3WN6A 4JKPL 2V17H 4Z3GA 3BKML 3V4UH 1IEXA 2VC2B 2WZGA 4TSAL 4NQXA 1CB7B 4FL4B 1VQTA 3ELFA 4V1DE 2ITCA 4TXEA 1KC5L 5DYFA 3GSOB 3MJ7B 4R5XA 3OXRA 4G82A 5D30A 3AMDA 2RDWA 1VENA 2P80D 4MWFB 4E9SA 3TZVA 4PGCA 3L2IA 4RFOH 3HG4A 5DJDB 4HYRA 4JLRA 5D32A 4AK2A 3TEXA 1IC7H 3K80A 3CT7A 3NG3A 1GQIA 2GSIA 3PQYB 5LAXB 4BD4A 2D03H 3JVGA 3E5PA 1BZQK 4PJFB 4ZS6D 5EORL 1G7UA 1Q8MA 3U46B 5KUMA 1L9QA 3GH4A 5LDUA 5ERWA 4P2QD 3VFLA 3GR7A 4ACZB 1RLCL 1F3JB 3KPPB 3VE9A 1AD9B 2EPOA 3F62A 1QQDA 1SLUA 5L2JB 4EE2A 3H2PA 3TTYA 1SJDA 5FF3A 3GSRB 4MAVA 4NQSB 3CPRA 1DO6A 1DFXA 2PCEA 4RGNB 1R2SA 2R27A 4YN5A 5JYMA 1JZJA 3ZE0E 1W0YT 4FHJA 3NZRA 1MEXH 1FRBA 3FCSB 1YTEA 1KJVB 2O4QA 4J1UA 3QP3A 4GXVL 3OV6A 1AK5A 4NU7A 1ZTXH 1H7RA 1Z9LA 3WEBA 5K39B 4NUGL 3EGSB 3GQFA 4KQ3H 1WBHA 4AGMA 3LEPA 3QXUA 4BWLA 4N8CH 4AXNA 1E4LA 2RALA 2QDDA 4MFEA 3TVMC 1E56A 3IPBA 1M03A 4BH8A 2VMEA 5TE4H 2AKRA 3RAOA 3K81A 4AIBA 1JS4A 4F3FB 3MRNA 1RZPA 5D2XA 3BCDA 1S5NA 3SQOH 4NENB 3BZ4A 4OI8A 3HG5A 3Q1SL 1JCVA 1SQ7A 5LGJB 5H4YA 1WSST 2Y7QA 3II1A 1V7YA 3MMEA 3THMH 3E5BA 3ZDXE 4LS1A 2VWEE 3LNPA 2LVCA 4YXHH 2DM4A 3CLWA 3IXTA 4LH8A 5KZMA 3PDGA 4Y2OA 3N25A 1TJ0A 1A5NC 3TONA 1GVFA 2UY5A 3C5ZD 5T1KD 3FJ4A 1A64A 1D9KC 2WTPA 1LO2H 1CGSH 4PMUA 4WVXA 3RJOA 4MJ2A 3NEOA 3WFHB 4KI5C 4KVCL 4UDUB 4KJQD 2QVIA 4GH1A 3QULA 2C18A 4LLMA 4TLSA 1BQUA 3TJ4A 3WSUA 3N4FA 3T4YB 3STCA 3NOIA 4LOCA 1TSRA 1GY1A 4RX4D 2OFQA 3SCNA 1F3WA 3FULA 1KV7A 1T89A 2KZWA 1GAFH 1JD9A 1Y1DA 4JDTH 4QTFA 2FFCA 1SMAA 2J8UB 1JNDA 2VR3A 1A3LL 4EJ1C 2PZNA 2WWDA 1CR9H 2Q9OA 2EE0A 2KAUC 3WSQH 3FYIB 2BFGA 4R97B 1ZHBA 2PPAA 3H55A 4DZAA 1EO5A 1JD7A 3DSNA 4ERGA 3UAJA 2PGRA 1K4CA 2X1XR 2R39A 1KC5H 5C0RL 3KWTA 1TVNA 2D2JA 4EDXA 3EF7A 4JJ5B 4MM1A 5I1CL 3FTYA 2DBLL 5CGMA 1H60A 3WLBA 1PXGA 2NSQA 2GTWA 4L3FA 1GZHA 1R3HA 1CICA 2J5LC 4YHZH 1BECA 3W1PA 1Q45A 3BLLA 3NCOA 5DR5L 3ZVHA 3K1DA 5EORH 3MDJA 1U0QA 2ADYA 3D0LA 2X87A 4MZIA 4XB3A 5D9SA 4QLLA 1CLOL 5GGRA 4K3EL 3SEPA 3A67L 2O4EA 2AJZA 1IJNA 5TH2B 1CI5A 2YAPA 4RDWA 3TXZA 1T99A 4G6CA 2DJXA 1HQRB 3VMPA 2UUDH 4PJDE 2CLRA 4DNLA 1O1ZA 1MVFA 1TELA 3WHXA 4HWZB 3VKJA 2OJPA 3VUPA 5GS0D 4G8FA 4KCVA 1JZ8A 1TV3A 3HB3C 5FYJE 2EXYC 3C86A 3EWYA 4CU8A 1QATA 5E4EC 4RGND 4ALAC 1SM3L 5GSRB 1QMUA 1KCVL 1CYXA 4WFFE 4WO4B 4IK7A 1UB5B 4K5MA 3MXWL 2OELA 4P5MB 5EU5A 4MZ2A 1V6VA 5CD5C 1G6RL 2G4EA 1PB0A 3DYOA 1OL0A 5J56B 4WV1B 3IFPA 5IOBA 6FABH 2GGHA 3EJUA 3N17A 4GI8A 1AFVH 4C47A 4ODTL 3F5KA 2V5SA 4JTGA 3VA6A 3TK7A 6TAAA 1XUZA 4MF4A 4UMGA 5DQ9B 4L8SC 5IESH 1EHAA 3WBXA 1N6QL 2HVMA 1X44A 1L9SA 3EDEA 1N2RA 1TENA 3Q1SH 2H47C 1UM5H 3BAXA 2BSTB 2J4WL 2J1XA 4KOCA 2X1IA 3GKWH 1DVTA 2B4CC 3L4UA 4DPQA 4TIMA 3LZFH 3HMXL 2ZRWA 5TK2A 4YDVA 4LAKA 4NX5A 3JTTA 1BJ1J 4R6UA 3JUYA 3NQEA 4NJJA 4FQXC 1UR2A 4ODWB 1OQXA 4DPAX 4HUMB 4HEPA 4YBHA 4BBWA 2QGBA 2X38A 1KIQA 3ZO9A 3FQNB 2VW4A 1IGFL 1U3JA 1PG7X 5AYBA 2PW1B 1B3OA 2YSSA 1S3KL 4S1QL 4MBOA 3KR3L 3DOPA 3USZA 5TK4A 3KWWA 2APXA 1OFAA 1BQHA 3AB0B 1NSNL 2FX7L 3N0PB 3IWUA 4FG4A 4EI6A 2HTKD 3AUOA 4IBYA 4X4KA 1VPOH 4WKFA 2EICA 3ULUC 3CDFA 4FI4A 4FR1A 3OJMB 4FCHA 1LHZA 4K9EC 4N0YL 3CU7A 1IM9B 4OJEH 5HJBA 1MFDH 2ATPA 1OZMA 1AZNA 4UTCA 3L3KB 4HMEA 3AY4A 2R9HD 2YAEA 5F6HI 4L1WA 3EWBX 1P5UC 5ITBL 1F2JA 3Q8EA 2VCCA 2JD0A 1MXGA 1HAUA 5AAPA 4D0BB 2CLEA 1A3WA 4AH7A 2HT2C 4OJYA 4XWOC 1JUBA 4DJFA 5G2HA 3AUWB 3AU9A 4M4RA 1UENA 4JX5A 1X5HA 5DSCA 1OD9A 3DMMA 2KPWA 4HN8A 4X42A 4ES4A 2QGCA 4AISA 3L95B 4G9PA 1FP5A 1UD8A 5C9JA 4HSNA 1QRNA 1BM3L 1RZIB 2P48B 2ZX9A 2HX9A 5DJZB 4PW9A 3B8WA 3DROA 2ZKHH 3F7RA 1S3HA 4AKPA 3OLIA 5KOVC 4GXFA 1QR1A 2QEZA 3VD4A 2AJSL 2QDWA 1H5BC 5KYWA 2FQEA 4LU5H 5GGSA 4I9XA 1A6TB 3OW1A 2F7RA 1S1PA 1XDTT 3MGAA 2E7CA 3E8UL 1OG6A 1RAKA 1WKFA 3M7WA 2V2WB 2FQGA 5K4XA 5KS9A 3OWRA 1S2CA 3U57A 3OKLA 2VELA 2ZCHL 1SYSB 1B3YA 3S2AA 4G5AA 2PP7A 1CLOH 4F91B 5LBVA 1VB9A 1NCBL 2JIXA 1CLVA 3P73A 3O4OB 3UTSA 3WIHA 1MJUH 2M26A 2V6AA 1J8HB 3FQWA 4O17A 3U36A 3FNKA 4ODBD 3IE4A 2V7HB 2VDIA 4PJ9C 3UW6A 3GVVA 2C9XA 1FI8C 1OAUL 5CR1A 7A3HA 3IMSA 3V7MA 4KROB 5EU7E 3CZUB 2OI9B 2XH7A 1NFDA 1HL5A 3GSXA 3T3MF 5B4MC 4HPXA 4LCWB 5LG6A 1QPPA 4GW5B 3TWAA 3ZKND 4XIMA 2VLLA 3VIJA 3CO4A 5AFDA 5D6DA 3MQIA 3WCZA 4JB9L 5F7WC 2RQ8A 4ZTOL 1L5GA 1J2BA 2JCVA 1G6RH 1PTDA 3HFML 4TSBL 3S1VA 2R1YB 2BS8A 3BPCA 5IOPB 3CK0L 3DURB 4HHAB 1CXFA 2VEKA 3QMSA 4IXHA 3Q6FB 3TJIA 3WFBH 4CSTA 2MNJB 1TUXA 2YCLB 5E1IA 4AHQA 1N9PA 4D9QE 5C08D 1NGQL 2YMXL 1F2XK 4GEJA 1X5FA 2NW3B 4H01A 4Z7NB 4E2OA 1O75A 2N0KA 2J4WH 3KGTA 4LCIL 3L3OA 5KVEE 4F0HA 2PWHA 3SDAB 4NJ9H 3NVQA 1T6WA 4TVPE 3HMXH 3GI9H 3MKKA 2IAMC 1ZPLA 2FTAA 2G4GA 2DYPB 1EXHA 5F1NA 1J0KA 4XAKD 4GRLB 4N0CC 4UFHA 3RVXD 1AODA 3CQKA 2VDOL 1CL7L 2EKSB 1EJVC 4QS5A 4EN2A 3HIJA 5LG1A 4PE8A 1IGFH 3UVAA 1H3GA 4JRFA 4B0MB 5ICYB 1Z6JT 6REQA 1S3KH 4S1QH 1RVFL 3LDVA 1TJRA 5JUEL 1FPTL 5DEGB 1EPVA 5DQPA 4HIHA 1U8JB 4YFLF 4L4TB 1O5DT 4C59B 5FYLL 4BFEA 4LUJA 3ETSA 3O6LH 1T04A 1EHLL 4N0YH 1NY1A 4KDVA 4DVBA 4NF7A 2F74B 3QHNA 3GSVA 5FM5O 2P8BA 2JCCB 2PABA 3V0IA 3NFNB 5LCVL 2W0UA 3W4RA 4DZBA 3TT1H 4I2XB 4CMHC 4POZC 2RMNA 5M03A 3U7WL 1ZSDA 3WL9A 3FLUA 1MCCA 1WEJL 3IIEA 1MWAL 1AZBA 4U3XA 4TUJB 1UP0A 3NRPA 5JBDA 1J7VR 1UXWB 5HGGS 4FXJA 1XGYL 3G5ZA 1NFBA 5C07E 1BM3H 2CA3A 1CTNA 1UM4H 2PAJA 3NAVA 2DAVA 2IBZY 4AYMC 1QLRA 5CGTA 5FB8A 1D5IL 3DAQA 1Q94A 2AJSH 1NEUA 3Q6GL 1S9VA 3EFDL 5KYUA 3KLAB 1PQZA 4RE4A 3FO1B 5ENWB 4AZBA 3DVGA 1F4XH 4P57A 4E4UA 4HJJH 3GW0A 5E8NA 5AG8A 3E8UH 1DBJL 4IMGA 1SOSA 1OGTA 4ZQRA 4FNRA 1CDHA 3UH8A 5CBJA 1J0IA 4IL2A 3SHSA 2YD6A 3W1UA 2ZCHH 3L1OL 1VFAA 3CSYA 1AZ2A 2DW5A 3GHEL 4MD5B 3BEWA 5DI8B 2X6VA 1J86A 4KWWA 1NCBH 3L23A 1GYVA 2A9BA 3M6YA 1KBBA 5FW6A 4OD2B 4TMCA 4BKSC 4EI5A 5DVLA 1R24B 2X70A 1OAUH 2XTJD 4NCC1 4ADJA 1W6TA 4NKCA 4P8VA 3B56A 4YZFE 2EKJA 2RFXB 4PLJD 4HS3A 5D8JL 3D18A 2B14A 4RX0A 1H49A 5J5DA 1I1AD 3PC0A 4HZ7A 2ATKB 5FIEA 4WFEE 4GRMA 5EMMA 2EIJB 3FB6A 4FXGC 3KDOA 2OP4H 1OK4A 2VNCA 1MI5D 3D85B 2UX6A 1MAJA 2ADFL 4M7KH 1HWWA 3QCTH 2E1DA 4OCXH 2ADIA 4GG6F 5GS2H 4ZMYA 3T7VA 4AQ1A 1SZFA 1I53A 2BVPB 1GVIA 3CK0H 1ONXA 3B03A 4LKCB 1US0A 2Z3FA 4HSOA 4RMVA 5K93A 5FO7B 3HW2A 1E7UA 3BSZH 2FB4H 3M17B 1NIAA 4M6UA 3FN3A 2QSVA 2VWEC 1NGQH 5I74B 4J3OF 2YMXH 2XBZA 3EWCA 4D7BA 4OFQA 3AXIA 3GTFA 3HE7C 3U6XS 1YBQB 1QPNA 4U6YB 2A4EA 2QPFA 3FV9A 1FCCA 4R7NA 4LUSA 2V2XA 1Y18B 1AP2A 3IDYB 5HUPA 4CBZA 1U8OA 2UVEA 1U2HA 2PCQA 1N19A 2NR6C 3VILA 2OL3A 1PKQE 1K3IA 2WINA 1MCNA 1J10A 4TL5A 3C12A 3MI3A 2ZZ3A 4GRLD 1M05A 1QJWA 5EZIL 4H9XA 3H4HA 1W1ZA 2V5KA 3EOYG 1CL7H 3FHAA 5BRBA 4QRSA 1KLGA 4B4FA 1IEHA 3GB6A 4EIVA 2HMID 2W07B 3H2QA 5L9DH 4P2OD 1OE1A 4OU3A 1YEFL 4W6XB 1XINA 4PFEA 1E6NA 1MSPA 3SUWA 1TEYA 3HQPA 2ZXAA 2WO3B 5HJLA 2VQTA 4MJ6A 1GOMA 5FYLH 3QPKA 4IPPA 5JBFA 3GD6A 3OGOE 5AVSB 4A4AA 5JA8B 3FFDA 5AYTA 4H1LB 5IHSA 1E4WL 1AG6A 1BWWA 4ZPVA 2E77A 3VFPB 1JPIA 1ZL1A 1CWVA 3O4LB 4H83A 2X28A 1P9MA 4TM9A 5CNHA 4ELDA 4QNWA 3H2EA 3TTQA 1Z1WA 4KT2A 3IFOB 1DR9A 3D6GA 2EC9T 2HG0A 1QO2A 2YPVL 4OSUL 3MSRA 1F4HA 2NY0C 1CX9A 2VXVL 1RIHL 3WTVA 5ESQB 2Q5BA 5XINA 2NTSP 1UWRA 5DEJA 2AXHA 4IMFA 1XGYH 5BNKA 1QFWL 1COBA 3UJIH 3RFRA 4JZJA 3ALWA 3UWQA 3LN3A 1HQTA 3LN4A 2WZ0A 4WZHA 4XAWH 4BFJA 3POCA 4PV9B 1PD6A 5J6HB 4KHTH 4EKXA 3A3YB 1LYXA 4W9HC 43CAA 1GKEA 2MEJB 4EDWH 4JYDA 5LBGA 3LN5B 2Y85A 2QF7A 1JK9B 2WN3A 3GVWA 3RKPA 2F15A 2CO7A 1AKJA 4JFFB 4QRBA 1EEPA 2CJUH 2VC9A 3HQNA 1W54A 1TVLA 1D5XA 5IWLA 5LAPA 1CFBA 5HDWA 3OPZH 4ADSA 5DLMH 3HC0B 5DJXA 3C6LC 4HUUA 4ENED 1MCWM 1V79A 4AIZB 2UXTA 1NEZB 4XZNX 3RCNA 1QWUA 4QAWA 2EYRA 2GK1A 1ZCRA 3RY5A 2ZA2A 2ZYRA 4GXMA 2RCSH 4QQ3A 5I6LA 4L4PA 1IILE 3QCVL 3PABA 1HYSC 3A9IA 1N12A 1TNMA 3W7GA 4O8AA 1JXGA 4BFBD 3OJ2C 4GRSA 4Y4KC 5KVMC 5IQ9B 3KLQA 1LK2A 3R8QA 1KM6A 2RA1A 3PV6B 4XT1C 4P2RE 3H3KA 4A7UA 3FA4A 2NYKA 4NAFB 3D85D 1TZOA 4J4KA 3UTQA 3TW7A 3ZHYA 1PY9A 1AKPA 5I2IB 2C9UA 3UWWA 2J66A 2I69A 4U4MA 4J3XA 4BINA 5F0LB 2DL2A 1I9CB 4F2FA 3SQBB 5A3HA 4NFDA 2C19A 1TTJA 4H25A 4BRJA 1AI1L 3VIGA 3ARBB 2IPWA 1XH1A 2HBVA 1BFVH 5FDWB 2CALA 3SIMA 3KBNA 5J1AB 4ETQB 4MAUL 3F01A 2ZOKA 2WMFA 4NO0B 2C9QA 3DG3A 2PCPA 2WLJA 2IDFA 1INQA 3Q1EA 1JJUA 4RCXA 4PC8A 3FQ2A 2OS7A 2WVVB 1YN6B 3SYAA 4KXZI 4AHPA 2Y89A 1LP9E 5IVZB 4U5IA 3LQAC 5FUZL 3JZEA 3T71A 5C7VA 4HU2A 1E1EA 2PLCA 2YD8A 2W94A 4X4ME 1XIWC 4Y9BA 1I2QA 3MUAA 1TSIA 2CBPA 3KDMB 3OZPA 5E2WH 2ARJB 4UBDD 2ZZ1A 2E27L 3VE7A 3EDKA 4GKSA 2WLNA 3UD6A 1B88A 3AADB 5T5FH 1S7WB 4HUKB 5AB3A 1E4WH 4P5TB 2ZXCA 3RZCA 3MNWA 4LNRA 1I7RB 2G9KA 5LNDA 4GAJL 2GJ6D 1U92B 2ZCLH 4KTYA 3KBSA 2VIRB 4X6CA 4IKJA 4L3EB 5K7JA 4G9FA 2JMRA 2YUXA 3VU2A 3M6DA 3FTXA 2HS6A 3BUYA 3OX8B 3R4DA 3UAAA 3CJPA 2X1RA 1FQ9C 1TTUA 1SJHA 2CIPA 1OJXA 1WTLA 1M3JA 1FP9A 1Q6DA 2WMPB 1G0YR 2ZKWA 1QFWH 2Y1AA 5HDBF 1QLEL 3ETTA 3UA3A 5J04A 3KPLA 4YDJB 3AABA 4NZJA 4Q6IA 3WNJA 3GSUB 4G5ZH 2EVJA 3DI2B 2XZZA 2HVKA 1HTIA 2FE0A 2EJAA 4UOQA 2FGBA 4N9DA 1QOPA 3LKSA 5F93C 4G7SB 4PRAB 4EO5A 3HA1A 2Y07H 4N2OA 5H8PA 5AZ2L 4WDUA 3QY7A 4YJZL 1QVOA 3BQUA 2PU0A 3FUIA 5DS1A 3M16A 3CFEB 4HQVA 3TPKA 3GRWL 1SLWA 1XBZA 5F88B 4QROA 3GG1A 3F7LA 2B4GA 2Z6IA 3MLTA 1P7BA 5EU7C 2I9LA 4PV8A 3PWPA 1H61A 1FWBC 3W7CA 3GMQA 4C54A 4JO2L 3UZVB 2PWGA 3LIUA 1HFBA 2IH8A 3QPYA 3ALFA 2AXFA 2VDKL 2IC2A 3VFMB 2IBZX 4PJEB 4YFEA 3UYRL 1E3ZA 4GC4A 1KDJA 2F58H 2OMUA 1O5PA 4LDLB 3T8VA 1NL0L 4OGQC 5KZDA 4ZENA 3U2OA 4JFOB 1X7TA 1HP5A 3LCYA 3W23A 3S35L 2IANE 3MTWA 2C4FU 3DFOA 4NIYE 3VI3A 4JNXA 3CC5B 5IR1B 1IF2A 1YDPA 2YKKA 1J79A 4J3OH 4PGBA 1W56A 2R69L 4HK7A 4OV5A 2KDYA 4QTHB 2ZF9A 3GIVA 2CHNA 4TTUA 1NGWA 4AG4L 5GNXA 4PJIF 1JCXA 2E6YA 1XLFA 3GDLA 2DKUA 5LB1A 3PCYA 3BP5B 5EO9B 3ZO0A 2WQAA 3M0JA 1F74A 3QDJB 3V5CA 3CFKA 2Z92B 2D8KA 2I60L 3S46A 3EKZA 1UKPA 4HJ1A 1ULVA 4ZUUA 6ENLA 3QV7A 4JN2A 2Y23A 1TIUA 4G1MA 3RITA 3T3PF 3IVKB 2L7JA 4ZVJA 4NAMA 5IJVA 4TLUA 5M95B 3RTQA 4NO0D 4W7UA 5AZ1A 4XP5H 1H8OA 3VX0A 1IKNA 3NPSB 3BVTA 5F3BA 1LF1A 1JCLA 3A12A 2P47B 3FCTA 3BW9B 2X4RB 4KJWC 4K8RL 4NCDA 3PUDA 3ARSA 3GAKA 3UESA 4LNVA 3WS3A 3VNLA 5F6IB 1OF2A 1XYCA 1I1WA 3RKDD 1Z5HA 5HD8D 4J2QA 3QQNA 3UTZA 4NRXA 2R1WA 1VF8A 5KZEA 4OQTL 1T66C 1GTHA 3NCWA 3MMDA 3GSNL 3G1XA 4A63A 3LH8A 2UWFA 1L6ZA 2R69A 5CEZD 4RDYA 1MCKA 4E8CA 2G5RA 5ABFA 1EHXA 4ODSH 4KTEL 3U0HA 4R26H 3TA3C 2H90A 4X63A 3U0TA 3ABRA 4GI6A 4F7CA 3ASOB 5DUPH 2X1SA 3WFLA 2JKRM 4WENB 2YQ2A 5CKGA 3MN8A 4XMVA 1US3A 1GJPA 4ELKA 4E5TA 1IZCA 2AQ1A 3OM3B 3V9CA 4X5PA 4CSPA 4L3AA 3WIIL 3VXQA 5DMNA 4GO8A 5FYJU 4L3ED 1R3LA 3EYFA 3WKPA 3FO0L 1T40A 1IL1B 4QHPA 3LD8B 4BK5C 5FJOA 1G9NC 1SHMA 3TBVB 2CD0A 1UPMB 1T1XA 4GG8A 2Y7NA 2VGGA 2Z7KA 1DBBH 2QQKH 5FI8A 3BRDA 3OKOA 4HPYH 5DX7A 1CBVL 2YRLA 2YD3A 1ZXKA 3P3BA 3B5GA 2H26A 1A4JB 3SDCA 3DO7B 5HULA 3CUJA 1M7DA 5D9PA 2PCYA 4U05A 3CJJA 4KQNA 5M5DA 1AIZA 1YY9D 3UG3A 1TYRA 4Q4KA 4QT5A 4XGZA 3WBDA 4KK6C 1RJQA 4L9XA 4OBRA 2DEWX 5AZ2H 4ZZFA 3MNZA 4PLKD 1J93A 2XPKA 3KJ4B 3VFVA 4G42B 1HKLH 3L9RB 4JRXA 3GRWH 4YJ5A 2K78A 4IM8A 4PR5B 1BGAA 4JIPA 3SR7A 3W5NA 3QFDB 3MREA 4GJ1A 3VXSE 2C9PA 1GQKA 2R0LL 1H3LA 3AIUA 3W7EA 2F53D 5ABZA 4X6DB 4LCUB 5FAJA 3KVMA 4J2XA 1OYCA 3EDDA 1MWOA 5C0CE 2VDKH 3JV4B 3V55A 1GR7A 4QHKJ 2BOFX 3T5WA 4DGIL 1OB1B 4CC4C 4OQ1A 3UYRH 4F2TA 4XCYB 3II2A 1B31A 1EGMA 3S37X 4ONVA 4GLRI 4DP4X 4N9GB 1ZLUK 1GHRA 5DRIA 1M7OA 5IB4B 4FOKA 1XZ0B 3M0KA 3PPGA 1BEUA 2NSXA 1NANH 2INEA 5EUOB 3IDMB 3QIWC 3M5ZA 3GPEA 2X4SA 2MQ3A 3AUJA 2A74B 5H1WA 3EO0B 2HFGL 3WIFB 4X9BA 4NKDA 2J62A 4I8YA 1MCQA 5GJSH 4GYPC 3QDAA 5DZAA 5I07A 4IEFB 3MO7A 4X98A 4AWEA 5JR1L 5D2NE 4N4PA 2GOKA 4TQEH 2IPTH 4AVNA 2DF3A 3MHZA 5JMUA 1OZTG 1VDGA 3MQTA 2BZDA 5DT5A 3UTPE 3WKNA 3TVAA 5DHDA 4DWSA 4GZJA 5FM4A 1CTMA 2L7UA 5DO2C 5A94A 1SYTA 4PJ7E 1HU8A 5IEHB 2OB3A 4PIRF 4ONGL 1P84K 2OZNA 2J5WA 1XXXA 4JM4H 3E49A 4GVGA 4K8RH 3L7EA 2PLTA 4PY7A 1BVNP 1UOVA 4F9LC 2AQ2A 4E41A 2X7LA 4LIQE 5MI0C 5DJ0A 1ROWA 3BUPA 3NCJL 5ID1B 3ZKMD 5JHAA 1YMMB 1QRKA 4OQTH 2P7TB 1VKXB 3HLKA 3MMWA 4DM2A 1YRKA 2C1OB 1CYGA 2H7WA 3HOGA 4TVSa 1JG9A 3H9SD 5CSSA 4PTXA 4HKBA 5EOTB 4Q14A 4J9JA 4AZ8A 3S2JA 4S1RL 2Z35A 4CN6A 4WFGE 3GUTA 1EFXD 4JFWA 3KPSA 3UC2A 3TAKA 3PWJB 3QUYA 1AY1H 5EBWB 3WIIH 3QOKA 4XZBA 4NFCA 3TDFA 1AG0A 3FONB 3AXXA 2XWZA 1A6ZA 4WWPA 4PBFA 4YDZA 2QIWA 4KO6A 2DEXX 3D05A 4J8RB 2ZOLB 1P1XA 4E9TA 5HDOA 4OBTA 3VTRA 5HHVL 3ZTDC 4MJHA 3ZDZE 3OIXA 1L6PA 3TNBA 1UWXK 4XCNB 4ZJ9A 3I9GL 4KRPD 3HZKB 3ANNA 4MMZC 4BCXA 3PPFA 3CQHA 3GFUA 1IQ8A 3VGHA 3TFKC 3XINA 3NDOA 2H1PL 5FO8B 1BBJA 5IF0B 4PP1C 4TNWF 3DCPA 4N2CA 2FUQA 4C56D 5F4SA 4I1PA 1MCPH 1FIGL 3RU6A 3EGJA 2DQ6A 2X4PA 2RD0A 5DA4A 3SECA 4JGJA 4EF8A 2EEDA 1DWGM 4PTTB 4YEEA 3ANUA 5B22A 4LAOA 4G8IB 4MNGE 3NRQA 2YD0A 2PR9A 1NGZB 4OF3A 4AH2A 4WRLA 2ZUTA 3N15A 3UO1H 4F7KA 4GFSA 1U3YA 1AQDA 2OSYA 2XX1A 3UZJA 3ARDC 3QNYB 1DBTA 4EIBA 1B4LA 4HNUA 4H9MA 2WYZA 3SYQA 3UCRA 4KFZC 1GKRA 3CFTA 1QFUH 5A6MA 1MNUH 1Z0NA 3S83A 1QNPA 1XR9A 2UXVA 3TVMA 2K6ZA 2PUSA 4YO0A 2H3DA 5JBIA 3VI4A 1KCRL 3NJXA 4HJEA 3NSFA 1JHKH 1ZB5A 1VERA 2GT9B 4KO9A 4M1CC 3RIFK 2A9ML 1RZMA 2R2EB 5D72H 3SCWA 3KZ8A 1CB2A 1OAXH 3QYCA 4F8XA 2HFGH 3UP1A 4JFEB 1FLRL 3DTXA 3TKFA 1N55A 4QDGA 3GLDA 2H0FA 5DD5H 1HJWA 1XIBA 2RHGA 2PNDA 3ARGB 3OMAB 1BMWA 1M42A 3WFCH 1AMKA 4YUEL 4DTGH 5AVTB 5AVWB 1X6LA 1A4KB 5C9ZA 4Y6PA 4G1NA 2KBGA 2P8LB 5G4WA 1BTMA 1MUWA 2PL5A 2YN5A 3VKDA 3G04B 3NIFE 2HN7A 1OKEA 3EOUA 2LLLA 3EBIA 3VA2C 4UOW1 4XMKL 4ZD3L 2GJRA 3J7HA 4D71A 1J5IA 1EFZA 1WWWX 4GUJA 3CFJA 2A6JB 3FT2A 2Y3AA 2Y7SA 3T44A 2E56A 3FUHA 5T1JA 3H7BB 1C5BL 3MROB 2EDJA 4Y1AE 1M7XA 2BSDA 5ESVB 3NDYE 1YMMD 4NPJA 4O2CA 2VQ4A 1KTBA 1UYWL 3S9ZA 4HAKA 1N67A 2BOBB 4Z7OB 4ORGB 4K6AA 2W8CA 4Q9CA 2X6CA 1OTTC 4ACPA 1OM0A 3QI9B 4GT0A 1UHVA 3WLRA 2BG5A 4Q6YA 2P5WB 4UUJA 3VD3A 4QJ5B 2P8CA 4IRSB 2AL1A 3VDAA 2CBUA 4XUYA 2CGRL 5IFHH 4AVHA 1M7JA 1YJDL 3QEZA 4WY0A 1T2XA 3HV9A 4Y9PA 3N2XA 1PZ3A 1HJBC 1ODZA 3P54A 5C09B 1Z9PA 4H1ZA 1FFOA 3Q9QA 2BRQA 3A6CH 5D7SH 3H4GA 1FYTB 1BF8A 4XPTH 1QBLL 4MZ1A 3D34A 2PCXA 3FUFA 5LGZA 1EDHA 5FO2A 1F2QA 3D0VB 5KBNC 1B4JL 3SBWA 1XLAA 4JDZA 4ZUTA 2NLJB 5ABGA 2JH2A 3H8NA 3UXAA 4X7TA 2GQ8A 4PJ5B 2CDFB 1ZBVA 3PFQA 3D3VE 4OZIB 1C8YA 3OHIA 1ZHKB 1CGVA 3ATFA 5BOEA 1OFEA 2YBUA 4FLHA 4US5D 3KOFA 2IXVA 3RNQA 1RHHA 3A0OA 1JNLH 5D1ZC 2DPEA 2WC4A 3IAPA 3M47A 1MQQA 4A29A 3GBNH 3VGGA 3QXVA 3H9ZA 1YRRA 4ES9A 2GC7C 3JVFC 3T0BA 1RD6A 5J89A 4IGMA 4LSSH 4OIBA 1DVXA 4ZSOA 2QQNL 1A3RL 3O6FC 1R85A 1XIGA 3W37A 5D7IB 2E6DA 5HY9B 4UOJA 5FEXA 8FABA 2OT0A 4KI1A 1A6PA 3KS0J 4PMOA 3L12A 1NDYA 3L4ZA 3V4VH 5B80A 3H6AA 2VN3A 3NO3A 3NIGB 3F4WA 4IQLA 1PCXA 3S6DA 1W3JA 1JR1A 4N2NA 3FT0A 3Q37A 3HI6L 4R7VA 5E08L 2QCCA 1TT6A 5FA3B 3LLDA 3SRHA 4JQVC 1S8DA 4IJ3C 2LW3A 2PDQA 3FS9A 2FPVA 2NX1A 2F54E 3DHFA 4WWKC 4HEPG 3SJVB 3XISA 3O2VH 2OBGA 1KCRH 2VSMB 4MPQA 3RVUC 2C7UA 5DHYA 2NY2C 5GGVH 4QRUA 1K85A 5DQDL 5FEBA 1V7MH 4HIIA 1C8PA 1MG3C 1XR8B 2FX8H 5EPMB 1BQHG 2R0KL 3WQGA 4LGPB 3R89A 3DVNB 4OKDA 3IVSA 2WWCA 3N6YA 4N28A 4O4YL 4UILL 4S3AA 2P44B 4B3LA 1QWKA 2GCYB 3QO1A 1VD6A 5KS9F 3BXNB 4GOSA 3FUNA 4JHMA 3K4DA 1SPDA 3SZ6A 1E30A 2QL1A 3QDMB 4XP4L 1JGMA 1IIGA 4PMJA 3X3GH 3ARGD 4JKPH 1Q7MA 4FQXA 1SN2A 4TV5A 4YUEH 2YBRA 2E7LA 3BKMH 3EJRA 3OXSA 3RWGA 1QTPA 4J39A 3G6JF 4TSAH 1EMTL 5I6MA 2X5PA 4AY7A 3HE6B 4ANWA 5D6CA 4M02A 4C6JA 3CIXA 4H41A 1WFTA 3REQA 3EKCA 1PEWA 1NFDF 1W1VA 5JORB 4XBGB 2BINA 2IWFA 2BB0A 4ZD3H 2OXHB 3AJXA 1TWSA 3RNKA 3I2CL 2O7QA 1WIOA 2X9WA 4YAQB 1JV2B 1GZ1A 3PQYD 4N1CA 3LV3A 3BH8B 5F4XA 2NQ9A 2JQMA 2XIIA 2VMCA 5D7JB 5JUVA 4FMKA 1VZIA 1R2TA 4D8AA 1AO7E 4UB0L 3ARYA 1TYEB 1A6WL 1S7XA 1TU2B 4O12A 4O9HL 3MR9B 1YJDH 4R85A 4PRRA 4Q89A 3E6HB 3T55A 3HW7A 1FFNB 2WAHA 3QT2A 4B3VA 2OPCA 4W4NA 1L6XA 3EFOB 1W9PA 2A9AA 3MC5A 4GBXB 2J88A 4HLJA 5EN2B 4FNLL 2IWKA 1PBGA 3X17A 2FZNA 1QBLH 3R19A 3VFSB 1OY0A 1V5XA 4ORMA 3FQTA 3JUZA 3F12B 1RLWA 3WKML 4MJIA 1BXCA 1H5BA 4TUOA 5FFLA 1P4LA 1VSCA 4QKXB 3PP7A 3X1FA 3TO4B 4GXVH 2H0JA 3W70A 3L5WB 4KK8D 2JV7A 4YGVB 4NUGH 4PJ5D 1Q8AA 4UTWC 4F15B 2A9NL 4AMCA 3KUMA 4WW2B 1DLHB 4MVAA 5EU4A 3FKRA 1YADA 1PKLA 4O18A 4P2AA 3C8FA 3UG8A 5DD0L 2LU3A 4J27A 2UWEF 1VKFA 1GC1C 2W27A 3PS6A 4AYFB 4XNZB 3N40P 2FJHA 4Z3IA 4Z7VA 1S2WA 2N1TE 1WFUA 3GIQA 2QQNH 5BO1L 3T4AB 3K4ZA 4OKVA 4C4KO 4MA1B 5ELIA 3A4EA 2H9GA 3I75A 2WBKA 4F33A 2GFTA 1O1HA 2Y1EA 4XRCA 5D5ME 2ZTBA 2CNCA 3O9WA 2KKQA 4MHHI 2I5IA 5HHQB 1ET8A 2FSDA 3HI6H 5DVKA 4PS8A 5E08H 3RU8X 3SO3C 2B0SL 5EWIL 3W28A 3W27A 3ENLA 4KVCH 2QCGA 3UTTE 1E9PB 5F44A 5M94B 1H3PL 3PFUA 3U0PB 1E27B 1WFJA 3CFDA 4C5ZA 4X8JB 2LR4A 2H8PA 3W86A 2P1FA 5DCDA 5JW4N 5SWZE 1AZ1A 3EBHA 2CBVA 4BS0A 3HFFA 4X9SA 3WIHL 5GGQL 3GVRA 5DS8A 1RP8A 1A3LH 2PSNA 5D2NC 3EDFA 3ATAA 4HKPA 4JIRA 5EBAA 1F1DA 4O4YH 4UILH 1MCSA 1S7QB 1ZHLB 2OSLA 5E0CA 3AIBA 3CXHK 4NVTA 2IAMA 3DFHA 4JE4B 3LHVA 4BE5A 4P5UA 1R8LA 4S3BA 2FBOJ 1W5MA 4LCRA 2HS8A 4KWUA 2JXMA 4YSAA 1WJ3A 5C0RH 3HE6D 4KETA 2EIBA 2OW6A 5D4IA 1ME8A 3RHWF 2DEPA 1AMYA 2HQAA 1IXQA 3E2RA 3VRJA 1UZ6F 2X9YA 4APQB 2GSHA 5I1CH 1P0NA 3L3DB 4FQ1L 2DBLH 3EJJX 2IPUK 2OZ3A 2A5UA 4QTIL 2Z8SA 1PY0A 1E5NA 2LVEA 4KZEL 3TN0B 1KV3A 1RPQA 4C6LA 3QDGE 4PREB 4N3TA 5DR5H 2W91A 2X89A 2BIQA 2E9MA 3WLLA 3QKEA 1QPRA 1I1CA 3SGEI 3UCDA 4V1DA 4X83A 3LX9A 3O6ML 3SOTA 3ITLA 2XTSA 2XPGB 1FZOA 4K3EH 4EANA 2OXGA 3A67H 2Y7DA 5A7BA 3DPBB 3AT8A 1YEIL 4IKKA 2YEZA 4XD5A 4N8UA 5CZKA 2QT6A 2PDHA 3LZPA 4UF7C 3KXFB 4RQQA 1NFGA 4GBXD 4LSPL 3LSOB 3OPSA 4ORZC 1SM3H 3KBJA 3T0EE 3RTLA 1KCVH 4HKZB 4WO4D 1V3LA 4YX2L 2PXYB 1MQPA 3FTGB 1NUDA 1AS6A 3MXWH 2OMVA 2PPGA 1K9TA 5EO0B 1XF5A 4BUGA 1OF8A 3IPEA 4ERAA 3TJPA 5FL0A 3Q8CA 2VHLA 3BDYL 4R53A 2QPEB 4N20A 3BZDA 4XUGA 5LNUA 1DORA 3G08A 5A2BA 1C08A 2Z2UA 4ODTH 1WUEA 2V2HA 3S7GA 3BN9D 2Y7EA 5LVEA 2E68A 4XSMA 5CZSA 4WCYL 3NJNA 2YD4A 5DD0H 1NVMA 1NPJA 1BYNA 1N6QH 3EWXA 1JYWA 3FO2A 2ZXWB 1T0PB 2QDGA 3WEAA 3GJFB 1RJZA 4GZ7A 5DGQA 5HGHB 3G0SA 5BO1H 3WAKA 3S36L 3CHEA 5DQJA 4YHYC 5IROD 4JAMA 3C0LA 1Q9KA 4J3WA 4U1MB 4F27A 3QAQA 4Z1BA 1CUOA 5G1TA 3CVHL 3NR0A 4K0OA 3QGKC 4YDNA 5BU6A 2Q2LA 1SW7A 1AGFB 4JTKA 2B0SH 5DTFB 1MQKL 1OZQA 4G80A 4F40A 5DCCA 3KR3H 4G6FB 1W0WA 2EUXA 4I9WE 4EZLA 2HTMA 2YRPA 4QS6A 2WMJA 1NSNH 2FX7H 4RV3A 2V2TA 2CCWA 1LDSA 4QKTA 1J11A 3S6TA 1KFAL 4PRIA 5D9OA 1F7BA 1ZD6A 3KCPB 2D9QB 4NNYA 1I1FB 4WDIB 3W82A 1IM9D 2OPJA 4MNQB 5DRNB 3ZSSA 5L2KE 4JFYA 6PTDA 5DDHA 3RRAA 3QUZC 2DIJA 4TUKL 3VIIA 1UB6A 3ZWTA 4QG8A 4DJDC 4AYDC 5KJ7E 3ZFHA 1W0VA 5ITBH 2WZIA 2DLEA 4F9PA 2XA3A 3LHZA 5JLZA 4Z5RA 4ZRGA 4AENA 4Z3EA 4KGLA 3UJFA 5CILL 5E4AA 2OX1A 4QEEA 4CU7A 1UCWA 2F0CA 3C2VA 4YNYA 3L5HA 4M61B 1WHOA 4Y2LA 3CVHA 3E0FA 3TV3L 4KKCC 4EXQA 2WZFA 1XM3A 4FQ1H 3W7QA 3D1MC 2WXDM 1HQ4A 1H62A 4QF1A 1W8OA 2XIJA 2NWSA 5A8OA 2GSGB 4LCYA 3BVUA 2BWQA 1DL7L 4U1GC 1WFOA 4XZUB 4MDJB 3EYSL 5ABEA 3IBEA 1LO4L 3CS2A 4PUUA 3OAZH 3V5HB 1UOZA 1MFEL 1VRXA 5HYEA 2DM7A 2J56A 3P77A 1ICPA 2ZFAA 3V5KA 4LXFA 3VFRB 3F7YB 3TBTB 2D3VA 4XBPA 5CSZA 1J0ZA 5CP7B 4PJBE 1J8HD 1NIFA 5AAWC 3VDGA 2YFOA 1FF5A 1P1MA 2OL3L 3QYQA 1OSZB 3O3EB 4FFVD 3LRSA 5ACMA 2YD9A 4KROD 2J9XA 3ZDYB 4LSPH 1E55A 3RDTB 3GQYA 3K30A 4LCWD 2OX4A 3ETBJ 5F7DA 1NCJA 2A83B 2K1MA 4L9YA 4NO5B 3NNTA 4CUCA 4L8CB 3KGUA 4H9YA 3HAEB 4YX2H 4JB9H 4CQCA 4ZTOH 1IGSA 3V4PA 1RA5A 4N22A 2W61A 2FATL 3BDYH 1WNOA 3KPRE 3HFMH 4DUVA 3PZUA 3CV6A 1XV8A 4TSBH 2WP3T 2XACC 4PJDA 5C0DA 2J20A 2NY5L 2L7EA 4A2SA 3T6VA 4ABWA 4ZPTB 3VKCA 1VBJA 3C6LA 3ESPA 4QGCA 4Y16C 1YAZA 5AVXB 5FPIA 2FLRT 5FL1A 3ESVF 4GZEA 2F5AL 3QWRD 1W72B 2R0ZL 4C6KA 3HZMB 4YHPB 1H3TA 4NLHA 1F6LL 1GJWA 3TP4A 4LCIH 5C9WA 5AKVA 1HYRC 2YXVA 2P24A 3QUXB 1GPWA 3SDAD 1UC4A 4WGVB 1YPZE 3VD2A 1A47A 2V8MA 4Y4KA 2RACA 1KG0A 4FMVA 2DYPD 3ECVA 3LXCA 2ZRVA 3TW9A 3GIPA 4Z23A 1ERNA 2X2JA 3VYOA 4GRWB 4RDZA 3HKFA 1JF5A 2VDOH 2D3LA 5J3HC 3P7YA 1RZKC 3C56A 2D69A 1MQKH 3QR2A 5A8NA 4N90E 4MJ5A 4KUZL 1RVFH 1NKRA 4MA3B 4M51A 3U2JA 5JUEH 1FPTH 1G6VK 2BIMA 2ZSWA 4M48L 1EO7A 2P8MA 4HD5A 4L4TD 4I9MA 4M81A 2NSMA 3ZBMA 3BT0A 1EHLH 4GY4A 1R5IB 1VACB 4MNQD 5HYJE 3S3BB 5C9KA 2ICWI 3C75A 4UR7A 3VXUB 2MRYA 2W63A 1XLJA 1NC2A 3EHBB 1KLFA 2ZWZA 5LCVH 4JIHA 2G9HB 1FKXA 3U7WH 2NCMA 4W88A 2DLHA 3O8XB 1WEJH 2NY3C 1MWAH 2FIQA 4OHQA 5ECGA 4NKMB 2BH0A 1RZFL 5CAHA 1DDTA 2ZPKL 3O11B 4R7JA 4NQCE 1GYNA 4LAQL 4YS4A 3DBXA 1A02N 2ZWLT 3T77A 1DQQB 1KXQA 2RHEA 4C1NA 3CQQA 4M62L 5MENE 2FECL 4IMCA 5LNGA 4MY8A 1D5IH 3Q6GH 3EFDH 3UZ5A 3VO0A 3FSWA 3CLEL 1JL8A 4A39A 4XXCC 2OQLA 1MVYA 1LLWA 3MS8A 3MA9L 3OKMB 3MRBA 3KOXA 4QNEA 3TYBA 4IMLB 2FGWL 2ZZ6A 3VI3F 1LO4H 1M53A 3BP7A 2MFNA 1WDQA 1DBJH 2ACQA 1MCOL 3HG0A 3JWOC 1NP0A 3PK7A 4L3CA 5KUKA 2KC0A 5D2LB 1A5CA 3VD9A 3MV9B 1AJ0A 1BLIA 2Z93A 1UR8A 3L1OH 3VGAC 3WMPA 4TQIA 3V79C 3GHEH 4GUHA 1X5GA 1PUDA 2DSUA 2XXMB 2HFEB 1A5LC 5DYOA 2C9RA 1MRCL 4KC3B 4JICA 1JP5A 3WQSB 1CGXA 1Z5LA 3W7OA 4CBPA 1OSEA 3VOCA 3VM5A 2OL3H 1OTSC 2XICA 5FDYA 3RLUA 2A7PA 1HJVA 1OFDA 2ZIDA 2E6QA 4ZQMA 3MCOA 2Q86A 5CJQL 4L1BA 4YK4B 5D8JH 5JDJA 2PO6B 3VSQA 1F07A 1XGEA 2F38A 1OPGL 3ES8A 4HNVA 1JI1A 2AGKA 4DKEL 4BJHA 2NNAB 3UYPB 5JOEA 4MGXA 2AI0L 3GLZA 3WGVB 4PG2A 2ADFH 2WNWA 2XGIA 4ZQCA 5EEWA 5J0BA 3FU9A 2MOVA 1IX2A 1WG3A 3S2LA 2DV0A 4LLDA 3MW7A 3W81A 3IJ7A 2P5EA 5CH9A 2NY5H 3IWPA 1V27A 2G2RB 9XIAA 1QNQA 2AANA 2JQZA 4V2CB 4TL4A 3U6RB 4GBUA 1NCAL 5C9XA 5DZNA 4G70B 4ZYKB 3W9DA 2AS5M 1G4TA 1C7TA 3CZLA 1GW9A 5H91A 4ATLA 2WSQA 5JIIA 1M6OA 3QIUC 3ES6B 4F93B 4I18C 2WGNB 2GGIA 2OWWA 4WHTA 5KEZA 3AT9A 2OMNA 3UNDA 2ALAA 3RI5F 3MNMA 2FVKA 4GAEA 4UTBA 5C0JB 4DLFA 2FL5B 3CBJB 3QRHA 4BKTC 4N02A 3B1TA 4JTSA 4MA8L 5F4WA 3U2ZA 3W29A 5E93A 1MCLA 1MCHA 2BOLA 1MHPL 2L4OA 4XR8C 1QI0A 1OO2A 1H7NA 3W2UA 5EZIH 5KSBE 3GLAA 2PMZA 3W1AA 1P7KA 2FYYB 3TBSB 3PZTA 5I6XC 2MNRA 2VZSA 2W0LA 3EYQC 4IQHA 4XKMA 5KN5B 4KUZH 4MSWA 4IDJL 3WDHA 1ONNA 1SUXA 1YEFH 2PDIA 1R6VA 2Y7GA 5G1YA 2XSBA 5ITFB 1QSFA 1FNSL 1G0XA 2DJSA 1ML0A 2NX9A 1BVKB 4YLCA 4LRIC 1IQWL 3NJFA 5TBOA 2XXGA 1LE5B 1T5XB 1NDWA 5IIEA 2K6YA 1MVUB 3Q2NA 2X30A 1MHHB 3O4LD 2ZX8A 1M7PA 5E5UB 4X0NA 4UM9B 4KAQL 2TYSA 2UZ9A 2EADA 4TV3A 1V3KA 1P7HL 1DLFL 5FHBL 5E6YA 3R7RA 3MODL 4UANA 3P84A 2YPVH 4OSUH 3L5IA 3A24A 3O8XD 3O0FA 2VXVH 1RIHH 2ITDA 2G5BA 1RZFH 2J1WA 2F7PA 5HHOB 2DZPA 4BK9A 3HR5B 4AEEA 1KEGL 2X41A 1ZAJA 3NJ3A 3VGBA 3SM0A 4CGUB 4JO8A 4YZWA 3T05A 4Z7WA 2X4OB 4Y8FA 3G5WA 2WKOA 2OTWB 4WNQA 3OB0K 4W6WB 3V0AC 2XZ7A 1S2TA 2DU2A 1LEIA 1X4XA 1OSYA 2YS4A 2ZZ4A 1HXKA 3OGRA 1BFSA 4JRYB 2QV4A 4QDWA 3TA3A 4JO3L 3N11A 3OGVA 2EINB 4K5NA 2W6RA 4D8LA 3WH6A 1CVSC 1OF6A 4JFFD 5D04C 5HHNA 4WJXA 4DPPA 2WW8A 4HX1B 2XTKA 1O9VA 3LDBB 1CFSB 4ZB0A 4IU3A 3IGLA 2X9ZA 2MH4A 4BK5A 1EXGA 2ON3A 4B0MM 3RFZA 3U79A 1G7IA 2PTDA 2G2PA 1K4DA 4JBRA 3WK2A 6XIMA 1GNXA 3FUJA 2YD2A 3T0EC 5HNNA 4XZHA 3DK2A 5T1LA 3NP4A 3IACA 4GFIA 2YXMA 3FQXA 3QCVH 1RCOB 4N5UA 2DYSB 2FNBA 3ORWA 4I8DA 2PO6D 1OPGH 2NY4C 2Q76A 3PAYA 4NKIL 3U2SB 1Z3NA 1FZKB 4NIKB 4XWGL 4NQVA 2QULA 2A2IA 2ZDRA 1PYWA 4OLWL 2ZT9C 3WYRA 2NUXA 5GJTL 3WO4C 2EE6A 1V7AA 3OKKB 5E99L 2AI0H 1QI4A 1HAWA 5G5DA 1J05A 1FFQA 1KRMA 4KFPA 3STGA 5B7YA 3QA3B 1MJJA 3ARPA 1ORSA 3WJMB 2WWNA 5JMRA 2G3XA 2B59A 4FZIA 2V5CA 1B54A 3EOEA 4NKQB 2W9LA 4W8AA 1NCAH 4Y4HC 2ISWA 3BLEA 3MRKA 3TXAA 1AI1H 2PRMA 4UNTA 5IJBC 3ARBD 5IHUL 3NSMA 1U8PB 3F58L 5BZZA 1GRWA 2VUYA 1DN0B 4X0KA 4MAUH 4TVDA 5GGTA 1IGJB 2AK4E 4ODUA 3AIRA 4PQXA 4CC4A 2NZ1A 5DJ2A 2WC3A 2P42B 4YTSA 1HP4A 2E6AA 2H0EA 4IH3A 2R2BA 1OAJA 1UKTA 1CECA 1L6YA 3BD3A 1KWGA 3MFGB 4IIQC 1D7KA 3GFZA 2AHIA 4HKXA 5IVXE 4X2PA 5FUZH 1J5DA 2ZRZA 4DF0A 3D0CA 4ZI8A 1KTJA 1U8CA 3TYZA 4UIMA 3URQA 1FBAA 1TKWB 2XM1A 3MVIA 5EDXA 5E94B 5EBLA 2F61A 3RE0A 3RPBA 4NHVA 2YL9A 2JKAA 1FNSH 2GUOB 3BLBA 2E27H 4HZLA 4BM7A 1RK5A 5F7MC 1H7PA 2WNXA 4W9DC 1IQWH 1W9VA 3I6GA 1OTUC 4OZHB 4AZIA 5DLCA 2BXZA 4P5TD 3NTCL 1NLBL 4JTIA 4P7LA 2PBGA 1ZE3H 4GAJH 5I66A 4XX1E 3RA7L 1UMLA 3VXTB 2VLRE 7PTDA 3DIDA 1BA9A 3DHJA 1BXXA 1G1KA 1DLFH 1XBRA 5FHBH 3UEZA 3MODH 2LE9A 4JDYA 3Q2CA 2AF2A 1XHGA 3VXME 1AJZA 1N18A 1EHNA 1IVLA 3QQ3A 2EXWD 2QUUA 4F9LA 5C0BB 5HHOD 3CZEA 2OFJA 3PWVB 4YMPA 3PWUB 1DBKL 1QLEH 1XL9A 4KERA 3TCSA 2YSWA 1AL8A 4U1HB 1L9MA 3DC0A 1P4UA 5HGDA 3O6CA 3PZOA 2F68X 4XI5D 2TPSA 3WLJA 5JIHA 1FZMA 3VNMA 4PCNA 1OV8A 5EUKA 3CMGA 2Y61A 1XF2A 3C2RA 4UUIA 4TMBA 2FFLA 3ARUA 3VIPA 15C8L 4JO3H 5E0QA 1FHGA 3RWDB 5AOJA 1QP1A 2IV8A 2ITFA 2GBUA 5IFTA 1CFQA 4IL0A 1PKOA 1FP8A 4R34A 3P5ZA 2CLZA 3Q8BA 4WXZA 3QB7C 3IU3B 2K7QA 4REQB 2P0IA 2VR6A 4JCWA 4ZSTA 4L4VE 4DO5A 4BF5A 1T03L 3T0CA 3WEXB 3W7LA 5MEOB 4QJ4B 2NTFA 3EOAA 2E6PA 5KVDL 4P46A 4JO2H 1AYOA 2VISA 3QZBA 4BKLA 5I1JL 1EQWA 3K72A 1W91A 4MMZA 1EH9A 2PI6A 4OLXL 1V03A 2XUWA 1KBLA 1NL0H 3R7QA 3LUTA 3ISRA 5I73C 3GUFA 3S35H 3REWB 3WJLC 2JJWA 1TTPA 1K6AA 3RLHA 1HH6A 5I75B 2EDXA 1DQLL 3K2KA 3VDHA 2R69H 4F57L 3B4YA 4B97A 3VYLA 1UXMA 1HE7A 1F41A 1NBZA 5IVOA 3T8LA 3AO0A 4UAOC 1TWZA 4K71B 2WYIA 2WOBA 1L4IA 3LKQB 1RLDA 5JXEA 4AG4H 3PBUA 3N9RA 2AK1L 2D7OA 2OLDA 2KZHA 4TX9A 2F1AA 3QDJD 2I60H 2PTVA 3ZGHA 4J4PD 1R9YA 4XXWA 3WF3A 4JQAA 5C0QA 4JS3A 2WUBL 4YVXA 4ECNA 1TPVA 3L13A 1QWNA 1REQA 1P84J 4P2RA 1WBYA 2Q1EA 3HJZA 3ARDA 3D69B 4MZ3A 1S5TA 1G7QB 3W2DL 4M3JA 1RSFA 2A73B 4IQJA 4O02A 3UPRB 5CU5A 2A6IB 4N2AA 4JE0A 4OJFL 4F3HA 1Y0EA 1BVLB 1G5AA 2YXXA 3N3EA 1JPFB 4Q56A 5HK4A 1GQJA 3KYMA 3EJYD 3EKGA 4LCCB 1A6VL 4NM4L 4Q32A 3WTUA 2POTA 1JPTL 4DK6A 2O1AA 1E51A 4ISVA 3WFZA 4D6IA 4LHUG 4GUQA 2YXWA 2OSWA 4GKZB 2DZVA 3KPNA 3GSNH 4H26B 4Z1CA 3W39B 1D5MB 1YNKL 1CI3M 1B0GA 3TYFB 2PTTA 4UCGA 1Q2SA 4KTEH 2BVDA 5JOPD 4LSVL 2FJFA 2OMZB 1T0NB 3NTCH 1NLBH 4GQPH 1EPFA 2FSEA 3PL6C 1WGVA 4X7FC 5EFIA 4GFXA 2IPJA 2HT4D 1AIFB 4HNOA 1OAZL 3AALA 1KIRA 3GU2A 3GUWA 3STBA 5AKSA 1WDPA 3FO0H 2J2ZA 4Q4RA 2FBRA 1OP3K 1UWIA 1XB6A 4G7EB 3DESA 2GTZA 3WIAA 1PFOA 2PYEE 1F90L 1CBVH 2C14A 1DBKH 3X13A 3WE6B 4OZGA 3C2EA 2Q01A 4PRPB 3SFKA 4ZAKC 3WO8A 1F3DH 3S4SB 3HBQA 3UGXA 1Y6MR 3KOWA 1LQAA 3T40A 4Z0JA 4QXUL 4AJ0A 3MP4A 1AW5A 1KNOA 4X8XA 4FQQB 1ETZB 4QOKB 2MWCA 4U6TA 1IR2A 4EBQL 3BSMA 1VA9A 5DEZA 4HEMA 1OG0A 3SZKC 4M5PA 4QRNA 4X50A 5T9BG 3SQLA 3U9UA 1S6NA 2R0LH 4D6JA 1T03H 1OCNA 1PG7W 3W22A 3WLWC 1XYFA 4XAZA 3ZXAC 4NI3A 4V33A 4JFHD 3OBEA 1H0DB 1PD0A 3U2CA 5KVDH 5FYKE 3IXAA 3W6MA 1KIPB 3AREC 1YE6A 1YYLL 1F73A 2AMXA 5HGAA 4ATTA 1LWJA