2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
1M01A 5F7UA 3AU8A 3ARWA 3WH7A 4GO8A 1GHRA 5FL1A 3HG5A 3AMGA 3APGA 2G41A 3D52A 1G1YA 3DX0A 4QCFA 1C7TA 2FHCA 1GOOA 1VB9A 2QV4A 2J7EA 1Q4NX 2CITA 4V27A 2E40A 1KQZA 3SEPA 1QBAA 6CGTA 1C90A 4HZ6A 5BYWA 1J0JA 1X6NA 3O9NA 3HG3A 3WIJA 1W3JA 1V6XA 2BHUA 1J0YA 3VIMA 3HN3A 5D8ZA 5AYBA 5CGTA 3EDJA 1R0LA 2DT3A 2GDUA 2OYKA 4UOZA 1W91A 3WQRA 2F7OA 4AIOA 4M8UA 2C8NA 1K9FA 4GI8A 3WY1A 4X9YA 1O6IA 3WF1A 5JIPA 3AUAA 2X05A 3EMCA 2Y5EA 4JFUA 5CLTA 4QLLA 1R85A 2D0HA 3W6MA 2VQUA 1HP5A 1KXHA 1AQ0A 3IJ8A 1R33A 2NSXA 1ISZA 1H3LA 3S5YA 3MMUA 1H1NA 5I24A 3AU9A 4CD8A 3DDFA 1WDRA 3IAPA 1TVNA 2XIBA 1FHLA 2QPSA 3DX1A 4D6CA 2FGZA 1ONPA 4W7WA 3WFZA 4MPKA 5A2AA 4M24A 3GBDA 3CTTA 1UR1A 1UWTA 4U2ZA 1QW8A 3M07A 3LPPA 4PTXA 2XFYA 4MNMA 1NOFA 3UR7A 4KMQA 5HBFA 2XTKA 3ECQA 1GOIA 3VKKA 2PWHA 3AHYA 4HPGA 2FH6A 1CGYA 3NSNA 4TUFA 4HA4A 3S5ZA 4UFKA 1V08A 3OLDA 2WZEA 3ALFA 1XCWA 2BFGA 4FNUA 2BV9A 1UH4A 4QP0A 1OIMA 1XCXA 3WKZA 1UZ4A 1VFUA 2VX7A 2X2JA 2EPMX 1UHVA 1XHGA 3N11A 4F8XA 1KB3A 5EMYA 3NSXA 1VAHA 1BYBA 4NRSA 3AROA 2UY4A 1B3VA 1AMYA 1KFWA 3IIEA 3VX0A 1JD9A 7TAAA 1J0IA 1B3XA 1TUXA 2JIEA 4MAZA 1ZB5A 1WPCA 1WE5A 3PBGA 1H0IA 3VD4A 5CZKA 4JIEA 5A8NA 2X2IA 2WANA 2E3ZA 1MWOA 1TA3A 1W1TA 1Q6DA 4QFUA 2NT0A 4J3SA 2YL5A 1X6LA 3IAQA 1D3CA 4DM1A 3RILA 1FHDA 3BCFA 4L4PA 1YQ2A 4GZIA 1PX8A 2DIJA 3TV8A 4PTVA 2J75A 1OT2A 4FLQA 2TAAA 1EIBA 3N15A 4Q7NA 3WF3A 3LXBA 3OGVA 1MYRA 1QBBA 4NF7A 2F7RA 4OOUA 4D6IA 1MQRA 4PMXA 1MFUA 2ZX8A 4HU8A 3B9DA 1LWHA 4YHEA 3VGGA 5HOSA 3F5LA 1M53A 4AEEA 1ODZA 1S46A 2WAGA 3KLKA 1UQZA 3ZSSA 1XC6A 2CHOA 5FD0A 2ZX7A 1VRXA 5DT7A 2WHJA 2WK2A 3HG2A 1GZJA 2YL9A 1HP4A 1UR0A 3RMEA 4OIFA 3VGDA 3VNYA 3DHUA 4J3VA 2EGHA 2VMFA 4XZBA 3IGUA 4OOEA 3GNOA 2YJQA 3S6TA 1VBRA 3ZR5A 1GHSA 1GNXA 2PB1A 3WSUA 3CLWA 5BXPA 3L4YA 4B9ZA 3WENA 2DSVA 3JUGA 1VFFA 2W91A 1W1VA 3IJ9A 1VBUA 3TOPA 1UYQA 1O7AA 4D6GA 1B2YA 1CENA 3VINA 4DO4A 3W81A 1C92A 1QHZA 4RE3A 1D2KA 2YIHA 3BAXA 2YLAA 2Y1CA 3B8SA 2JE8A 2VVNA 2WCAA 3WDQA 3BGAA 3WY2A 1H5VA 1CPUA 1TVPA 5BRPA 3AJ7A 5I0DA 3THDA 1V0MA 5A94A 2WKGA 4HMEA 3OG2A 1E43A 4XV0A 2FHFA 4FLOA 1CXHA 1HNYA 1JFXA 1KXVA 2VVSA 1ZJBA 4ZQEA 1KBKA 1V02A 4H41A 3WDHA 1UD3A 1Q0LA 5HXMA 3K8LA 1W9BM 1MXGA 1B90A 2W63A 4J3XA 3OLIA 2JCXA 4H8HA 2CBVA 2XFRA 1B3ZA 4DO6A 4W84A 4H8UA 5E09A 1DWJM 1V3MA 2BVTA 3UETA 3W4RA 4AY1A 1GOQA 4CVUA 1VEOA 1V0LA 3WQWA 1EXPA 3A23A 4W5ZA 1HL9A 1B0IA 4HA1A 5AC4A 3W28A 3KZSA 4GZJA 2UY5A 4W88A 1LF1A 3OBAA 2XPKA 1JZ7A 1UH2A 4CCCA 3FAWA 4YPJA 4AZHA 1DHKA 2V3GA 2BXZA 2GVYA 2YL8A 2WVVA 1T0OA 3ANNA 3VTRA 4PMUA 4ZQFA 7A3HA 2VJXA 3MO4A 1FH9A 4TOQA 5JNLA 4GI9A 8A3HA 4U3AA 4PCTA 3VIKA 2IGTA 1Q6EA 3U7BA 2D3NA 3VNZA 1TR1A 2W4XA 3SUUA 2OWXA 2EPNA 1NWUA 1CYGA 1GVYA 2E9LA 2EAEA 1E6NA 3L4WA 4GPNA 5BXSA 3II1A 3K1DA 1JIBA 2WC3A 4MNJA 3MUIA 4PRWA 3L2MA 4M82A 1HJVA 3W27A 1WZKA 1CXKA 4AISA 1W2PA 4PMRA 5CPQA 3VIPA 2DQXA 1H09A 3PZ9A 4D6HA 4ZXLA 2XUCA 3WL0A 4GO9A 2VRJA 4N0RA 3AXXA 3AS0A 2W92A 2WCSA 1EHNA 4A4AA 1KGXA 2YOCA 1JDDA 1KBBA 1TQWA 7CGTA 2JF6A 1JGIA 4AZ7A 1HL8A 1HJWA 1W2VA 1R46A 1KXQA 2WHMA 2PBOA 1TQVA 1JL8A 3W38A 4D6DA 4PMOA 3GH7A 1BYDA 3D5HA 3A47A 5JBFA 2YL6A 2X0HA 1B9ZA 4XB3A 3EMZA 3GBEA 1WDSA 3WUEA 3WD1A 3AIRA 1VF8A 4TX6A 2PI6A 1FP9A 3FXYA 5KZ6A 4JKMA 1V3KA 2RGMA 3WD4A 4IPNB 3MUAA 3HG4A 5CLWA 2XVGA 4C7FA 3CUIA 1H11A 2FDMA 3ALGA 2OW6A 4JKKA 4W8LA 2XN0A 1AQMA 2J7FA 5A8PA 1OCQA 3GXPA 3BCDA 1E56A 3D50A 3K8KA 1WZMA 2V3DA 2F8QA 1UD2A 1ITXA 1UKOA 5FKYA 4MB5A 3D4ZA 5ABHA 4AYGA 2A3CA 2PC8A 2BY0A 1R7OA 5D9MA 3EDDA 3MUZ1 5FOOA 4BS0A 1JYNA 1DTUA 1C8YA 1QI0A 4ATWA 1OINA 1CBGA 1UQYA 1UKQA 1E15A 2OYMA 3RPMA 3A14A 4ZQGA 1HKJA 4ATDA 2YFNA 3WELA 1HJXA 3GH4A 3BAWA 1OM0A 3PZTA 3SCRA 2G4FA 1OD8A 4P8XA 5IXEA 3WQQA 3WDJA 3MSDA 4AZ5A 4CXFA 1CXLA 1A3HA 4IISA 2OLHA 2E8YA 1WO2A 3ZMRA 5JC1A 1H49A 4W7VA 4NZFA 3TP4A 2JD0A 1OBAA 1M7XA 2ZWZA 3A21A 1CDGA 3CH9A 1BPLB 5A6BD 2WNWA 5DF0A 1C8QA 2XWEA 1HVQA 1SFSA 3RM4A 4PUEA 1UR4A 1MVYA 3PZUA 1JYVA 1HKMA 3M6DA 4EK7A 3HZ3A 1JD7A 4QAWA 1BAGA 1SMAA 3CIVA 1JDAA 3LMYA 3W82A 4Z2JA 3HJEA 1HVXA 3W26A 1R8LA 3NSMA 3DDGA 2FE0A 4MB1A 1JNDA 2J7CA 1UKPA 1QWNA 3M7SA 4BQ2A 2ZXDA 3AHTA 3MUY1 1XRVA 4UQDA 5M03A 4AW7A 5C8BB 1FH8A 1E72M 4AIUA 4MNKA 1MQPA 1ZS2A 1GONA 1N82A 4HOXA 4LX4A 1QI3A 3VILA 3AZTA 1E6XM 1E4MM 1VJZA 4Z2LA 1UWUA 1KR0A 1GJWA 3AOFA 3N04A 3L4TA 3CHEA 4PN2A 1KXTA 1W9DM 3CMGA 5C71A 1GOWA 1WZAA 8CGTA 3BAIA 3ARVA 1V02E 4WSJA 4PMQA 3AXIA 2ALWA 1J0ZA 1PZ2A 5FCZA 1WNOA 1CZ1A 1E4NA 2B31A 1JG9A 2BY1A 2EEXA 2WSPA 4UQBA 1ZL1A 5D9PA 3SUWA 1JYWA 1E4IA 4AD2A 1MFVA 3WNKA 1GW1A 1ZU8A 3AS2A 3EYPA 4M80A 2OSWA 1QOXA 3DYMA 3KE0A 1V3IA 2WM0A 3ARZA 1V6YA 1FFRA 2ZUVA 1QHPA 1HTYA 5CGMA 4WKFA 2CYGA 4GINA 2J7GA 3WQ8A 1PX4A 1EOMA 1JZ8A 3VVGA 5E0CA 2XSBA 3VIGA 4M81A 1GOKA 5IHSA 2WVUA 3OGSA 1UD5A 5ABEA 1B31A 3T2OA 4F66A 3EJRA 1EO7A 1ISYA 3ZHZA 4CU8A 1UR8A 1BYAA 2WZHA 4N42A 4M29A 1DP0A 2G3IA 3CUHA 3CZKA 4AXNA 3EDFA 3PZIA 4R27A 1CGXA 2CBJA 4MDOA 3WY3A 1U30A 5JAZA 1DWIM 1VENA 1D7FA 2BY3A 1RH9A 4U3CA 4PBGA 4L4OA 3RDKA 3BMWA 3VD3A 4WKAA 3N1AA 2AMGA 2W61A 1RP9A 3ZR6A 3CZJA 4FK9A 1Q0QA 3OA5A 2EACA 4FNPA 3SCOA 4RE2A 1WB0A 3MI6A 1HJQA 1NP2A 4JCMA 2J47A 1H2JA 2D0FA 5GNXA 3DC0A 1ESWA 4OJYA 1BFNA 1E3XA 3THCA 5AC5A 1BTCA 5TD4A 4HU0A 2RGLA 5DEZA 2Y8VA 2VCAA 4WKHA 3TTSA 3WQVA 4TTUA 1I75A 2VR5A 3L4ZA 1J0HA 1K9DA 3WD2A 3L4VA 4AZCB 2D73A 3FW6A 3POCA 3MS8A 3DYPA 4EAMA 3CZLA 1KWGA 2VOTA 2BHYA 3H54A 2WC7A 4W5UA 1TQUA 1UR2A 1EO5A 1JYXA 2GJXB 2GUYA 1QNQA 3ZM8A 4NX0A 2DH2A 1BVZA 3ZHXA 2A3AA 4AYSA 5GNZA 3VD5A 3WDPP 1GCYA 3A6OA 1JZ3A 4IUGA 2WMFA 3BMVA 5LYRA 3PHAA 2PBGA 3D4YA 3CUJA 4UCFA 3SUVA 3TTOA 3WQ6A 4DWSD 3L2LA 2AAAA 1HF6A 3ZHYA 5LA2A 3H53A 3VIHA 2V3FA 2D22A 4JCLA 3AI0A 3W25A 3WNLA 3WFLA 2IXUA 3ZIZA 3OB8A 1QHOA 2XN1A 3SCSA 4Z2IA 5EB8A 2IXVA 4D1IA 3VDAA 4ZE4A 3AS3A 5I6SA 2XSAA 1AVAA 3ZJ8A 3K46A 3AMLA 2DSKA 4UFHA 4BQ5A 1UWRA 3ZOAA 1HX0A 3BSHA 3OZOA 2QF8A 3ARTA 1OR7A 3A4WA 3RASA 4MNLA 3U57A 4HPHA 1CWYA 1C91A 3MV11 3L4UA 2WCGA 2ZUNA 2CBUA 3GH5A 4CCEA 2X2HA 3O2LA 3EJTA 4TXEA 2D3LA 4HZ8A 2X8RA 5CQ1A 4DUXA 2CERA 1UD4A 3SUTA 3WMBA 2BHZA 3AXHA 3AHXA 3HU7A 1KGUA 3BXWA 2EBNA 1JI2A 5C70A 5DO8A 4MAVA 3GZAA 1FFQA 5M17A 4U5IA 1UWQA 4DWSB 1J01A 5EBAA 5M5DA 1F4HA 1BVNP 2D24A 2XGBA 3L4XA 4F79A 5JMWA 3O6AA 3RCNA 2EJ1A 1JAEA 2VNCA 1JZ5A 3VMNA 3WNNA 3MU7A 3ANLA 3F4VA 2CNCA 4D72A 1SC5A 3AQUA 4UQAA 5FIPA 2VX4A 3VPLA 4B3KA 1YHTA 2UY3A 1ZBVA 4H2CA 2EO7A 2VX5A 3FHQA 5IFPA 2NW0A 4UQCA 1OGSA 2Y2WA 1JXKA 4XZWA 2Z1KA 2W62A 2IUZA 3ZT7A 4JFWA 3GDBA 3GXNA 3WMCA 3EDEA 2ZOXA 3OLGA 1C7SA 2WWCA 1GUVA 3AYRA 4UR9A 1I1XA 1PAMA 3KLLA 2G3JA 5A6JA 1LG2A 2F2HA 4F9JA 2E4TA 2WMGA 2Y1FA 3BAYA 2CPUA 2D20A 4B3LA 4AZIA 2F1BA 1V03A 3TTQA 2FHBA 4GZEA 5DT5A 2PWEA 2X09A 4A3YA 2F7PA 4WSKA 3W53A 2ZXAA 5DFAA 4EKJA 4U31A 3WH6A 1HXKA 3LRKA 4OKDA 4PSPA 2C7FA 4PMDA 2YDSA 2BY2A 3K4AA 4AD4A 1BLIA 2DSZA 1J9YA 4FLSA 2XVNA 4P7LA 3GXTA 3EDKA 2ZUTA 3WF4A 3BLBA 3G6LA 2WMKA 3WN6A 2WB5A 2WHLA 3T0DA 1M03A 4UQ9A 4NRRA 2OYLA 3MMWA 1BYCA 2C82A 2V38A 4JHZA 5JO0A 4BA0A 2D1ZA 4W8AA 4GQQA 3TTYA 1SZNA 2DT1A 2E9BA 3WEMA 4WIWA 2Y24A 4OOFA 2BVDA 2VQTA 4KGLA 1J0KA 1V0KA 4PTWA 1BG9A 2Y1DA 1QNPA 3SCVA 4OGZA 2Y8KA 3AIBA 4P8VA 1W32A 5E0FA 4PMZA 3LXAA 2EABA 4LXFA 2E8ZA 1VIWA 1UKTA 3UG3A 1E6RA 3QOKA 1RD6A 4P8WA 4UFJA 4J27A 3F5JA 1HWWA 4J7RA 4NZJA 1R86A 3WDRA 1E3ZA 1CGUA 3PZVA 2PWGA 1E6SM 4KP7A 3NIYA 1E6QM 3WD3A 2WKLA 4WK9A 1EOKA 1CGTA 2XJ7A 2DDXA 3DECA 4CD7A 5CSUA 2GFTA 2ZE0A 3WNOA 4P7NA 5CSYA 3AYSA 2A3HA 4H04A 3GYCA 5CPSA 1ZBKA 3ZT5A 3WNPA 5BXRA 2OSYA 5DULA 1PIFA 2YDRA 1ONNA 3WF2A 2D2OA 3CZSA 3CUGA 4ML4A 1DEDA 3VIJA 4W7UA 3T09A 2ZX5A 1ZJAA 2WMIB 1GQIA 1BSIA 4GIAA 2JD1A 1VEPA 1UASA 3I3BA 4BQ3A 1OSEA 5A6BA 4GAEA 3H55A 2O9RA 3VUPA 1XYFA 1LWJA 4UFIA 3ZO9A 3ARPA 2CCRA 2BXYA 1V3HA 2VL4A 3AIEA 4FF5A 1IZJA 4FNTA 3ZT6A 3NUKA 3MANA 4AD5A 1XSJA 1DWHM 4UOQA 3BVVA 1UA7A 1LL4A 1HJSA 1QPKA 2XG9A 1B1YA 3WF0A 1PPIA 5CJ5A 2Y1EA 3VIOA 1XYZA 2YFOA 3VX1A 5A6LA 3T0AA 3VM7A 4MB4A 5EFDA 2BNJA 1QWUA 4B16A 2CKRA 2AOSA 2YA0A 1CGVA 5DMYA 4V2XA 4AD3A 1DWGM 4P7OA 2JD2A 3T08A 3VOCA 1G0CA 2D23A 4Y6RA 2JCVA 3SCTA 1R7AA 4ATLA 1VEMA 1JZ4A 1H3GA 1KQYA 3RIKA 1K5HA 1TG7A 4PUDA 3ARSA 4QLJA 1UD6A 2JCYA 2XM1A 1HXJA 3I3EA 3U5UA 1UZ1A 1L0PA 1DWFM 3AIQA 1LL7A 2W5FA 3ZJ7A 4P8UA 3GNPA 1SR0A 2W67A 1EDGA 3UEQA 1E0WA 4S3KA 4OUEA 1VJSA 5I77A 4AWEA 4TVCA 1CLXA 2J7DA 5JBEA 1PS3A 3VMPA 1WDPA 2VZOA 1XH2A 4U5KA 5A95A 4BF7A 3GXIA 4TX8A 3LPGA 4RE4A 4YHGA 1J10A 4UFMA 2JEPA 3ARRA 1VFMA 2XVKA 3PZOA 3ANMA 1CTNA 3WEZA 4AZCA 1C8XA 3AICA 4CN1A 4NZCA 4EANA 3DX2A 2MANA 1K9EA 4RCVA 4C7DA 2GJXA 4ACZB 1E5JA 1KR1A 3J7HA 4E8DA 1JXJA 1UD8A 2ZXBA 2VZTA 2JIWA 4JL2A 2J7HA 2DSWA 4PEEA 4ZEPA 3BLPX 2VT0A 2WXDM 1R87A 4QCEA 1CXIA 4PCSA 1UKSA 1LQ0A 2J78A 2O92A 3ARUA 4KGJA 1EH9A 2Q8XA 4P7RA 3RM8A 3AMDA 3VDBA 1V3LA 5A1AA 4D6EA 1CECA 2ESCA 3CZGA 1Q6CA 3PZQA 5IHRA 1JF6A 4CU6A 1IZKA 1DWAM 5GQBA 4OBSA 2YDQA 1B3YA 2VZVA 1LL6A 3ZJ6A 2J62A 1BQCA 2X2YA 2YLLA 3AS1A 4QLKA 1MW1A 3BC9A 1W3LA 2WHKA 5HDRA 4D71A 1UWSA 1V6WA 1MW2A 4UZUA 2XFFA 3QHOA 4FLRA 4LYQA 2CXGA 5I78A 3CGTA 3CHFA 5D8WA 5A8MA 1RP8A 6TAAA 1WCGA 1IT0A 3NDZA 4CKQA 3ARYA 4X0VA 1K9TA 1EA9C 4Y6PA 2XWDA 3KL0A 1E1EA 2BVYA 3SCNA 1ISWA 1KTCA 3VD9A 3CO4A 3BUQA 2F61A 3VGBA 5A6KA 2WSKA 3F5KA 4GKLA 3RM9A 3FHAA 3ZSTA 1CXEA 3BVWA 4E4PA 1KWKA 5I79A 4MTVA 1W1YA 2DPEA 2OWCA 4DWSA 1X1NA 3OLEA 5A2CA 2O9OA 3ZJKA 5A6MA 2Y1GA 1XD0A 1ZBCA 2XM2A 3OZPA 1HT6A 1W9PA 1I1WA 2A3EA 2HVMA 4D6JA 4ZENA 1BHGA 3AMKA 1PX3A 3W37A 2VCCA 3FNDA 1XSKA 1Q0HA 3N12A 1JAKA 3DX3A 3PZNA 4J28A 4PYSA 4CD4A 3HMCA 2ZXQA 1MW0A 2ZUSA 1TZ7A 1VFOA 3VO0A 5BWFA 2WLZA 1R47A 3WQ5A 1GJUA 3CC1A 1B3WA 4CCDA 1HKIA 1H41A 3BSGA 4F9DA 3A3HA 1QW9A 1BGAA 1BGGA 5D9OA 5EFFA 3T2PA 3AIUA 3IK2A 3N9KA 1XV8A 1EDTA 1TCMA 4BQ4A 4CGTA 2J8FA 3T2QA 3WUFA 5M3WA 1NWRA 4JKLA 3I3DA 5A3HA 4AMXA 1PBGA 4GI6A 3LXCA 1JF5A 3CPUA 2UWFA 2EPLX 1Q6GA 5I23A 1U33A 2WPGA 2G3NA 1TFVA 2JEQA 1JNEA 1HKKA 4DUWA 4Y67A 3MKKA 4LQ1A 4E8CA 3CHCA 2VZSA 3AZSA 2MAPA 3RO8A 2CESA 3GM8A 4DM2A 1L8NA 1SYTA 1AQHA 2ZUMA 3KWXA 2GK1B 4CN6A 2V5DA 1E5NA 4XX6A 1MQQA 2CKSA 3KL5A 4WLCA 1CLVA 3AISA 2GDVA 2XHYA 4J3UA 1PEZA 2WMHA 1E0XA 3S2CA 3T0YA 1GOMA 3PTMA 5LA0A 3EJUA 5D4YA 3LX9A 3WBEA 3N18A 4P7QA 3VD7A 1Y7VA 1GQKA 3CZEA 3AZRA 3FY1A 5GPRA 3WMSA 3WDIA 4Z2KA 1GPFA 1G01A 5ABFB 2XVLA 5BCAA 3BUDA 4HP5A 3CUFA 3WQ4A 5JBDA 3TONA 3VSUA 1EHAA 5JUVA 3SUSA 1W9UA 2VI0A 2X1IA 4MB3A 2WZIA 2CEQA 3MV01 1WP6A 1NOWA 5E6YA 2ZX9A 5BRQA 1E1FA 2YA2A 3GNRA 3TA9A 3QOMA 4URIA 2GJRA 2ZICA 2QHAA 1KCLA 1UUQA 2OW7A 3NJ3A 4D1JA 1NP0A 2YBUA 4WJXA 2J74A 3AHZA 4JL1A 3GTNA 5E6ZA 1PJ9A 3VMOA 1LG1A 2YKKA 5ECUA 3OIHA 3CZ8A 2V3EA 3K4DA 2O7GA 3M46A 2F1AA 5IFTA 3IANA 1TE1A 5D9NA 3BH4A 3SIMA 1G9HA 1JFHA 1KGWA 4Y6SA 2QMJA 1E4LA 4AD0A 3VU2A 2JALA 3B9AA 2WMIA 1PZ3A 1XH0A 2BS9A 2EPOA 4GXPA 4Q22A 3CZNA 2XYLA 4LPCA 1JZ6A 1E71M 1GORA 3NCOA 3D3AA 5E1QA 2HISA 3WY4A 4CUCA 4LUPA 1M04A 5JMPA 5A69A 2DT2A 3FAXA 2DIEA 2GJPA 2ZWYA 1KCKA 2J77A 3QR3A 1XGZA 2Y4SA 3WL1A 3A24A 1CNVA 1KTBA 3KEHA 1QI5A 3WH9A 5A8QA 3D51A 1FH7A 3PZGA 1XSIA 4U2YA 1US2A 1XH1A 1JDCA 1E9LA 2WYSA 3DHPA 1W3HA 1W1PA 4RL3A 3ZQ9A 3VSVA 3AMCA 1LJYA 2X0YA 4Z2HA 3A06A 3EBVA 2CHNA 5I3DA 1ISVA 4W89A 5A6AA 4HOZA 3N13A 3SCQA 4PMVA 3LRMA 3WBAA 1WZLA 1ISXA 5I5RA 2QPUA 2CIPA 1JI1A 4MADA 1OD0A 2WBGA 5LA1A 3VSTA 4UOJA 4AMCA 1WAWA 2WVSA 4PMNA 4AZGA 2DT0A 4OOZA 2A3BA 3UERA 2J8GA 2JFEX 4J3WA 1NWSA 3DX4A 1NQ6A 1HIZA 4R5EA 3ZI0A 1E40A 2NT1A 2PF0A 1T1RA 4W87A 3T0BA 1QVBA 1GQJA 3A5VA 4XUYA 2CETA 4U33A 1JZ2A 1NH6A 2G8ZA 3RJYA 2O9PA 3WH5A 3W0KA 2FGLA 4KRTA 4FMVA 3CMJA 1V3JA 4IPLA 3VGFA 3A22A 2XVPA 4OZOA 4AD1A 1QNOA 4WF7A 3VIFA 4NQWA 1NWTA 1NOUA 2WLYA 4HA3A 4OBRA 1UH3A 1OWQA 4EE9A 4GQRA 1J12A 1MW3A 3A4XA 4AICA 3UG5A 4UZSA 1U2YA 4NSBA 2V5CA 3GXDA 4CD6A 2J7BA 4ACZA 4AZBA 5BROA 4ZE5A 2WVTA 1OT1A 4TVUA 4AMWA 1BG4A 4DWSC 4J3TA 4E2OA 4ZFMA 1EQPA 2QLYA 1E6PA 3WUGA 3BLKA 3VDCA 4Z2GA 3VIIA 1C3FA 1UWIA 4BZYA 4MJ2A 3UG4A 4X0NA 1R34A 4Y7EA 4AZ6A 4M1RA 4AEFA 1ODUA 2XN2A 4HMDA 3SCPA 3R0IA 1XD1A 1B30A 1QNSA 3KL3A 3WEOA 3NYDA 1TA3B 1RPKA 1TQTA 9CGTA 1OIFA 3CHDA 2EQDA 3AHVA 1UA3A 1TMQA 5AY7A 2ZUUA 2ZIDA 5ABGA 3PN8A 3VDHA 4LYPA 4JFVA 3CV5A 4CU7A 3EJSA 1SMDA 2ZX6A 2W66A 3BAJA 5E70A 4K68A 1CEOA 4PSRA 2UY2A 1QI4A 3MMDA 5IDIA 1PIGA 4HZ7A 2OSXA 1GVIA 2DSUA 4JAWA 2VR4A 1F4AA 3FN9A 5KEZA 4KH2A 2QMKA 3GXMA 3POHA 4CVWA 3CBWA 4JFTA 1C93A 3VGEA 3LPOA 4H7VA 2CBIA 3BVUA 1EDQA 2WWDA 4CN4A 4AIEA 2D0GA 3UESA 1US3A 4LYRA 1JVSA 3W29A 1FA2A 1G94A 1QI2A 4JFSA 5GNYA 3AIVA 5A2BA 2OWWA 4NXSA 1O7DC 1W3KA 3BUPA 4UTFA 2FYVA 4FNQA 5HNNA 3GXFA 4ZN6A 2EADA 1BF2A 5JIWA 5CXPA 4B15A 5JBIA 4ZXOA 3LPFA 1ITCA 3ARQA 5HPCA 3WQSB 4W8BA 4UFLA 3IJ7A 1EGZA 1GQLA 5A8OA 2YBTA 5CPTA 2C0HA 1ZBWA 5BXTA 5AYIA 1CGWA 4DO5A 4ACYA 3BUBA 4JZ5A 4FNSA 2YA1A 1W9XA 1WDQA 3SCUA 1HN1A 2WW5A 4D6FA 4DUVA 4TVDA 2PWFA 3WUBA 4AC1X 1UOKA 1J11A 4KWUA 3A4AA 4A3HA 4MJ4A 1ECEA 2WBKA 4YN5A 1H0GA 5I2UA 4W86A 2VC9A 4QDMA 2XGIA 2VTFA 2MAOA 3ARXA 1TQSA 2E9MA 4PTMA 1E0VA 4W93A 4FNRA 1OGBA 2GK1A 2XIIA 2DH3A 3PTQA 2DGAA 2JF7A 4UQEA 6A3HA 2VO5A 3RJXA 4NXKA 1IV8A 2VCBA 4HOWA 1FP8A 1R0KA 3AFBA 4TTGA 2VX6A 2VRKA 2EPKX 3W6LA 1E6ZA 2WMJA 3E1F1 3WD0A 2ZUWA 1R75A 2G3MA 1HJUA 1RP3A 4ZQHA 1V0NA 2VZUA 3UCQA 4NI3A 1E70M 1E73M 3WH8A 2WVVB 3U5YA 3G6MA 1UR9A 3EJPA 3AIWA 2GSJA 5HPOA 1A47A 4PMYA 5ABFA 2VRQA 2PWDA 1NARA 1P6WA 4H8VA 2E0PA 4S3JA 1FOBA 1T1SA 3OGRA 3BVTA 1EQCA 4W85A 4KRUA 1NM9A 2J79A 3SCWA 4CD5A 1WKYA 2F7QA 3BAKA 1E55A 2WC4A 4M56A 1K6AA 3DYOA 2VUYA 4A03A 3VM5A 2J4GA 1CIUA 3PTKA 3QGVA 1J18A 3PZMA 1LLOA 1Q6FA 4JHOA 4B9YA 4C7GA 4HTYA 4LGXA 3U7VA 2F18A 1V6UA 2O9TA 4MDPA 1OB0A 5E9AA 4BCEA 4HMCA 5CG0A 3WNMA 3B9EA 1OGGA 3UR8A 3VGHA 2VURA 3QHNA 2Z1SA 2FH8A 2DEPA 3BUIA 2EXOA 1H4PA 4UNIA 3QHMA 4V28A 1Z32X 1QX1A 3MSGA 1CXFA 3BVXA 1G5AA 3EJQA 3EMQA 1W9VA 5A6SA 1MXDA 3K8MA 3NDYA 5FL0A 3LRLA 1V6VA 3W24A 3SURA 1QNRA 3N17A 1ONOA 2J25A 4IM4A 1UG6A
chains in the Genus database with same CATH superfamily
4HHPA 3EPMA 4GO8A 3TCSA 3TWAA 2X3BA 2BSBA 3DKLA 5JW4N 2PDMA 4V27A 5JW5A 1XDMA 3NIGE 4HZ6A 1QSFB 1JOIA 2P5PA 5I02A 3EAUA 3IS4A 4HIBA 5HNHA 3H42H 1J0YA 3HE6D 3HN3A 3O45B 3CCHA 4GRWE 5E5RB 4E5TA 3KNBA 2QDWA 3E9UA 1HAWA 3OWRA 1PAZA 2JJSC 1I7UB 2DI7A 3W72A 3GHTA 1JBJA 1OWRM 4V1DE 2IQ0A 3LUTA 4D6CA 2QVFB 4L3EB 2BWQA 1LK3H 1BQGA 5FHBH 4LKCB 4JYFA 4Z7NB 3NEXA 1DTNA 1FJ1A 3NCJH 4KMQA 3MRHB 4PRIA 3CQ0A 3ASWA 2FH6A 3UZEA 1BXBA 3KBWA 3ALFA 4WW1A 2BSLA 2WSRA 1MDLA 5FECA 3KZ8A 1S3TC 4KI5E 3D48R 5C92A 1XHGA 3FC8A 1IKFL 3PBWA 2C13A 4DCQA 1MAMH 4PVMA 1B3VA 3IIEA 4RCAA 3PIQB 3QCUL 2WWNA 2OL3H 3FT2A 3MBEB 1S2VA 3BCFA 2P5WB 4EUPG 1U5JA 3OJDA 3GI8H 3DIFB 4M7JH 4P3CL 1MYRA 4F0KA 4XAWL 3PWJA 4HALA 2W0PA 3R89A 3CXHK 2Y70A 4XWOC 1NGQH 4LSBA 1F2XK 3VQMA 1ZGDA 4IIEA 5BOPA 5CGYC 2D7MA 5G5DA 1AR1B 1S46A 3T6CA 1H3TA 2FX9L 3ITOA 3QULB 2DQ6A 3S35L 2AGJL 4XZBA 5E6SB 1DVTA 1P84K 3VFMB 3DUSA 5EU7E 4G7RB 2Q5BA 4E5XB 3QUMH 5BXPA 3IJ9A 1VBUA 2NMSA 2FT6A 2IANA 1CENA 3ZRCC 3VINA 3Q2DA 5EBGA 4I5RA 2WCAA 1CPUA 5E1AB 5DVOA 1XLGA 2EHHA 4R26H 43CAA 1NUNB 3SJNA 1ZJBA 1KZYA 3F12B 1BOYA 3WO8A 1YSOA 2EUZA 3PSVA 3CJPA 1O7SA 1EFXB 1ROCA 1EXPA 2X4UA 3FDWA 1OOWA 2LHAA 3AACA 1E8XA 4O53A 1UH2A 4R7XA 4QG6A 1X1ZA 2X7LB 2GJ6D 4PMUA 3RTQA 1HWHB 3NDOA 3KCPB 8RUCA 5C9UA 8A3HA 4I1NB 2VDGA 5CC5A 4YSQA 1Z9AA 1UM6L 5LIXX 2XXGA 1HO4A 4TSBH 2F9RA 5L2KA 5ACMA 3MRLB 4PR5A 3BP4B 3MRBB 2DQUL 1ZDQA 2H90A 4PMRA 5EZLA 3OEXA 3VIPA 4NERA 2X9YA 4D6HA 4DJMA 4GG6B 1TSIA 1EHNA 2DN7A 2DPKA 2OMVA 3SDCB 4BFNA 1MG3C 5LHDA 2HVKA 3RVXC 4Z0JA 1FWHC 4P49A 5L4MA 3JU2A 1EZSA 2Y5TB 4JFXB 3REQA 3PAOA 4D6DA 1LBLA 1DJXA 1W0WA 3F7KA 3GBEA 2NY6D 3NAAL 4EWJA 5HYQB 4IPNB 3QZOA 1N0LA 3UZEC 4Z6AT 2R29A 5K9OB 1BQHA 3IDUA 3ECBA 4H9XA 2HLAB 2V3DA 2PTDA 4AU0A 4X7TA 4X6FB 2PC8A 4PUMA 2RFXB 2ZZ5A 1WFJA 1DSWA 1KJ2B 3MYOA 3BH9A 2XY2A 1PVHA 1I0BA 3HFTA 2M83A 5D8JL 1ONRA 5F89B 1VHCA 3EA2A 1FIEA 5C9JA 4ZX5A 3H9ZA 4FRWA 2XZAH 3WDJA 4POCA 5E4EC 3UZ5A 3VRIB 3PNWB 5ID0A 2H3BA 4U7MA 4WUIA 1U3NA 1XGQA 5DQJB 2IH8A 3GWQA 4J2PA 3SQRA 2BZNA 5DF0A 4WEMB 4RDWA 4PJEE 4HDIA 4FGMA 3KVPA 1EHKB 1HCFX 2HTLC 3JWNE 2Z31A 1RH8A 2D03H 3BXNA 1BWLA 4TTDC 5C8BB 3UP6A 2AV7B 4YXHL 3GO1L 3STFA 3ROLB 3K1GA 5EZIL 2CUMA 3VNMA 5KYYA 5FB8A 2R6OA 1VJZA 3QDGA 4XP6H 3RPIA 3O6MH 5JNYA 2V0TA 3K80A 3SJVA 1Q63A 1EKOA 5C0BA 4YHYC 3EOBB 2UXTA 1E4NA 3E12A 4TRPH 4AD2A 6TIMA 2AL1A 5FYKE 4ZFGL 1Z42A 5I6PA 1NLBL 1HL5A 1VPOH 1P5UA 1FFRA 4PWIA 1ITUA 1K3IA 3UVIA 3WFDH 2WGXA 3D25B 4IQJA 2CLMA 5SWSA 3TSMA 1B31A 4PJIB 2E76C 4Q8QA 1XGEA 3DHDA 2DQDH 4GQGA 1BX2A 4L9LB 1K4DA 2PR4H 5FAJA 1YJDH 2YUZA 2RFGA 1SXZA 3UC0H 1JZFA 1C29A 1G4PA 3RTQC 4OJCA 1Q5MA 4L4VB 4O11A 3ZKMC 5J6SA 2NQ5A 3BWSA 3CQJA 5EC1B 2YN5A 2Y5SA 4RIRA 5T3ZH 2QVHA 1W56A 4IIQA 2UX7A 3P73A 2PXYD 1BFNA 4FX6M 4HZLA 5GXBB 1U9KA 2VCAA 5D4JA 4AH7A 4DERA 4ZNCD 3D9AL 1PEWA 1EJRC 3CZLA 1PSKL 2H9GA 3H54A 2Q8AH 1FBAA 4L6DA 1KLUA 3W6YA 4HWZA 1OC7A 3BOVA 1A9EA 4IBVA 4XZIA 4FHJA 3WQ6A 3RGVD 2C7UB 1TJHL 4HBCL 3KOFA 2VWEC 2R0LL 4AXWB 4HG4J 1G6VK 3TT3H 4XNMA 3LCIA 3F4CA 4NP9A 2QADB 1WD8A 1L6GA 2WLHA 2J9ZA 1TZIB 3U57A 2B3RA 2XV6B 3W7HA 1N7ML 5F2MA 2NUTA 1EGJL 2GPZA 3GH5A 2X2HA 2BZDA 4HZ8A 4BUHA 4DUXA 3QT2A 1VZIA 5TJWK 1XF2A 2BHZA 4YGVA 2LLLA 2O6EA 3WIIL 4OI9A 2AW2A 4YSDA 5M17A 3T6ZA 5FOBA 3RVUC 5FEZA 5HJYA 2XY1A 3KBJA 3WCYA 5J56B 3GJFA 2Q8BH 3UJIH 2CNCA 2QUTA 1XF1A 3AQUA 4FIQA 1NCBL 3W0WB 3IDJA 3NSJA 3BWWA 4DNHA 2A83A 2GCYB 1BQUA 1CDYA 2DFAA 3L1OL 3OLGA 2WWCA 1VH7A 2Z6FA 3AY2A 3HPAA 2Z31C 3MA8A 3AM8A 1JHLL 3FRUA 3JTTA 3W23A 2BOCB 1VGKB 2KZWA 2P48B 4MUZA 1FPTH 2PDQA 1S7QB 4IL2A 1EANA 5KVEL 1CBVL 4O4YL 2XQYA 3RLVA 2BY2A 3SAZA 4HIQA 3IGAA 2E6PA 3Q6GH 1GZPB 1GC1H 3WF4A 2NQ9A 4R2GD 2ZYFA 2YLKA 4MXVF 3CH1B 3MMWA 3WIFB 1U8QA 1O1ZA 1Y5XA 2E1DA 1DQKA 1X5KA 4Z3EA 4XNYL 1P5UC 1EXUB 1XW8A 1SZNA 4WIWA 1AG1O 2P49B 3VXUB 2YMTA 5ICXB 4Z7QE 3N9SA 4N8VB 3AIBA 3TSDA 2NUPB 1GVEA 4CW1B 5TDOB 4JANA 1GYUA 1CZ8L 3QJZA 4M62H 4Z1YA 2K4AA 3KP0A 3BDYL 2PWGA 4QOKD 3E2SA 1XBDA 4WFHE 4N2DA 4ZMTA 2ZE0A 4BWUA 3SADA 1P7TB 2F53E 4I18C 1V7AA 3HG1E 2EG8A 1DVSA 3NCCB 4IIQC 3D69B 2PDWA 1V5JA 4AD5A 1FI8C 2VFHA 5C08A 1ADSA 4MCNA 5I75B 4QHMB 2PW1A 5D7LB 3GHEL 4MB4A 1I2OA 1WSST 2EDXA 1YEHL 1JNLL 1R7AA 3EPNA 3ZL4H 4XP4L 4X60A 1KQYA 4JO4L 4PUDA 2HQAA 5HYEA 5LIYX 1NIDA 2UY6A 3OGCB 3A3WA 1A9VA 4J1UA 1LEIA 4P2CG 4MCYB 3AWNA 1G4TA 1RV8A 4PRBB 4PRRA 3Q3GB 1X5IA 4W81A 2MUCA 4YHGA 3B0YA 3QXAB 4N8CL 2KLSA 4GQZA 3JWDL 1GY1A 1CT8B 3W83A 5G2NA 1LD9A 3RR1A 1SZFA 5K1JA 4V1DD 3MROA 4RCVA 4PJFF 3S98A 1YEJL 5IBUB 3K2KA 3CDZA 4QT5B 3LOTA 1JXJA 2ZKHH 2DMKA 2DSWA 1E7UA 4QCEA 4XXDA 5KSAC 2ZP9A 2PGWA 4QLRA 4PV9B 2PP0A 2GTQA 2AEQH 3GSOB 3CL8A 1ES0B 2HX7A 4GSUA 3RL2A 2X2YA 1AD4A 2J55A 4QLKA 3NZRA 4EKXA 1TR9A 2V82A 3BC9A 4KI5D 4E41A 4YLQT 3EKGA 4KHTH 1MW2A 1A7NH 2PGEA 3KTSA 4LYQA 4L1GA 1AZVA 4L5FE 1W6TA 4ZQPA 1TX0A 1U92A 2E7HA 4Y9OA 3C5ZC 5C2BH 1BW8A 1CFNB 3P8IA 4M6VA 4KU1A 4XQ6A 1K8YA 4WHDA 1HIML 1ICTA 2V2TA 1ZT4A 4YL9A 2AANA 2YCKX 5FGBA 3ECWA 1BHGA 3G1AA 2EE0A 2WQDA 1NDWA 4RDQF 1INDH 1T1WA 3H1ZA 7FABL 2QPXA 2WO4A 3H6AA 2NQZA 4XO4A 4WWKB 3IDIB 2X12A 3E5BA 1O5KA 3HAEB 1XKYA 3IWVA 4YZWA 1YPZA 5GGSA 5K9JL 2VW6A 5JO5A 1D5IL 1UWYA 5CKGA 2XSXA 2V2WB 3T2PA 5H37H 1E2VA 1KPRB 1MCJA 3GK8L 3QQ3A 3OU8A 3DJTA 1M1SA 1OAXL 5A3HA 4GK8A 4CVZB 4UWMA 2EPLX 1G7MA 2XBDA 5BOEA 1M3JA 1OM3L 3GIZH 3K5XA 4R5XA 3UP8A 1GMIA 2NY1C 1AH0A 1NMAL 4XR8C 3S4SB 3QUXD 3Q67A 1VZGA 4QHNB 4Q97A 3DBNA 3V6FB 1KBWA 4HIIA 3H2NA 2W0UA 2VXSL 3ERPA 4J3UA 1AJ0A 2HMIC 3QUZB 1MNUH 4GFSA 3GG7A 2R82A 3TQPA 3KW3A 3L12A 2O7QA 2YEZA 1JWUA 3ALXA 3CHSA 4Z7WA 2Z91B 3BUDA 4FQ1H 5D7JA 5KTLA 3RB5A 3V0AC 4Q33A 4HK5A 4FFVC 3ARDD 5KOMC 1S3HA 1KULA 3GRWA 3O8XA 2A9NL 3LEXA 4B9JA 5KJ7E 4UM8A 1P5VA 4R3SB 4ALAH 1GH7A 1NFPA 1IGTB 5J13B 1TV2A 5LNUA 2WMIA 3L16A 1T5AA 1WUEA 3T81A 3NCOA 1FORH 1S7WB 3STGA 3X3GH 4DP6X 4QE1A 2FAUA 3OD3A 4OUIA 2NY3D 3ISWA 1WISA 1V8HA 1AQ8A 1SM3L 3WUWB 1SZGA 1FH7A 1KBGL 4N0FB 5JR1H 1OY0A 3BWAB 1E4WH 2FT8A 4DJDD 4WWID 3C87A 4BKSC 1F4YL 4HUWA 5C0FB 3SZ6A 3N0PB 3LQGA 3RUGF 4HWBA 1D5MA 4U1GC 4L9ZA 2ASHA 4MWFA 4PY7A 3EZ8A 5CF3A 3Q8CA 3UCDA 5HPMA 5AL0A 2WBGA 1N5AA 2VR8A 1WC7B 3WK1A 2XISA 2X6MA 1A6UL 3LCWA 4OLXL 4JM0A 5DEGB 1G9NL 3HQOA 4R4ND 3UPRA 1PWMA 5DCDA 3FL7A 3D18B 5EMJA 3JT1A 2EEDA 2ZUQB 4AHQA 1D6EB 4HSQA 5IDZA 2BRRL 1DDHB 3DX5A 5LAXB 1EMTH 3FO9B 4KHXL 2VN5A 3C08L 4HMNA 1H6EA 1LHZA 4DP1X 1L9WA 2QCDB 3B7RL 1B2WL 5DJ6A 3VE7A 3U0TA 1X7IA 4NSBA 2V5CA 3C6LD 1MRDH 3I9AA 3Q6FA 3H2QA 1H7WA 2EDOA 3VRLE 4JTRA 2J9XA 4CDGC 4JFPB 4MAYD 1S5MA 5FGBC 3H7UA 3CHOA 4NSKB 4Y4KB 4Z18A 4QNEA 3KWWB 1YTEA 2W5PA 5KS9E 3VGAB 1ID2A 5I5JA 4RX4A 4KKAD 5KJRH 3P69A 2V7NB 4G80B 3PUGA 5DHVA 4YHIB 3MLSH 4UTKA 1RUKH 5KETA 5F88B 4H6QA 2LQRA 2Q20A 2OSXA 3TVMB 3OMAB 3V0UA 4MAUH 2KLTA 1F4AA 4OLZH 3FHEA 2R1PA 4A2SA 3CUPA 1YQVL 3PV6B 1NDTA 5DJAB 1SPDA 3C8KB 3NR0A 5G1MA 5KN5B 2QUMA 4B3VA 2D0GA 5FYKD 3HBPA 4O2EA 5C09E 1CFMA 2HVJA 1B4RA 4WQ6A 1WITA 5E9NA 2XWJA 1PHQA 3IVUA 2EADA 1OGAE 4PB9L 3EAKA 1T5XB 3IJDA 3SCMB 4TV6A 1VACA 3OPZL 5D7JC 4LL1A 3DRTB 3B6SB 5JVLA 5BMXA 3V5HB 3DSFH 4OFPA 1CF1A 2YA1A 3SCUA 2VXUL 3U2SA 4KKXA 1EJSC 3HGJA 4OV5B 3SDXA 4RCXA 4DUVA 1L9SA 1P9MA 1W1B1 3C0QA 3B34A 1UOKA 2VLKA 3T04D 2OK0L 3REWB 4XSLA 4JFQA 1SBSL 3M0ZA 2DQEH 2W8CA 5LXGH 5JLZA 4KQNA 4UB9A 3EFDL 2Z4QB 2J5WA 2XETA 2FTYA 1KNOA 4YHZL 4QIRA 5BS0A 5EKYA 3KHOA 2Z4GA 5JHLL 5D2LF 5DELA 3G6MA 5GGVH 4YXKH 3G08B 5ABFA 2XH0A 2FGWH 4S3JA 2X42A 5BZWA 3R06A 3OGRA 2EDBA 3C6CA 4LOUC 1XDJA 1E55A 7XIMA 3DYOA 1UCBH 1J18A 3ZJAA 1H1ZA 4JHOA 4H3DA 3KPOB 1RLWA 2PDIA 4K3EH 2Y1YA 1MN4A 3FN3A 2PRLA 3VKAA 5I1EH 4PJ5A 5F7HA 4MJIA 4Z0XA 3D6GA 1UG9A 3F2CA 3TC7A 1W9VA 3NDYA 2XPZA 3VRJA 3UW6A 2Z0UA 3QISA 2EDDA 3D2TA 3W85A 4OZGE 2D7NA 3KGSA 1JWSA 4ILDA 2Z3FA 4O54A 1T7XA 3VFWB 1XJBA 3NPSC 4QF1B 2BHUA 1WS8A 2BM3A 1ZCCA 4IRZH 3VIMA 3U9IA 2YC1B 2FATL 3OHXA 2CKBA 2N0MA 2EXSA 2WQWA 5AVWB 4F0SA 4YDIH 1ZV9A 2DD8L 2J66A 1QYGH 4PJ9B 4K94C 5CLTA 1ZJIA 5AVRB 3CMOH 1CF8L 1ONQB 1WBYB 3MRMB 4F9PA 3SPHA 3TCLA 3E9AA 2J56A 3SQOL 4HKBB 4H9YA 1ROWA 3ULVL 3K4ZA 4H9UA 4UAHA 1A6VH 4RZ4A 1PLGL 5I9QC 1QRNB 4MNMA 4G6KL 4N0CD 1VLXA 5E8EB 1G4MA 3MOBH 3P9MA 5C0AB 1WBZA 3WE1A 3ES6A 1U8KB 1DVFA 5EU4A 1CGYA 2MFNA 2VDNH 4R0LA 2E6JA 2I32A 1MAKA 2BFGA 3S2MA 3BJSA 2GTZA 4GXFA 3R7RA 3RA7L 4LGRB 4RDQG 4CMMB 3P6LA 4IMDA 3ZTNH 1MNNA 1OAZH 5D71H 4NRSA 4S1SH 2EXWD 4IGSA 2BIHA 3IJLA 2ATSA 5BO0D 1NMBH 5KYUA 3PABB 4RAVA 2CR0A 3WTUA 3BDBA 1Q6DA 1R3HA 4PGEB 3IAQA 3FS2A 1QABA 4OCWH 1AH3A 4N28A 3WX7A 4WFHD 2C1HA 2P46B 3HZKA 4D6IA 4PJCA 1MFUA 4GBUA 4XVTH 2O55A 4OGAC 1M56B 1CO1A 2F53D 3O9WB 3CG8A 5I1IL 3HG1D 2WLIA 1XC6A 3O0FA 1GVQA 2RR3A 3XINA 5SX4I 3HG2A 3QCTH 4Z1CA 1KEGL 1HP4A 2GTWB 5JA9A 3B8TA 3PG8A 1RIUH 2O5YL 2YMOA 3LHWA 3L4YA 4YSPA 4YBHA 4GYJA 4LT9A 4POZC 2B5IC 1IAMA 2DJXA 3O6KH 2K6ZA 4NQVA 5IW6A 5DCBA 1E7VA 5I0DA 3EKLA 3PP3H 4UT7H 3L9EA 5AVUB 4BUGA 1NGYB 1K3UA 5I6XC 1R3LA 3IWPA 5TH2A 4N6EA 3S34L 5ECJE 2ESVB 3EHBD 4N8UA 4H40A 3BOFA 4CNIB 2XINA 4K55A 1O12A 3KZSA 4HT3A 5KAQF 2Y6ZA 4CCCA 4F7KA 3IT8D 4XVOA 4ODHH 5AW1B 1ETJA 4OZFA 3UO1H 4PCTA 1I1AA 5IG7B 4AJ0A 3BZJA 4KUZH 5DRWA 2EAEA 4GQBA 3DX6A 3OHXC 4XTIA 1KC5L 4PM1A 4W4QA 1NC4A 3Q48A 4U4BA 4DAIA 1MH5A 3MGOB 1XLIA 4EXBA 4LOFA 4O1DA 2JK5A 5H4YA 1Q0YH 1WOBA 4JPKL 3QR1A 4HCLA 3R79A 4F9PC 3QFEA 3D3VA 1ORQA 1HXMA 2EKSB 3PE9A 1KZQA 3OZKA 4NO3A 2YS4A 1T7YA 4U1LA 4AENA 4MKSA 5L0QC 3R7MA 4EIZC 2QPDB 3IDXL 3A47A 1W0VA 2P5EA 2J5LC 1TREA 2OX5A 3H23A 1DVFC 3K6IA 3IB4A 4R0LC 4AY0A 4W8LA 4ZXBA 2X7VA 4FZEH 5C3TA 5H8DA 1QLEH 2DWDA 3BG3A 2F8QA 1N64H 3BSMA 2F7IA 2OP4L 1ZTVA 2DYPB 4OECA 3ABSA 1HSAB 1JCJA 1OCWL 1ZGLB 3VWKA 1E15A 3VB9A 2DMGA 4IH3A 4PP2B 3CEPA 3NIFE 1HJXA 3MRGB 1TFPA 1ZENA 3PZTA 3GSUB 1LYQA 3BKCH 4MNHA 3UPAA 5CLZA 3GUTA 3L81A 5D6DA 1M7XA 3KLDA 4JTFA 1T1ZA 3BN9C 3K6FA 3OG3A 3BKML 3EOAA 3ES8A 3P77B 1XLKA 3FQRB 3L95B 1DVUA 1AL8A 4DP5X 4MYAA 3FB7A 4QRRA 3MUY1 2LU3A 4RNIA 4UQDA 2XCMC 4NO0B 5C6WH 2GOUA 4JRYB 35C8L 5KUKA 2AEWA 2OMWA 3QVQA 2Y1ZA 3FQNA 4JFZH 5JIQA 2HYMA 4LASL 3QZWA 5DVNA 1MNSA 2C91A 1A7QH 4WSJA 4MS8C 1J8HA 5I76B 3LS4L 1MJJB 3MZ2A 4MSSA 3OC5A 1NGPL 5D9PA 3SUWA 3EF4A 2B7NA 4ONVA 5JQ6H 3WD5H 4UYQA 3MO1B 2O6CA 1CR9H 3DGCR 4JRXE 2MH4A 3TXAA 5KSUA 1GOKA 1UD5A 4FL4B 4G7EB 5AYQA 4Y1AA 3ZHZA 3T5WA 1BYAA 3IRPX 4KK9C 4BQ6A 1GVSA 2RCSH 4CQCA 4R27A 1YUHA 5D1XA 2RDUA 1KT2B 4PBGA 4OM1H 2XPGA 3CZJA 4OFIA 4ZS7L 4K39A 1ESOA 3PWAA 1UC4A 3V0SA 3N1QC 1Z5LA 2DLFL 1O6VA 3MUXA 4FP1A 3FFCE 2GGGA 4IBTA 3ZUCA 3CZFB 1KM6A 4PJXA 4HU0A 5I1AA 1DZ0A 4RA3A 2VXNA 1OAQL 3MW7A 1J0HA 2D73A 5K39A 2KZ1B 2VISB 5B1KA 1JCYA 3LMJL 5C0QA 3P93A 2VHLA 2YMXL 3ZM8A 4NX0A 2WLKA 5DA4A 3UC2A 1SQ2N 4EPDC 1ETZB 3EGJA 3PAUA 4BDVB 3KVKA 1QFHA 3KPSB 3L2LA 4GLEA 2VN3A 3VIHA 4O58H 2QJNA 3ML8A 2R15A 4HX1B 3I50H 4JIRA 3RLUA 4M1BA 4OT1L 4OM0L 4KNTA 3ZJ8A 4ZXBC 3L1EA 3ZOAA 5ADPH 5ABDE 2VDMH 4HW6A 3VU1A 2KYIA 1QMUA 1HKFA 4HPHA 3S42A 2QCGA 1WHPA 4QQUA 2YCJA 3LB6C 1HHKA 2HVNA 1FC2D 2UX6A 3UTSE 5CQ1A 4AQAB 2OCFD 4RETB 1ND0A 3ZTCC 2C5DC 4FP8H 4RK8A 4Q8WA 5EBAA 4JS7A 2B61A 4F79A 3TEZA 5I6KA 4FI4A 3P82A 3FIGA 2ADGA 5D6DC 2HWZL 1EVUA 3NABH 4Y16B 5FIPA 2VX4A 1IQ8A 1YHTA 3BWUC 4WU7B 3U9WA 1PDKB 3FYOA 4NT0A 1KO0A 5A2IH 2X4TA 4I48A 4JFWA 4WY7L 3U6XA 3MRJB 1UVQA 2FQGA 3HNTL 4P4KA 2CBMA 4YC2B 3VACA 1WIOA 2FVLA 5C09D 4LCUB 4AZIA 5D55A 5BVJB 3C75A 3FT4A 1OGAD 3P4MB 4PTTA 1P0NA 3WH6A 2NTSP 3G0UA 2DSZA 4FLSA 1INQA 2DWTA 1VFSA 3L3HA 2HPOA 4IMLB 1MWAB 2C82A 2CIIA 3W5MA 3W3OA 5E9DB 3NM3A 5IP4A 4PWGA 4W8AA 3CU2A 5I1GL 2UWEB 1CE1H 3TIMA 4WO4A 2BVDA 1RZ8B 2CZDA 4EI5D 3RC3A 1TXKA 1GT8A 1FUYA 3LEYH 2BVUA 1HTIA 1UKTA 3VG9C 3HHSA 1JWMB 1HFBA 5D1XC 1DFBH 5HYJE 2EE6A 2XOTA 5EG6C 5ID1A 1E3ZA 3WJYA 3ATYA 4NAJA 4FFYH 4ERAA 3PWLB 5A5WA 2DDXA 4YHMH 1VESA 3WNOA 1AGEA 1BJ1J 4HH8A 3HNSH 3VYPA 4I0KA 3DU0A 4ODWB 1DEDA 5C55A 4UAOC 4QSFA 3SBPA 2J3SA 1IEHA 2Q2EB 3M5YA 3RX9A 3GSVA 3PFQA 4XPFL 5E99L 1H3UA 4Z7UF 5EV7A 1W8SA 5L9DH 3S3BB 1PLBA 4QYAA 4A3QA 5KAQG 4TVPE 4NGHL 1MVUA 4HAGA 3WF0A 3FQUB 4LCYA 1S5VA 4W68A 2HG0A 1JPSH 1UT2A 3LHPL 3PJWA 4W9EC 2ATMA 3P4OA 3BKYL 4UINL 3ZKXC 1JPTH 3FTSA 2CCVA 2EDLA 4UIKL 4JDBA 4C56B 1KEML 4ICXA 1UZ1A 3AIQA 3TMQA 3D6NA 4XBMA 1BQHG 4NUPA 1EYWA 4RMUA 1E0WA 5KMYA 2F08A 3LZNA 3X12A 4NC1E 2NX1A 3NEHA 1EEQA 7ODCA 3LN5A 4R7LA 4BF7A 4ZZKA 2Z9TA 4L1HA 4RE4A 2NSMA 4XRCB 3NGFA 5A16A 4YTSA 3JW7A 1KTDB 1P53A 4NZCA 4EANA 2UXFA 6FABH 1Q45A 1T2QL 1TMHA 3QWRD 1N3NA 3Q8FA 4Q6JA 4QHLB 5G4HC 1YNTF 4Q4EA 3G3LA 3F7VA 3ESUF 4MQXC 3IGLA 2HNHA 1W3IA 4HPJA 3N6YA 4FXJA 3BL3A 3NPVA 1EAOA 1MPAH 1S9VA 4G9FE 4WI0B 3CZGA 2HZGA 4LSQL 4PP1D 1I2PA 3H8AA 2MRYA 3AU0A 5KTEL 2P10A 2HNEA 1BQCA 4A2HA 3PP7A 1TOXA 1ZAHA 4D71A 3NJJA 3RKDC 1V6WA 2N1TE 4UZUA 4FLRA 3TLRA 1DJIA 1FHUA 3CGTA 1TPFA 1YPZF 4P4KC 4ABWA 2ZZ2A 4AVJA 2Q7YA 4HU3A 4ZW5A 3CPGA 4FXSA 1OVZA 2XVBA 3DGRA 3SPJA 5AZ1A 4L8BB 4JDVB 2IQ9H 4WTXA 1BFTA 5IB5B 1LK2A 1ZFJA 1IXOA 4IQDA 5K4ZA 1XLMA 1TQJA 2P7TA 3II3A 2HJKB 2JELH 2NX9A 4D6JA 4FG4A 2NXIA 1EJXC 2G9HB 2QKIA 2D69A 1MW0A 1H0DB 3KLQA 3V7AG 3NIDB 3MNWA 4WO4C 5FS5A 2RD0A 1SXBA 2VXTL 2YUXA 4Z7WF 1QXLA 3PQYA 1VDGA 1XC4A 4P59L 3I3DA 1QFPA 1WFOA 3RAOA 1XF3A 2NXYC 2X4NA 4M93B 4W9GC 4PFMA 2HA1A 3OKNA 3V55A 4U0RB 5DR5H 3ZE0E 5F7EH 3I9GL 4IBZA 2R9HD 3R25A 1AIFB 3ZE1B 2WMHA 3H2FA 3S2CA 2WB7A 1QBML 4ZSOA 1BREA 4WFGE 1DJHA 3GSQA 2XVLA 5JBDA 1F4WL 3M6YA 1OHQA 1EGMA 1W9UA 4S3BA 4IZGA 4MDIB 4HD5A 2YA2A 2R2EB 1O60A 3CHRA 4NG3A 3M0VA 3B3DA 1H7NA 1QR7A 4NP4H 4DZ8A 3BQVA 4Y5VB 1HC1A 3DI2B 3KRZA 5ECUA 2WZ0A 1FIGL 3EBHA 4PJFB 1BEYH 4DZHA 5D1QB 3BLDA 2UVFA 1BJ1H 3APFA 3WS3B 1K7EA 3LA4A 3LTSA 3F04A 3W9DA 1TEGA 3N1GC 3B9AA 3EH3B 3H7BB 5AZUA 3VK5A 4R7DB 2I7SA 4LVHB 4YQXH 5E1QA 2XBTA 2X1XR 3U1PA 1XGZA 5DVLA 3E3HA 2B0SH 5FV1L 3OX8A 1QI5A 4MKVA 2C1PB 2X7WA 5IZ7A 2G60L 4BK5A 3N1PC 1W3HA 2VDIA 2X0YA 4YYCA 4WCYL 2B77A 2ZG3A 1GSMA 3L3IB 4NNCA 2JB5L 4TV5A 2E7FA 5I1LB 1ZEAH 1YMHA 3B3IA 3RWHB 2NDGA 1U83A 1IXPA 5LA1A 1SJVA 4C6PA 4HEME 1F6LL 4R4BB 1PUDA 4OAWA 4E2DA 5HDOA 1EBAA 3NSYA 3NZSA 4APQB 5I17B 1JZ2A 3ZL1A 3LB0A 3TEUA 4Y5XA 3G5VA 1FVDB 2XVPA 3QFDB 1JCNA 1C12B 5K33A 4TO8A 2AJXL 3PHOB 2ZYRA 2XQYG 3HVDA 1MW3A 4F8PA 3A4XA 2JQMA 3VFOA 3UG5A 1H51A 2VYRE 3F65A 1SDDA 3HE7A 3FBKA 1WTGT 2Y7SA 1N2RA 2QLYA 3VNJA 1C3FA 2Z1VA 2HJLB 5DZNA 1I9IH 3AG1B 1X5JA 1R34A 1IT8A 3HIJA 3MUJA 2XN2A 1P4IL 3O4OC 1IBGL 5L88L 4Z23A 5C0CE 2QKIC 5KUMA 5KANI 3WEOA 1TQTA 3V5KA 5I66A 2I9LB 4BZ1A 4XP1L 1FVEA 5I1DA 4ABUA 1PY0A 4KMLB 3UF9A 3A12A 1ADOA 4I9JA 5DD0L 3SDXF 1PDZA 1DJQA 5DS8B 1SEQL 4NQSB 3CQHA 5MI0B 2QMKA 4YK4B 4LVOB 1GKOA 4XZ4A 4X4YA 3BVUA 1RJLA 5F7MC 1MNZA 1ZAGA 1A6WL 1G94A 2CWRA 2X53A 1TB3A 5TPWL 5GNYA 1OYAA 1P1ZA 1W3KA 4PGJA 4FA7B 3FFSA 4MA8H 4H0GA 3UTQB 1OAKH 4XZUA 1PE1A 2ZRUA 4JRXD 2J6EA 3S2NA 1HYRC 5AAWA 5EBLA 1KBIA 5HWJA 2K7QA 5BZDB 3IE9A 5A8OA 5KOVC 1A14H 4YMZA 5TDNB 4DO5A 3BUBA 1SJHB 4LU5L 3MOQA 1D5BA 1C9SA 4EZLA 2CDFB 1L9RA 5FO9B 2B1AH 1ELSA 3FTUA 4W86A 3U82B 2EILB 1KJ2L 4M61B 1FP5A 2QTEA 4O02H 2BFVH 2NUXA 5TK2A 5EMMA 4G83A 1TETL 4UQEA 3FFCD 2E28A 1D2PA 3ULUC 5AVZB 4W4NA 4GVHA 1YBQA 2VRKA 1JN6A 3NXFA 2P45B 1GY2A 4ZL1A 5DD3H 1J9SA 1N6QL 1DBKH 1PS9A 5AW0B 4AGPA 2ERJC 4JN8A 3SGUA 1IGCL 2RIKA 2ZZ4A 1F3DJ 5HPOA 5CINL 4Z7VB 4AVFA 3GB6A 2I5YL 4U49A 3GXUB 5HYFA 4BK5C 4LUJA 2J79A 4YE4H 1EWHA 5BRZE 1OX5A 4H20H 1A6AA 3FQTA 5D7HA 2ZD0A 1CIUA 2OOGA 1RHFA 4HK3J 4JPSA 4C7GA 4B9YA 5JDSB 1R2SA 1OSYA 2G2RB 3B9EA 5FKPA 3JV0A 3TKFA 3RIFF 2VURA 2Z1SA 1IX2A 1Z32X 3VFNB 5HHPA 4K9EL 1G69A 4JG1L 3Q5TA 5KW9L 4Y5XC 5DGRA 3AAMA 4JHAL 3UBXA 4BK9A 3QJTB 3UTSD 4HKZB 3AMGA 2F0CA 3ATDA 3DSNB 1PKQE 2ZF9A 1BMGA 5IOBA 2YSSB 2CLOA 3BUYA 3EO0B 3HE7C 4I5XA 1M7DB 1MJ7L 3OZMA 1YDNA 5JPNB 4HVBA 3RO6A 2ZZ7A 1KGCE 1AACA 1S78D 3AUAA 1OF8A 3W6MA 2QEJA 4I18A 1SJBA 1WDRA 1UUOA 3IAPA 1T21B 3VXME 4FXFA 2ADJB 2RH9A 3ARGD 4MPKA 2BZCA 4PS4H 4DP9X 3CNYA 4J4PD 3S96A 9XIAA 5EDSA 2AXHA 5AOZA 4QEGA 1JPMA 4NBXB 4QXWA 3ME0B 2ZBTA 3QGAC 3APCA 3NSNA 1A7OL 2CGRL 3BPWA 2P8LB 4PI0A 4MMYA 4QP0A 1YLVA 2PRMA 3PBVA 4PJCF 1HINH 2X2JA 2DBLL 3MVIA 2W9EH 2K1MA 1NWOA 2Z92B 3INPA 4XZMX 2A2IA 4JX6A 3VFSB 2PDHA 1QZ1A 3WU1A 4X7FC 3CVIL 1AMYA 3UGXA 5A6IA 1M7OA 3UAJD 5I8EA 3VD4A 3B9KB 3LSOA 3F64A 5I73B 1T66D 3ABQA 1TA3A 2R1YA 1Q65A 2NT0A 5AAWC 4TL5A 1LDPH 4CQBA 4TUJB 5IHZB 2P1YA 4OSUL 3G6AA 4Y9CA 1AZCA 3URBA 5HYJD 4HKPA 3IMVA 2CZNA 4CVXB 3X1GA 2F7RA 4YDLB 3N42B 1MQRA 4HU8A 3HRZB 3BYTA 1FBIH 4JDZB 2OMZB 1M53A 3RMJA 2C9VA 2GY7B 1UWXK 1E27B 5KSAA 2J4WH 1RLCL 3ZSSA 1E4XH 3EUUA 3H9SB 2AEPH 5KSBB 2WHJA 4QOKA 1TZGH 1RZ7L 3RMEA 3INOA 4PW4A 5IJKC 5HWNA 2YJQA 5I0WA 3RZCD 2Y7GA 2ZA3A 1UROA 5IB2B 4G8FB 1QZNA 2KL6A 2Z7WA 3KWUA 2C4FT 4TVPD 3OW1A 3S88H 4XVSH 1RJPA 3ME3A 1IKOP 2XWTA 1GJIA 4XTRD 2PXYC 4IQHA 3SKOA 3MGTB 2YIHA 2DJSA 1D5RA 4XVEA 4YMPA 3PBMA 2XTSA 3C5ZA 2YPVH 4C1LA 3THDA 4C4BA 2UV8G 1F6PA 5DHEA 3LHTA 1O9VA 3BPCB 4GO6B 1B90A 4S1RL 3K6NA 4LVAA 4BH8A 1RZKH 3T6QC 1DWJM 2BVTA 1FNGB 3MLZL 1O0VA 2YAFA 1VEOA 4AL8H 3D39B 2Y72A 3ILQC 3SGEI 2YUWA 5AC4A 3V7MA 3W28A 5DUML 4GUJA 3RGVC 1J8KA 4KQ4H 1EP2A 1F3DH 1CFTA 4RE0A 1HFUA 3STZB 4K7YA 4UT6A 2MSPA 3VNZA 4O1FA 1LT7A 5AW8B 4Z8FL 1TX2A 4JGNA 1JPGA 1FZJB 3UTZA 4XB7A 5EUOB 2VMDA 4G70B 4OQTA 4PB5A 2NX5B 3QP3A 3PGDA 1AI1H 3OQEA 4G9FD 1I2RA 4Q7BA 2NQHA 3LTPA 3TN4A 4DVRL 5AB2A 5CFHA 3VOHA 3VG0L 1S5HA 4X9BA 4XN9A 4WZ9A 5GS0D 3S0PA 3RWJB 5F3HA 2OEJA 3UZQA 4Y19A 3QXDB 3PWVA 1R46A 4X42A 3LXUX 4Y2LA 4OZIB 1IAKB 1SQMA 3GAYA 2QT6A 1GKRA 3D5HA 1OXYA 1LUCB 1WDSA 5D38A 3TN6A 3AIRA 5IR1B 3US1A 5B7ZA 2CNYA 1RZFL 3DUSB 2WXOA 2DJ4A 2BC4B 4KDWA 3MUGB 3BWUF 3GXPA 3STCA 5DXWA 4U0QB 3P02A 4MB5A 2NXZB 1NF7A 1J1XH 3WSQL 1SXNA 1UKQA 3CFUA 1HW6A 1LOSA 1X38A 3LQAL 1NF0A 1NIEA 1MRQA 3GH4A 2DQFA 1KJMB 5B80A 3ZN6A 2J24A 2WXLA 2QNEA 3GLCA 3B4NA 3EOOA 3RAJH 3UYCA 12E8L 1KIUA 1H49A 1LE5B 3O7UA 3OAYK 4AQ1A 5DA0B 3QDME 2J1XA 4DJEA 3WHXA 2YB4A 2EDMA 3B2UC 3MJ6A 1C8QA 4ZJ9A 4CGUB 3G1DA 4FKHA 2IJ0C 4P2RA 2IDQA 4Z2JA 4RMRA 4PW3A 3HM7A 5T1DL 2REQB 3PHQA 3RWFB 4WFGD 1KSRA 1Y1DA 1QI3A 2XIDA 2O4EA 2BSDA 4PGDA 1SFDA 4O5LH 1P0KA 4HS8H 3RXZA 3AOFA 3ET9F 4IRJD 3LIZH 3LRGA 2O5NA 1X3ZA 8CGTA 2XG4A 5A3ID 1W3TA 4M3KB 5T3XL 3K2MC 4KVPA 4MVAA 3CIWA 1HILB 2AL2A 2X6AA 5BWAA 3EYPA 1BFVL 2AJSH 3ARZA 5H8MA 2CM6A 2D8KA 4WKFA 1NCWH 1Q0EA 2J7LA 4PJXF 2R1XA 4IBQA 1FNSL 2FMNA 3EYSL 3DK2A 1PCWA 1UZ8A 3TA3D 2BLFA 1F90L 1VCBC 4UT9A 2VDRH 1DLHA 2GI7A 1QPXA 4FZ8L 2BPBA 2FEDC 4J3OF 4FXKA 2VCOA 3WY3A 4HQVA 4RVBA 4U3CA 1UACL 5CNHA 4WKAA 4L0PB 2WMPB 3QIWB 4IMFA 4FK9A 3IXTA 4LL9A 4IDJL 5E0KA 1ADWA 5CZTA 5AOIA 4U6TA 3IDMB 1RSYA 2FSEA 2CD0A 1MCWW 4KV5F 1XXXA 3KXQA 3IACA 5CLYA 1HE7A 5DEZA 3H70A 2MCG1 4ODVL 4JHWH 4FA8A 3DV6B 4HYWA 5TQ0H 3JV4B 1KBVA 1EF2A 3CLEL 4AZCB 1MRFH 3W11D 4A63A 2EEFA 3SOBL 3SDDB 2Q6ZA 2HKFL 1ZLSH 2XKUA 1Y0LA 1JEZA 1QNVA 3WKQA 4NIRA 3TBYB 5H35B 1JZ3A 5I1CL 3RL1A 2X4RB 1A5CA 4YTUA 3TNMA 4LLQA 1EXHA 1VQTA 3E9TA 2B81A 3AI0A 2QSCH 1OE2A 3BJTA 4XZ9A 3OKOB 3CT2A 5LBSL 5F0MB 4AH2B 2XSAA 3HW7A 5ISZA 5T5FA 2WZMA 2B4GA 3CH8A 1YC7A 4BSVB 4U4IA 1CWYA 2BOBB 5F1NB 3KCLA 1KCUH 1NDYA 5EOQL 1EUAA 2ICWA 5C0CD 3BPLB 3C6LA 1JV2A 1UUMA 1MFBH 3S1XA 5GGRY 5ESVA 1IILE 3PFMA 2TRYA 2Z1PA 5E1IA 2Y7DA 4MAYA 2XGBA 3IMBA 2DW5A 3FCTA 4FQIL 5K59F 3B5GA 2G4JA 1ZV5A 4AQ1C 4DJEC 3MREA 3VPLA 4X9FA 3K30A 2XG5B 5I71C 1N5YL 2EDRA 4ZQNA 4I9WE 2EO7A 4ANWA 3NCWA 3LBCA 2V17L 3ULSA 4G82A 4ZTYA 1DHPA 3VFPB 1F8MA 1KENL 3E7JA 2F2HA 2ZSWA 3CK0H 2UY7B 1A80A 3C8NA 3C56A 4WSKA 3W53A 3QUXC 2EUWA 3BPOC 2JQXA 4PPTA 1TLMA 5TDPA 4UCGA 5DK2A 3HZVB 5F1IA 2ZUTA 3BLBA 1SRDA 4OUUB 2EKGA 4KIEA 4WXZA 1A0DA 2CR6A 4UOW0 1E4HA 4BA0A 3BHBA 4ZS6C 3OJ2C 3K3QA 1FZKB 3RYSA 4N90E 2A73A 2ACUA 1QFWM 2QVWA 4Q4PA 1BEXA 2BP3A 4OD1H 4LLYB 1IFRA 1CFBA 1ZVSB 5IJDC 1A21A 2IDCA 4K5LA 2F19H 1RK5A 3B0UX 4X9IA 5EIIA 4HYVA 1TPXB 2EABA 4LXFA 1XINA 4DPBX 4FXKC 1IM9B 4EUPB 4CJ1A 5ADOL 4NZJA 1W1A1 4S3AA 4NUJA 4F3HA 3F5WA 4WK9A 2ANUA 2XN9A 4LB4A 5BRZD 2DS4A 3ID7A 1MLCA 1VERA 3MC0A 2IALA 3W2KA 5DQDL 3TBTA 4OJFL 2GJJA 3H55A 3GBMH 2FJFA 3RJOA 3HS9A 3UAFA 1Q4WA 2QF7A 2F68X 3UDWA 3HZYA 2Q01A 3SRKA 4DJDC 1R2TA 4H5SA 5KVDL 1VADA 5GRVL 1OCOB 1UJ3A 5T1KD 3GLDA 2YAEA 5A6LA 3BCJA 5ESQB 4B16A 4QHKJ 2YA0A 5DFVD 2H3NB 5E94A 2QQLL 5TQ2H 2D23A 2PDNA 5DMIH 1PKOA 3WEAA 1CFQA 5L2JB 3O6YX 1VGEH 2Q2LA 2EYRA 1USQA 4QLJA 2IWKA 2B8OT 2JCYA 1HXJA 2Z93B 5FGCE 3K91A 3MODL 4R4NC 3AFLA 4UNTA 4O17A 3GMPB 1JGLH 3PJSB 2PYFB 3NQIA 1DE4A 1FO0B 1LBFA 5B8CB 4S3KA 2P0OA 2VM3A 4R8WH 4AWEA 4HCDA 2J7DA 2Y5QA 5IMKA 5HAOA 4PJ8B 5D72H 3FH7A 2XQYK 2ISVA 1QP1A 1KGCD 5F93C 3FQ2A 1U8QB 1NAMH 5HYIA 1WUZA 1IBYA 4GCAA 1XFCA 4O12A 2Y6TE 1MJUH 1DVYA 4QRUA 3ZVIA 1R3IH 3C6LC 2VGGA 3VXMD 3V0GA 4UILL 3KBSA 3HS0B 4E8DA 3W7OA 3PK7A 1XCTA 4MAYC 1IUZA 1ZLUK 4NRYA 2ZONA 3VFLA 3HGSA 3VW3H 3THQA 4WV1A 2ESCA 3EOYG 1B4JL 2YK1H 3T4WA 3HI1B 1XBVA 1F5ZA 3G6DL 3ML9A 5IB3B 4KKAC 3FU8A 2YZRA 4IIDA 1OGTA 1V77A 5DX7A 2HFFB 3IBEA 5DJ2A 3PJUA 5AQ0A 3KWVA 3W87A 4M3JA 2R4SL 4X0VA 1ZP3A 4I87A 1EA9C 4IDLA 4G2DA 4O13A 2IKHA 3QZWG 4GABA 4HIXH 1NFDB 3I02B 3LZQA 1OLLA 4UM9D 1TJIH 1ET7A 1H9DA 3TC6A 1U8JB 4DEWA 3OKLA 3WLWD 4PIBA 3TQKA 3CDFA 1W1YA 2DPEA 3CV7A 4EMZA 3SM0A 4OKVB 4YHOL 4AK1A 4G7QB 4I0PD 4DNMA 2V9QA 4R7NA 1K5NB 1OCCB 4HUUA 1ZBCA 4JY8A 2G96A 4CC0A 2A3EA 1X3WA 1Q0HA 1HJBC 4RWHA 1A5MC 5E4IA 3O0RL 4ADIA 3AT8A 1B3WA 2VM8A 3L7FA 3WQGA 3L08A 4Z7UB 2IQAB 2FBJH 1HKLL 4G8GE 2Z1BA 1JF5A 1PKMA 4KXZH 2UWFA 1FRGL 2Y7MA 3MRCB 2QZQA 3WIHL 4WEUD 1I8KB 2MNJB 4J1OA 1WQ5A 2V5DA 1E5NA 5CZ0A 2CKSA 2ZKMX 3ALWA 2APFA 1XF4A 2P5NA 1IC4L 1Q1JH 1S7SB 3PTMA 3ULUF 1E8ZA 2E9JA 5D4YA 1UIOA 3W75A 1KYUA 1A5NC 3BGFB 3HLKA 3FY1A 3WMSA 3KUMA 2QZ5A 4J3OG 3SKMB 1H7OA 4Z77B 1WKFA 2AK4E 3UDWC 4LCWE 4I3GA 5LXXA 2VL5B 1L5GB 2BP1A 1WK0A 1UJ3C 4RGMC 3CHVA 4Y1TA 4QHUB 4LNRA 3M0MA 2GJRA 1KGIA 4OCNC 4WK2B 1WBXB 4TMPA 1JSYA 3QPXH 5H2BA 2EYTA 1FTXA 2JBMA 5E6ZA 2TRHA 3IIZA 5E4AA 4E42B 3ZU8A 3ZLHA 2CLRB 1XIGA 3ZHFA 3IANA 4OLEA 1YNTB 3STEA 3PWIA 3VI4B 4LMQI 3IRCA 3LN4A 5E5MB 3G6JA 5FM5M 3NA9H 1D5ZA 4QE5A 2VAJA 3UBFA 4PCNA 3SDAD 4LPCA 1JZ6A 3MRNA 2NY2B 3V35A 5D7EA 3TSBA 4LB8A 3CN4A 4ES4A 3KDMB 5DCEA 3BGMA 3TT1L 2A5HA 1A1MA 3QR3A 2CJSA 5EEXA 2GGIA 1T4KA 3UO8B 1RPXA 3LH2L 1T1WB 4GRLB 2C9XA 3FB8A 4AZ8B 1GGYA 2XX1A 1LJYA 3C0LA 2DF3A 1B0GB 4A1RA 1YPZB 2CHNA 5TE4H 1SW7A 4W6YB 4ADTA 5A2FA 4FAAB 3N2TA 2N01B 3WI9A 3UJ2A 2VQ1A 5I5RA 2C9AA 4LRSA 2IV9A 4W9TA 4WV1C 4Q4OA 3USZA 4XN7A 5KBMA 4KS0A 4XO5A 4I7WA 4P99A 1BFOB 1LJMA 1QVBA 1M2VB 2ZCLH 5JYLA 4U3SA 3IDGA 4F58L 2ALDA 2FGLA 4N0CC 4G6JL 4ZUVA 4OZOA 3HGOA 2VSMB 3C52A 1DLFH 2NV9A 1F6KA 2CXEA 4C47A 4EE9A 2YEZB 3U30C 1NBZA 4JYDA 3M44A 2Z25A 5DRXB 2QV2A 4AG4H 3HEIB 4QJ1A 1OT1A 5CPMA 2NY5H 1RK6A 4M1DL 3KP1A 1EQPA 4XZLX 3BLKA 3VDCA 1MVFA 4FQXD 3KPNB 1L9QA 5CKAA 1HHHB 2A0NA 3QDMD 1X5XA 4JCWA 1G4SA 3U4KA 3O41A 4LVNC 1S8DB 2GVJA 3IIPA 2TSAA 1CLOH 5JHDA 5C6TH 1RY8A 3X13B 3O8XB 4C4KO 1SZEA 1YEFL 4AAJA 9CGTA 1ODAA 3ICJA 1T7ZA 1DQLH 3J07A 4PJAE 5AY7A 3QNXA 1F6AA 4B96A 3K2IA 4RMVA 2W1NA 2NZLA 2R2BB 4K68A 1XGTB 1W3NA 4LK4A 3OO2A 4OQ1A 3IV3A 5DK3A 5EHFA 3QXUA 3UWWA 5CEZH 5FO8A 3CLMA 4OVUA 1US3A 3TYBA 2B7DT 4NN7C 3TQ0A 4LCCB 1TU2A 3IDYB 2EDTA 5D93C 1RSFA 2IPTH 1XR2A 4RDZA 2JGQA 1L6YA 3T65A 4AQZA 3IPFA 2OX1A 2CRMA 1I82A 1GGTA 4DGIH 1P7KB 5PCYA 1OPGL 2YXVA 4NCC2 1TZHA 4LCVA 3QIBB 1M2OA 1P7BA 5GS1B 4D6FA 1E28B 1IEBB 4LNVA 4JREB 2YPLA 2AXGA 1BVLA 1X8CA 1FF5A 1UFGA 2CU0A 3O3BA 1ZXQA 3EHBC 3UGVA 5ECGA 1IM3D 2JF7A 3KWSA 5AW3B 5JIKA 3ZWTA 4MQSB 4NUMA 3QQ9C 4TTGA 2PU0A 1E6ZA 1LGVA 2W9DH 4XWGL 4JYEA 6XIMA 2YQ3A 3BEVA 4Q8OA 4DF0A 1FOBA 2JCCA 1WAEA 4IGNA 2YCEA 3SCWA 3GF8A 1UOWA 3MJ9L 1MCDA 3KJ4B 2F7QA 2Q09A 3QGVA 3PZMA 2Q3AA 5D1ZD 3TZVA 3TYDA 3P81A 5E9AA 1XIWA 4RFEA 4JJ5B 2DTSA 3M17B 5E2UH 3VGHA 3S2LA 3TWBA 1A4KA 3V1HA 5IEKA 3UYPB 1SNRA 3MX0B 3TH2T 3FF7A 4TSAH 3DO4A 4D0CB 2YGPA 4DYEA 1OARL 4DP2X 5CZVL 3LRLA 3WL9B 1ONOA 1AOZA 1GAFL 2OB3A 4JKPL 5JW4M 1MIML 1CURA 4M7ZC 4BFEA 4TMCA 1T6BX 4Y6GA 4CC4C 2O5ZH 4F2UA 1POJA 1Q4NX 2C3VA 2JXMB 5IREA 2DL9A 6CGTA 5JXAH 4N7QA 1HZHH 4U6XA 1GPWA 2J21A 4TM9A 3MJYA 5J1AB 3MDJA 4GC4A 1OVDA 4ZFCA 2F7OA 3UA4A 4DOHE 3T7VA 2NZ9D 1P1XA 4RLIA 2QL1A 3WF1A 3LKPB 4XXCA 2X05A 4RBPK 1AQ0A 1FV1A 3LTVA 3OTRA 4I9WD 1H1NA 4YBLC 3FO1B 5I24A 5I00A 3N73A 4ADUA 5IB1B 4EBQL 1RXLA 1FHLA 2IIJA 5ABAA 4P5TD 5FUCE 5IFHL 2FB4H 3QIUA 4FQHB 3H21A 1W72H 3TH6A 4P5RA 3MCKB 3RPBA 1X6UA 5HBFA 1GOIA 3RY4A 5F7BA 1BVKA 2OJEB 4RSVA 4XPTH 2JKTM 4BUQA 1TWZA 4GW1A 3CDGB 4C8XA 4Y2DA 5I3KA 4U05A 2W0FA 4WNJA 4MRCA 1OIMA 3ARED 3WXVH 2TRSA 1CCZA 4ZFOB 4JVWA 4KNSA 1QSEE 1DJYA 3N4EA 5L8LB 4ZFOL 5GRUL 4XX1G 1QDSA 2E59A 2IMRA 4N90D 4UF7C 4GUOA 1H5BC 1T3FA 4PRTA 4ODTH 2X2IA 2WANA 4ZDHB 5M1TA 1FWDC 4C60A 4PUWA 3HI5H 1XVSA 2ATKA 4PE8A 2JKIS 2BNQB 4FLQA 4L1SA 2YRBA 5CMAB 3AQZA 3LS5L 2JKJA 4F8OA 1L4IA 1E5AA 4D9LL 4EI5A 3TO2B 4FQJL 3B9DA 3FQWB 3ATAA 3DX7B 4TQEH 4I4WA 4ELME 5MHSE 4ECLA 3HUJA 5MENE 1BRLA 1G84A 2X30A 4D0BA 1N26A 3G1HA 4G2AA 2R4RH 4LUSB 3IGUA 3FFDA 5AECA 1T20B 3RIFK 3T0VA 2LW3A 3KPRA 3FN0L 1W1ZA 4K8RD 4IFKA 1B2YA 3KPLB 5EU9A 4FG0A 4DO4A 4OCSL 2XH2A 4ZA0A 2R1MA 2VVNA 1K85A 1CDUA 2VE6A 1V0MA 4WHBA 2WKGA 4WHTA 3OC8A 3TZVC 2N56A 4JO2L 2FTPA 3ELQA 1XIWC 3L3GB 4PODA 3VFUB 1W9BM 1A5OC 3EOUA 4H8HA 1WG3A 5FJPA 1H50A 4HHHA 4RMTA 1OWWA 4H8UA 2F8VA 3QG6A 4JNXA 4CVUA 2Y1HA 2YD7A 5BVPL 3P7YA 3GD6A 4XMTA 4GBDA 3UABA 3CIXA 1MWAL 4V1XA 4YPGB 5I2IB 4ONHB 3T78A 4AZHA 1DHKA 3KYOB 3TM6A 3W73A 2YL8A 3AAZB 2WUBH 4U6YA 1ME8A 3U7BA 1CWVA 1FL6B 5DZJA 3RDTB 1NEZA 2E9LA 1DBAL 2WC3A 2DDQL 4U1MA 1MREL 2CWNA 5ICYB 1UC5A 2X0UA 4ERSL 4WJEA 2Z1WA 4XXCC 3G5XA 3AXXA 3QA3B 3F00A 4RGNE 1RK0B 2OMNA 1FGNH 1KBBA 2PE4A 3QIUC 1IEVA 4TU1A 5AVTB 4ODXA 4OD2B 3M86A 4AC2A 4WX2A 5JMOC 2BTMA 1TVBA 3QZBA 4U1JA 4Y2DC 3ZTDC 2CLVB 1F00I 4MA7L 3CU7A 3OYXA 4GD0A 5EFIA 5K5YA 2Q6WA 1GYNA 4HS3A 3D4ZA 3QSKB 4ACTA 2L04A 1TJXA 2UZPA 4PB3A 2BY0A 4C6FA 5ESAB 1DTUA 3GIQA 1CBGA 4AG0A 4NHCL 3QO0B 2AP2A 3WELA 2P88A 2ZOOA 2MHAA 2G4FA 4ZNEA 4BHYA 5IXEA 4YHNB 3FCBA 3P30L 1CD1A 4IISA 1OADA 3HN5A 4LY8A 4G8GD 5FYJH 4LESA 4NZFA 2JD0A 4QTGA 2DIKA 1EX5A 2A6IA 4HJGB 3RM4A 1MVYA 3HE6A 2UYLB 4EI5C 3VXOB 2B4CL 2AQSA 3CVCA 2KS0A 4Q4MA 4XHQA 2X5PA 3QWOA 3KR3L 2HT3D 1ITBB 3FGCA 4NDMB 2WV3A