2WPGA

Sucrose hydrolase
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
625
Chain Sequence
SPIDAAALRASVAAALDPSTAVATLARFDTHAPRLLDALSTLYGDHADYVTWLPQWLSALGVVAQARPAALRHLDDSRAPGWFGQQDMLGYSAYVDRFAGTLRGVAERVPYLQELGVRYLHLLPFLRARAGDNDGGFAVSDYGQVEPALGSNDDLVALTARLRAANISLCADFVLNHTADDHAWAQAARAGDTRYLDYYHHFADRNAPDQYDTTLVQVFPPGNFTWVDETRQWMWTTFYPYQWDLNWSNPAVFGEMALAMLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVAPSVVMKAEAIVPMAELPPYFGSGVQRGHECHLAYHSTLMAAGWSALALQRGDILQDVIAHSPPLPPNCAWLSYVRCHDDIGWNVLQHEAAGTAAQPPFSLREVAQFYANAVPGSYARGESFQVHGTNGMSAALVGVQAAHEHADAAAAARAVDRLVLLYAVSLAMPGVPLIYMGDELALPNDTAYLDDAQRRHEGRWLHRPAMAWELAAQRHDASTLAGTVYTRLRALIRLRAGLPALAATQSLGSVALGDARLFALTRGDSFLAVHNFSDVPLPVDLTQTGHALWAVLDTDGTGDAPEPHTELLLPAYGVRWLQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Apo Structure of Sucrose Hydrolase from Xanthomonas Campestris Pv. Campestris Shows an Open Active-Site Groove
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
molecule keywords AMYLOSUCRASE OR ALPHA AMYLASE
total genus 222
structure length 625
sequence length 633
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2wpgA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wpgA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wpgA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 2wpgA03
2F1AA 5IFTA 1HIZA 1JYWA 4OZOA 1GOOA 1MQQA 5D9MA 1J0HA 3T0YA 2Z1SA 3PZ9A 3W6MA 2F1BA 3II1A 1ZBKA 1BPLB 1JZ5A 4AWEA 3VGDA 1VFUA 4MB4A 4F9DA 1UA7A 3IK2A 1J0KA 3BVWA 4ACZB 3MUAA 3PTQA 2X09A 3GYCA 4ACYA 1UASA 1TQVA 4ZFMA 4HU8A 3MKKA 4JAWA 2DSZA 3AIUA 2E9MA 4OOEA 2TAAA 2WM0A 5D9OA 1TQTA 5E0CA 4P8UA 1E55A 4JFVA 2QLYA 1V3HA 2DT3A 1PZ3A 3BMVA 3TP4A 1UKPA 3VVGA 1DTUA 1H0IA 3GXPA 4XX6A 1D2KA 1WB0A 2WYSA 3CUGA 5M3WA 4D6DA 2DIEA 3VMPA 4NQWA 2X2YA 1GQKA 1B9ZA 3UR8A 4H04A 4NRRA 3VUPA 2J7EA 2V3DA 4W88A 4PUDA 4UCFA 1RP9A 3L4YA 1C8XA 5I78A 2WVSA 1T0OA 3WEZA 1EXPA 5IFPA 3QHNA 5JBIA 2PWDA 2BHZA 1UHVA 1NP2A 5AYBA 3WIJA 4D6EA 1HJWA 1OR7A 2VR4A 1UD5A 3D5HA 3MUZ1 4P7QA 4A4AA 2CYGA 5GNYA 2D23A 3CUFA 3WELA 3VIMA 1IZKA 3VU2A 3HG2A 1FH7A 3POCA 4KP7A 4JZ5A 1R85A 1J12A 2D22A 3TTOA 1JYNA 1DWFM 1VFFA 3OB8A 3PTKA 4AZ7A 4UTFA 3LPGA 2W66A 1V02E 2DQXA 2J7FA 3RJXA 3VNZA 1B3YA 3PN8A 3M46A 1B3VA 4ZXLA 3VIGA 1C90A 4MTVA 2CXGA 3AU8A 3ANLA 1XH2A 3AYRA 5A8NA 3CZ8A 1OD0A 1B3WA 1JD7A 1UA3A 3RPMA 3BAWA 3WF0A 3WQ4A 1ISWA 1B2YA 3W0KA 1KBBA 2A3EA 2WZIA 2E3ZA 1XGZA 2BS9A 3A5VA 4AW7A 2WMFA 3ARTA 5C8BB 4NI3A 2JFEX 1KCLA 1FFQA 3LRLA 1QX1A 1XHGA 4ATLA 1E6RA 1HL9A 1WNOA 4K68A 3WN6A 1V03A 3VIOA 1TA3A 1G0CA 2XM1A 3SCNA 1K9FA 3TTQA 2WMJA 3RASA 3ZSTA 1BHGA 1UZ4A 5ECUA 3BUPA 4MNJA 2E8ZA 1FP9A 3TOPA 2FH8A 3VD9A 1D3CA 4X0VA 5IXEA 4HU0A 2Y1DA 4YHGA 5CPTA 2E0PA 2DSUA 3BAIA 3PHAA 3BCDA 2D3LA 2CHOA 1B31A 2Q8XA 5JBEA 2XVLA 3OZPA 3WUBA 1E3ZA 4AZCA 3A6OA 2J7BA 4FLQA 3A4XA 2XGIA 5M5DA 3S2CA 3K4AA 1JAEA 4U31A 4CCEA 4DUXA 1NOWA 3RILA 1FH8A 3VDAA 3DDFA 2ZX6A 1WKYA 3ZMRA 3OIHA 4Z2KA 1V08A 4P7RA 3RCNA 1EIBA 1W3LA 3AHYA 4HA1A 1ECEA 1V0MA 3K46A 3HJEA 2WWDA 1JF6A 1E3XA 1VEMA 1K9TA 4A03A 4XUYA 2QV4A 5HDRA 3ZHYA 3HU7A 5HBFA 2UY3A 1E72M 4B3LA 3LPOA 2FHFA 3DHPA 3IANA 1DEDA 3EJRA 2X1IA 3CH9A 3EJTA 4GINA 1WZLA 1ZJAA 1FOBA 3AS1A 1GONA 4MADA 3PZQA 4M29A 3BUDA 3GH4A 1OGSA 1QW8A 4TTUA 2X05A 2WWCA 5KEZA 2BFGA 4M80A 3I3EA 4UQCA 1E6XM 2WC7A 2CBUA 4EE9A 4H8HA 4FNSA 2XN1A 3WMCA 2FH6A 1HKKA 3CHDA 1Q4NX 3EYPA 4GZJA 1LJYA 2WLYA 5CGTA 2OWXA 2QMKA 1NWRA 2F7PA 3F4VA 3BSGA 4H41A 1E43A 5E70A 1HVQA 4ACZA 3WF3A 3A24A 5GPRA 2WKLA 2UWFA 1OT2A 4PSPA 2J7GA 2J75A 2GK1B 3AJ7A 3GNRA 4CD5A 1CLVA 1UG6A 4Y6SA 1S46A 1CTNA 2VURA 1E1EA 3N9KA 4BA0A 1DWAM 1HF6A 4TTGA 1SMDA 1GPFA 1KQZA 1UYQA 2VI0A 2VVNA 1QNPA 5DFAA 1RH9A 4HMCA 2X2IA 3CC1A 3F5KA 3U7BA 3BAKA 1K5HA 1XCWA 3L4ZA 1UUQA 2GK1A 1W9BM 3MSDA 4NF7A 3OLGA 1UR2A 1PS3A 2YLLA 1HN1A 1QPKA 2D0GA 4AEFA 4DM2A 4CD6A 1W3JA 3ZIZA 1C8QA 4DWSA 3MI6A 1OT1A 3SUWA 3VD4A 4S3KA 3AMDA 3RM4A 1C92A 7TAAA 2X2HA 1TA3B 4RL3A 2PWFA 3WH6A 4HA3A 3MANA 1JI1A 3MMUA 2VZTA 3VIKA 2ZUVA 3N1AA 2BXYA 4F79A 4CXFA 3CHFA 1RP3A 4ZXOA 3DDGA 5BWFA 2Y1CA 5FD0A 4PCTA 1C93A 3WBEA 1HP5A 1KXTA 2CNCA 4WLCA 3VSUA 5A2CA 4HOZA 3GXIA 2IXVA 5DF0A 3SIMA 3VD5A 1H49A 4HPHA 3APGA 3ZJKA 3JUGA 3SCOA 3AMLA 2WKGA 2J7DA 3UG4A 5BRPA 5D8WA 1V3LA 2OYKA 4J3XA 3PZGA 3CZJA 5A1AA 1OIFA 1MQPA 1M01A 3I3DA 4TVCA 3ARUA 3PZUA 1CXFA 4JKKA 1C3FA 2YL6A 2FYVA 1KFWA 3KL0A 2WBKA 4LYPA 1QBAA 4ML4A 4JKLA 1QHOA 2FHBA 2WANA 4CU6A 4YPJA 1TUXA 2EAEA 1VJSA 1QW9A 1LQ0A 3HG3A 4QLKA 3U5UA 2J8FA 4W7UA 4WKHA 3WF1A 4M24A 1XH1A 2YKKA 2WZEA 5EMYA 2EADA 3I3BA 5CPSA 4CD7A 1EDGA 4QDMA 2C0HA 3B8SA 2IGTA 1E0WA 4W89A 4UOZA 4PTVA 1SR0A 1EHAA 5D4YA 1BG9A 3OLEA 3F5LA 2J8GA 3WUFA 1A47A 2A3BA 5GNXA 1CXIA 4UFMA 1UR1A 1R47A 3GM8A 4P7LA 3WD3A 3HG5A 5BXTA 2XSAA 2G3JA 4Z2GA 1R33A 3GXTA 3CUIA 4GZIA 1W9XA 4QLLA 3W4RA 1YQ2A 1RD6A 1CNVA 5FL1A 2XUCA 2ZOXA 3K8LA 2RGMA 5I77A 1Y7VA 1Q0QA 4AIOA 4OOFA 3G6LA 3HG4A 4X9YA 4HOXA 1H11A 2WMHA 3A4WA 1UKOA 1HWWA 1QI3A 4BQ5A 2BVTA 1KBKA 5JNLA 1ITCA 3QHMA 2EABA 5I5RA 1E0VA 4TOQA 3ZJ6A 3CUHA 2OSXA 3FAXA 3ZQ9A 4CD8A 1BF2A 1N82A 5E0FA 4W8BA 3DECA 3EDFA 4FLOA 2XYLA 1ZS2A 5IHRA 4TX8A 2W4XA 4YN5A 2Y8VA 4MNKA 2E9BA 2YL9A 5C70A 2ZUSA 3AMGA 1ISYA 1E56A 3AIBA 4C7GA 4W7VA 5CZKA 1LWHA 2VTFA 1G94A 4M8UA 5A95A 1JZ4A 2DT0A 2WW5A 3ZSSA 4BQ2A 1LWJA 2CPUA 4JFTA 4UQ9A 3LPFA 2C8NA 4MJ2A 2JE8A 1L0PA 3VSVA 1CXKA 4PMOA 3N18A 1J11A 5D9NA 1G1YA 1QWNA 2DH3A 2XVGA 3LXCA 3VGBA 5A6JA 2EACA 2F7RA 4GKLA 1E6ZA 4QCFA 3SCVA 3DYMA 1ISXA 1NOFA 4GI6A 4PMDA 1GHRA 5BXPA 1U2YA 4GI8A 1E4LA 1EOKA 4M82A 3ARZA 1V6WA 1VRXA 2QPSA 2G8ZA 2VT0A 1L8NA 4HMEA 3N04A 3WL0A 1D7FA 4XB3A 3TA9A 5BCAA 3A3HA 2WMKA 4CGTA 4JHOA 1K6AA 2ZXQA 3B9EA 4P8WA 2BVDA 1GOMA 3OGRA 2CBIA 4JKMA 3BLKA 3CZEA 1X6LA 2ZUMA 2VNCA 3AIWA 2YDQA 1H1NA 4OJYA 3E1F1 1OM0A 1V6UA 2WCGA 3CZGA 3VGGA 2ZWZA 1V0KA 2JD0A 3WY2A 2O9PA 3ZT5A 4OBRA 3WDRA 3DC0A 3ZR6A 1CGVA 1R7AA 4J3WA 1H2JA 4CCCA 1XD1A 3DX0A 3GBDA 3NCOA 2CKSA 1R46A 5M17A 1PBGA 3ANMA 2XVPA 3HMCA 3CLWA 3AZTA 5BXSA 5AY7A 3KLLA 1R34A 1E6NA 2PB1A 3NIYA 1J0YA 1UR9A 2ZXBA 2GSJA 1V6VA 5BXRA 1GOWA 3VTRA 4PEEA 2ZUTA 2ZX7A 3AS2A 1E6QM 1QNSA 5GQBA 4P7NA 2JIWA 2IXUA 2VL4A 1Q6EA 4UFIA 3CPUA 1PX8A 3A21A 3VPLA 4PUEA 3AOFA 2WC3A 3ZT6A 3CUJA 2DDXA 2J79A 2XTKA 1GHSA 1MWOA 2G3NA 4GQQA 2F18A 3CHCA 2RGLA 1KTBA 3W53A 1NQ6A 5D9PA 4DM1A 5A2BA 5EBAA 2NT1A 1NWTA 3NSNA 2WVVB 3ZR5A 1O6IA 1EQPA 4QCEA 4M81A 1CENA 1WPCA 2J47A 3FN9A 1JZ2A 1A3HA 1PIGA 5EFDA 3VGFA 1DHKA 4MAVA 4H7VA 4KWUA 1XSJA 2IUZA 4JCLA 1OD8A 5HXMA 1TG7A 1UWSA 5CSYA 1WO2A 1JD9A 2VRQA 4ZQFA 3AZSA 1WDSA 1HP4A 1QI5A 4MB1A 3AUAA 3BMWA 4GI9A 2XN2A 4AD1A 4ZQGA 4AZHA 4QAWA 5JBFA 3GNOA 2ZXAA 3BUIA 1Q0HA 3WD1A 3L4WA 4CN6A 3WEOA 4MB3A 1UWUA 4HOWA 1JYVA 4IPLA 4Y6PA 4FLSA 3FW6A 1IT0A 2Y2WA 5CJ5A 4XZWA 4B9YA 3AYSA 1V3IA 5EFFA 1KGWA 4J3VA 2WVVA 1MYRA 2X8RA 1ZBCA 2VCBA 4UFKA 3EJSA 1WDQA 2UY4A 1V3JA 4P7OA 1MW0A 1CGTA 1HTYA 2YDRA 2AAAA 4GQRA 1W9DM 1W2PA 2V3EA 4UNIA 1XCXA 5E1QA 1ONPA 2ZWYA 2V38A 3DX4A 4UQDA 4AZ6A 5JUVA 1H3LA 1QWUA 3WDPP 2DIJA 1J0ZA 3SCSA 4AZCB 3UESA 2D0HA 4B9ZA 2CBVA 2VQTA 2ZUUA 1HJSA 3LXAA 3WNMA 3ZI0A 3SUVA 1BQCA 2BXZA 2YOCA 2CESA 2VX7A 2D24A 2ZX5A 2PF0A 5JIWA 1MFUA 2F2HA 8A3HA 2V5DA 4TVUA 3VDHA 3D4YA 3SCQA 3O9NA 1M04A 3K4DA 4A3YA 2DPEA 3KWXA 3SUSA 2ESCA 4JL1A 3S5YA 3K8KA 3MUY1 2J4GA 1MQRA 1R7OA 2WB5A 1EO7A 2PBGA 2GJXA 1KWKA 2EJ1A 2WXDM 2CKRA 3CO4A 1ZB5A 4ZEPA 3K8MA 4KGJA 3ARSA 1KWGA 4UFJA 3A4AA 3OBAA 3WQRA 1UKQA 1KXHA 3POHA 3GDBA 4J3SA 1HXJA 3R0IA 2WVTA 4KMQA 2EBNA 3K1DA 3PZOA 4V27A 1E15A 1UWIA 3WQ6A 5LA0A 2CERA 4W8AA 3WQVA 1QBBA 2GVYA 2F8QA 5DO8A 2YA1A 1XSIA 1WE5A 3ARVA 1W32A 1OIMA 4J3UA 2O9RA 2XIBA 3RDKA 1KTCA 3DYPA 4U2YA 1JIBA 3KLKA 2FDMA 4W84A 2V3GA 1GJUA 1HJQA 1PX4A 2WSPA 2JCXA 4CVUA 2QHAA 3AHVA 4E8DA 4JFWA 2C7FA 1CECA 2AMGA 2DSVA 3EJQA 1CXEA 4GXPA 2PBOA 3BAYA 4CUCA 3W6LA 3J7HA 3MV11 3VDBA 4AY1A 1F4AA 5A8PA 2W62A 1E9LA 3VD3A 1US2A 1QOXA 3CZSA 3W28A 3BUQA 1UOKA 2WK2A 3UEQA 2J7CA 4FMVA 2WHJA 4E4PA 1V02A 5DT5A 1ZU8A 4Y67A 1J10A 2PWGA 3NSXA 1JNDA 3WNLA 1JZ8A 4NXSA 3TTYA 2DT2A 1MXDA 3BAXA 3M6DA 5JO0A 2XFYA 3BVTA 2ZUWA 3GNPA 1GJWA 1CWYA 1KGXA 1PEZA 3WBAA 4JFSA 3QR3A 1HX0A 2Y1EA 2JIEA 1UWTA 4Z2IA 7A3HA 3PZTA 4LUPA 4HMDA 3ZHXA 2WC4A 4NSBA 4MNLA 2FGLA 5FKYA 2BY1A 4P8XA 1K9DA 3T2QA 3ZJ8A 4TUFA 2OYMA 3D4ZA 2Y24A 1UR0A 4D6CA 2WCAA 1MW3A 1CGYA 4D6FA 3MSGA 2C82A 4GIAA 4AD4A 3N15A 4TX6A 5AC4A 2D1ZA 5A6MA 2ZUNA 3WMBA 1LL7A 4FNUA 1I1XA 1AQMA 4XZBA 4GPNA 1WAWA 1TQUA 4C7DA 4ATDA 1JDAA 3CZKA 1NWSA 3FAWA 5CLTA 4ATWA 3PZNA 2JD2A 3VIFA 2X2JA 3EDEA 3WH8A 4WK9A 2YBUA 4MB5A 3S5ZA 2CIPA 3KEHA 3VO0A 1CIUA 3OLDA 3F5JA 4UZSA 1XC6A 1SC5A 2WMGA 3ARXA 1P6WA 4F9JA 4Z2HA 3BLBA 3RM8A 4W85A 3FHQA 5CQ1A 4FNRA 2B31A 4PTWA 1TVNA 1EOMA 1JG9A 4CN4A 4CU8A 2XWEA 3CTTA 1JF5A 4F66A 4PMZA 1KXQA 4DO4A 2Y1GA 3WQSB 1JZ6A 3THCA 6TAAA 2EXOA 4AZIA 3WUGA 1GUVA 4U33A 2YJQA 4PSRA 2FHCA 5I2UA 5BYWA 2XFRA 3L4VA 3EJUA 1SMAA 3BVXA 1UWQA 1OINA 1ZL1A 3W26A 1W9PA 5F7UA 1NP0A 3SCPA 2JEPA 2W61A 1QHZA 3OLIA 3VDCA 1TE1A 1FFRA 5A8QA 1UD3A 5ABFA 4V28A 5CXPA 3MS8A 3FNDA 4EK7A 2ZE0A 4RCVA 4GO8A 1E4IA 2WHLA 2VC9A 1CZ1A 3N13A 3AXIA 3M7SA 4M1RA 3GBEA 3GH5A 3NJ3A 1JDDA 3O2LA 5DT7A 2GJPA 1H41A 2DSKA 4W86A 1XV8A 3W27A 4OOZA 1NOUA 3H55A 1TFVA 5M03A 2VOTA 3ZM8A 1GOKA 2XJ7A 1BLIA 3WUEA 4U5IA 3L2LA 3AXXA 1TCMA 1EDTA 3CV5A 4FF5A 3AIQA 3AQUA 3D50A 4J27A 1V6XA 4HP5A 3VGHA 3BAJA 5I24A 3CGTA 1ZBVA 3ARRA 3NDYA 2G4FA 1BGAA 5I23A 2WBGA 5TD4A 3IJ8A 5E6YA 1JI2A 4KRTA 2EGHA 1R86A 1ODZA 2J74A 3RMEA 2PWEA 1ZJBA 4W7WA 1RP8A 4LXFA 1CGUA 3VIIA 1V0LA 3DX1A 3WY1A 5C71A 4AD2A 1GNXA 3VSTA 4HZ8A 4N0RA 1TQWA 1JNEA 4PMUA 4NX0A 2Y8KA 2MANA 3KZSA 3AFBA 1NARA 4PCSA 2VZVA 4R27A 4AYSA 3UCQA 5JMPA 1Q6CA 3ARPA 4ZQHA 1J01A 3DYOA 2F61A 1NH6A 1E6PA 3AROA 1V3MA 3VMOA 5AYIA 1UH2A 2ZICA 3WD0A 4Y6RA 5JMWA 3NDZA 3D51A 2DSWA 1JL8A 3ZHZA 1C8YA 1DWJM 3OGVA 3WQWA 3GH7A 4FNQA 3CBWA 5I6SA 1FP8A 2D2OA 3WFZA 4QFUA 1BVNP 1GQJA 8CGTA 2WHMA 4D6GA 1LG1A 1W9VA 3MO4A 1QI2A 1FHDA 1M53A 4HPGA 1GZJA 2XN0A 1W1VA 2MAPA 3UG5A 2E8YA 4MDPA 3A23A 3CMGA 4RE4A 2VRKA 1AQHA 1KR1A 2XGBA 4LX4A 2BHUA 4AMXA 3OZOA 4PMYA 1MW1A 1DWIM 4AD3A 2GFTA 1E5JA 4WKFA 2EPNA 4BCEA 2YL8A 1H4PA 2CHNA 2G3IA 1ODUA 3AS3A 2OWWA 1CGWA 3VIPA 4JHZA 3QOMA 3WF4A 2OSWA 4C7FA 4DWSD 3WQQA 5A6SA 4PRWA 4MNMA 3VIHA 5JAZA 5DULA 3AMKA 2W63A 4AZGA 1R0LA 3GZAA 2CITA 4D1IA 1B30A 4AEEA 4NZCA 1JFXA 1U33A 3AZRA 5I0DA 3VINA 3WD4A 3LMYA 1UR4A 3W82A 3D52A 4WKAA 5FL0A 2UY2A 1AVAA 4OOUA 4R5EA 1R75A 3BVUA 1BTCA 1CXLA 3ZOAA 2XHYA 3ARYA 1OSEA 1WZAA 3L4TA 1EO5A 4U3CA 2X0YA 3T2OA 3VOCA 4LYRA 5CPQA 4D1JA 3G6MA 1WDRA 2VZUA 1F4HA 1VEPA 1VF8A 4GO9A 4U5KA 4D72A 3BXWA 5E9AA 2XM2A 3OG2A 1HL8A 2J77A 2FGZA 2EPKX 1OWQA 1HJUA 1WDPA 4JFUA 3WQ5A 5LYRA 3IJ7A 5LA2A 4UFHA 2BY0A 1EGZA 3W25A 3OGSA 3VX1A 2HISA 2WNWA 3FY1A 4CVWA 1VJZA 5A6KA 1UKTA 1J9YA 1B1YA 1K9EA 1CXHA 4M56A 2YA0A 1E4MM 3SURA 3ECQA 3AXHA 2ZIDA 4BS0A 2DH2A 3AI0A 2HVMA 5CSUA 5ABHA 1SFSA 2PC8A 1XH0A 5D8ZA 5JC1A 4A3HA 2JF7A 4MPKA 1PX3A 3WH9A 3T09A 1E40A 3PZVA 1OGBA 3RO8A 1MW2A 1B90A 1KB3A 3ARWA 3TONA 4PMVA 5A6BD 3ZO9A 4B3KA 1UD4A 1EHNA 3CZLA 4QP0A 3ALFA 2NT0A 2YL5A 3N17A 3IAQA 1LL6A 1EH9A 3UERA 2W92A 5AC5A 4WSJA 2DEPA 2XSBA 1JDCA 2QMJA 4L4OA 6A3HA 3AIRA 3QOKA 1B3XA 4H8VA 1GQLA 2PI6A 1TZ7A 1YHTA 2Y4SA 4YHEA 3GTNA 5A3HA 3WMSA 2VO5A 1DP0A 3BLPX 4W87A 5ABFB 2XVKA 2YFOA 2BVYA 2E9LA 3LRKA 4PMRA 1JVSA 1W3HA 2D20A 4LPCA 1VB9A 2F7QA 2WVUA 1HVXA 4ZE5A 2YFNA 2MAOA 4AMCA 1J0IA 1M03A 1HJVA 4AISA 4BF7A 3WNNA 1FH9A 2V5CA 3AHXA 1Q6DA 4ZQEA 1OCQA 3RM9A 4X0NA 1V6YA 1O7DC 1DWGM 2ALWA 2XG9A 3EDDA 4LQ1A 5A8MA 2X0HA 4ZE4A 5CLWA 2G41A 3ZT7A 1JZ3A 2WHKA 1R8LA 3WDJA 1AQ0A 5A94A 4PTMA 1W3KA 3VX0A 3T0DA 4ZENA 5A6AA 2E40A 4AC1X 4CU7A 3PZIA 2BHYA 1CYGA 2O92A 2OYLA 4KGLA 4URIA 3CHEA 1SYTA 2VRJA 2J62A 2YDSA 3BCFA 1TQSA 1C91A 1HNYA 3WNOA 1CLXA 1HXKA 1W1TA 1NWUA 3A14A 3VMNA 3PTMA 2JCVA 3SCWA 1W91A 4HTYA 1E0XA 2GJXB 4ZN6A 1LLOA 1UD8A 1XYZA 3SUTA 1LL4A 2GDVA 4Z2JA 2JD1A 4OUEA 2NSXA 1E4NA 1QVBA 1Z32X 2WMIA 1HKMA 1T1RA 1PIFA 5CG0A 2O9OA 1UQZA 4IUGA 2CCRA 2Y1FA 4JCMA 1JXJA 3AICA 1W1YA 3ARQA 1GVIA 4B15A 2BV9A 4P8VA 3PZMA 4PMNA 4MDOA 3W81A 1JFHA 1V0NA 3UETA 2WCSA 4GAEA 1XD0A 3O6AA 4Q22A 4Z2LA 3W37A 2E4TA 1HT6A 3U57A 3ALGA 1E1FA 1W1PA 3WL1A 1OGGA 4LGXA 1EA9C 2J25A 2WLZA 4AD5A 3VD7A 3SCUA 1TR1A 2EPOA 4FLRA 2FE0A 1H3GA 3T08A 1U30A 4WIWA 5I3DA 3KL5A 2QPUA 1BSIA 3AS0A 3UR7A 4DUVA 1H5VA 3BGAA 4PTXA 3RJYA 1T1SA 2VQUA 3A22A 1VBRA 4V2XA 3WKZA 4QLJA 3AIVA 2XWDA 4OGZA 2WZHA 5KZ6A 5A8OA 2BY3A 1EDQA 5A69A 1J0JA 4AICA 2W67A 3NSMA 4W5UA 1BYDA 3DX3A 3A06A 1JXKA 1KCKA 1J18A 1B3ZA 1HJXA 1KXVA 2VCAA 4TXEA 3HZ3A 1XYFA 1VENA 1CPUA 1ONOA 1AMYA 1IV8A 1ISVA 1BYBA 4UQBA 4NZJA 1HKIA 2VX5A 3VGEA 2VCCA 3BC9A 3SEPA 1IZJA 3QHOA 2DGAA 4IM4A 4UOQA 2GDUA 1QNRA 3MV01 4AZBA 1DWHM 3LXBA 2D73A 2A3HA 2QF8A 4PBGA 3S6TA 4UZUA 3T0BA 3AHTA 4E2OA 3AISA 1UH3A 4IPNB 2W91A 3B9AA 1O7AA 1B0IA 3LRMA 2CBJA 2G3MA 2V3FA 4CN1A 3WNPA 1M7XA 3GXDA 2OWCA 4AYGA 4FNTA 1VFMA 3FXYA 3U7VA 2XFFA 1BFNA 3U5YA 1UKSA 4N42A 3B9DA 1BYCA 2YLAA 2BNJA 3IIEA 2CETA 4OBSA 3T2PA 3WDQA 5JIPA 2EPMX 3WENA 3W38A 4KRUA 1W2VA 2A3AA 4AIUA 1GOIA 5JBDA 4W5ZA 5CGMA 2VZOA 1ISZA 3PBGA 1CGXA 3VILA 4MAZA 1FA2A 5A6LA 1JZ7A 3WSUA 2VMFA 4UR9A 1C7TA 1WCGA 2WAGA 1OBAA 4W8LA 9CGTA 5IDIA 3HN3A 4CCDA 2W5FA 3SCRA 1BYAA 1OB0A 4Q7NA 1R0KA 2ZX8A 1QI4A 3AMCA 1FHLA 4IISA 4EANA 3LPPA 4FK9A 3IJ9A 1H09A 3EJPA 5LA1A 3T0AA 4L4PA 2GUYA 3D3AA 1GVYA 4NZFA 4U2ZA 2OLHA 1NM9A 3N12A 4TVDA 1CDGA 4U3AA 4BQ3A 1US3A 3WDHA 1TMQA 4H8UA 1XRVA 3WH5A 1UWRA 3WF2A 4KH2A 1CEOA 4JL2A 3H53A 5E09A 2ZXDA 4UOJA 2OSYA 4OIFA 4HZ7A 3WDIA 1E71M 3NYDA 2YIHA 4AMWA 1R87A 3L4UA 4EAMA 2O9TA 2CEQA 3SCTA 4DWSB 3AU9A 4J3TA 4E8CA 5FOOA 7CGTA 1WZMA 3TV8A 1KR0A 3H54A 4AIEA 2EPLX 3CMJA 3OA5A 1G01A 4PMQA 3MU7A 1UR8A 3ANNA 2JCYA 2OW7A 4DO6A 1GQIA 5HPCA 5ABEA 1I1WA 1GCYA 4RE2A 2YBTA 1KGUA 1WP6A 2Z1KA 1E73M 3SUUA 3CIVA 1QNOA 1MXGA 2JF6A 4PN2A 2WMIB 2WSKA 5EB8A 1PPIA 1SZNA 4BZYA 2VX6A 3UG3A 4DO5A 1E6SM 1Q6FA 3DX2A 2AOSA 2J78A 4F8XA 3TTSA 1BVZA 4W93A 3KE0A 3FHAA 4JIEA 1UQYA 1JAKA 1LG2A 2Y5EA 3RIKA 6CGTA 4D6IA 1PZ2A 4XV0A 1XSKA 3MMDA 4AD0A 1X1NA 3BVVA 2PWHA 2O7GA 3LX9A 2VVSA 2XIIA 4WJXA 3VM7A 4PYSA 4UQEA 2J7HA 1LF1A 1VAHA 3WY4A 4UQAA 2D0FA 1VBUA 4D6HA 4Y7EA 1BG4A 1VEOA 3ZJ7A 3AIEA 3N11A 1H0GA 1QI0A 2GJRA 4WSKA 5HPOA 4FNPA 2EO7A 4DUWA 4CD4A 3WEMA 4HZ6A 3EDKA 1V3KA 1PJ9A 5E6ZA 2EEXA 3IGUA 3KL3A 1JYXA 3AHZA 2OW6A 4D6JA 1WZKA 3BUBA 1UD2A 4GZEA 2WPGA 3M07A 1ZBWA 4B16A 3L2MA 2VUYA 5I79A 4AZ5A 4OKDA 2VJXA 1HKJA 2D3NA 1RPKA 1ITXA 1Q6GA 4EKJA 4LYQA 3VNYA 3VIJA 2VR5A 3MUIA 3DHUA 5FIPA 1E5NA 3W29A 1BGGA 2EQDA 2JALA 2JEQA 5GNZA 5BRQA 1G5AA 1I75A 1GW1A 1BAGA 5DEZA 2F7OA 3W24A 3WY3A 4J28A 5BROA 3BH4A 2VZSA 4H2CA 4RE3A 5DMYA 1UZ1A 3IAPA 2XPKA 3BSHA 4DWSC 1GOQA 2VX4A 3EMZA 4PMXA 5ABGA 3WQ8A 1JGIA 2A3CA 3WNKA 3VKKA 1VIWA 5HOSA 4WF7A 3QGVA 1W9UA 3GXNA 2UY5A 2XVNA 3VM5A 3WFLA 1PAMA 4S3JA 3GXFA 1C7SA 1ESWA 3MMWA 1ONNA 1MVYA 1CBGA 4D71A 1G9HA 5FCZA 5HNNA 3NUKA 5A6BA 1MFVA 2YA2A 1QHPA 2DT1A 3EBVA 3A47A 1EQCA 4AXNA 2ZX9A 3EMCA 1Q0LA 4BQ4A 3EDJA 1UH4A 1E70M 4CKQA 3WD2A 1X6NA 2NW0A 1VFOA 1UD6A 3CZNA 1GORA 4HA4A 4MJ4A 4NRSA 5A2AA 4UFLA 3THDA 4NXKA 2BY2A 3GXMA 3WH7A 1KQYA 1QNQA 3L4XA 5IHSA 3EMQA 1TVPA 4J7RA
chains in the Genus database with same CATH superfamily
1TDQA 4NZ8A 5EO0B 4AMAA 4D8PA 4OZOA 1GOOA 3SCMA 1XBZA 1AJ2A 4JFPB 4LTSA 5DMGD 4RFNB 3VQ1C 2PPFA 4RZ5A 4FULA 3W6MA 1T83A 3KPNB 1AD1A 2MH4A 4AE1A 2XWBB 2F1BA 4ZXBD 2DN7A 3NQBA 5JW4R 3GJFB 3V4LA 1J96A 3NZHH 3ULUE 1UUOA 4TVPL 2IDFA 3PBVA 3EYQD 3WFEL 4NCC2 4BCXA 4AWEA 2ON3A 3H3BC 2GL5A 3JV4B 1LE9A 1BQKA 4PGZA 3O11A 4LF3A 1OGAA 4ZR8A 4WRLA 1CDHA 2DM3A 1TJ0A 2N7AA 3MUAA 1M1SA 5LNUA 4ORIA 5H1WA 4M7LH 1YECL 4JMNA 1OK8A 3R0MA 4ZFMA 1JRHL 2LFGA 3OX8A 2DZAA 3NN8B 1W8EA 1XB8A 1MWAB 2O5NA 3MROA 5EN3A 1E28B 1FWGC 2CLLA 2V69A 2V9DA 1HL5A 3CVIL 5IVZA 4KW2A 4OCYL 4XZNX 2GC7C 4MCYA 4BSWB 3QCVL 4JPWH 5CP3A 3PWPD 1CU4L 1TQTA 3B4NA 1PW3A 3D4CA 1CS6A 4O12A 3DO7A 1E55A 4YLWA 4QHMB 1M1XA 3LMJL 4F9PC 1V3HA 2UWEB 4HZMA 4PI2A 2V82A 5J1AB 1LHZA 1NCWL 1JPHA 2IXQB 4HCRH 1DUZA 2F68X 1MKFA 3GZQA 5BZDB 4AM0Q 1DBML 3ULUD 5FECB 3GVVA 2AQNA 2GPZA 1MUJB 4G7VL 2BSEA 1ADQL 1BBJA 5I16A 3GIQA 5B1BB 2Z31A 3DSFH 4I2XB 1EP2A 1H0IA 4Z3TA 1OVDA 1V79A 1MZRA 3O6ML 1PKLA 2JGQA 4MSWB 3RUGF 3UJIL 1H7XA 5FYLD 1EFXD 1OANA 3KW7A 2IBBA 5ES4B 4FHAA 2VDMH 4WDUA 4XO7A 5AW1B 3VMPA 2XG4B 4HK0A 1Z44A 3QG6B 3SRKA 4MQ7B 1GOFA 1QBML 4W9GC 5I6LA 4HIJA 1B9ZA 1GQKA 4HJJH 1CLOL 2HJLA 3GSNB 2HX8A 4AQOA 4PFMA 4PBXA 2J7EA 3S42A 5DQJA 2YPLB 2V3DA 3D5OF 1ZJHA 4LDOB 4ZTEA 2IBZY 4WJG3 4JMXA 3FB7A 4UCFA 1C8XA 4QXUH 1GK8A 2ZE3A 3BW9A 2XY1A 3S3PA 5GRVK 4YDZA 5TK4A 2YD2A 3DV6B 4UQ2A 4ZUWA 3S4TA 3WEZA 5IFPA 4YE4L 2BNQE 2Q76B 2Y70A 1QWHA 2BCKA 2BHZA 2GT9B 3EOAB 3IGFA 1NP2A 5AYBA 1I4NA 3GBLA 4OZIF 3D5HA 4P7QA 4GW5A 4XXCA 1IIKA 3SAZA 5C9RA 3SKJH 1Q63A 1T4WA 4JM2B 4AJVA 3SYQA 2X4NB 3MNWA 1F3EA 2XTJE 4F2EA 2MQCA 2MJWA 3IFLL 4LCWE 3T07A 3MRIB 4GQZA 1J8RA 4RFOH 1IZKA 1AP2B 2BCMA 4GEJA 4JFZH 5D7IF 3VU2A 1E9ZB 2ISVA 2IKJA 2NWRA 3P8IA 2F8XC 4LOVA 1ME7A 2QAFA 3FB6B 1QRQA 4DEPC 1A6WH 4B5TA 4ZFOA 3RGHA 2AHIA 2PLCA 3DOSB 4X4YA 1N5YH 4PJBA 3NZ8B 4H5SA 4JPGA 1UC4A 4IL0A 1FNGA 5IVXF 3TCTA 4AV0A 2BIHA 1G43A 2EECA 2H2SC 4L65A 3VXMA 4HLZG 1DWFM 35C8L 1VFFA 3OB8A 3S36L 4LHUD 5D5ME 3PTKA 2R4SH 5B8CC 3IYLW 4HJSA 4MIMA 5CPMA 3LPGA 3PHSA 4E0CA 5J9PA 4OY9A 2V6AA 2FEDC 2YPKA 3I9AA 4UTJA 3E6HA 5CCGE 1XIGA 5LNVA 1SN5A 4Y1TA 4CW1A 4EPSA 1XRSA 4MNGA 2JFCA 4MA8H 5JPNB 3HUJB 4FQ1H 4PRDB 1RXLA 1TMHA 3ANYA 1V05A 2FECI 2YX0A 4A04A 4LVNB 1JWSA 1TIUA 2KDGA 3KJ6H 1K1DA 1OCBA 2VDPL 1RLDA 1PZAA 3MT1A 3BIAX 5A8NA 1EEUA 1OD0A 3GVWA 4C55A 4IDLA 3ZE0B 3PP4H 4PRIB 4A7UA 3TBWA 5CEXA 3LHTA 1Y6NR 1U41A 2A3EA 5HQEA 3BGMB 4OZFA 2HZHA 1LM1A 1AQKH 1EGJA 4EAEA 1KA9F 2NQHA 2WPBA 1CLCA 2CUAA 4B3ZA 2Y72A 1T1ZB 2E9WA 4X6CF 4Y1AD 1ROCA 2E3ZA 2OR2A 3A5VA 3IK4A 1QO2A 3FXGA 5E2WH 2HRPL 4GGBA 1F18A 3N41B 3O2DA 1NUNB 1UFUA 4HS3A 4X7TB 2GYIA 4QG9A 3ELQA 4KWVA 4K23H 1LTDA 3LRLA 3NA4A 3MJ7B 2MNJB 4DN4H 1TXKA 4LIQH 4QHLA 1U8LA 1HL9A 1OW0C 2E7BA 1BKHA 1WNOA 1UB3A 1YW1A 4ADTA 1XGTA 2A7BA 1U5JA 4WW2F 2A7NA 4PG2C 1H8SA 1R5VB 3NOEA 3SCNA 3TTQA 2AANA 2G3ZA 2ZF8A 2N1KA 2G5BB 4X80H 5T1MA 4PS7A 5DWUH 4DPBX 4LRTA 4MFEA 3BO8A 1LDPL 2AJUH 2QEJA 3VWJB 1BHGA 1SJXA 1I3RA 1MEWA 4L6HA 4K8EA 4M7LT 1INQA 5CJNA 1AO7B 1MH5A 3BUPA 3OC5A 4MNJA 1GC1C 2OMTB 4UAOB 5C08E 1CG9A 4TS6A 3CXHJ 3VFWA 3FU7B 4QXTB 1D3CA 1LILA 1JVLA 3RZCC 2GGHA 2HXUA 5M1TA 1KRCC 1RJZB 1TTUA 1UYWH 5C3IA 4U1MB 4XB7A 1S2UA 3DJZA 4JIRA 2M8XA 3WKML 4YHGA 2E0PA 2BWQA 4X5QA 3ZUNC 4C8XA 1WKDA 2A9AA 1P7HL 4IIBA 1ZA6B 3HBGA 3KHOA 4Z7VA 4LCSA 3LG3A 4QNEA 2CHOA 3UTQA 3K71B 2OAAA 2K8MA 2CZNA 2D03H 3CQKA 3DN5A 2IAMB 4IBYA 5H6HA 4MAYA 4JFXA 3OPUA 3SYAA 3MJ8A 1HXYA 2YCJA 4UMBA 3ZXAC 3F4DA 3QUKB 4C56B 4R0LC 4MHHI 3RVUD 1E3ZA 1P69B 1OGTA 1XYAA 1TKWA 3SOTA 4QNPE 2PPEA 3CVHH 5I75B 4FLQA 1ED3A 4YDMA 5SWZD 3P3RA 3VFSA 3K4AA 4YH6A 4UANA 5HHQA 1JAEA 4KO6A 5J5EA 2XGIA 4U31A 1B0GA 4CCEA 2PO6D 3V6ZB 3R1ZA 1FH8A 2E67A 2WJZA 3F2DA 3GB6A 2Z1VA 2F5BH 4RMBA 2R2HB 5ESAA 5A2JH 3L3JB 4ZTPL 5C0GA 2ZKHL 4GRMA 1V08A 1X5GA 4L1BA 3L08A 4B96A 3KTCA 2CO4A 4M7TA 4GRWE 2R9RA 2YB1A 1JPFA 1ECEA 5EB9A 3T6XA 3PS6A 5IIEB 3AGWA 4YNYB 3WKPA 1FV1A 4LSVH 5AD0A 2CDGA 1JNNL 2QKSA 4ELDA 5IBUB 3MQTA 4RBPH 3T8MA 4XUYA 5IM7B 2EXWC 2QV4A 1IC7H 2I57A 4DP7X 1SEBB 3CFBB 3X14B 4H9UA 1GS8A 3WSQL 3O9WB 3FBQA 3V35A 4CLMA 2NQ5A 1ICTA 5J56B 3UPWA 2IALA 5JMUA 1UMYA 3W23A 3DUUA 2UUDH 1RFDH 3OZ9H 3O05A 3GSNH 4YWGL 3EJTA 4ADJA 2WJDA 5E00A 2GI0A 2OS7A 1ZQ5A 1KCBA 2Q02A 3RLVA 2WXFA 1FOBA 5J5RA 1GCFA 1NOAA 1LUCA 4MADA 4V1DE 3QIUB 4QHNB 1GTFA 5I16B 4M29A 2VLLA 3BUDA 3EO9L 4BSJA 3CXOA 3GH4A 3LSOB 2EDJA 5CCHE 4JHWL 1IT8A 4XMPL 1IGTB 1WV7T 4N2FA 1DIDA 3O0FA 1F3RB 1MEXH 4PJXE 3W1RA 4UQCA 3NP3A 3RKDD 2WMPB 5E99H 4X2UA 4OFYD 4H8HA 4RE0A 4FNSA 1I8AA 3DROA 2XN1A 3FA5A 1LWIA 5CEWA 1CDYA 3QNXB 5EY5A 1LLZA 4IU2B 3FOMB 3WMCA 4KKXA 3ECBB 1Q1PA 3GMQA 2N7SA 3KPQA 4ZODA 4HVBA 1LJYA 3HE6C 3GYEA 5TE6H 3QMRA 4FHBD 4QXGH 1OP9A 1A5NC 2ENSA 3MFFB 4OQTH 2OJZH 4ZBJA 1OFBA 1RCOB 2F7PA 4G9FA 2WKOA 4MA1C 3F4VA 2HYMA 4LW7A 1ZK5A 1YECH 4KEMA 5E70A 4DKDC 1VZWA 2WUCH 5DUBA 4BK4A 2WXOA 3A24A 4FQJH 5F3HB 2EZ0C 2X4NA 4YCPA 3R18A 5LAXB 4H6KA 3QNFA 1U58B 3LNIA 4LCYA 4JZJC 3I4EA 3B04A 4L6OA 2ZWKA 3H9HA 1XF0A 5I17A 4F3HA 4DP0X 4DW2H 1V6TA 2Y2YA 5BWAA 1IMHC 2WYTA 4M6OL 4Q9QL 5FFLA 5DEGA 4L18A 2OZ4H 2NCMA 4XAKE 3BT2H 1AR1D 1KJ2B 2VURA 4KK8C 4KVCH 4ZQOA 2GTQA 4JFPA 4N8VA 3N9KA 1SVBA 2GCYA 2ZKYA 4NP9A 5AVSB 4PS4H 5E4EB 3VAEA 3QGAC 4L3EE 4M7KL 1YXDA 3RCYA 1E8WA 2CHXA 1BPVA 3U0PA 3PJUA 1Z9LA 4OCWH 4MVAA 2RDWA 3V1PA 1DJNA 5RUBA 4N2HA 2BMKB 4JYEA 4O50A 3O8XB 1IAMA 1QBMH 4JFOB 4QIRA 2AGJL 2VENA 2W79A 2O5XL 2F7IA 1UYQA 4D6FA 1C08B 2XZCH 3C5ZB 3VVVA 1QNPA 3EH1A 2Z1XA 1Q6OA 3FCTA 4J6RH 4ZTXA 4Y9BA 1OSPH 4U6HA 3TFKD 2Z00A 1YYMH 2XZ9A 4CNTA 1FCCA 1EO8L 2FX7H 2OXGA 5HI3D 1CDJA 3TOYA 2QJDA 3DRTB 2TRSA 3F5KA 1JZHA 1AS7A 1K5HA 3PGCA 2IEPA 3KDPB 1RVFL 1EGJH 3L4ZA 3QULA 1MG3C 4N0CC 2FTPA 1A6TB 1S3RA 3SGJA 3MSDA 1LOSA 4AX7A 1XIHA 3BGGA 5D7KD 3UDWC 1UR2A 2WBJB 3EOUA 4FQLL 3FGCA 3QQWA 2YAMA 2YLLA 4PL1A 1HN1A 2YAFA 2RALA 5GGQH 2NUYA 2WV3A 3P9WB 4IMLA 1UWYA 4ONGL 3PP7A 1TIWA 4PRPE 4DM2A 5IF0B 3MUUA 4CD6A 1MCBA 4J2XA 3ZIZA 1GGCH 4UTCA 4ESKA 2PWVA 3SGZA 3SUWA 2VLRA 2VXTH 1JV5A 1MF2H 5CGBA 3TNMA 4S3KA 3RWGA 3IS0X 4U1HB 3WFHB 1LT8A 3RM4A 2AITA 3GR4A 1UM6H 2KDYA 3D4GA 3VUAA 3ZQXA 1V7AA 4IG2B 4OIIL 4ZUTB 1R5VA 3V18A 3UR8A 3ZGHA 5D6DC 3VI3B 3Q3GB 4OZGA 2P8CA 5DCBA 1W3TA 5E9NA 3LA4A 5G4NA 3ZYOA 4PJFE 3O11B 4LF3B 1DE5A 1F8TL 2QQNL 4GP4B 4IRSC 5EOTA 4GUCA 2A74A 3GSWB 4YHML 2X6UA 2P50A 4WEVX 5F0MB 5FK9B 3KYOA 5CJQH 1ZHBB 4FQHA 2BP3A 3ROOA 4HN8A 3GBML 4OF8A 3RN6A 1X7QB 4F79A 5I1JL 2E5CA 4PUKA 4JFFE 4WO4A 1ITBB 4NWUL 6ALDA 3O8AA 3QRBA 3LN4A 4JGJA 2D69A 1A0QH 3WKNA 2WQUA 4JM2F 5FD0A 4DF9A 4W9CC 5EZOL 1GEQA 4LLDA 1EZSA 1G7LB 1JZFA 2PTDA 5EIIB 2OR9L 2GBTA 1YDVA 4H26B 1A4KA 4OGXH 4I18B 4QRTB 3CXBA 4QRUB 3UZVA 3GU9A 1MVFA 4MY9A 3F1QA 5LNSA 3L5JA 3VXOB 4F1SA 3PL6A 5EO0A 3CL7A 2XPGA 4J4PA 1GTEA 5CR1A 5MI0B 5T5FH 3OVPA 4GI4A 1BWVA 2IXVA 4R7OA 2GFBB 2YJLA 3N1GC 1T1XA 3F7LA 4D2NA 3P6LA 3W7HA 1WHPA 3MRFB 4HPHA 2PTWA 3ATDA 5G4WA 2PCPA 1I1YB 3PWNA 5LXGH 4ZQNA 5E7BA 3ARBD 2CZDA 1GGYA 3UFIA 3JUGA 1Y5WA 3PF3A 2P52A 5JXAL 3ZJKA 4MLJA 5C0IB 2P3EA 2JKAA 3QQ3A 2VGBA 3KXQA 1J8HD 2HB0A 4F93B 2GGEA 5D1QE 4BZ1L 2HRWA 2VEPA 3BDBA 5BRPA 1G7MA 3VW3L 2EDFA 4PFEA 1VPQA 3TZVB 3PPGA 3D0AA 3V4BA 4ZQCA 4MASA 4FPSA 4OCXL 3IS1X 1WZ1H 2JKXA 3O0LA 4PWFA 1QFUL 4EKXA 4RAHA 3S37X 3N06B 3MROB 3WNIA 3ZDYB 3I3DA 5D1ZC 1XIWD 2COQA 5D7KE 4A6YA 4F33B 3JZUA 1YEFL 1ZPLA 2YL6A 5E4EC 2FYVA 1C12B 3WD5L 1DVFD 3UAAA 4DGIL 1KFWA 4LYPA 4JFDE 2NX3A 3HOGA 4MJJA 1G9NL 2LHAA 1QBAA 4HALA 1YN7B 4TUJB 4JM2A 4JKLA 3BWWA 3CH0A 3OVRA 3SGUA 1EJOH 2HRPH 5IQ7H 2FJGB 3IGHX 3HC3L 5GHWL 1CMOA 1KPUB 1V10A 4P5MB 4YPJA 3STBA 4B7IA 5JHDD 1QW9A 2J43A 3HG3A 3SBRA 1LQAA 1SO4A 4QLKA 4RCXA 5LSMA 3QFDB 2EDYA 3CT7A 5SWUA 4NQCD 2OMWA 5JQHC 3BFQG 4W6YB 4ZNEA 3MRJA 5JLZB 4HQVA 5JOEA 5EMYA 2WXNA 2JV6A 5CJXC 2IKIA 5CPSA 3IEBA 2VDLB 3VG0H 1T04B 4G9DA 1M65A 4JO5A 4NO0D 3WLWD 4G1NA 5JPMA 4QDMA 4YVXA 4ODXB 2RACA 1TVPA 5G2WA 2IGTA 4NO5A 1CDBA 1SR0A 3BG9A 4PTVA 3E1ZA 4K3GA 4LLUB 5KVGE 3KPLB 3N1PC 1CFQB 3FT1A 2OMXB 3WUFA 2H45A 2DQFA 3ATEA 1ZE3C 3DX6A 4JFQB 3VYOA 4G2DA 4HD5A 4N9BA 1FBAA 1IAIL 1JF1A 3BWUC 2Y2TA 4LLWA 4UFMA 5I09A 3HPJA 3KWWA 5EIIG 43CAA 5ANHA 2R1XB 4J12A 4NIYE 1OYBA 3V0GA 4QD2E 3WD3A 4HF5H 3GQFA 3PCYA 3FRUB 5BXTA 3KBPA 3LN3A 2XSAA 1P84J 1CG9B 1XC4A 3UZJA 1EQWA 4X8CA 4ADIA 3GXTA 5DCCA 1S9YB 2R0ZH 3CXFA 1AODA 3H22A 4GY0A 4D2JA 2GTWB 2X6AA 5HINA 5EWIL 1IKFH 5INCA 3GMNB 1ZGDA 1G7JB 2G95A 4ZI8A 2G3FA 3GSNL 4YWGH 1IKNC 4KV5E 3TYDA 1PD0A 1T0NA 2Z4TA 4AIOA 5A16A 3BWZA 4HOXA 1NAMB 1EZUA 2WMHA 2GHWB 3A4WA 1U8IB 1U8CB 2B20A 2FZ3A 2R15A 5IB2A 1PCSA 3ATZA 3U6XS 3MP5A 3QUKA 5CF3A 4HZ1A 5K4XA 3VOCA 3WLBA 1QLRA 3CHQA 3DSFL 5T3ZE 3EH5B 1E6OL 5D2LB 1EJFA 4OT7A 1H5BC 3BLEA 4FXFA 3CX2A 5FW8A 2J2ZB 4P46C 2POZA 3C8HA 3QUYA 3R89A 3MGTA 3FCPA 2DMKA 3MV7A 3ZIYA 1W72L 4X98A 3QXAA 5D96B 3M0JA 2WUBL 2WXQA 3GT6A 3NXFA 2OSXA 3AM8A 4HJJL 2NUXA 2EYSB 4WO4C 2OV0A 3SDXE 3SY8A 4R7VA 5CKGA 2HWZL 4X5LA 2Q8BL 3PWUB 5DFWH 5TGBB 3ABLB 3H2FA 3MCG1 2GSGA 1J8SA 4QXGL 3MV9A 5IMMA 5D7JA 1V5XA 4ERSH 1MRCH 2CU9A 5IJDC 2ZYFA 4WX2A 1MFCH 5AWNL 3SPVA 4LL1A 3TEXA 2XU2A 2RJMA 5IHRA 1T7VA 5CMAB 4FFVC 4O4YL 5DJ0B 3W2DH 1T5AA 3NQ7A 4YN5A 1WS8A 4AQLA 1Q0YL 1W1IE 2DD8L 3HBPA 5DK3A 3W1ZA 4HPXA 1PVNA 3O3AA 3BLDA 3Q37A 2YARA 2ENPA 2A7PA 3TBVB 4XMPH 3PJWA 2J6WA 4W7VA 1ZPTA 1UZ8A 3N40P 4Q56A 4YZFF 1P4BH 4QTGA 5IFJA 1IEHA 1MJUH 3BJ91 5E99L 1G94A 5A95A 2IJ0C 2WW5A 1INEH 2YGQA 2UY7B 1MJJA 3UDWA 3ZSSA 3WJJC 4JR5A 3AU6A 1A4LA 3F7VB 3CYVA 1OHZA 1EFXB 4U1SB 2IO5A 4M7KH 3QMTA 1L0PA 1VZIA 4PMOA 2I85A 1KCVL 1B0GB 1I2PA 5D7JD 4LSDA 4FFYA 4Q2ZB 3OEXA 4HSNA 2XVGA 4KNUA 5BXFA 4L1XA 4UI2A 1VA9A 4IU2A 3DYMA 3QHFL 3X12B 3O4LD 3NR0A 5F8QC 4KK9D 1Q90A 2HVJA 4BH8B 2EH8H 3RTQA 4WGVB 5C07E 2N59A 5F1NB 2PLKA 4PRHB 4TV3A 4I77H 2F6XA 1OSPL 1AHKA 1U2YA 1N18A 4OJAA 3U7AA 3RB5A 3UMNA 3TJLA 2H32B 2QV5A 3GRWL 1U2HA 4M6OH 4TN9A 4Q9QH 1EOKA 1K5NB 3MJ9L 1AQFA 4XQ6A 1UXWB 1EGJL 1XMEB 3PUCA 2FWUA 4HMEA 3ZE1B 4YHNB 5I1IH 1MNSA 2G8ZA 1D7FA 1H5YA 2NQJA 1WFNA 4FAAB 3M8OL 1ET7A 2FT7A 1SZRA 3GDTA 1QEWB 5GGRY 5K3VA 3MC0A 5C9XA 2OKMA 2BSCA 2X89A 3EUUA 4IX2A 4PI0A 4JPQA 1UT9A 1ZANH 3HC4H 3NCYP 5EOCJ 2LV4A 3QR0A 3OGRA 4X6DF 1TPC1 2PO6C 2NY0D 1MPAL 1PKOA 2P0IA 3BD3A 3FQWA 5C7VA 3AIWA 1C16B 3FHEA 4ZUSB 1KC7A 3JUZA 1A3LH 3IMWA 1H1NA 1C9DA 5CHNA 2WCGA 3FOMA 3QTPA 3BUTA 3WXVL 3S3DB 3T0ED 2Y7LA 3VTAA 1H50A 4PTUB 3NCYS 1OX5A 3ZT5A 1TWWA 4LC6A 2X6BA 3BDYL 5EU6E 3ZR6A 3P9LB 1BJ1H 3QZWB 4CCCA 3E6FA 3TPKA 3GVGA 1XD1A 3WEAA 3DX0A 3GDMA 1WJ3A 2YXGA 2QADD 5M17A 3DU0A 4HGMA 4Z95L 1ACYH 3C5SB 1WKFA 3SJ3A 4M93C 1K7EA 1QRNE 3TVMC 4B4FA 3CN3A 3RHWK 5F3BA 2ZCHL 1YQVH 4PLOB 2PB1A 4GIPD 4PJCE 3ZL1A 1PQZA 4OGXL 3G9VA 3KP1A 3PWJB 5TFSL 4JY5L 2GSJA 1MF2L 2G4EA 2HA1A 1KKOA 2ETWA 3DX8B 2BSED 5KSUB 2ZBTA 5BXRA 2BOCA 2ZX7A 3AS2A 3GGWB 5INDB 3IJEB 1HYSD 2WBJA 5DC9B 3OTTA 5GQBA 1ZHNA 5IHUH 2C91A 4P7NA 2B77A 3FO9A 3T0XA 3IVKA 4UFIA 4JM2C 4CNSA 4O2CB 3VPLA 1S8DA 3UO1H 3A4DA 1ZV2A 3S34L 3C0QA 1CGSH 4FEZA 4FXGA 1UWXH 3HFML 1CL7I 2QQNH 3O81A 3AOFA 1MCWM 4O51B 4Y5XB 3BW2A 4PLKC 4CQBA 1YE4A 3SDCC 3IVTA 3GLDA 4PJEF 5CJQL 4J4PC 1KXQE 1HZLA 3OHXC 2K45A 4JFFA 3DGRA 4MXVF 1WEJL 1Q9KA 5T3XD 1Q0XH 1MWOA 1L7TL 4A55A 2DUZA 2XDFA 3ITGA 1P7KA 3EBAA 1I7RA 5AW9B 1PKQE 4OZGB 1L9OA 2DMCA 4NHCL 4EN3D 2RGLA 2XWRA 1KTBA 4C6OA 1NQ6A 5D9PA 4R97B 2WLMA 5HPMB 3ASWA 2ATSA 3DJSA 3NGFA 1CDIA 3FK3A 3QHTC 5FGBA 2X87A 5IB3B 3NSNA 4DF1A 2V2DA 3SYCA 2D3VA 1CFSB 5D7LD 1EQPA 4Z9KB 1UP0A 2ZTKA 4XN5A 1A6ZB 1WA1X 3B5TA 3L6FB 3E2SA 2BNQD 4QCEA 5GZOD 3CSGA 4R4BA 3RRAA 2BBFA 3CJPA 4NSKA 1CENA 2E7LA 3UZEC 4WWKD 3RI5K 3HC2A 3BP4A 1GAFL 4JG1L 5DEGB 1HDMA 3ILDA 1PHWA 1XIWB 3FT3A 3PBMA 1ZXQA 5CAKA 5F0PB 8FABB 3HC3H 2FEDD 2ESVD 4GLRI 2DWYA 5GHWH 5AAWC 5AZ2L 4ACPA 4Z5RA 3VGFA 4FA7B 2QULA 4JTSA 3W9EA 4J6IA 2C3WA 3UZQB 4MAVA 1QKZH 4KWUA 4BFNA 2EIJB 2PUQT 3RWGB 2ITDB 1J6OA 5LBSH 4E5TA 4J4PD 3CFEB 5DRWA 2X70A 1PYMA 1TG7A 1P4CA 3WQGA 3RX5A 1LDSA 2WOQA 3GR8A 3IRDA 4GY7A 1SJVA 1WZ1L 1XYCA 2J27A 3P5YA 1RQ5A 1HP4A 3VKJA 3VG0L 1YEKL 4A7VA 2R0KH 3F83A 4OCNC 3CWHA 4Q97A 1USZA 3AUAA 1HOCA 1JPGA 2NY3B 2Z3FA 4X6DA 1AH0A 4QAWA 2EG6A 1LEGB 1T89A 4JANA 2ZXAA 4A38A 3BUIA 3F05A 4FE9A 5D7IA 2NXGA 4IKJA 5C0CA 3GU2A 4TPRH 5HHVH 2AQVA 1DV7A 3G08B 5FGBC 2PF8A 1EJOL 1I1FB 3IMVA 3B7TA 1D7DA 3PV6A 3CPRA 3LGDA 4K38A 3RWCB 3KYOB 3N43B 1V7NH 4XUGA 3TYBA 3L9RB 1JOIA 3CDZB 4JJHA 1JYVA 4HOWA 1FDLL 3BZFB 3HMWH 4N2AA 2CM5A 4M7JH 3FW6A 4D9LL 5GRVL 3FS9A 4WXYA 3HRZA 4GKNA 4BFRA 1ZFJA 1F73A 1ML0A 1NBVH 2JV7A 4JDTH 4WWKC 3EWDA 3P5ZA 2BNRB 3FU9A 3PIQA 3LUTA 5EFFA 4Q4KA 4KESA 1ZUAX 2WVVA 4R7XA 4F7CA 2BC4B 1MREL 4HPYH 1ZBCA 4H6EA 1AXIB 4JTLA 2X42A 4F2ME 5K4ZA 4HGWB 4ADGA 3D39D 4G1MB 3WKQA 1KF9B 3DTUB 2WBJC 4IYKA 4Y16A 4C56E 4IOIA 1WDQA 3VFOB 2AC0A 1QFOA 1IAIH 3RA7H 1KT2B 1S5HB 2A74B 5BV7C 1C5DB 3B9KA 2CBTA 2Q5BA 4L8SA 1QLFA 3BH8B 2AAAA 4XNYH 5EORH 5T33H 3E0FA 2ATMA 1W9DM 5I3KA 3DIVA 1E4XL 2VR2A 2XBTA 3EGSA 4BKNA 4XP4H 5KTEH 3BD5A 4NQUA 2H3BA 5K7JA 3TZVA 4U1LA 4E68A 1B4KA 3EX6A 2K6WA 2ZWYA 5I00A 5DGRA 1BAFH 3W86A 4G5DA 3DX4A 4UQDA 2E1DA 2V33A 2G37A 3BPNC 3TZFA 3BQUD 5IJVB 4PY8I 2XZ7A 2ED6A 1GZQA 1WFMA 5E8OB 1X6UA 4QY8B 1E3FA 3CL8A 5EGRA 4JFDB 4PUBL 3KVMA 4RRPM 3TJEL 1ELSA 1PTDA 2JJSC 5XINA 4AZCB 5HR7A 1ZT1B 2CJUL 1MFCL 3NCMA 5AWNH 4B9ZA 1W8NA 4DJFD 2CBVA 4FSAA 3S5LA 4CNNA 3KXFD 4N0UE 4O4YH 2CLZB 3NNTA 4FEIA 4HIEB 4M48L 1I82A 3O2VL 4IKNA 1KGYE 4HD9A 4BH7A 4LLMA 5DHYB 5D05A 2B0SH 5M2FX 4DCQB 1QLEH 3NIDB 1KPVA 2F53A 3V7AE 1YY8B 3B9KD 2D24A 2A3LA 1U92B 3M6YA 1FWSA 5JIWA 2F2HA 3EYUL 3CH8A 3C8KB 8A3HA 1U8OB 7REQA 2XIDA 1MCPH 5E08L 5JDSB 3VDHA 2Z8VC 3GS0A 3OB0H 4EDXB 2BJMH 3FT4B 4WFEE 4JN7A 3GI8H 3KM8A 2Z64C 4X5WB 5LLIC 3STLA 6FABH 5JNYA 2G2RB 1NCDL 4ZDHA 3QUZA 3ID7A 3SUSA 5IBXA 1TFPA 2ITCA 2NMSA 1TWDA 4JL1A 1K7FA 4UWMA 3ECUA 1Z9PA 2MKWA 5MHSD 2PR4H 3R1GH 5L88L 1MQRA 1D7BA 4AV4A 3HPFA 1X3WA 2ATKB 2TRHA 2Z92A 4WU5A 2GJXA 1A0QL 2EJ1A 1HHHB 2QFPA 2J6XA 3ES6B 3BKCH 4ETQB 3ZRFC 4PVLA 1Q4WA 2WWMD 4PRHD 3IV8A 3RX2A 2DUXA 3V6FA 1OP5K 2OK0L 3A4AA 2OJPA 3CFDB 3V4UH 1MHCA 2PP8A 4W9ZA 4UNLA 3V0HA 3TCLA 3WJWA 3GDBA 4J3SA 4LGSB 5D5MB 4S3GA 2OBGA 4GO6B 4A7SA 2QTEA 1EAPA 3IU4H 3O3AB 3Q8AA 4HCGA 4KMQA 4X5XA 1VF5C 4D0CB 1TPFA 4K5PA 4UR7A 2CERA 1CL7H 3WQ6A 2P5WE 3QV7A 2BDNL 1AXTH 3LAFA 2V9UA 4MZ3A 4Q4MA 3HRZC 3ZDZE 3NJFA 5EUOB 4UTBA 3WQVA 1OC5A 1FFTB 5E6UB 4IEFA 2G60L 3O6LL 3OHXB 3QIWC 4PCKA 4WEBL 1MPAH 1EEYB 1XSIA 3QHFH 1WOAA 1P7KB 1P1XA 3GG8A 3CIAA 4KZEH 4GQ0A 3TXVA 1OIMA 3JV4A 3NJIA 1LE9B 1KM3A 2OXNA 1MHHA 2XIBA 1J5SA 3GS7A 1G4RA 4G3YL 1KIQB 4NB7A 4QNPF 3B0PA 3WXVH 2ABAA 3N9RA 3BWAA 5D70L 2YS4A 4OCXH 4W84A 5LIKX 4IDJL 3QV6A 2WKJA 4F0MA 3RY5A 1KIRA 3P3UA 2AQ1A 3GUFA 2JCXA 1WQVT 4KTGA 1B3OA 1RKRA 5IR1B 1D5MA 1JV2B 5I19L 3C8NA 4WHBA 4WW1B 1KTJA 2YD8A 4X99B 3W70A 1PDKB 1S5IH 3IACA 1MCKA 2AMGA 3TEZA 1Q2RA 2PABA 3M8OH 4HLZH 3D07A 4ELME 1NEUA 4YBQD 3EJQA 2CDFB 1WA2X 4R0LA 2ARJA 1K8DA 2IH1A 1AFSA 1OZMA 1S38A 1CFVL 1AGCA 3V9FA 2PBOA 4OLYH 3LQAH 1K4DA 3HC4L 3QQ4B 1YQVL 4JM4H 1YTDA 2A1YA 2K0RA 2PGFA 4IU3A 3ZDYE 4EPKA 2PLTA 1E9LA 3R13A 3FS2A 2P49B 4NASA 4NYLB 5TE7H 3O4LE 3FQUB 2L7QA 2CQVA 1NBCA 1MJJB 3NH7L 4F2UA 2IWKA 3UZEA 1EJTC 3S8GB 1AHWA 4OGAC 1FZOB 3TA3D 1HW6A 3UEQA 2FQGA 3HFFA 4FMVA 1S5WA 1O7VA 4ZBCA 3NA9H 1H7PA 1BXCA 1ZWIB 3FDKA 2A9BA 1RALA 5BO0D 1XH3B 1V02A 2ADJA 4UWQB 5I6NA 2BO0A 4NPJA 2X2GA 3PB2A 1LEGA 1QBLL 3VTMA 3E74A 1GKQA 1R3JB 1N8ZB 2ZOOA 1JNDA 1WAAE 2DT2A 1Q0XL 2MOQA 1MXDA 1PD1A 4Q8VA 5ANME 5FW6A 2VDLH 4OGYH 3VTTA 4JICA 5F1VA 2KUTA 4KAQH 3WE1A 2PLMA 2XFYA 2ZSWA 1BM7A 2VDRB 4K7PX 3UC2A 3S0PA 4LL9A 1Q85A 4BFBD 4DTGL 1PFOA 4UT6H 5FF3A 1OF0A 2YPLD 4DBDA 4HH9A 5AAWA 1MWAA 3QR3A 1UVQA 2YGYA 2DYPB 5KSAD 4I9TA 1IGYA 5T1KB 3O0RL 1HX0A 2VITA 3GW0A 3P93A 4GKNB 2BZNA 3R4IA 3V0SA 3CK0L 1KJ3H 3ZBMA 1O95A 7A3HA 3PZTA 3MRIA 5GZND 5D32A 3M1OA 5LCVL 1IKFL 3MR9A 4JTJA 2XWBA 5AZ1A 2FGLA 1BD2A 2QDVA 3GHBL 4P8XA 3T2QA 1K9DA 1CFNB 1T8XA 1V7ML 1A1MB 3CC5B 1VPOH 2MFNA 2OYMA 5ANMB 2PPGA 2VP8A 4TUFA 4J2PA 5GZOA 4QAIA 1S7QA 4MDRA 2F74B 4YXLH 4YDLB 1UR0A 4D6CA 4GRWB 4PUMA 3F7JA 3CZFA 4TMBA 3ZTJH 4LY8A 2YZ5A 1JWMA 2XRAH 4ZUSA 2IF7A 2EVIA 1CGYA 1R3IL 2G2NA 4OZGF 4QR7A 4JY8A 4Q2ZA 3TX4A 5AVTB 4Y9EA 5DQJB 3LBOA 5CILH 2HVBA 3FUDA 4EBQH 3N15A 5DLLA 2OTWA 2BRRL 2W94A 4MQ7A 3RL1B 1YEKH 2BLFA 3GYRA 2C15A 2V5JA 3WG6A 1T1WA 2ZP0T 3B3IA 1QPXA 2JLPA 3IETA 4I7ZC 1Y1UA 1OAXH 2BCKB 2FATL 2DZTA 3MYJB 4I5XA 3NSJA 2A0LC 5DHXB 5F2GA 1RUMH 5A2IH 4XP6H 2HKHL 2NXZC 5GZNA 4A66A 1O6SA 5ISZD 1JDAA 3CZKA 2FT6A 1HQRB 1B3IA 4V15A 4XPAL 2C13A 2N0MA 3LDBC 4WKXA 3SQOH 4ATWA 3PZNA 2XIMA 2JD2A 4JBSA 5FA3B 2X2JA 1U83A 1A6UL 4PFHA 4PH8A 1XG4A 4E9VA 2WXRA 2X4OB 2A6IB 5KSUA 2N7BA 4TSBH 3BARA 4RMQA 2PETA 2YBUA 3QIUC 4P5UA 3NCBB 4TOYL 3RI5F 2CLKA 3KBNA 1R5WB 1FGNL 3THMH 2WQDA 4NOFA 1CD1B 3F5JA 5CCKH 1SC5A 2J4WH 1Q9WA 2HVKA 2R0KL 3LDBB 1OF2A 2Q8ZA 2BVPA 3NJVA 3QZOA 3UADA 4LSRH 4O54A 1FNHA 1GW9A 3RMEA 4PB5A 3TN5A 3QDMD 1FVEB 5C08A 4BQ6A 1TZZA 4D0DB 2PSNA 4WY0B 3W7OA 2VMJA 4W85A 3JSZA 4X5WA 3ZY7A 3M17B 1RVGA 4GBUA 4AWSA 2B31A 1F7BA 2EDEA 3V79C 4MRCA 4PM1A 4X6EA 3EOAA 3D39A 3NQ6A 5IMLB 1BVNT 4AUJA 3DO4A 4CN4A 4QNWA 2OLSA 2AXGB 5KJRL 2EUVA 4XNZB 4NKQB 2PO6A 3FYPA 1FDLH 2X28A 4PJXF 4PMZA 4YO0A 1G9EA 3HZYA 2WSDA 3IJLA 2Y1GA 3Q43A 3WQSB 1ZLDA 5C0BE 4JPWL 5FEBA 4HFWA 4N6RA 3ARBC 6TAAA 5KYXA 4Z7NB 1R38A 3PUEA 5FLUA 5D2NC 3GZKA 1FHUA 2YBRA 1GUVA 1YLVA 2CBMA 4V2BA 1D9KC 3I50L 1F6LL 4WI8A 2FHCA 5TQ2L 3TJEH 3U82B 3AWEA 3D12B 3MKVA 2PD9A 2XFRA 5IBTH 3TVMB 3JVFC 1TITA 3F5WA 1DBMH 2FUQA 3HQ1A 4JPIA 3HTWA 5HNHA 4JTDA 3P4MA 3KVJA 1XQ4A 3GZOA 1NGYB 4I13B 1IRAY 1IBGH 2HT4C 3BZ4A 2W5PA 3ILPB 3W26A 1DLHB 3PL6C 3ZO0A 5FSDC 4KUCF 4EWND 3QUYD 3VCLB 3VG9B 3UJIH 1HKLL 2JEPA 2C16A 3OLIA 3FJ4A 1E4XH 1M71B 2X3CA 5J1AA 4QEHA 3RPDA 3VIKA 2VD9A 4MNGB 2QQLL 1BXVA 5JPNA 3EAUA 3L12A 1A3LL 4MJ5A 5FGCB 2NY5L 2ZE0A 2WO5A 1WCBB 4L1DA 4P57B 4JZNB 2VC9A 1NAL1 3WYZA 2VYRE 3BWUF 5J6SA 4MGGA 5M94B 1NCDH 1U95B 1UZ6F 1U91A 3AXIA 4PD4K 3SZKC 5DLML 1GMEA 4K3JH 1CE6B 4M1RA 4XN2A 3PREA 3GH5A 2ARJB 4ZFOL 3OU8A 4GSRA 1KBLA 3CU2A 4FJZA 4Z95H 1ACYL 3PPEA 2R2CA 1MJ8L 3HE6D 1JDDA 4TRPL 5EU4A 1I8IB 1L3WA 3U4BL 3UPCA 3WFBL 4AV5A 5C7XH 1H41A 3SE4A 4JFZL 4L80A 1SYVA 5DO2C 4W86A 3CX5J 3W27A 5EZLB 1BGXH 1J5CA 3A3YB 3OKDB 3ZM8A 1GOKA 2WLLB 1P5VA 3EYUH 5IVOA 2V2WB 4XMLH 2OLAA 1U8PB 1P6CA 1Q2SA 2VYOA 3J27A 3L2LA 2C3ZA 3AREC 3MBEA 4JX4A 1CGSL 2BASA 4WFGD 5FKPA 3TFKC 4GZIA 3EFDL 4FTVB 1A2YB 1P5UA 2GJ6A 3MLZH 4IOFD 5L2JA 3ARRA 2G4FA 2O5YH 5IGXH 2A6KB 4FXSA 3UACA 1HEHC 3EYOA 3KPQB 4FRWA 1BZ7B 1GGUA 2WBGA 4UCGA 2FIKA 3AITA 3IJ8A 4ZMOA 3N6JA 1J87A 3AU1A 2RHEA 1JMXA 4PRPD 2DOCA 3QY8A 4W9IC 4TM9A 2DIAA 4KRTA 2EGHA 3VB9A 1R86A 5CBBA 1CICB 3BQUC 2UWEF 3NCCB 5BMFL 1MDRA 3MRLB 1MNZA 5F4XA 1F3JB 3M0VA 2CBOA 5T3XL 5IOKA 1J8KA 5IM51 3FTGA 3C56A 4KY2A 2FIRT 2XZQH 2PTVA 4AR9A 3MR9B 3RWHA 4XWGH 2YXMA 2ZONA 3WQWA 3N85L 3UROR 3V5DA 4R9XA 4ACTA 5IQNA 1LQ2A 4G1KA 3U1SH 3PAZA 1OT4A 3O16A 2YN3A 3SY6A 3WCYA 1FIGL 1DSFL 4AD2A 4JKPL 1NFDA 2DQGH 3VSTA 4PTNA 5C0BD 2E6FA 3DFQA 3WIHA 2EZ0D 1PTGA 1TQWA 3D47A 4N8VB 3I6RA 2GCYB 3R0KA 1IYXA 1RAKA 4MWAB 3WJYA 5BVPL 5LBSL 5HBBA 1YTEA 3A9IA 1ZT7A 3UXKA 3CPLB 2CDEA 3V6OE 2WXKA 3IM1A 5DJ8A 1B4TA 1AI1H 2OMVB 2CDGB 2G5RA 4R9OA 2PDBA 3CAFA 4PJFA 1E27A 5F6IB 3L3DA 3HPLA 4DPPA 5BZXA 1RSYA 1EAJA 3T8VA 4AYSA 2BNRD 2IMRA 2VGFA 1QUNA 1JMZA 4A8LA 3HFYA 1ZAJA 3KAAA 3QEQB 4WVRA 4U6YB 4OZIB 4XP1H 1TSRA 1H8LA 5HHXL 2L7UA 5AYUL 4JRWA 1VESA 4WOQA 1A22B 1LLAA 5LN4A 4RQQA 4JD4A 5FPIA 2O4MA 3KZPA 3W00A 3N3EA 4Z7NE 3MHUA 4DTGH 2HRGA 4GG8A 4QHNA 1AO7A 1J05B 1V3MA 4K9EC 4YGAB 5AYIA 3SDXF 4DELA 4Y6RA 3PWVA 2QLVB 4ES8A 3V95A 2VWEC 3D51A 3GIYA 4JPVL 5B1CA 4EN2A 1C8YA 3OGVA 4W1TA 5C3LD 1JGDA 4FNQA 2RGSA 3CBWA 1TX0A 1SG7A 1NBVL 2HQAA 1FP8A 4LS2A 2H0PA 3WLOA 2Y9RT 3OC8A 3VU1A 3VVWA 5I0ZA 1BVNP 1OX4A 2GJJA 1V7MH 4U0RB 1DKWA 2IANA 4NAEA 3FPXA 4JREB 2DZSA 3I6EA 3HE7D 3L8QA 5L2KD 2IFGA 1RLBA 2F5BL 2MAPA 2E86A 4N1EA 5I74C 5LUMA 1W1VA 3M0YA 1P6BA 4HCDA 2VUOA 3O8XA 4AW4A 4NQXA 1QRKA 4Z0XB 1MHHB 2BHUA 4DLFA 5C09A 1WYIA 4Y4HA 3OZOA 3VB8A 5FJRA 3C5ZA 1FE8H 2IVFC 2PODA 3N4AA 4GIOA 4NZ4A 4UT6L 5F3HA 4KMLB 3BVNA 2QAPA 4AYMC 5GZOC 2BNUA 3PULA 2GFTA 1O0VA 4AWUA 2NOYA 4Y2OB 3O0RH 1JV2A 1IC7L 2CHNA 1ODUA 1UQSA 1EMTL 4KHTH 3U7YL 3WJLA 4BUHA 4IBVA 4ODBD 1NDVA 4M3KB 1U3JA 4FQIH 5IIEA 4YNYA 3FUMA 1RFDL 5K9KA 1XSOA 3TCLB 4HV8A 1JHKH 1NQBA 2I25N 3R06A 4LEXL 3SQOL 3TJHC 1O7SA 1L6GA 5JORB 4TXVB 3I02B 4N9GA 1CI1A 1YPZA 4JRFA 1TRIA 4MA1B 1R0AH 4M48H 5B7ZA 5C2UB 3GLCA 3MNMA 4L6DA 5HANA 5MEND 1BM3L 2MQGA 4PRWA 3GSVB 1UB6B 3FFDB 4Z78B 3VOIA 2YPLE 3QNYB 4JHWH 3SDCD 2E09A 3BVDB 4G6FB 3Q94A 2FB3A 1LK3L 4YHZH 3JSSA 1ZSDB 1HGYA 2ISSA 3DIPA 5JAZA 1NGWB 5DULA 2GBVA 1TB3A 4LCVA 4DIXA 3DERA 5E8EB 1HIMH 1R0LA 2F9BT 3ZHNA 5HYSB 5JHDA 1L2UA 3U9UB 1OP4A 2R23B 1CIDA 5AVYB 3TJXA 2VOMA 1DO6A 4LBSA 5E08H 2ICWB 3AZRA 2YW3A 3HF3A 3O6YX 4B90A 3UGVA 4QIUA 4U3SB 3BOLA 5D6DA 3H2MA 3KMDA 4WKAA 2N56A 1EL3A 4R5XA 1KLGB 3EJYC 2UY2A 2REQA 1AVAA 1OTUD 1A6TA 2DQUH 2GTZA 4GFXA 4XPAH 1R75A 1D5IH 3QIWB 4R83A 1IGWA 1YEIH 4NGHH 3GMLA 2UXGA 2Q20A 2I1OA 4Q14A 3RVTD 5AOIA 1LO4L 1OSEA 3R1GL 5IHBA 5L88H 2NX1A 2WINB 3U30C 3L4TA 4NZDA 2GIXA 3EJJX 1FCVA 4J8RB 3BXNB 2QADB 4E41E 2ZCGA 1P1ZA 2Z0UA 5HDBB 3HB3C 4J2MA 1FZKA 3KGUA 4XCCL 5HHPA 4LYRA 1OE3A 5DJYB 2ZJSH 5CSGA 4LKXB 1TOXA 4HUVB 4MYWB 3S7GA 3G6MA 2VITB 1W1B1 4IG2A 1A4AA 5AQ0A 4L1GA 4WDTA 4PW4A 4G5ZH 2YQGA 5DS2A 3UJ2A 1XICA 4GO9A 4GY4A 4U5KA 4ZS7L 3ES8A 2Y36H 4WWNA 1PYWA 3T9PA 4N24A 3OG4B 4H1LB 5J3HD 2BDNH 2JK5A 2BOFX 4D72A 2N01B 5CR8A 3TNNA 5G5DA 2V6HA 4FF9A 3G1YA 4QDWA 3ZR4A 5ABAA 3CNKA 4NJHA 3D85D 4LPUA 5A6TC 2QSQA 3UD6A 2GOKA 2OO0A 4QHMA 1UATA 1A7QL 3MRRB 4M43H 1HJUA 5GGVH 4CAGA 1KY6A 1J2WA 4A3QA 1HNGA 4ZSOA 3UPBA 5DVLA 1FYTA 4HS8L 2DQFB 3DX6B 2OX5B 4JPKL 4KH9A 3IJ7A 5EF2A 2YDAA 3JZ7A 4UFHA 5HGDA 4G3YH 1KTKE 4NENB 4WZ9A 3T8LA 4P23A 4G43B 1G1OA 3T9WA 4ZW6A 3K2UH 5DJDA 4HH9B 3O6FC 4LRIA 1OOAA 2ASHA 4JNYA 4Q8UA 2XPGB 2CBQA 3ABQA 5EMLA 2E7MA 4FALA 1VHNA 3DHFA 1UKTA 1C12A 4OH2A 3IFNH 1SN2A 5F70A 3W11D 1B1YA 2R2BB 4MFDA 3HZYB 2A9NL 3TQVA 1XEDA 1SM3L 5AW8B 1Z5LA 2YA0A 3ZLGA 3H9SD 3ECQA 3AXHA 2ZIDA 4YPGB 2Q86A 4E9TA 2YWYA 3KPSB 4ANUA 1EPVA 2ADFL 4OLYL 4MSSA 4KX9A 5JA8B 1NCIA 5FHBH 4LALA 5GGRB 4GT7A 1EZWA 3V5OA 5JC1A 1Q72L 3T09A 3PZVA 3SBFA 5FDWB 1OGBA 2BOEX 5TF1L 4EUPG 4XXCC 3FCUB 2NY5H 1MW2A 4LVOB 1B90A 1LO2H 1M6UA 1XIIA 3SDDA 1FVEA 3QISA 5C08B 1KDIA 2Y0SA 2Q10A 3UJTH 5DA4A 1LXMA 2POTA 4OV9A 4PMVA 5I07A 1DQMH 1EHNA 2YR3A 1I2NA 4NZUH 3ALFA 2YL5A 1DE4B 1CD8A 3NACH 4IJCA 4YL2A 3IAQA 1WIUA 3U1QA 2VKZG 4NDMA 2GK0A 3GAKA 1QBLH 3UERA 3UBPC 4BI6A 4BFAA 1J1PH 4NM8H 3BWSA 4S3CA 2DEPA 1WCBA 1W72A 4L4OA 3THQA 4M1GL 3QOKA 2QL1A 4G8FB 3WJMB 2J8UB 3CCHA 4KTDH 5KN5A 2NUTA 3PQYB 3ZGIA 3UBXB 4WCJA 2AV7B 1VYRA 2A1WH 5C0BB 4X5RA 3GMPB 1Z69A 3R8HA 1UACL 1ZAIA 2VO5A 3UTZB 3U46B 5J9PB 4W87A 5FJJA 4MJHA 1S2WA 5SWSD 3QXBA 2XZQL 3BISA 1KD0A 1KELL 1NSNL 2X2UA 4YVUA 3MRCB 2BVYA 2E9LA 4M61B 3NWRA 4PMRA 1UB5B 4E3VA 4FQXC 4P3DA 4XPBH 1W3HA 1IB5A 5K9OA 3GSMA 4K2UL 1H1ZA 5CZTA 2F7QA 2HLAB 5AVRB 2FX9H 4XPTH 3C60D 4OFIA 5JHAA 1AYOA 3EFOA 3ENEA 5I5MA 4GFTB 2MAOA 4OF7A 3W7PA 2Z2AA 3NAAH 4RWHA 1EWDA 2P8MB 4J3OF 3LEXB 3LKRA 3NEOA 1EYWA 3UGRA 2X4QA 1T1YA 4JAMA 4G42A 3GHEH 4F1ZA 2F15A 3GC5A 3MNZA 2E9IA 3CH1A 3AHXA 1PFCA 4U1GB 1IIHA 4ZQEA 2YKLL 2ALDA 1AI1L 4KPLA 5D1XE 2JQXA 1OVZA 4XRCA 4NJKA 2F53D 2VH5H 2WQPA 4UTWA 1XFBA 2ALWA 2EG8A 2XG9A 5BMFH 4XVOA 1FCQA 4C1NB 1YEDB 5F96H 3FTVA 4YHLL 3Q6GL 3BGFB 3OAZK 3BX7C 4ONHA 2V5MA 2X0HA 5E2UL 3ZE2E 4DF0A 5I30L 4XB8A 1O9VA 2CHZA 2KI6A 4S1RL 2DUAA 4JO4H 1F4XL 1BFTA 1G7UA 1TTIA 3O45B 1L6YA 2QCGA 2Z28A 1AQ0A 3SPVB 4P3CL 4PTMA 3WUZA 1NAMA 3Q2LA 2F58H 3REVB 2H8PA 3VX0A 3VWJA 1LJMA 5EG6C 1NBZA 3T0DA 2LQRA 4YEFA 4JEQA 4ZENA 1YY9C 3VFGH 1O9ZA 4AC1X 4DX3A 1KV3A 3E38A 3U4EA 1N8FA 1CYGA 2J56A 3LIUA 4KGLA 3F04A 3FTUA 4M6MH 2OYLA 3V5DB 3RZCA 1SYTA 3R5EA 2Q09A 1TG8A 3WHXB 1IUZA 3KTXA 3KPPB 4KRLB 1P0DA 2ZRYA 3MWCA 1N67A 1EFXA 3RPTA 7PAZA 2P46B 1NCGA 1TLKA 3L9CA 2HCZX 5CJ8A 4Q33A 1RU9H 4RZCA 3RL2A 4FZ8L 2FWOA 3ECVA 1COBA 2R7EA 3HLAA 1BF5A 4ZB5A 4NUJB 5CD5D 5DRXB 5DZVA 1T4KA 1OL0A 1O12A 2ZNWA 3GJEA 3PDGA 1EZVX 3QIBA 5AYUH 1BZ7A 5C86A 4M0XA 3QUYC 4PJCA 1E28A 3TV3H 5DEJA 1T04A 3G5YB 1FLRH 4Z2JA 2JD1A 3DARA 3TYZA 2IQTA 2YLHA 2P45B 1ED3B 2DQJL 1QVBA 1YUKB 2WMIA 1NGPH 1I8UA 2J1XA 1SU5A 3C6LC 3QVAA 4ZX3A 2B1HL 1PDZA 2HBXA 4HK7A 4NQDA 1T1RA 2PW2A 5DZOA 3EKLA 4O1AA 2O9OA 5CG0A 4DAGL 5EWIH 4M9PA 2CCRA 4FX7A 4LANA 2OX1A 4BZ2L 1W6WA 3CFKA 2QXWA 3VYNA 4WIQA 2K9UA 1W1YA 3L5AA 4KTEH 4TLUA 3B0XA 1GVIA 2HXAA 1ZHNB 5B4MD 4LNYA 3ABRA 3ARFC 1YKWA 5J04A 5D9SB 3OWEA 1BYPA 3A64A 3NQ2A 4LAZA 1JK9B 3GKWL 5FO7B 4PL2A 4LHUA 1JFHA 2WWOA 3QK0A 2OMAA 1WISA 1KEML 5FYJE 1FKXA 2WCSA 3QAZB 3S2AA 3T3PB 1HHJB 1Z3NA 1DQDL 1N0LA 2WM1A 2W81C 3N3TA 1UGKA 4US5D 4Q22A 4Z2LA 4KXDA 2LGNA 4DGUA 3MDUA 4G7RB 3V0AC 3ARGB 1HT6A 2OM5A 1YMHB 3SDCA 2AABH 3SGKA 4Z7OF 2CU0A 1AKJD 3WL1A 3CAKA 1EA9C 5C6MA 1IBBA 4YDKL 2J25A 1TMLA 2PF6A 3E6FB 4FFTA 2HWZH 1WT5A 3DTXA 5ETUA 3HI5H 2Z1WA 3R0UA 5GVJA 4U6YA 3M0KA 3W07A 2LABA 4GW5B 2VWEE 3HS8A 1H3GA 3VXNA 5J0BA 1H3VA 1MRCL 3NEEA 3P2TA 3O8XD 3H7UA 2UZYA 3B7SA 1RQHA 3ATBA 4QSHA 1T22A 1RLCL 1WFOA 2NW3A 5B7FA 3AS0A 5B22A 3QQNA 4R8WL 3TR9A 4FMFA 4P2OD 4IP7A 4OVXA 4KFNA 1VBRA 3IWVA 1DJXA 4CNOA 3S88H 2FWLB 4O2EB 4OF0A 3AIVA 1FXQA 4XAFA 4X4MA 5D7LB 1MJUL 5KZ6A 3APDA 1P0BA 3DX8A 1W1ZA 1I2RA 3IMSA 3VI4A 3EZJB 5DVNA 2F19L 2Y7GA 4YHKL 3NSMA 4YR6B 4YIQB 5E6SB 4OV6F 3CM4A 3URNA 3A06A 1JXKA 3CFIC 4GUHA 1IM3B 1FPTH 1J18A 2VAJA 2PYED 3F2LA 1B3ZA 1GZ1A 2QF7A 4MX7A 3E5PA 1MN4A 1SXAA 5DDHA 5E2JA 4HISA 3OO2A 4DNMA 4JIHA 5L4FA 2DQUL 1A3QA 2ISFA 4IWWA 2A4ZA 3VXPB 3QFGA 2RA1A 2XPZA 3U9WA 4IOTA 3QEQA 5T1KD 1LO4H 1RPXA 2JQMA 2O5YL 3I75A 4UQBA 1ITQA 2GJXB 2HUEA 4NFCA 4TUUA 5IOPB 2QELA 4JN1H 2XQYK 1D5BB 1X5MA 2YRZA 2EH8L 3MCLH 3CAWA 1VCBC 3JYCA 4N0CD 5ITBH 4IM4A 4CSTA 2CD0A 4UOQA 1J05A 3LV6A 2ZJSL 1YEEL 4XBJA 2J3SA 3EEGA 3B8IA 1AFVL 1FL5A 3NQGA 3T0BA 1RJRA 5HJYA 1CR9L 2EIZA 4NQVA 4Y2NA 3BT0A 5KSAC 2B7PA 1BJ8A 2ZKMX 3QEGL 1EEZB