4BKXA

The structure of hdac1 in complex with the dimeric elm2-sant domain of mta1 from the nurd complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
161
Chain Sequence
GEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METASTASIS-ASSOCIATED PROTEIN MTA1
publication title Class I Hdacs Share a Common Mechanism of Regulation by Inositol Phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 161
sequence length 169
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bkxA02
1.10.1740.200 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4bkxA01
1B72A 5K7ZA 1S7EA 2L7FP 1X2NA 3Q0UA 2DMUA 4EEFG 3GTJJ 2R7ZJ 5DS9A 5M3MJ 4DW6A 3I4MJ 3MVPA 4L5EA 5E3LA 3IH3A 4JX6A 2R5ZA 5EG0A 5F27A 1MBEA 4D5CA 4JX5A 1TWCJ 1Y1WJ 3FK7A 4I76A 2Y31A 2XGCA 2OF7A 2XGEA 2HOTA 2HXOA 3SJMA 1BL0A 1XC5A 1HDPA 2HQ5A 3GBGA 4GFBA 3BTLA 4UUSB 2DA5A 4RDUA 3JRBA 2IEKA 5C4JJ 3ZQLA 3TW7A 5JLXA 5IP9J 1U9OA 3S1NJ 1G2HA 2FJ1A 1XS9A 3PO3J 5F04A 4A3BJ 3H3VK 2EZIA 4MFEA 2LY9A 3OOUA 1ZTRA 5M5WJ 1QPIA 2K9QA 3BR3A 4J19A 3RQIA 4A3LJ 2IBDA 3JRIA 3BG5A 2FD5A 3S1QJ 2DA3A 5GPCA 4XRSA 4AYBN 3BR5A 3HBLA 4V2GA 2EZHA 5J1UA 5C3EJ 4W1UA 1W0UA 1F43A 1JUMA 1H8AC 3ZOBA 1TWFJ 4B4CA 4XICA 1WI3A 1T56A 3RZOJ 2CRGA 2M9HA 1VF9A 4A3KJ 1IDYA 5EGOB 2LLKA 3S2DJ 4XIDA 5IYBJ 1JTXA 4NDLA 2DA1A 2H8RA 2DMNA 2MW8A 1ZKGA 1GUUA 3F0CA 2O8KA 1AKHA 2ID6A 5FKKA 3QPLA 3UKGA 1JUSA 2WAQN 2DA7A 1XG1A 2E2IJ 5GP9A 3HOYJ 1TWGJ 2AHQA 4A3FJ 1OCTC 3IV5A 1FJLA 4MFDA 1YRNA 2ECBA 3OIOA 1Z77A 2JK3A 3Q0VA 1RESA 2TRTA 2XSDC 3TEDA 3HDDA 2COBA 2L9RA 2YUSA 2LKXA 2L7ZA 3SFIA 1ETKA 3JRGA 4Y7NJ 1IV6A 2XB0X 3HOUJ 1IUFA 4M3DA 2ID3A 3G1LA 2NOGA 1ZQ3P 3VPRA 4IHXA 1IGNA 3BG3A 1APLC 2LP0A 4BY1J 1MH4A 3BQYA 2OPTA 2JWTA 3JREA 2VUMJ 2G0EA 1UG2A 4MIMA 4XRSG 4IHWA 3BTJA 2NS8A 2NVXJ 1RKWA 4M3BA 5K7HA 5IOYA 4X6AJ 2E1OA 3DCFA 5FLVA 5F0FA 5IOZA 1AHDP 3MKLA 5E3OA 2X48A 3RZDJ 3GTGJ 2ME0A 3JRAA 1FIPA 1FTTA 4D7MA 4AC0A 2HOAA 5EZHA 5M5XJ 1GT0C 1A5JA 1FTZA 1EF4A 3FIWA 1PUFA 1ETQA 1BA5A 3O8GA 2M34A 2XRLA 3FKIJ 3B6AA 3CCYA 1U9NA 1UHSA 3TW6A 1JJ6C 1FEXA 2CQXA 1OJLA 1MBHA 2DA2A 3CMYA 1TWAJ 3GTMJ 1P7JA 5E3NA 5FJ8J 2R93J 3HOVJ 1LE8A 2Y2ZA 3GTLJ 2X6OA 2EH3A 2K9NA 4A3JJ 5F1JA 5BNGA 1ETVA 1MBKA 1ETOA 5EZGA 2B63J 4A3GJ 1RPWA 1B8IB 4DZJA 2I10A 2M0CA 3Q0WA 3BT9A 3FK6A 3IH2A 4FTHA 2HOSA 3S14J 4G12A 4XRMA 1JJ8C 5E3MA 3Q3SA 1WH7A 4A3CJ 3BR1A 4CYCB 1NK3P 2E19A 2KT0A 3A01B 5HODA 4M6VA 3HGYA 1A6IA 1NK2P 2DMTA 4LOCA 3I4NJ 1MH3A 5C4XJ 3M4OJ 1QVTA 3CDLA 2R0QC 4IHVA 1WCMJ 1GDTA 2GBYA 2FX0A 2JA6J 1P7IA 1ZGWA 1T33A 3E7LA 4UUTA 4C2MJ 2ME6A 4DYQA 2MGQA 2EQRA 5F08A 3LSGA 2HXIA 3HM5A 2AO9A 1D5YA 1SFOJ 4BBSJ 5IYCJ 3JR9A 2R5YB 1I50J 2H1KA 4JYKA 2KDZA 3RKQA 1B72B 2WB1N 1RETA 5FKLA 1IDZA 1VI0A 2JA5J 2NVYJ 2ELKA 2QF7A 3ZQCA 3NARA 2NVTJ 4S0HB 3LSPA 4C3JJ 5IYDJ 5K7FA 1JKOC 3A02A 3LSJA 2R5ZB 4B1RA 5EG0B 4FISA 1DU0A 1I6HJ 2P81A 1UMQA 3BR0A 4A93J 2CQQA 3JRFA 3S15J 4UUSA 3HOZJ 5J1RA 4A3DJ 1HDDC 3GTQJ 4MO7A 3HB9A 3BTCA 2XPUA 3LNQA 2DA6A 3D1NI 2GM4A 2N8GA 1GV5A 1ZR2A 2LD5A 4QSHA 1LFBA 1BJZA 2LVSA 3PO2J 3BR2A 3QQAA 1X58A 4DZPA 3WHBA 4M3EA 2FQ4A 4M3GA 2ECCA 1TWHJ 1SANA 1K83J 5IP6A 1H89C 2VPRA 5IPAA 2DA4A 2DMQA 4W97A 4FE7A 1MBGA 2X9DA 1WPKA 3FISA 5EF6A 3HOWJ 5FKMA 1ETYA 5FLMJ 1Q1VA 3SDGA 2K40A 4IEJA 3S1RJ 1IC8A 3B6CA 4A3EJ 4A3MJ 5FKNA 5EGOA 1K61A 4FE4A 2LR8A 3OSGA 3GTPJ 4BY7J 1ZK8A 3NAUA 2YS9A 1LFUP 3ZQIA 1H88C 3K2AA 4Y52J 3L1PA 2E2HJ 3OSFA 4FCYA 4V2FA 2ZB9A 4D5FA 3BTIA 1AKHB 2Y9ZA 2K9SA 2L7MP 3S17J 2JN6A 2W48A 1X2MA 3ZQHA 1O4XA 2DN0A 2D5VA 2CU7A 4A3IJ 2DTZA 2Y9YA 2JA8J 1YRNB 1E3OC 5EDNA 3IH4A 1MSFC 1ENHA 2XPWA 1WGXA 1JGGA 2RAEA 2PMZN 3C2BA 1W0TA 2JJ7A 1WH5A 1ITYA 1JKQC 2CJJA 3JRCA 4A69C 1I3QJ 4BXXJ 1HCRA 3M3YJ 5J1YA 1NTCA 4IHYA 2MG4A 4AUXA 3G1OA 4BKXA 5F0CA 4QIWN 1MSEC 2O9LA 1F36A 1OCPA 1MBJA 4B3AA 4M3FA 2LFBA 2EZKA 2M2EA 2M8GX 5FKOA 1BW5A 3S2HJ 3HKZN 2NS7A 2R92J 2HI3A 2L0KA 1FIAA 2CUFA 1GVDA 1U8BA 1QVUA 2WV1A 4HNVA 1IJWC 5J3LA 1ETWA 2O7OA 1BW6A 3H0GJ 4ABZA 4BBRJ 3DEWA 3TP0A 5IP7J 4RBOA 3G1MA 3BR6A 3LSRA 2LK2A 1RKTA 1RR7A 3CQZJ 3MN2A 2VI6A 1JT6A 4C3HJ 5M3FJ 2Y30A 4X1EA 2XGDA 1HOMA 4MLOA 3A03A 1PUFB 1CQTA 3S16J 4DYCA 1JKPC 2DJNA 2CUEA 2EZLA 2JMWA 3PM1A 4D7NA 1MBFA 1ZR4A 1GV2A 2HDDA 1U78A 3BQZA 2TCTA 4XK4A 4DYRA 1LE8B 4C3IJ 2JA7J 3HOXJ 2VKVA 1B8IA 3S1MJ 1HF0A 3JRHA 4QTRA 1Z0XA 2Y0SN 2VKEA 9ANTA 2XPVA 1ORKA 1ETXA 1Y1VJ 3LOCA 3W6VA 3O8HA 5EYRA 4I6ZA 1QRYA 5DTDA 2YU9J 5JLWA 2LTPA 2E2JJ 4CYCA 4JX4A 5C44J 3A01A 3QPSA 1IRZA 3ZQGA 3TP3A 1JT0A 3GTOJ 1JTYA 5GPAA 2NVQJ 3WHCA 2QCOA 3ZQFA 1JKRC 2HYJA 3K7AJ 2DMPA 5M5YJ 1R9TJ 1OFCX 1VFCA 2IAIA 1HLVA 3BG9A 5F0HA 1MNMC 1TC3C 1IG7A 1DU6A 1AU7A 1VNDA 2MSYA 3HGGA 2R5YA 4JP0A 3JRDA 1POGA 1JUPA 3HEFA 2GLOA 2EBIA 5EEAA 2XB5A 3GTKJ
chains in the Genus database with same CATH superfamily
4F92B 1BC7C 2JV7A 3B34A 3F3XA 2A07F 1FNNA 2FEZA 1X2NA 5F6FA 3AUAA 1K78A 2JQ7A 2DMUA 3GTJJ 1U5TB 3AU8A 3OYBA 5DS9A 1ZYRF 3I4MJ 1XSVA 5AIPA 4KMUX 1QZZA 4ITVA 2A6EF 4JX6A 5H20A 3RPUA 2R5ZA 4XKCA 3V8JA 4D5CA 1VQMI 2ZSIB 1TWCJ 4B47A 3GVAA 3FM5A 1QPMA 5FD6A 4I0AA 2HXOA 1XDSA 3SJMA 1JE8A 1BL0A 2NRAC 1T0FC 1OYYA 2K5CA 4RM3A 2X4HA 4EMSA 3CCVI 2O6GE 4Q47A 3DLLF 1TW2A 1YE9A 5C4JJ 1MMSA 3P9KA 1EJ9A 1G2HA 5GAHJ 4HAMA 2D2WA 3ZN0A 1VQOI 3ZI0A 1OKRA 2NNNA 2LY9A 5LLQA 3PJRA 2Y48A 1ZTRA 4PJ0C 3OYAA 2K9QA 4CCOA 2RGVA 2X51A 4XN4A 3K70C 2V79A 4XLHA 1I27A 2FD5A 5HLTA 3MKWB 2B61A 3V4GA 1IUYA 3FTUA 4XRSA 3VYSB 3DPLC 4AR8A 4ZTJA 2QLZA 3LFKA 3JAMZ 1W0UA 2GTQA 1JUMA 2L9VA 4A2UA 4QIRA 5DM6F 1A36A 1RRJA 2F5EA 1WI3A 2VJIA 2V1UA 1VF9A 1IF1A 1BJAA 1IDYA 5LRSA 2RQQA 4OOEA 5E79C 2PI0A 4Z2YA 4KIBA 1Z21A 3WTWC 5FD5A 1Y8QB 2QWWA 1S7AA 2LKSA 2VXZA 1I1SA 1HSTA 1GUUA 1FOXA 4ZDOA 2RQPA 4K5OA 4XQFA 3FM3A 1R0LA 2WAQN 3MWMA 2A69F 2RC4A 4ANJA 3P9IA 3TKYA 2DJIA 2V1DA 1Z67A 2AHQA 4BGDA 4ZC3A 3IV5A 1YRNA 3KYCB 2LBFB 3VWBA 2ECBA 3Q0VA 1RESA 2TRTA 4LB6B 2CO5A 3LAPA 4FLQA 2YUSA 3HIFA 1SD6A 2L7ZA 1ETKA 3JRGA 2QBYA 3ROUA 4Y7NJ 2XB0X 3HPHA 1DP7P 3ELKA 3OYEA 2NOGA 3VPRA 1IGNA 3MKZA 1MH4A 5CVRA 1MJAA 3RKYA 4H0EA 2JWTA 1YW7A 4QPOA 5DCFA 5HVQC 2AS5F 2V9PA 4IHWA 4ETSA 1YHQI 3Q9VA 1FP1D 2XUBA 3F22A 1BIBA 3I71A 3KP4A 2JCXA 3E0JB 5K7HA 4CCLA 5IOYA 5B1BH 3JTHA 2OUMA 3DCFA 3K1NA 3D5SC 2BOLA 1S5LC 4P1WA 3MKLA 1BC8C 3U9WA 2FBHA 2X48A 4BACA 4FX4A 4PVBA 4RAYA 2GZWA 3OS1A 1HW2A 5E20A 2OBPA 2EWNA 1MW2A 3JRAA 1FIPA 4Y17A 1F1ZA 1FTTA 2JTVA 4AD9A 1X3ZB 1TZLA 2IGMA 2HOAA 4ZJZA 2JD0A 1Q0HA 3S3NA 1MNDA 1D8JA 1R4NB 3AG4H 1UFMA 1EF4A 4G6QA 4U7BA 5E8IA 1KU7A 1X1PA 2WTEA 3FKIJ 3CCYA 4IOCF 1JJ6C 3TW6A 3FU5A 2I8DA 1WHUA 3KP3A 2GXAA 1MBHA 1UCRA 2VT2A 3O2PE 3CMYA 4CGZA 5D6EA 4X2UA 3DXJF 3KFWX 5FJ8J 4A0ZA 1WJBA 3HOVJ 1H19A 2E35A 2QKLB 3ERMA 1LE8A 4M6YA 2R7TA 4G6DA 2R7FA 3OYLA 1LPQA 3MZYA 2M30A 3KZZA 4BQOA 1FWZA 4DPRA 1O7FA 2NNYA 3K4NA 3WE3A 2FF4A 3CC7I 2EH3A 2K9NA 4K5LA 4A3JJ 3UEQA 3BOQA 5F1JA 4PFPA 5BNGA 1MBKA 2V9VA 4A6EA 4CDGA 3HRUA 1RPWA 2CV1A 2VOOA 4DZJA 4DIQA 1R5HA 4ZYDA 3KZIC 1G59A 1I6XA 2WWYA 3DQVC 3BT9A 3BPXA 2ZNYA 3IH2A 2XAHA 2DK8A 4S05A 3S14J 3B7SA 4DGWB 1YYVA 5E1XA 3JCUC 3Q3SA 5KCMA 2MAPA 4A3CJ 3ZHZA 4OAZA 3GMEA 4RM2A 1NK3P 2DOEA 4LJZF 4MNUA 5HODA 4NQWB 3HGYA 3AL0B 2BVMA 2PL5A 1A6IA 1NK2P 2DMTA 2IS6A 4R79A 3I4NJ 3GFLA 1C0WA 1LJ9A 1QVTA 2W82A 3CDLA 2R59A 4IHVA 5HDGA 2WB1A 1ZGWA 1T33A 2BXZA 3V8KA 1W5SA 4C30A 4CZZA 2VXDA 4Y13A 4LK1F 4C2MJ 2ME6A 5F08A 1G3TA 4XLEA 4AU7A 3OYHA 1FSHA 4I7HA 4UHTA 4V19K 3I3LA 1D5YA 1XB4A 2AO9A 1G8XA 5IYCJ 4EJUA 1I50J 4RGSA 2QENA 3G2BA 2WC2A 3SEQA 4XLAA 4CUGA 3CCLI 4JYKA 4BE1A 2H1KA 2ADUA 3RKQA 2DODA 5E17F 3DBRB 1JG9A 1YLFA 1KZHA 5H2FC 5LD2C 1VI0A 4BE2A 2NVYJ 2QF7A 2XASA 1P4AA 2LDUA 2NVTJ 5J8CA 4NHJA 3LSPA 2V26A 4BDZA 1R1UA 2BZTA 2AXLA 2E1MC 1PP8F 1LB2A 1HKQA 3A02A 3LSJA 5JC1A 5EG0B 1UAAA 4FISA 1USTA 4UVBA 1Y56A 4ENNA 1I6HJ 1S46A 4XNAA 3PUFA 4XOTA 2EIKH 3V42A 3E97A 3JRFA 1IXRC 3M8JA 4AM3A 5KVRA 1FYLA 2L9NA 1FSEA 1GXPA 2Y1EA 1NG6A 1BI0A 1Y0NA 3LNQA 2DA6A 2DQRA 4BAYA 3VVMA 4BJTA 3V7RA 3WTSC 1BN5A 3E6BA 2LD5A 1HC8A 3CUQB 4ZQEA 3KP5A 1LFBA 3PO2J 2L7KA 3WG7H 1ZARA 3SFZA 4L0YB 1YW9A 4HV6A 4NQWA 2A61A 2DOFA 4HEA2 2ZXGA 4OAYA 4XBFA 3GTKJ 1F9NA 1K83J 3RSNA 3C1DA 1DP3A 1H89C 2KRFA 3ZGKA 2IPQX 4M73A 4FE7A 2QVOA 4KYWA 3FUNA 2B9SA 3T5XA 2BBYA 1JXSA 3VSLA 5L3GA 2K40A 3BZKA 1D0XA 4IEJA 2IRFG 1SAUA 1K61A 3WTUC 4FE4A 2LR8A 3GTPJ 2QVWA 5E1ZB 1N75A 2OV7A 3DWLE 4Y3OA 3IKTA 1H88C 2DFHA 4EQQA 4F7ZA 4IL6C 5DDGA 1G3YA 4F3QA 3OSFA 5JI6A 3LSTA 5ED4A 3E3VA 2Z3YA 3CP2A 2LF7A 2GOXB 4ZW5A 5JAZA 2EFOA 4QMEA 2H09A 3ZQHA 1O4XA 2DN0A 2D5VA 3B2XA 1VQLI 4PW4A 2VKDA 5F64A 3K69A 1ENHA 1WGXA 1ZELA 2RAEA 2ZJPF 3RQ4A 1BI1A 2AQEA 2DPDA 4XMXA 3K70D 3HKZA 3BJOA 1T2KA 1I3QJ 4U0VA 4BXXJ 3JTGA 2BV6A 3OL4A 2MG4A 4AUXA 3WTZA 3ANLA 4GO1A 1MSEC 2FOWA 2O9LA 2VB6A 5K5QA 1GHCA 5ILVA 3FTSA 1F36A 4MS6A 1R22A 3W2VA 3F8CA 2LFBA 2EZKA 2M8GX 3MD2A 4PJNA 3A4CA 1BW5A 4A5MA 2UXXA 1SD7A 3G71I 2XPZA 4KMFA 3KP2A 4ZH4F 1X1DA 2L0KA 2CUFA 3K0LA 4J01A 2UWMA 5B3SH 1FBQA 1WJFA 1IJWC 4PUSA 4WWCA 5B66C 5FRNA 1W7PB 3RI4A 4BBRJ 3ZMUA 5AENA 4HX7A 3G1MA 2DCEA 1TNTA 2VI6A 4XKBA 2W25A 4Z6YA 1V5EA 5M3FJ 3FMQA 3RASA 2BY1A 3CLOA 3RIRA 4X1EA 2HYGD 4XN0A 4B44A 3A03A 4E70A 1LDJA 1PUFB 2ELJA 1SMYF 3ECHA 1KA8A 1LFPA 3B2PA 2Y0SA 4D7NA 2CUEA 3PM1A 5KK1A 2JVHA 1D3YA 1GV2A 1RNLA 3P5JA 4HF2A 1R4MB 1V3FA 2HWVA 2DT6A 2HDDA 2Q2EB 2LMDA 2CG4A 4F93B 1U78A 2A5YB 5LRRA 3SZPA 3L2CA 1R7JA 2JA7J 4QWQA 1SAXA 2VKVA 2R70A 1B8IA 2HGCA 2CS3A 3JRHA 3HG9A 4CO8A 1XGMA 4QTRA 2MD5A 4LFUA 5DUKA 4RS8A 2MAOA 3B3BA 2OD5A 4IHTA 3CZEA 4RAGA 1ETXA 3LOCA 2Y75A 5EYRA 5DTDA 1W1WE 2DT5A 2M5WA 2W1OA 2ZFWA 2E34A 3H9QA 3HRTA 4GYIA 1T39A 1FZPB 4ZW6A 4PZJA 2ZKZA 3QAHA 3F6VA 2JD2A 1WFXA 2OQRA 3QPSA 4IOAF 3FH8A 5K5RA 1MJBA 3OYCA 3U1DA 2FU4A 1SC7A 3WU1B 4FLRA 3ZQGA 3ABUA 2GOMA 3WQQA 3LA2A 2ZNZA 3U1KA 2Z5UA 5GPAA 3ZHYA 2LOOA 2X85A 3WHCA 3R61A 3GXOA 1XCBA 1J75A 1X3UA 2DMPA 2IA1A 2K85A 4RGUA 4E7JA 3E5XA 1OFCX 3K4KA 4QHPA 2IAIA 4PJMA 2R7XA 2F4OB 2AXTC 2R7OA 5LEJA 3F72A 3MKYB 4P96A 1DGWY 4ESBA 3CHOA 1YJWI 1AU7A 1FLIA 5D8KB 5LGNA 1OCRH 3NQOA 1FOKA 5HNHA 1POGA 3HEFA 3QWLA 3H1CA 5ERIA 2GLOA 1B72A 4U7DA 1ULYA 4GXOA 3ABMH 1T8IA 1ZG3A 5TJJA 1MW1A 3JSPA 3B73A 3PSIA 4OWRB 3VYTB 4EEFG 3B37A 4ZQFA 5M3MJ 2PGGA 3GO5A 3SXYA 3MVPA 5BQTA 5FLXK 2EB7A 2DQLA 3DP7A 3E6DA 3VODA 1IN4A 2GA2A 2LYCA 3HHGA 3TO9A 2XC7A 2Q0OA 1IRXA 2H6BA 3HC7A 3ZMSA 3K1MA 2C82A 1ON2A 2Q2EA 4RSYA 1IW7F 1Y0UA 4JX5A 5TRDA 1YOVB 4I76A 4U88A 2UZKA 2Y31A 1YTYA 3M1CA 2OF7A 2XGEA 4LUPA 4HBLA 4KIFA 1P6RA 3WU2C 2MD0A 2PMUA 1XC5A 1HDPA 3GLXA 1R00A 3OL3A 5ICCA 3GBGA 4XMVA 4FLOA 3C2HA 2BHZA 3OYKA 4Q48A 2A7OA 3MZ8A 3KYLA 2V9KA 3ZQLA 3TW7A 3EDPA 3GX4X 5IP9J 2HZTA 4I99C 4PSXA 1B1BA 4A3BJ 1U6GA 5DYFA 3A0BC 4HQEA 2EZIA 4MFEA 3U9GA 4BU2A 1QPIA 3CCQI 2NXNB 5JFRA 3RQIA 3FUKA 3JRIA 1ZAOA 2KPMA 3S1QJ 1YIOA 1VQNI 4IF4A 4AYBN 3FUIA 3I53A 1IO2A 2LH9A 2V4JC 3BR5A 3W3CA 2HDCA 4OIRF 3TO7A 1FOWA 2JZYA 2ZJ2A 2XAQA 3X2QH 4YFNF 2X1CA 2ZSHB 2GIVA 2CWEA 2DYSH 5DD4A 4L5IA 2M87A 2MFZA 2WY7Q 1GW6A 3B7TA 3ZQ7A 2FBIA 2H8WA 4L9TA 3S2DJ 4XIDA 1MW7A 2ZFUA 3ANNA 3N97A 1HKTA 4NDLA 2H8RA 3K4JA 3W6KB 3G4SI 1ZKGA 3FXJA 3F0CA 3TMOA 1AKHA 1K7AA 4CHUA 1D5VA 2UUZA 3UKGA 3ABLH 3R60A 5FLXZ 3F9KA 1MMGA 3ECOA 4AIJA 1Y8RB 2JPCA 2JRTA 3MFKA 2E2IJ 5GP9A 4X0GA 1TWGJ 3L09A 3ZMTA 4A3FJ 2J5PA 3PIPF 1OCTC 3PUBA 1FJLA 2HZDA 2GXBA 2LSOA 2V1XA 5LGUA 2RNJA 3FU3A 2JK3A 3LMMA 4P9UA 1STZA 1R1TA 4RGRA 1LDDA 1KYZA 3PQJA 3OIQA 1X19A 1QU3A 4PGGA 3HOUJ 4M3DA 1PVEA 2YSRA 1MNEA 2ID3A 5HLGA 1ZQ3P 2PLYA 4DJAA 4OINF 5DULA 4IHXA 4KT6A 4BY1J 3ABKH 4MGRA 5J47A 4D1QA 1TL8A 2X0LA 3RPUD 4Y4RA 3KEDA 2ELHA 3CHSA 3OYDA 2NVXJ 1RKWA 3VEPA 4JQFA 2ZXJA 3I58A 4KP7A 4E7LA 5JMPA 1WJDA 5BMZA 2F4IA 2ZO4A 2LG4A 3CJTB 1XCVA 1AHDP 5DUIA 4ESJA 1YX5A 2VN2A 3RZDJ 4FLSA 4WK8F 1XMKA 3GTGJ 4HA8A 3L00A 5CKTA 3IL2A 5HLIA 4D7MA 1UHMA 3K4CA 2MA3A 2F6CA 4PDKA 3DTIA 4AC0A 1ZG1A 1Z7UA 2KISA 2XKOA 5EZHA 4BEHA 1GT0C 4LLLA 1TQMA 2FOKA 2W85A 4A03A 1V4RA 2E5NA 1ETQA 2LY2A 2HVRA 3HHHA 3OYJA 4XO5A 2VONA 4XN2A 5CLSA 1DPUA 1U9NA 3HSRA 2MABA 1FEXA 1V54H 1FX7A 2Y1GA 1OJLA 2DA2A 1Z1DA 2K3PA 3ANMA 2ZCWA 4IJAA 2GWRA 2B7EA 4BDYA 3WG9A 4LG0B 3NRVA 2XAUA 4GGGA 2X6OA 2IS4A 4K5NA 2ICWG 1TT5B 3J7AY 2QQAA 2P8TA 5L3FA 1RC9A 1ZLKA 2PX9A 3P7NA 4AVZA 4EGZA 1ETOA 2K9LA 1U0JA 4KN7X 4F91B 3A0HC 2I10A 4KDPA 1BBYA 1MMNA 2KIFA 1K5HA 2UXNA 2DOAA 5KAFC 3CCSI 2PBIA 3M07A 4HF1A 3LSHA 1MDMB 4G12A 2HKOA 4YELA 1M1EB 2L54A 4RB0A 4XRMA 2PQ8A 3DBHB 3IP4B 5GAEJ 3OYNA 1RR8C 3BDDA 3W6JB 2XF7A 4CYCB 1XDUA 2HU9A 3CHQA 4ZYEA 4M6VA 2D45A 3ISPA 3S3OA 2DQMA 4LOCA 4UV9A 5GADJ 3MMYB 5C4XJ 1A04A 2CH0A 3T1BA 5D8LB 5A2QK 3M4OJ 2QZ8A 3I4PA 1HBXG 1GDTA 2GBYA 2JA6J 1P7IA 2R7SA 1X3WA 3E7LA 4UUTA 5CQGA 4HQMA 1FOYA 4YG2F 5CQEA 3DF8A 4DYQA 3LSGA 4RVBA 1DUXC 2V6CA 3F8FA 2HTJA 3HM5A 3QYBA 4PJLA 1D1BA 4CSWA 4L0ZB 2R5YB 4JK1X 3CDIA 4KISA 3L9FA 2JCVA 3K2ZA 2BW3B 3OY9A 4IO9F 2E71A 3GWZA 1U5TA 1Y39A 1FY7A 2MC4A 4IQJA 2OCEA 1IDZA 3ZR8X 3WGHA 3VFZA 2IP2A 3KPHA 3VYUB 4S0HB 4CXFA 1IZ1A 1BR4A 3T8RA 2L4MA 3FUJA 2Y69H 4IZZA 4ZX3A 3I9V2 3GEZA 5IYDJ 4Y6PA 2EA4A 2ZJQF 1ONOA 1S6LA 2PJPA 5L3CA 2R72A 1DU0A 1KQ0A 1B6AA 1F5TA 3KEQA 4XN1A 4M9ZA 2P81A 4JBAA 5L3DA 1YG2A 4IX7A 4A93J 3AG2H 3BJ6A 4XMTA 3OR1C 1EA3A 1T08B 1LKXA 3HOZJ 3OYMA 1JGSA 4H4KC 3CTAA 5EJCA 1BOBA 5ICGA 4A3DJ 3DBLB 1B4AA 3BTCA 2K02A 2ZXIA 4G94A 5JR3A 3F23A 3LQRA 3T8VA 4YEJA 2N8GA 1ONVA 2VC0A 1GV5A 1G3WA 1WZ2A 1DDNA 2EILH 1BJZA 2KMUA 4HSRA 2EPFA 4XSXF 3C3WA 4DZPA 4BQAA 4QPEA 2IGNA 1W36D 4HX4A 4M3EA 3HPGA 1D0YA 5A2QZ 1KQ9A 1TWHJ 4K2EA 4Y6RA 1SANA 5IP6A 2BXYA 1BM9A 2VPRA 5IPAA 3OR2C 2FQ3A 2VOPA 2QSFX 1FT9A 1MBGA 3R0AA 1MW0A 1WPKA 2PMHA 2RJIA 4BHCA 4UV8A 4LIUA 1Q1VA 5BOXA 3T8TA 1SFKA 1IC8A 4L2LA 3RJPA 3AG1H 4HYEA 4KJZA 1K4TA 3EBGA 4A3MJ 5HDNA 1XGNA 4YFKF 3OSGA 2HTSA 1YW8A 4BY7J 4A5NA 3NAUA 5K1YA 3F8MA 4XN3A 5LHGA 1I39A 2WADA 3CDHA 3FXKA 3K2AA 5EEHA 2EV6A 1QHHD 2E2HJ 3EBIA 2MBFA 1LVAA 4BH9A 4GDFA 1J9IA 2M4KA 3LA3A 3LA7A 1MMDA 5ICEA 2W48A 5F1RA 2LKPA 2LBFA 1X2MA 5FO5A 4EJVA 1UHWA 2E7XA 1WVRA 2DFIA 2FMLA 3FTYA 1GXQA 2Y9YA 4PCQA 3A1YA 1A6QA 5EDNA 3UR3C 1MSFC 4EATA 1SQMA 3S3MA 2RNGA 2PMZN 3C2BA 3F21A 2OTJI 2KIMA 2MYSA 4C9YA 2JJ7A 1W0TA 3NEUA 3H92A 4PSWA 1CGPA 1ITYA 4K5MA 3RKXA 1RI7A 2CUJA 2G9WA 2OU2A 4QLCU 3QYFA 3ZMZA 5HS8A 4EGYA 2XKPA 4EM0B 4JOMA 2OZ6A 5F0CA 1FYKA 2QGUA 4WCGA 4ZW3A 1ZN2A 1IRGA 2K9MA 5DD8A 3L2QA 5J4YA 3HUGB 4KT5C 1OCOH 2M2EA 3PFYA 3CC4I 3FUDA 2L9SA 3EETA 3E6MA 2HVQA 3ZQQA 2P7VB 3LSMA 2CV2A 1FIAA 1G5AA 4E4HA 2HPTA 1U8BA 1CF7B 5L3BA 2KP6A 2WV1A 1X3ZA 1ETWA 2O7OA 3CCEI 3H0GJ 2FUG2 4RBOA 3RYPA 3IC7A 1REPC 2LK2A 1RR7A 3MN2A 1JT6A 4C3HJ 3H3ZA 2K4JA 2XGDA 2VBWA 1HOMA 1HQCA 3S93A 5DM7F 1SD4A 2R7VA 1WSUA 2KJBA 4BQNA 1P4WA 2PJRB 1S8NA 4DYCA 2JUCA 5FWQA 1JKPC 4HDUA 5EV7A 2CMPA 2ZMEB 2DJNA 2JMWA 2EZLA 4E7KA 4CICA 3IIEA 2VKHA 1NH3A 5AONA 1HW1A 4Y6SA 1OR7A 3FXQA 3BJAA 2R7QA 4XK4A 4XMUA 4DNCA 1YJNI 4C3IJ 3I59B 2FNAA 2VODA 4R1HA 1WKMA 1Z6TA 2BHYA 4OOFA 3BC8A 2KFDA 3EYYA 1Z0XA 3SZGA 1D8KA 2VKEA 5HDKA 6PAXA 2IS1A 1QRYA 3UNGC 2JPBA 5D4SA 3HL2A 2E2JJ 1DPRA 5JVTA 5C44J 2F5FA 4Q4IA 2O3FA 4RLQA 3L2VA 1IXCA 3DKXA 4R5TA 2KRHA 1IRZA 2HDWA 1WJCA 2HQRA 1JT0A 1O7LA 4S04A 1JTYA 1VTNC 1D1AA 3I54A 3HUGA 1LVKA 3REOA 4RLFA 3QOPA 1QNTA 3OS0A 3FHZA 2E1CA 4LK0F 3OYFA 1IRFA 1S72I 2GAUA 3ZCOA 3BG9A 2JD1A 2HPOA 4WX9A 1TC3C 4XNFA 2IA0A 2W24A 2YPRA 2XQ0A 3HGGA 2IVMA 3OYGA 2HEOA 2XAGA 1YFHA 1JUPA 2CSOA 1W5TA 2PUSA 5EEAA 2XB5A 1ZH5A 2HR3A 1SVLA 2NYXA 3GFMA 3DKYA 3TBIA 1ZLJA 2L7FP 3JSZA 3Q0UA 3WQRA 4YFXF 2L02A 4FX0A 2R7ZJ 3CJQB 5LHIA 3IHUA 4DW6A 3CJRB 5JBIA 2BY2A 3BPVA 3K1PA 1KU9A 5LHHA 3IH3A 4L18B 3ZHXA 4Y15A 3OYIA 4GYGA 5EG0A 3FXOA 3CMMA 1SG7A 1X4OA 2EFQA 2CQ7A 2EFPA 2HOTA 1W4MA 1ACIA 2IW5A 1W5CC 3ZMVA 1IV8A 2K86A 4NC7A 2P6SA 3IKVA 4GFBA 1XTAA 2PFBA 3DPUA 3CXBA 4UUSB 2DA5A 4O3MA 1ZGJA 4RDUA 3H5AA 1I3AA 2IEKA 1HKSA 3CUQA 3GUDA 1SMTA 1YS6A 2LREA 2O03A 2DYRH 3ML6A 1XS9A 1X1AA 5F04A 2A3SA 2DAOA 2QSHX 2JUGA 4RB3C 3OOUA 1LNWA 3BR3A 3QU3A 1TLHB 3RCOA 4IQ4A 5KNLA 1U5TC 4OIQF 2H1LA 3DLAA 3BG5A 4I0BA 3CZKA 3RTRA 3Q43A 1DQUA 4L9NA 5GPCA 2LNBA 2Z9OA 2OTLI 1SD5A 1JVSA 3RPQA 3I0TA 5J1UA 5C3EJ 4W1UA 3G6EI 4RGXA 2WAQA 1O3SA 1H8AC 3EQLF 5J40A 1J59A 3ZOBA 4L5JA 2XDVA 1YI2I 4B4CA 4XICA 1T56A 2CRGA 3QOEA 2AQFA 2CUZA 4EVIA 4A3KJ 5DCMB 2G7UA 2LLKA 5EGOB 1J09A 4Y67A 4CZCA 5L3EA 3VVLA 1X4PA 3J80K 2MW8A 1OISA 2KQRA 3ABTA 2O5RA 4R7LA 3QPLA 2R4GA 2KIQA 3CF5F 2P7CB 2DA7A 5FGMA 3GZNB 4HNTA 3BROA 1TBXA 5GTHC 4IKFA 2CYYA 4FHTA 3F8NA 1WI9A 2V7FA 3OIOA 5JO0A 3PFIA 3ASOH 2FMYA 4LMYA 4DBQA 1H0MA 4LLNA 1N25A 2ISZA 2COBA 3WTTC 1QZEA 2LKXA 4RB1A 3SFIA 2BY0A 1R23A 1IV6A 3FUEA 4AICA 1IUFA 3E5UA 4IHSA 1YO5C 3QJXA 3H5NA 5E18F 1QZYA 2HKXA 4HG2A 3BG3A 1APLC 2LP0A 2OZUA 2XRNA 1R1VA 4HLXA 2YR2A 4B8XA 2VUMJ 2G0EA 2FFLA 3HOTA 2DU9A 4CCMA 3QU6A 1G4DA 3DEUA 5CYVA 3I5UA 2DQ6A 3TOBA 2D1HA 1K6YA 2ACJA 1FPQA 3DV8A 4DOZA 1P9QC 4BHPA 2VLAA 1XMXA 4PJJA 2KLOA 3J7ZI 2ZBKA 1W7PA 1JHFA 3CJNA 2WZFA 1EKEA 3EYIA 3FTXA 1NHAA 4HW0A 4NC6A 4J00A 5GTIC 1FTZA 2VJ5A 4G7HF 2Q1ZB 1PUFA 2VJJA 3VYRB 2ESHA 3O8GA 3L2WA 2M34A 4I09A 3IAM2 3V7SA 1BA5A 3O3KA 2XRLA 3TQNA 1S9HA 2KKOA 1ZS2A 2DK5A 1XGOA 2CQXA 4LITA 3IRRA 2IA2A 4ZQGA 2GIZA 2VQCA 1TWAJ 3KETA 5E3NA 2EGHA 2R93J 2R7RA 3IRQA 4HLYA 2C6YA 3MQ0A 4ENKA 3GTLJ 2NS0A 4AVPA 2YX4A 2HS5A 2P6TA 4P5OA 2XVCA 4G7ZF 3QYEA 2KL4A 3HRSA 4EV0A 2B63J 4HZFA 3T0YA 1RUNA 2M0CA 3D5LA 1R71A 3QPTA 3KCCA 2P0WA 4B09A 3KIOA 4NB5A 1JJ8C 3ZRGA 4XMWA 1VZ0A 4YIFA 1WH7A 2VBYA 2X1EA 3BR1A 1YIJI 2E19A 3A01B 5J8FA 1SVOA 4M9XA 4XNBA 2E7WA 1Q1HA 1UB9A 4BUPA 3I64A 4OMYA 1MH3A 3CHRA 3DTKA 2E1MB 3MCZA 1MIJA 2OJED 4ZDPA 3IWFA 2JSPA 4EJTA 4BE0A 5D5VB 3DEEA 4OMZA 2Z1DA 1OR7C 4IRGA 4CA0A 4ZYGA 3R0IA 2CW7A 5EEGA 2EQRA 2FNPA 3J81K 4HRIA 2ETHA 1PJRA 2QSGX 5HS7A 2HXIA 1SFEA 1S29A 2CFOA 3DTEA 2VE8A 2WZGA 3GCMA 2OCCH 3IWZA 3OWTA 4BBSJ 4LLGF 1UG0A 3DFGA 2R7UA 3ONQA 4I01A 1SVMA 1EH6A 3ERED 2K4BA 1XSXA 2D1VA 5D5XB 2QQ9A 2WB1N 3EUHA 2DLLA 1PP7U 1RETA 2VQGA 5FKLA 2JA5J 1R0KA 2FSWA 1L0OC 5IT3A 3U21A 1KYWA 2CQKA 2QM3A 2O8XA 1K78B 4Q4ZF 2QA4I 3AL0C 4C3JJ 4BJ6C 4ON0A 1QO0D 2WPGA 4UNOA 3COAC 2VBXA 1Z6RA 2E60A 5FFXA 2IXSA 1JKOC 4XSZF 3N05A 3SEZA 4FASD 2R5ZB 4B1RA 3FHNA 1E2XA 4ZQHA 2FRHA 4C2TA 2KZVA 1UMQA 3BR0A 4D9JA 5GAGJ 3HSEA 2LF8A 1YQAA 3FXMA 4F52A 1T95A 4P55A 2WBMA 1HDDC 3GTQJ 3RC8A 4MO7A 3KE2A 3HB9A 4XMZA 2KDOA 2XPUA 2HPIA 3D1NI 4GAEA 2GM4A 5FRMA 1Z05A 3LSIA 2X6YA 4MEXF 2OA4A 1ZR2A 2Z16A 1X1BA 4QSHA 3G3ZA 4BL0B 2W7NA 4B48A 3M1EA 3A14A 3QQAA 1X58A 3WHBA 3PIOF 1YJ9I 5J6XA 5D5WB 2ECCA 3S32A 1Q0LA 2V1NA 3DKWA 3E1SA 5CJ9A 4B3XA 4EM1A 2K7LA 1QGPA 2DA4A 2DMQA 4W97A 3CP8A 3FBIB 2CGPA 5KAIC 1ETYA 5FLMJ 3SDGA 4M72A 4BXUA 3B6CA 3S1RJ 5ICFA 1N77A 1HXDA 4A3EJ 5FKNA 4QUOA 2LY1A 3H9JA 1F4KA 3VSKA 2M7AA 1ZK8A 3M8EA 4XMYA 3JAMK 2YS9A 2L2OA 1Y6IA 1TNSA 3ZN1A 4Y52J 3L1PA 1AWCA 3C2GA 1Z9CA 2M1BA 2GXGA 4XN7A 3OV8A 3CCRI 2B0LA 3S8PA 4D5FA 3BTIA 3CUQC 2Y9ZA 3S17J 4P9FA 4A0XA 5BPPA 5K5OA 3KX2A 4B43A 2WV0A 2JA8J 1FMWA 1MKMA 3R0JA 1YRNB 1E3OC 3IH4A 1SC5A 3LQQA 1IN8A 2XPWA 2VQHA 5CVIA 2O61A 3QP5A 4KUMA 2MH9A 3TDZC 2DO7A 3QP6A 3H9GA 4GRIA 1XX5A 5AIQA 1RUOA 2X6XA 3S2WA 1WH5A 1JKQC 2QBYB 2CJJA 2JT1A 3JRCA 5BPIA 4A69C 1UJ8A 4R5VA 5B5EC 3HTUA 3LL7A 3M3YJ 1PYVA 3GZ5A 3L7WA 1NTCA 2XPYA 5IY5H 3FU6A 4BKXA 4HV5A 2QYOA 4QIWN 3JW4A 4HPQA 3A2KA 1U3EM 5E8GA 2QQ8A 1WJ5A 3M7GA 3KP6A 1T1SA 4IRIA 5FKOA 2CV0A 3S2HJ 2VJ8A 3HKZN 2Y1FA 4XO4A 1P4XA 2R92J 2HI3A 1VQ6I 3TOAA 4GAAA 2L5QA 2OQGA 5H6RA 2G7HA 2VQLA 3WE2A 4HNVA 1KU2A 5J3LA 3AG3H 3DU6A 2XGXA 4ZQTA 4XKWA 2K27A 4ABZA 3TP0A 4UUVA 3VDXA 3BR6A 4L9JA 1RKTA 2EJRA 3ZXSA 1UZCA 5FB2A 2F5DA 1YITI 1BOAA 3PNYA 4MLOA 3D0SA 3KEYA 1CQTA 4UVCA 3G73A 3S16J 1AOYA 4YIRX 1PDNC 3FUMA 4LG0A 4XORA 1MBFA 1ZR4A 4BJ5C 3B7RL 1WJEA 5B1AH 3RDIA 1ODDA 1FC3A 3BQZA 2TCTA 1LE8B 1ZG5A 2WAFA 1T6SA 1R58A 3HOXJ 4IXAA 3S1MJ 4UXNA 1HF0A 2JSCA 4G7OF 1R5ID 2W4SA 3IUOA 4ZZLA 4RB2C 3C7JA 2CW0F 2Y0SN 5TISC 2K3FA 2XPVA 1MDMA 3OOPA 4XKVA 4BNCA 1ORKA 1Y1VJ 5KHDA 2IJLA 2YU9J 1TQPA 2EV5A 3HXLA 3HSFA 2VIXA 4CYCA 1Z7LA 1Z91A 4XNDA 4HX8A 2DW4A 3EBHA 3GW2A 2ESNA 1XSDA 1S3JA 2M3AA 2RREA 2VBZA 1Q0QA 3PL8A 1NG7A 4XOPA 5TGTA 3ZQFA 4ASNA 1A35A 2HYJA 3BCBA 2KRCA 3BLYA 4K5PA 3FKJA 5M5YJ 1R9TJ 3FH5A 3UERA 3K9TA 1VFCA 1OMIA 3FZVA 4ZYAA 4MHGA 1TQIA 3EUAA 4ZYHA 1MNMC 4OOIA 3FTZA 1O3RA 1IG7A 1J5YA 5ILSA 3V7CA 3M8FA 2XIGA 4RMNA 3WQSB 2MSYA 2R7DA 2R5YA 3Q44A 1WRJA 2TDXA 4OU0A 2COMA 3JRDA 5H6QA 2BW3A 2EBIA 3FUHA 2DT7B 2KHMA 3LAJA 2DBBA 5K7ZA 1S7EA 4L9VA 5D5UB 4HF0A 1ERDA 1JHHA 1VQ4I 4E7HA 1X1CA 4EJWA 2DXIA 1R5GA 4L5EA 5E3LA 1I5ZA 4N9HA 3C18A 5F27A 1IAWA 1MBEA 2P4WA 1LEAA 2FA5A 3CZ6A 1Y1WJ 4XLNF 3FK7A 4CCNA 3ESWB 5CVVA 4MKTA 2MLGA 2XGCA 5DV5A 1TT0A 4WXCA 4I2OA 1V5GA 1TP4A 4XONA 2HQ5A 2A6TA 3BTLA 1ZREA 1IN5A 4A0YA 4HDVA 3BZ6A 4AYBA 4IRHA 3JRBA 3HW2A 4F55A 3FXRA 5JLXA 3EUKL 1U9OA 3S1NJ 2FJ1A 3PO3J 3BY6A 3H3VK 1FBSA 1R6RA 5M5WJ 2X6WA 4O6JA 4KIGA 2EFNA 4J19A 2DDAA 2DTRA 3K4LA 2UV1A 3TDUC 2IBDA 3EUHC 1XPXA 4A3LJ 2LRDA 2DA3A 4XLCA 4UB6C 2VC1A 1IXSB 1KGSA 1JGIA 2HNHA 3VOEA 4ZW7A 5LBQA 4AWXB 3HBLA 3OMYA 4HSTA 4V2GA 2EZHA 2J5OA 4YIIA 2EA2A 4BS9A 1F43A 4M74A 2QUFA 2XAFA 3RC3A 1U8RA 1ON1A 3PNVA 1TWFJ 4ENJA 3RZOJ 4D0PA 1EH7A 2QEXI 2M9HA 1HA8A 4ZX4A 4BHBA 1O3TA 1VQ8I 5IYBJ 1JTXA 3N4MA 4LG3A 4FCAA 2DA1A 2DFFA 3K4MA 1R36A 4NNJA 2DMNA 1MMAA 3E5QA 1ZRFA 1XMAA 2O8KA 2ID6A 5FKKA 5DLLA 1JUSA 5JVGF 2O0YA 1XG1A 2NAZA 1ZRDA 4OIPF 2JVGA 5JHUA 1OLTA 3HOYJ 4U87A 3H0DA 3U2RA 3H3UA 4Y33A 5BS6A 5LGTA 4MFDA 4ZN6A 3P9CA 1Z77A 1E17A 2XSDC 3TEDA 3K6GA 2ZXWH 2L4AA 1K79A 3HDDA 2L9RA 2MC3A 3CLQA 4DBRA 2E36A 5LEKA 2PEXA 2Q8KA 4UY8I 2WY8Q 4CH7A 2ZJRF 3DU5A 2V6EA 4NUBA 3Q9SA 4FETA 2A6HF 2H6CA 3G1LA 4RA2A 2HFHA 3MZHA 4G8XA 3SQNA 1I1GA 3BQYA 2OPTA 2STWA 2F2EA 3JREA 3VB2A 2BGCA 2M45A 4N4OB 1LUJB 1UG2A 2HOEA 3CUOA 4MIMA 4XRSG 3FF5A 2DFEA 3BTJA 3R4KA 1L3LA 5IT9K 2EINH 2DI3A 2NS8A 4FT8A 3CZGA 4M3BA 3FH7A 2PN6A 4X6AJ 2E1OA 5FLVA 4MQ9F 5F0FA 4E6KG 5HS9A 5IOZA 3O6BB 1CF7A 2RN7A 5E3OA 5JNLA 2DDBA 3QPHA 4E7SA 4M9SA 2ME0A 1QHGA 1E3PA 3R6SA 5DEQA 2QKMB 2XHKA 1YS7A 4PFOA 2EIMH 4ZX5A 3KEOA 1T1RA 5CVJA 1FBUA 1WWXA 5M5XJ 1A5JA 3CIAA 3KP7A 3FIWA 3MEXA 1Z3YA 2PJRA 2M8EA 2VL8A 3B6AA 3W2AA 2ZMEA 4Q4EA 4R5XA 2HVSA 1UHSA 4XN9A 5HLHA 4E7ZA 2KIUA 3UCQA 3GFJA 2ISYA 2QJ1A 1RZ4A 2XROA 4XRFA 3GTMJ 1P7JA 2W84A 4TV7A 3PUUA 3WU0A 2Y2ZA 3OS2A 3CCMI 3I59A 1N78A 3FX3A 4II2A 1VQKI 5CPRB 4M71A 1IN7A 1TW3A 1HW5A 2XAJA 1Z3XA 2JCYA 3PSFA 1ETVA 4ESFA 2Y1DA 5EZGA 2FE3A 3BCAA 4A3GJ 1B8IB 1FYMA 3Q0WA 4KNYA 1OCZH 2KJCA 3FK6A 1ZRCA 4FTHA 2HOSA 3AAFA 3CO6C 1ONPA 3J7AO 3FTVA 1RIOH 5IT9Z 5E3MA 2EV0A 2JRMA 4NBQA 4N9IA 2KT0A 1MZBA 1WJAA 1O3QA 1MVYA 4U0YA 4A12A 1G3SA 1FMVA 4MEYF 3AKZA 3L2RA 3PQKA 4KN4X 1WQ2A 2STTA 1O57A 3HRMA 1OYWA 4QPQA 1E3HA 3GLLA 2R0QC 3H35A 1WCMJ 2FX0A 3BG6A 2Y1CA 3PNTA 1T0FA 3Q5FA 1BR1A 2KZGA 3WTVC 2MGQA 2LC2A 2IGOA 3SHFA 3QRFF 3KYDB 3D5RC 1SFOJ 3F8BA 4ZDLA 3JR9A 1P2FA 1HSJA 1SFXA 4MTEA 2GQQA 3FULA 2KDZA 2C5ZA 2IT0A 3BG7A 1B72B 3H5RA 4LIVA 4CCJA 4E7IA 1YX3A 2ELKA 5JHFA 3ZQCA 1W7PD 1MW3A 3NARA 5LFAA 4BXFA 2BE5F 2HQNA 5BPDA 2VPLA 3RKWA 2RDPA 3KZYA 3CCJI 5K7FA 2PG4A 2A5WA 3BP8A 2RVCA 3B02A 4M6XA 2EK5A 2WA0A 3GFIA 2OAZA 2H94A 4XN5A 4XN8A 2CQQA 1LEBA 4RAZA 3S15J 4ZX6A 2VT3A 4NC8A 3ULQB 4A6DA 4UUSA 3CD6I 2RKHA 5J1RA 3HOSA 3FWEA 1VQPI 4OIOF 3NWTA 3K4BA 1QBJA 3KLNA 2ZXHA 4WF2A 3AFHA 1V5FA 1TTYA 4I98B 1SFUA 1H3LA 3FUFA 2LVSA 3FBNB 3BR2A 3GZ6A 2DPUA 4XR6A 5D6FA 4KA4A 2XSJC 3CC2I 2FQ4A 4M3GA 3TO6A 2P5LC 1B9NA 1B9MA 4WXDA 3I56I 4AR1A 1GLNA 1K6OA 2GA1A 4N4NB 3LWFA 2FXAA 1VQ9I 3CMEI 2BY3A 3FHEA 2WAEA 2X9DA 1G6NA 1U2WA 1XN7A 3FISA 5EF6A 2M4GA 3HOWJ 5FKMA 3J80Z 3HTSB 2BYVE 5DCMA 2L3DA 5EGOA 3FXUA 1S7OA 3CMAI 4EM2A 5HNFA 1LFUP 3QODA 3K10A 3ZQIA 3JT1A 1W36C 1V55H 4FQGA 2P5KA 2PMZA 3WGIA 2XF5A 3CESA 1HS6A 4RAFA 3ZP5A 4FCYA 3FMSA 1MGTA 3FDYA 4MQVA 3TGNA 4V2FA 2ZB9A 1BR2A 3LSKA 2P5VA 1AKHB 2K9SA 2CFXA 2L7MP 4DQ2A 2R3SA 3DPTA 4UB8C 2JN6A 1SEUA 3TL4X 3H36A 4AYSA 1H9TA 5JMWA 2CU7A 1B59A 4ZW8A 4A3IJ 2DTZA 2L01A 1T98A 2E5ZA 3GYHX 1ZHFA 4C2UA 4LB5A 2RV8A 2HPMA 4GCVA 1JGGA 3HYIA 1GVJA 3WTXC 1XGSA 4II3A 4MTDA 2NOJB 5DYMA 2XV4S 2YX7A 3SYTA 2O7GA 2F5CA 4JNDA 4ENMA 4EJOA 5D4RA 4G9YA 3L2UA 4UVAA 3CZLA 1UELB 1HCRA 2IS2A 5J1YA 2BVLA 4ZTFA 3FMRA 4KFCA 4IHYA 3G1OA 3I55I 1USSA 2A05A 3ZMDA 1OQYA 1FP2A 1OCCH 2A68F 1H9GA 1OCPA 1MBJA 2CQNA 4B3AA 1AA7A 1P92A 4M3FA 1R49A 2FBKA 1VQ7I 3FU0A 2CW8A 3LFUA 1MJ9A 3BZCA 2X1DA 4AIKA 4CCKA 4AIDA 2NS7A 4YRVA 3SDBA 2MLKA 3GF2A 1GVDA 4IVNA 4J3BA 1QVUA 2ZC2A 1D0ZA 1QQIA 1JI8A 1LDKB 3CF2A 2I5UA 1OYIA 3F6OA 1BW6A 4ARFA 3DEWA 5IP7J 5CVUA 3W2WA 3LSRA 1OPCA 3CQZJ 1D1CA 2Y30A 1KQ8A 4BEHB 1DGRM 3RYRA 4AR9A 2OC6A 3ASNH 3BWGA 2F5VA 4N0BA 3AU9A 3J7YJ 4PU2A 4ZZDA 2MH2A 1BI3A 3A06A 2VJ4A 1E0EA 2EIJH 1T38A 4CYDA 3HJEA 4XLPF 1XD7A 4IPAA 3E6CC 3CCUI 3OIPA 4XLFA 4DYRA 1QA6A 3KLOA 5ILUA 2BEOA 1J0RA 4O5VA 1K4SA 2YU3A 4WXHA 1BIAA 5FROA 2H27A 4PK4A 9ANTA 4G6TB 5HOOA 3MAJA 4I02A 1ZGAA 5E1WA 3JSOA 3CO7C 3W6VA 3O8HA 1EV7A 3FXLA 4I6ZA 2HQAA 3B7UX 5JLWA 3WGGA 2Z99A 4HNUA 2LTPA 2W00A 1KONA 4KITB 4XL9A 4R8HA 3HZJA 4JX4A 4U0WA 3A01A 5FFZA 2Y0MA 1IN6A 4LGWA 4AIHA 1MD0A 1ONNA 3M9AA 4KICA 2XF6A 5J4VA 2F4MB 3TP3A 2ZMEC 3GTOJ 4HOBA 1VQ5I 4RCVA 2E1NA 2NVQJ 3CHPA 2QCOA 3J81Z 1BI2A 2IGKA 3EPZA 1JKRC 2W57A 2M7BA 3K7AJ 3SZTA 1J2XA 3FTWA 1KU3A 4BQQA 4XO3A 2EFWA 2Z2SB 1HLVA 3V8LA 4PGHA 3WODF 2F48A 5F0HA 2VE9A 1A31A 1X3WB 3NWSA 1RP3A 2QQBA 3WTYC 1DU6A 1LQ1A 3IAS2 2R7WA 1J7KA 2NVUB 1VNDA 2Z33A 4JP0A 1PUEE 4XM3A 4BYYA 2M0MA 2JA2A 1EH8A 4LD5A 2HYFA 2VASA 3ZPLA 4Q5SF
chains in the Genus database with same CATH topology
1B72A 2JV7A 5K7ZA 1S7EA 3B34A 2L7FP 1X2NA 3AUAA 1MW1A 3JSZA 3Q0UA 3WQRA 3B37A 2DMUA 4EEFG 3GTJJ 2R7ZJ 3AU8A 5DS9A 4ZQFA 5M3MJ 4DW6A 3I4MJ 2PGGA 3MVPA 5JBIA 4L5EA 5E3LA 3ZHXA 3IH3A 4JX6A 2R5ZA 5EG0A 5F27A 2C82A 4RSYA 1MBEA 4D5CA 1SG7A 4JX5A 1TWCJ 1Y1WJ 3FK7A 4I76A 4MKTA 2Y31A 4LUPA 2XGCA 2OF7A 2XGEA 2HOTA 2HXOA 3SJMA 1BL0A 1XC5A 1HDPA 2HQ5A 3GBGA 4GFBA 4XMVA 4FLOA 3BTLA 4UUSB 2DA5A 4RDUA 3JRBA 2A7OA 2IEKA 5C4JJ 3ZQLA 3TW7A 5JLXA 5IP9J 1U9OA 3S1NJ 1G2HA 2FJ1A 1XS9A 3PO3J 5F04A 4A3BJ 3H3VK 5DYFA 3ZI0A 2EZIA 4MFEA 2LY9A 3OOUA 1ZTRA 5M5WJ 1QPIA 2K9QA 3BR3A 4J19A 4XN4A 3RQIA 3FUKA 4A3LJ 2IBDA 3JRIA 3BG5A 3CZKA 2FD5A 3S1QJ 3Q43A 2DA3A 5HLTA 2B61A 5GPCA 3FTUA 4XRSA 1JGIA 4AYBN 3FUIA 4ZW7A 1JVSA 4AR8A 3BR5A 3HBLA 4V2GA 2EZHA 5J1UA 5C3EJ 4W1UA 1W0UA 1F43A 1JUMA 2GTQA 1H8AC 3RC3A 4QIRA 3ZOBA 1TWFJ 4B4CA 4XICA 1WI3A 1T56A 3RZOJ 2CRGA 4ZX4A 2M9HA 1VF9A 4A3KJ 1GW6A 3B7TA 1IDYA 5EGOB 2LLKA 3S2DJ 4OOEA 4XIDA 5IYBJ 3ANNA 1JTXA 4Y67A 4NDLA 4FCAA 2DA1A 2H8RA 3VVLA 2DMNA 2MW8A 1ZKGA 1GUUA 3F0CA 2O8KA 4R7LA 1AKHA 2ID6A 5FKKA 3QPLA 4K5OA 3UKGA 1R0LA 5DLLA 1JUSA 2WAQN 2DA7A 1XG1A 2E2IJ 5GP9A 3HOYJ 1TWGJ 3FTSA 2AHQA 4A3FJ 1OCTC 3IV5A 1FJLA 4MFDA 1YRNA 4ZN6A 2ECBA 3OIOA 3FU3A 5JO0A 1Z77A 2JK3A 3Q0VA 1RESA 2TRTA 5JMWA 2XSDC 3TEDA 3HDDA 2COBA 2L9RA 4FLQA 2YUSA 2LKXA 2L7ZA 3SFIA 1ETKA 3JRGA 4Y7NJ 1IV6A 2XB0X 3FUEA 4AICA 3HOUJ 1IUFA 4M3DA 2ID3A 3G1LA 2NOGA 1ZQ3P 3VPRA 3QJXA 5DULA 4IHXA 1IGNA 3BG3A 1APLC 2LP0A 4BY1J 1MH4A 3BQYA 2OPTA 2JWTA 3JREA 2FFLA 2VUMJ 2G0EA 1UG2A 4MIMA 4XRSG 4IHWA 3BTJA 3KEDA 3CHSA 2DQ6A 2NS8A 2NVXJ 1RKWA 3CZGA 4M3BA 2JCXA 3FH7A 5K7HA 5IOYA 4X6AJ 2E1OA 4KP7A 3DCFA 5FLVA 5JMPA 2VLAA 5F0FA 5IOZA 1AHDP 3MKLA 5E3OA 3U9WA 2X48A 5JNLA 4PVBA 3RZDJ 4FLSA 3GTGJ 1MW2A 2ME0A 3JRAA 1FIPA 2WZFA 1FTTA 4D7MA 3FTXA 4AC0A 4ZX5A 2HOAA 1T1RA 2JD0A 1Q0HA 5EZHA 3CIAA 5M5XJ 1GT0C 1A5JA 1FTZA 1EF4A 3FIWA 1PUFA 4A03A 1ETQA 1BA5A 3O8GA 2M34A 4XO5A 2XRLA 3FKIJ 3B6AA 4XN2A 3CCYA 4R5XA 1U9NA 1ZS2A 4Q4EA 1UHSA 3TW6A 1JJ6C 1FEXA 3FU5A 2CQXA 4XN9A 3UCQA 4ZQGA 2Y1GA 1OJLA 1MBHA 2DA2A 2QJ1A 3CMYA 3ANMA 4X2UA 1TWAJ 3GTMJ 1P7JA 5E3NA 5FJ8J 2EGHA 2R93J 3HOVJ 1H19A 1LE8A 3PUUA 2Y2ZA 3GTLJ 2X6OA 4K5NA 4DPRA 2EH3A 2K9NA 4K5LA 4A3JJ 3UEQA 2JCYA 5F1JA 5BNGA 1ETVA 1MBKA 2Y1DA 1ETOA 5EZGA 2B63J 4A3GJ 1RPWA 3T0YA 1B8IB 4DZJA 2I10A 2M0CA 3Q0WA 1K5HA 3BT9A 3FK6A 3IH2A 4FTHA 2HOSA 1ONPA 3FTVA 3S14J 4G12A 4XRMA 3B7SA 1JJ8C 4XMWA 5E3MA 3Q3SA 2MAPA 1WH7A 4A3CJ 3ZHZA 3BR1A 4CYCB 1NK3P 2E19A 2KT0A 3A01B 3CHQA 1MVYA 5HODA 4XNBA 4M6VA 3HGYA 2PL5A 1A6IA 1NK2P 2DQMA 2DMTA 4LOCA 3I4NJ 1MH3A 3CHRA 5C4XJ 3M4OJ 1QVTA 3CDLA 2R0QC 2R59A 4IHVA 1WCMJ 1GDTA 2GBYA 2FX0A 2JA6J 1P7IA 2Y1CA 1ZGWA 1X3WA 1T33A 3E7LA 4UUTA 3R0IA 4C2MJ 2ME6A 4DYQA 2MGQA 2EQRA 5F08A 3LSGA 4RVBA 2HXIA 2WZGA 3HM5A 2AO9A 1D5YA 1SFOJ 4BBSJ 5IYCJ 3JR9A 2R5YB 1I50J 2H1KA 2JCVA 4JYKA 3FULA 2KDZA 2C5ZA 3RKQA 1B72B 2WB1N 1JG9A 1RETA 5FKLA 1IDZA 1VI0A 2JA5J 1R0KA 2NVYJ 2ELKA 2QF7A 3ZQCA 1MW3A 3NARA 2NVTJ 4S0HB 4CXFA 3LSPA 4C3JJ 3FUJA 2WPGA 4ZX3A 5IYDJ 4Y6PA 2PUSA 5K7FA 1JKOC 1ONOA 3A02A 3LSJA 2R5ZB 5JC1A 4B1RA 5EG0B 2R72A 4FISA 1DU0A 4ZQHA 1I6HJ 1S46A 4XN5A 4XN1A 4XN8A 2P81A 4XNAA 1UMQA 3BR0A 4A93J 4XMTA 2CQQA 3JRFA 3S15J 4ZX6A 4UUSA 3HOZJ 5J1RA 4A3DJ 1HDDC 3GTQJ 2Y1EA 4MO7A 3RC8A 3HB9A 3BTCA 4XMZA 2XPUA 3T8VA 3LNQA 2DA6A 3D1NI 2GM4A 4GAEA 2N8GA 3VVMA 1H3LA 1GV5A 3FUFA 1ZR2A 2LD5A 4ZQEA 4QSHA 1LFBA 1BJZA 2LVSA 3PO2J 3BR2A 3A14A 3QQAA 1X58A 4DZPA 3WHBA 4QPEA 4M3EA 2FQ4A 4M3GA 4NQWA 2ECCA 1Q0LA 4AR1A 1TWHJ 2ZXGA 4Y6RA 1SANA 1K83J 5IP6A 1H89C 2VPRA 5IPAA 2DA4A 2DMQA 4W97A 4FE7A 1MBGA 3FHEA 2X9DA 1MW0A 3FUNA 1WPKA 3FISA 5EF6A 2RJIA 3HOWJ 5FKMA 1ETYA 5FLMJ 1Q1VA 3SDGA 2K40A 4IEJA 3S1RJ 1IC8A 3B6CA 4L2LA 3EBGA 4A3EJ 4A3MJ 5FKNA 5EGOA 1K61A 4FE4A 4QUOA 2LR8A 3OSGA 3GTPJ 4BY7J 1ZK8A 2QVWA 3NAUA 5HNFA 2YS9A 1LFUP 3ZQIA 1H88C 3JT1A 3K2AA 4Y52J 3L1PA 2E2HJ 1HS6A 3EBIA 3OSFA 4FCYA 4XN7A 4V2FA 2ZB9A 4D5FA 3BTIA 1AKHB 2Y9ZA 2K9SA 2L7MP 3S17J 4ZW5A 5JAZA 2JN6A 4QMEA 2W48A 4AYSA 1X2MA 3ZQHA 1O4XA 2DN0A 2D5VA 3B2XA 2CU7A 5BPPA 3FUHA 4ZW8A 4A3IJ 2DTZA 3FTYA 2Y9YA 2JA8J 4PW4A 1YRNB 1E3OC 5EDNA 3IH4A 1MSFC 1SC5A 1SQMA 1ENHA 2XPWA 1WGXA 1JGGA 2RAEA 2PMZN 3C2BA 1W0TA 2JJ7A 2O7GA 4K5MA 1WH5A 1ITYA 1JKQC 4JNDA 4XMXA 2CJJA 3JRCA 4A69C 4R5VA 3CZLA 1I3QJ 4BXXJ 1HCRA 3M3YJ 5J1YA 1NTCA 2XPYA 4IHYA 2MG4A 4AUXA 3G1OA 4BKXA 3FU6A 5F0CA 3ANLA 4QIWN 1MSEC 4ZW3A 2O9LA 1F36A 4MS6A 1OCPA 1MBJA 4B3AA 4M3FA 2LFBA 1T1SA 2EZKA 2M2EA 2M8GX 3FU0A 3FUDA 5FKOA 1BW5A 2XPZA 3S2HJ 2VJ8A 3HKZN 2Y1FA 4XO4A 2NS7A 2R92J 2HI3A 2L0KA 1FIAA 1G5AA 4GAAA 2CUFA 1GVDA 1U8BA 4J3BA 2HPTA 1QVUA 2WV1A 4HNVA 1X3ZA 1IJWC 5J3LA 1ETWA 2O7OA 4ZQTA 1BW6A 3H0GJ 4ABZA 4BBRJ 4ARFA 3DEWA 3TP0A 5IP7J 4RBOA 5AENA 3G1MA 3BR6A 3LSRA 2LK2A 1RKTA 1RR7A 3CQZJ 3MN2A 2VI6A 1JT6A 4C3HJ 5M3FJ 3RASA 2Y30A 4X1EA 2XGDA 1HOMA 4MLOA 3A03A 4AR9A 1PUFB 1CQTA 3AU9A 3S16J 4PU2A 4DYCA 5FWQA 1JKPC 5EV7A 3A06A 3B2PA 2DJNA 2CUEA 2EZLA 2JMWA 3PM1A 4D7NA 3FUMA 1MBFA 1ZR4A 1GV2A 3IIEA 2HDDA 3B7RL 1U78A 3BQZA 2TCTA 4XK4A 4DYRA 1LE8B 1OR7A 4Y6SA 4XMUA 4C3IJ 2JA7J 3HOXJ 2VKVA 2R70A 1B8IA 3S1MJ 1HF0A 3JRHA 4OOFA 4QTRA 1Z0XA 2Y0SN 2VKEA 9ANTA 2MAOA 3B3BA 2XPVA 3CZEA 1ORKA 1ETXA 1Y1VJ 3LOCA 3W6VA 3O8HA 5EYRA 4I6ZA 1QRYA 5DTDA 3B7UX 2YU9J 5JLWA 4ZW6A 2LTPA 2E2JJ 4CYCA 4JX4A 5C44J 3A01A 2JD2A 3QPSA 4Q4IA 3FH8A 4XNDA 3EBHA 1ONNA 4R5TA 1IRZA 3ZQGA 3TP3A 4FLRA 1JT0A 3WQQA 3GTOJ 1JTYA 1Q0QA 4RCVA 5GPAA 2NVQJ 3ZHYA 3WHCA 3CHPA 2QCOA 3ZQFA 1JKRC 2HYJA 3K7AJ 4K5PA 2DMPA 5M5YJ 1R9TJ 3FH5A 3FTWA 4XO3A 1OFCX 4QHPA 1VFCA 2IAIA 3UERA 1HLVA 2HPOA 3BG9A 5F0HA 2JD1A 1MNMC 1RP3A 1TC3C 3CHOA 3FTZA 1IG7A 1DU6A 1AU7A 3WQSB 1VNDA 2XQ0A 2MSYA 3HGGA 2R5YA 4JP0A 3Q44A 3JRDA 5HNHA 1POGA 1JUPA 3HEFA 2GLOA 2EBIA 5EEAA 2XB5A 3GTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 A;  5K7Z A;  1S7E A;  2L7F P;  1X2N A;  3Q0U A;  2DMU A;  4EEF G;  3GTJ J;  2R7Z J;  5DS9 A;  5M3M J;  4DW6 A;  3I4M J;  3MVP A;  4L5E A;  5E3L A;  3IH3 A;  4JX6 A;  2R5Z A;  5EG0 A;  5F27 A;  1MBE A;  4D5C A;  4JX5 A;  1TWC J;  1Y1W J;  3FK7 A;  4I76 A;  2Y31 A;  2XGC A;  2OF7 A;  2XGE A;  2HOT A;  2HXO A;  3SJM A;  1BL0 A;  1XC5 A;  1HDP A;  2HQ5 A;  3GBG A;  4GFB A;  3BTL A;  4UUS B;  2DA5 A;  4RDU A;  3JRB A;  2IEK A;  5C4J J;  3ZQL A;  3TW7 A;  5JLX A;  5IP9 J;  1U9O A;  3S1N J;  1G2H A;  2FJ1 A;  1XS9 A;  3PO3 J;  5F04 A;  4A3B J;  3H3V K;  2EZI A;  4MFE A;  2LY9 A;  3OOU A;  1ZTR A;  5M5W J;  1QPI A;  2K9Q A;  3BR3 A;  4J19 A;  3RQI A;  4A3L J;  2IBD A;  3JRI A;  3BG5 A;  2FD5 A;  3S1Q J;  2DA3 A;  5GPC A;  4XRS A;  4AYB N;  3BR5 A;  3HBL A;  4V2G A;  2EZH A;  5J1U A;  5C3E J;  4W1U A;  1W0U A;  1F43 A;  1JUM A;  1H8A C;  3ZOB A;  1TWF J;  4B4C A;  4XIC A;  1WI3 A;  1T56 A;  3RZO J;  2CRG A;  2M9H A;  1VF9 A;  4A3K J;  1IDY A;  5EGO B;  2LLK A;  3S2D J;  4XID A;  5IYB J;  1JTX A;  4NDL A;  2DA1 A;  2H8R A;  2DMN A;  2MW8 A;  1ZKG A;  1GUU A;  3F0C A;  2O8K A;  1AKH A;  2ID6 A;  5FKK A;  3QPL A;  3UKG A;  1JUS A;  2WAQ N;  2DA7 A;  1XG1 A;  2E2I J;  5GP9 A;  3HOY J;  1TWG J;  2AHQ A;  4A3F J;  1OCT C;  3IV5 A;  1FJL A;  4MFD A;  1YRN A;  2ECB A;  3OIO A;  1Z77 A;  2JK3 A;  3Q0V A;  1RES A;  2TRT A;  2XSD C;  3TED A;  3HDD A;  2COB A;  2L9R A;  2YUS A;  2LKX A;  2L7Z A;  3SFI A;  1ETK A;  3JRG A;  4Y7N J;  1IV6 A;  2XB0 X;  3HOU J;  1IUF A;  4M3D A;  2ID3 A;  3G1L A;  2NOG A;  1ZQ3 P;  3VPR A;  4IHX A;  1IGN A;  3BG3 A;  1APL C;  2LP0 A;  4BY1 J;  1MH4 A;  3BQY A;  2OPT A;  2JWT A;  3JRE A;  2VUM J;  2G0E A;  1UG2 A;  4MIM A;  4XRS G;  4IHW A;  3BTJ A;  2NS8 A;  2NVX J;  1RKW A;  4M3B A;  5K7H A;  5IOY A;  4X6A J;  2E1O A;  3DCF A;  5FLV A;  5F0F A;  5IOZ A;  1AHD P;  3MKL A;  5E3O A;  2X48 A;  3RZD J;  3GTG J;  2ME0 A;  3JRA A;  1FIP A;  1FTT A;  4D7M A;  4AC0 A;  2HOA A;  5EZH A;  5M5X J;  1GT0 C;  1A5J A;  1FTZ A;  1EF4 A;  3FIW A;  1PUF A;  1ETQ A;  1BA5 A;  3O8G A;  2M34 A;  2XRL A;  3FKI J;  3B6A A;  3CCY A;  1U9N A;  1UHS A;  3TW6 A;  1JJ6 C;  1FEX A;  2CQX A;  1OJL A;  1MBH A;  2DA2 A;  3CMY A;  1TWA J;  3GTM J;  1P7J A;  5E3N A;  5FJ8 J;  2R93 J;  3HOV J;  1LE8 A;  2Y2Z A;  3GTL J;  2X6O A;  2EH3 A;  2K9N A;  4A3J J;  5F1J A;  5BNG A;  1ETV A;  1MBK A;  1ETO A;  5EZG A;  2B63 J;  4A3G J;  1RPW A;  1B8I B;  4DZJ A;  2I10 A;  2M0C A;  3Q0W A;  3BT9 A;  3FK6 A;  3IH2 A;  4FTH A;  2HOS A;  3S14 J;  4G12 A;  4XRM A;  1JJ8 C;  5E3M A;  3Q3S A;  1WH7 A;  4A3C J;  3BR1 A;  4CYC B;  1NK3 P;  2E19 A;  2KT0 A;  3A01 B;  5HOD A;  4M6V A;  3HGY A;  1A6I A;  1NK2 P;  2DMT A;  4LOC A;  3I4N J;  1MH3 A;  5C4X J;  3M4O J;  1QVT A;  3CDL A;  2R0Q C;  4IHV A;  1WCM J;  1GDT A;  2GBY A;  2FX0 A;  2JA6 J;  1P7I A;  1ZGW A;  1T33 A;  3E7L A;  4UUT A;  4C2M J;  2ME6 A;  4DYQ A;  2MGQ A;  2EQR A;  5F08 A;  3LSG A;  2HXI A;  3HM5 A;  2AO9 A;  1D5Y A;  1SFO J;  4BBS J;  5IYC J;  3JR9 A;  2R5Y B;  1I50 J;  2H1K A;  4JYK A;  2KDZ A;  3RKQ A;  1B72 B;  2WB1 N;  1RET A;  5FKL A;  1IDZ A;  1VI0 A;  2JA5 J;  2NVY J;  2ELK A;  2QF7 A;  3ZQC A;  3NAR A;  2NVT J;  4S0H B;  3LSP A;  4C3J J;  5IYD J;  5K7F A;  1JKO C;  3A02 A;  3LSJ A;  2R5Z B;  4B1R A;  5EG0 B;  4FIS A;  1DU0 A;  1I6H J;  2P81 A;  1UMQ A;  3BR0 A;  4A93 J;  2CQQ A;  3JRF A;  3S15 J;  4UUS A;  3HOZ J;  5J1R A;  4A3D J;  1HDD C;  3GTQ J;  4MO7 A;  3HB9 A;  3BTC A;  2XPU A;  3LNQ A;  2DA6 A;  3D1N I;  2GM4 A;  2N8G A;  1GV5 A;  1ZR2 A;  2LD5 A;  4QSH A;  1LFB A;  1BJZ A;  2LVS A;  3PO2 J;  3BR2 A;  3QQA A;  1X58 A;  4DZP A;  3WHB A;  4M3E A;  2FQ4 A;  4M3G A;  2ECC A;  1TWH J;  1SAN A;  1K83 J;  5IP6 A;  1H89 C;  2VPR A;  5IPA A;  2DA4 A;  2DMQ A;  4W97 A;  4FE7 A;  1MBG A;  2X9D A;  1WPK A;  3FIS A;  5EF6 A;  3HOW J;  5FKM A;  1ETY A;  5FLM J;  1Q1V A;  3SDG A;  2K40 A;  4IEJ A;  3S1R J;  1IC8 A;  3B6C A;  4A3E J;  4A3M J;  5FKN A;  5EGO A;  1K61 A;  4FE4 A;  2LR8 A;  3OSG A;  3GTP J;  4BY7 J;  1ZK8 A;  3NAU A;  2YS9 A;  1LFU P;  3ZQI A;  1H88 C;  3K2A A;  4Y52 J;  3L1P A;  2E2H J;  3OSF A;  4FCY A;  4V2F A;  2ZB9 A;  4D5F A;  3BTI A;  1AKH B;  2Y9Z A;  2K9S A;  2L7M P;  3S17 J;  2JN6 A;  2W48 A;  1X2M A;  3ZQH A;  1O4X A;  2DN0 A;  2D5V A;  2CU7 A;  4A3I J;  2DTZ A;  2Y9Y A;  2JA8 J;  1YRN B;  1E3O C;  5EDN A;  3IH4 A;  1MSF C;  1ENH A;  2XPW A;  1WGX A;  1JGG A;  2RAE A;  2PMZ N;  3C2B A;  1W0T A;  2JJ7 A;  1WH5 A;  1ITY A;  1JKQ C;  2CJJ A;  3JRC A;  4A69 C;  1I3Q J;  4BXX J;  1HCR A;  3M3Y J;  5J1Y A;  1NTC A;  4IHY A;  2MG4 A;  4AUX A;  3G1O A;  4BKX A;  5F0C A;  4QIW N;  1MSE C;  2O9L A;  1F36 A;  1OCP A;  1MBJ A;  4B3A A;  4M3F A;  2LFB A;  2EZK A;  2M2E A;  2M8G X;  5FKO A;  1BW5 A;  3S2H J;  3HKZ N;  2NS7 A;  2R92 J;  2HI3 A;  2L0K A;  1FIA A;  2CUF A;  1GVD A;  1U8B A;  1QVU A;  2WV1 A;  4HNV A;  1IJW C;  5J3L A;  1ETW A;  2O7O A;  1BW6 A;  3H0G J;  4ABZ A;  4BBR J;  3DEW A;  3TP0 A;  5IP7 J;  4RBO A;  3G1M A;  3BR6 A;  3LSR A;  2LK2 A;  1RKT A;  1RR7 A;  3CQZ J;  3MN2 A;  2VI6 A;  1JT6 A;  4C3H J;  5M3F J;  2Y30 A;  4X1E A;  2XGD A;  1HOM A;  4MLO A;  3A03 A;  1PUF B;  1CQT A;  3S16 J;  4DYC A;  1JKP C;  2DJN A;  2CUE A;  2EZL A;  2JMW A;  3PM1 A;  4D7N A;  1MBF A;  1ZR4 A;  1GV2 A;  2HDD A;  1U78 A;  3BQZ A;  2TCT A;  4XK4 A;  4DYR A;  1LE8 B;  4C3I J;  2JA7 J;  3HOX J;  2VKV A;  1B8I A;  3S1M J;  1HF0 A;  3JRH A;  4QTR A;  1Z0X A;  2Y0S N;  2VKE A;  9ANT A;  2XPV A;  1ORK A;  1ETX A;  1Y1V J;  3LOC A;  3W6V A;  3O8H A;  5EYR A;  4I6Z A;  1QRY A;  5DTD A;  2YU9 J;  5JLW A;  2LTP A;  2E2J J;  4CYC A;  4JX4 A;  5C44 J;  3A01 A;  3QPS A;  1IRZ A;  3ZQG A;  3TP3 A;  1JT0 A;  3GTO J;  1JTY A;  5GPA A;  2NVQ J;  3WHC A;  2QCO A;  3ZQF A;  1JKR C;  2HYJ A;  3K7A J;  2DMP A;  5M5Y J;  1R9T J;  1OFC X;  1VFC A;  2IAI A;  1HLV A;  3BG9 A;  5F0H A;  1MNM C;  1TC3 C;  1IG7 A;  1DU6 A;  1AU7 A;  1VND A;  2MSY A;  3HGG A;  2R5Y A;  4JP0 A;  3JRD A;  1POG A;  1JUP A;  3HEF A;  2GLO A;  2EBI A;  5EEA A;  2XB5 A;  3GTK J; 
#chains in the Genus database with same CATH topology
 4F92 B;  1BC7 C;  2JV7 A;  3B34 A;  3F3X A;  2A07 F;  1FNN A;  2FEZ A;  1X2N A;  5F6F A;  3AUA A;  1K78 A;  2JQ7 A;  2DMU A;  3GTJ J;  1U5T B;  3AU8 A;  3OYB A;  5DS9 A;  1ZYR F;  3I4M J;  1XSV A;  5AIP A;  4KMU X;  1QZZ A;  4ITV A;  2A6E F;  4JX6 A;  5H20 A;  3RPU A;  2R5Z A;  4XKC A;  3V8J A;  4D5C A;  1VQM I;  2ZSI B;  1TWC J;  4B47 A;  3GVA A;  3FM5 A;  1QPM A;  5FD6 A;  4I0A A;  2HXO A;  1XDS A;  3SJM A;  1JE8 A;  1BL0 A;  2NRA C;  1T0F C;  1OYY A;  2K5C A;  4RM3 A;  2X4H A;  4EMS A;  3CCV I;  2O6G E;  4Q47 A;  3DLL F;  1TW2 A;  1YE9 A;  5C4J J;  1MMS A;  3P9K A;  1EJ9 A;  1G2H A;  5GAH J;  4HAM A;  2D2W A;  3ZN0 A;  1VQO I;  3ZI0 A;  1OKR A;  2NNN A;  2LY9 A;  5LLQ A;  3PJR A;  2Y48 A;  1ZTR A;  4PJ0 C;  3OYA A;  2K9Q A;  4CCO A;  2RGV A;  2X51 A;  4XN4 A;  3K70 C;  2V79 A;  4XLH A;  1I27 A;  2FD5 A;  5HLT A;  3MKW B;  2B61 A;  3V4G A;  1IUY A;  3FTU A;  4XRS A;  3VYS B;  3DPL C;  4AR8 A;  4ZTJ A;  2QLZ A;  3LFK A;  3JAM Z;  1W0U A;  2GTQ A;  1JUM A;  2L9V A;  4A2U A;  4QIR A;  5DM6 F;  1A36 A;  1RRJ A;  2F5E A;  1WI3 A;  2VJI A;  2V1U A;  1VF9 A;  1IF1 A;  1BJA A;  1IDY A;  5LRS A;  2RQQ A;  4OOE A;  5E79 C;  2PI0 A;  4Z2Y A;  4KIB A;  1Z21 A;  3WTW C;  5FD5 A;  1Y8Q B;  2QWW A;  1S7A A;  2LKS A;  2VXZ A;  1I1S A;  1HST A;  1GUU A;  1FOX A;  4ZDO A;  2RQP A;  4K5O A;  4XQF A;  3FM3 A;  1R0L A;  2WAQ N;  3MWM A;  2A69 F;  2RC4 A;  4ANJ A;  3P9I A;  3TKY A;  2DJI A;  2V1D A;  1Z67 A;  2AHQ A;  4BGD A;  4ZC3 A;  3IV5 A;  1YRN A;  3KYC B;  2LBF B;  3VWB A;  2ECB A;  3Q0V A;  1RES A;  2TRT A;  4LB6 B;  2CO5 A;  3LAP A;  4FLQ A;  2YUS A;  3HIF A;  1SD6 A;  2L7Z A;  1ETK A;  3JRG A;  2QBY A;  3ROU A;  4Y7N J;  2XB0 X;  3HPH A;  1DP7 P;  3ELK A;  3OYE A;  2NOG A;  3VPR A;  1IGN A;  3MKZ A;  1MH4 A;  5CVR A;  1MJA A;  3RKY A;  4H0E A;  2JWT A;  1YW7 A;  4QPO A;  5DCF A;  5HVQ C;  2AS5 F;  2V9P A;  4IHW A;  4ETS A;  1YHQ I;  3Q9V A;  1FP1 D;  2XUB A;  3F22 A;  1BIB A;  3I71 A;  3KP4 A;  2JCX A;  3E0J B;  5K7H A;  4CCL A;  5IOY A;  5B1B H;  3JTH A;  2OUM A;  3DCF A;  3K1N A;  3D5S C;  2BOL A;  1S5L C;  4P1W A;  3MKL A;  1BC8 C;  3U9W A;  2FBH A;  2X48 A;  4BAC A;  4FX4 A;  4PVB A;  4RAY A;  2GZW A;  3OS1 A;  1HW2 A;  5E20 A;  2OBP A;  2EWN A;  1MW2 A;  3JRA A;  1FIP A;  4Y17 A;  1F1Z A;  1FTT A;  2JTV A;  4AD9 A;  1X3Z B;  1TZL A;  2IGM A;  2HOA A;  4ZJZ A;  2JD0 A;  1Q0H A;  3S3N A;  1MND A;  1D8J A;  1R4N B;  3AG4 H;  1UFM A;  1EF4 A;  4G6Q A;  4U7B A;  5E8I A;  1KU7 A;  1X1P A;  2WTE A;  3FKI J;  3CCY A;  4IOC F;  1JJ6 C;  3TW6 A;  3FU5 A;  2I8D A;  1WHU A;  3KP3 A;  2GXA A;  1MBH A;  1UCR A;  2VT2 A;  3O2P E;  3CMY A;  4CGZ A;  5D6E A;  4X2U A;  3DXJ F;  3KFW X;  5FJ8 J;  4A0Z A;  1WJB A;  3HOV J;  1H19 A;  2E35 A;  2QKL B;  3ERM A;  1LE8 A;  4M6Y A;  2R7T A;  4G6D A;  2R7F A;  3OYL A;  1LPQ A;  3MZY A;  2M30 A;  3KZZ A;  4BQO A;  1FWZ A;  4DPR A;  1O7F A;  2NNY A;  3K4N A;  3WE3 A;  2FF4 A;  3CC7 I;  2EH3 A;  2K9N A;  4K5L A;  4A3J J;  3UEQ A;  3BOQ A;  5F1J A;  4PFP A;  5BNG A;  1MBK A;  2V9V A;  4A6E A;  4CDG A;  3HRU A;  1RPW A;  2CV1 A;  2VOO A;  4DZJ A;  4DIQ A;  1R5H A;  4ZYD A;  3KZI C;  1G59 A;  1I6X A;  2WWY A;  3DQV C;  3BT9 A;  3BPX A;  2ZNY A;  3IH2 A;  2XAH A;  2DK8 A;  4S05 A;  3S14 J;  3B7S A;  4DGW B;  1YYV A;  5E1X A;  3JCU C;  3Q3S A;  5KCM A;  2MAP A;  4A3C J;  3ZHZ A;  4OAZ A;  3GME A;  4RM2 A;  1NK3 P;  2DOE A;  4LJZ F;  4MNU A;  5HOD A;  4NQW B;  3HGY A;  3AL0 B;  2BVM A;  2PL5 A;  1A6I A;  1NK2 P;  2DMT A;  2IS6 A;  4R79 A;  3I4N J;  3GFL A;  1C0W A;  1LJ9 A;  1QVT A;  2W82 A;  3CDL A;  2R59 A;  4IHV A;  5HDG A;  2WB1 A;  1ZGW A;  1T33 A;  2BXZ A;  3V8K A;  1W5S A;  4C30 A;  4CZZ A;  2VXD A;  4Y13 A;  4LK1 F;  4C2M J;  2ME6 A;  5F08 A;  1G3T A;  4XLE A;  4AU7 A;  3OYH A;  1FSH A;  4I7H A;  4UHT A;  4V19 K;  3I3L A;  1D5Y A;  1XB4 A;  2AO9 A;  1G8X A;  5IYC J;  4EJU A;  1I50 J;  4RGS A;  2QEN A;  3G2B A;  2WC2 A;  3SEQ A;  4XLA A;  4CUG A;  3CCL I;  4JYK A;  4BE1 A;  2H1K A;  2ADU A;  3RKQ A;  2DOD A;  5E17 F;  3DBR B;  1JG9 A;  1YLF A;  1KZH A;  5H2F C;  5LD2 C;  1VI0 A;  4BE2 A;  2NVY J;  2QF7 A;  2XAS A;  1P4A A;  2LDU A;  2NVT J;  5J8C A;  4NHJ A;  3LSP A;  2V26 A;  4BDZ A;  1R1U A;  2BZT A;  2AXL A;  2E1M C;  1PP8 F;  1LB2 A;  1HKQ A;  3A02 A;  3LSJ A;  5JC1 A;  5EG0 B;  1UAA A;  4FIS A;  1UST A;  4UVB A;  1Y56 A;  4ENN A;  1I6H J;  1S46 A;  4XNA A;  3PUF A;  4XOT A;  2EIK H;  3V42 A;  3E97 A;  3JRF A;  1IXR C;  3M8J A;  4AM3 A;  5KVR A;  1FYL A;  2L9N A;  1FSE A;  1GXP A;  2Y1E A;  1NG6 A;  1BI0 A;  1Y0N A;  3LNQ A;  2DA6 A;  2DQR A;  4BAY A;  3VVM A;  4BJT A;  3V7R A;  3WTS C;  1BN5 A;  3E6B A;  2LD5 A;  1HC8 A;  3CUQ B;  4ZQE A;  3KP5 A;  1LFB A;  3PO2 J;  2L7K A;  3WG7 H;  1ZAR A;  3SFZ A;  4L0Y B;  1YW9 A;  4HV6 A;  4NQW A;  2A61 A;  2DOF A;  4HEA 2;  2ZXG A;  4OAY A;  4XBF A;  3GTK J;  1F9N A;  1K83 J;  3RSN A;  3C1D A;  1DP3 A;  1H89 C;  2KRF A;  3ZGK A;  2IPQ X;  4M73 A;  4FE7 A;  2QVO A;  4KYW A;  3FUN A;  2B9S A;  3T5X A;  2BBY A;  1JXS A;  3VSL A;  5L3G A;  2K40 A;  3BZK A;  1D0X A;  4IEJ A;  2IRF G;  1SAU A;  1K61 A;  3WTU C;  4FE4 A;  2LR8 A;  3GTP J;  2QVW A;  5E1Z B;  1N75 A;  2OV7 A;  3DWL E;  4Y3O A;  3IKT A;  1H88 C;  2DFH A;  4EQQ A;  4F7Z A;  4IL6 C;  5DDG A;  1G3Y A;  4F3Q A;  3OSF A;  5JI6 A;  3LST A;  5ED4 A;  3E3V A;  2Z3Y A;  3CP2 A;  2LF7 A;  2GOX B;  4ZW5 A;  5JAZ A;  2EFO A;  4QME A;  2H09 A;  3ZQH A;  1O4X A;  2DN0 A;  2D5V A;  3B2X A;  1VQL I;  4PW4 A;  2VKD A;  5F64 A;  3K69 A;  1ENH A;  1WGX A;  1ZEL A;  2RAE A;  2ZJP F;  3RQ4 A;  1BI1 A;  2AQE A;  2DPD A;  4XMX A;  3K70 D;  3HKZ A;  3BJO A;  1T2K A;  1I3Q J;  4U0V A;  4BXX J;  3JTG A;  2BV6 A;  3OL4 A;  2MG4 A;  4AUX A;  3WTZ A;  3ANL A;  4GO1 A;  1MSE C;  2FOW A;  2O9L A;  2VB6 A;  5K5Q A;  1GHC A;  5ILV A;  3FTS A;  1F36 A;  4MS6 A;  1R22 A;  3W2V A;  3F8C A;  2LFB A;  2EZK A;  2M8G X;  3MD2 A;  4PJN A;  3A4C A;  1BW5 A;  4A5M A;  2UXX A;  1SD7 A;  3G71 I;  2XPZ A;  4KMF A;  3KP2 A;  4ZH4 F;  1X1D A;  2L0K A;  2CUF A;  3K0L A;  4J01 A;  2UWM A;  5B3S H;  1FBQ A;  1WJF A;  1IJW C;  4PUS A;  4WWC A;  5B66 C;  5FRN A;  1W7P B;  3RI4 A;  4BBR J;  3ZMU A;  5AEN A;  4HX7 A;  3G1M A;  2DCE A;  1TNT A;  2VI6 A;  4XKB A;  2W25 A;  4Z6Y A;  1V5E A;  5M3F J;  3FMQ A;  3RAS A;  2BY1 A;  3CLO A;  3RIR A;  4X1E A;  2HYG D;  4XN0 A;  4B44 A;  3A03 A;  4E70 A;  1LDJ A;  1PUF B;  2ELJ A;  1SMY F;  3ECH A;  1KA8 A;  1LFP A;  3B2P A;  2Y0S A;  4D7N A;  2CUE A;  3PM1 A;  5KK1 A;  2JVH A;  1D3Y A;  1GV2 A;  1RNL A;  3P5J A;  4HF2 A;  1R4M B;  1V3F A;  2HWV A;  2DT6 A;  2HDD A;  2Q2E B;  2LMD A;  2CG4 A;  4F93 B;  1U78 A;  2A5Y B;  5LRR A;  3SZP A;  3L2C A;  1R7J A;  2JA7 J;  4QWQ A;  1SAX A;  2VKV A;  2R70 A;  1B8I A;  2HGC A;  2CS3 A;  3JRH A;  3HG9 A;  4CO8 A;  1XGM A;  4QTR A;  2MD5 A;  4LFU A;  5DUK A;  4RS8 A;  2MAO A;  3B3B A;  2OD5 A;  4IHT A;  3CZE A;  4RAG A;  1ETX A;  3LOC A;  2Y75 A;  5EYR A;  5DTD A;  1W1W E;  2DT5 A;  2M5W A;  2W1O A;  2ZFW A;  2E34 A;  3H9Q A;  3HRT A;  4GYI A;  1T39 A;  1FZP B;  4ZW6 A;  4PZJ A;  2ZKZ A;  3QAH A;  3F6V A;  2JD2 A;  1WFX A;  2OQR A;  3QPS A;  4IOA F;  3FH8 A;  5K5R A;  1MJB A;  3OYC A;  3U1D A;  2FU4 A;  1SC7 A;  3WU1 B;  4FLR A;  3ZQG A;  3ABU A;  2GOM A;  3WQQ A;  3LA2 A;  2ZNZ A;  3U1K A;  2Z5U A;  5GPA A;  3ZHY A;  2LOO A;  2X85 A;  3WHC A;  3R61 A;  3GXO A;  1XCB A;  1J75 A;  1X3U A;  2DMP A;  2IA1 A;  2K85 A;  4RGU A;  4E7J A;  3E5X A;  1OFC X;  3K4K A;  4QHP A;  2IAI A;  4PJM A;  2R7X A;  2F4O B;  2AXT C;  2R7O A;  5LEJ A;  3F72 A;  3MKY B;  4P96 A;  1DGW Y;  4ESB A;  3CHO A;  1YJW I;  1AU7 A;  1FLI A;  5D8K B;  5LGN A;  1OCR H;  3NQO A;  1FOK A;  5HNH A;  1POG A;  3HEF A;  3QWL A;  3H1C A;  5ERI A;  2GLO A;  1B72 A;  4U7D A;  1ULY A;  4GXO A;  3ABM H;  1T8I A;  1ZG3 A;  5TJJ A;  1MW1 A;  3JSP A;  3B73 A;  3PSI A;  4OWR B;  3VYT B;  4EEF G;  3B37 A;  4ZQF A;  5M3M J;  2PGG A;  3GO5 A;  3SXY A;  3MVP A;  5BQT A;  5FLX K;  2EB7 A;  2DQL A;  3DP7 A;  3E6D A;  3VOD A;  1IN4 A;  2GA2 A;  2LYC A;  3HHG A;  3TO9 A;  2XC7 A;  2Q0O A;  1IRX A;  2H6B A;  3HC7 A;  3ZMS A;  3K1M A;  2C82 A;  1ON2 A;  2Q2E A;  4RSY A;  1IW7 F;  1Y0U A;  4JX5 A;  5TRD A;  1YOV B;  4I76 A;  4U88 A;  2UZK A;  2Y31 A;  1YTY A;  3M1C A;  2OF7 A;  2XGE A;  4LUP A;  4HBL A;  4KIF A;  1P6R A;  3WU2 C;  2MD0 A;  2PMU A;  1XC5 A;  1HDP A;  3GLX A;  1R00 A;  3OL3 A;  5ICC A;  3GBG A;  4XMV A;  4FLO A;  3C2H A;  2BHZ A;  3OYK A;  4Q48 A;  2A7O A;  3MZ8 A;  3KYL A;  2V9K A;  3ZQL A;  3TW7 A;  3EDP A;  3GX4 X;  5IP9 J;  2HZT A;  4I99 C;  4PSX A;  1B1B A;  4A3B J;  1U6G A;  5DYF A;  3A0B C;  4HQE A;  2EZI A;  4MFE A;  3U9G A;  4BU2 A;  1QPI A;  3CCQ I;  2NXN B;  5JFR A;  3RQI A;  3FUK A;  3JRI A;  1ZAO A;  2KPM A;  3S1Q J;  1YIO A;  1VQN I;  4IF4 A;  4AYB N;  3FUI A;  3I53 A;  1IO2 A;  2LH9 A;  2V4J C;  3BR5 A;  3W3C A;  2HDC A;  4OIR F;  3TO7 A;  1FOW A;  2JZY A;  2ZJ2 A;  2XAQ A;  3X2Q H;  4YFN F;  2X1C A;  2ZSH B;  2GIV A;  2CWE A;  2DYS H;  5DD4 A;  4L5I A;  2M87 A;  2MFZ A;  2WY7 Q;  1GW6 A;  3B7T A;  3ZQ7 A;  2FBI A;  2H8W A;  4L9T A;  3S2D J;  4XID A;  1MW7 A;  2ZFU A;  3ANN A;  3N97 A;  1HKT A;  4NDL A;  2H8R A;  3K4J A;  3W6K B;  3G4S I;  1ZKG A;  3FXJ A;  3F0C A;  3TMO A;  1AKH A;  1K7A A;  4CHU A;  1D5V A;  2UUZ A;  3UKG A;  3ABL H;  3R60 A;  5FLX Z;  3F9K A;  1MMG A;  3ECO A;  4AIJ A;  1Y8R B;  2JPC A;  2JRT A;  3MFK A;  2E2I J;  5GP9 A;  4X0G A;  1TWG J;  3L09 A;  3ZMT A;  4A3F J;  2J5P A;  3PIP F;  1OCT C;  3PUB A;  1FJL A;  2HZD A;  2GXB A;  2LSO A;  2V1X A;  5LGU A;  2RNJ A;  3FU3 A;  2JK3 A;  3LMM A;  4P9U A;  1STZ A;  1R1T A;  4RGR A;  1LDD A;  1KYZ A;  3PQJ A;  3OIQ A;  1X19 A;  1QU3 A;  4PGG A;  3HOU J;  4M3D A;  1PVE A;  2YSR A;  1MNE A;  2ID3 A;  5HLG A;  1ZQ3 P;  2PLY A;  4DJA A;  4OIN F;  5DUL A;  4IHX A;  4KT6 A;  4BY1 J;  3ABK H;  4MGR A;  5J47 A;  4D1Q A;  1TL8 A;  2X0L A;  3RPU D;  4Y4R A;  3KED A;  2ELH A;  3CHS A;  3OYD A;  2NVX J;  1RKW A;  3VEP A;  4JQF A;  2ZXJ A;  3I58 A;  4KP7 A;  4E7L A;  5JMP A;  1WJD A;  5BMZ A;  2F4I A;  2ZO4 A;  2LG4 A;  3CJT B;  1XCV A;  1AHD P;  5DUI A;  4ESJ A;  1YX5 A;  2VN2 A;  3RZD J;  4FLS A;  4WK8 F;  1XMK A;  3GTG J;  4HA8 A;  3L00 A;  5CKT A;  3IL2 A;  5HLI A;  4D7M A;  1UHM A;  3K4C A;  2MA3 A;  2F6C A;  4PDK A;  3DTI A;  4AC0 A;  1ZG1 A;  1Z7U A;  2KIS A;  2XKO A;  5EZH A;  4BEH A;  1GT0 C;  4LLL A;  1TQM A;  2FOK A;  2W85 A;  4A03 A;  1V4R A;  2E5N A;  1ETQ A;  2LY2 A;  2HVR A;  3HHH A;  3OYJ A;  4XO5 A;  2VON A;  4XN2 A;  5CLS A;  1DPU A;  1U9N A;  3HSR A;  2MAB A;  1FEX A;  1V54 H;  1FX7 A;  2Y1G A;  1OJL A;  2DA2 A;  1Z1D A;  2K3P A;  3ANM A;  2ZCW A;  4IJA A;  2GWR A;  2B7E A;  4BDY A;  3WG9 A;  4LG0 B;  3NRV A;  2XAU A;  4GGG A;  2X6O A;  2IS4 A;  4K5N A;  2ICW G;  1TT5 B;  3J7A Y;  2QQA A;  2P8T A;  5L3F A;  1RC9 A;  1ZLK A;  2PX9 A;  3P7N A;  4AVZ A;  4EGZ A;  1ETO A;  2K9L A;  1U0J A;  4KN7 X;  4F91 B;  3A0H C;  2I10 A;  4KDP A;  1BBY A;  1MMN A;  2KIF A;  1K5H A;  2UXN A;  2DOA A;  5KAF C;  3CCS I;  2PBI A;  3M07 A;  4HF1 A;  3LSH A;  1MDM B;  4G12 A;  2HKO A;  4YEL A;  1M1E B;  2L54 A;  4RB0 A;  4XRM A;  2PQ8 A;  3DBH B;  3IP4 B;  5GAE J;  3OYN A;  1RR8 C;  3BDD A;  3W6J B;  2XF7 A;  4CYC B;  1XDU A;  2HU9 A;  3CHQ A;  4ZYE A;  4M6V A;  2D45 A;  3ISP A;  3S3O A;  2DQM A;  4LOC A;  4UV9 A;  5GAD J;  3MMY B;  5C4X J;  1A04 A;  2CH0 A;  3T1B A;  5D8L B;  5A2Q K;  3M4O J;  2QZ8 A;  3I4P A;  1HBX G;  1GDT A;  2GBY A;  2JA6 J;  1P7I A;  2R7S A;  1X3W A;  3E7L A;  4UUT A;  5CQG A;  4HQM A;  1FOY A;  4YG2 F;  5CQE A;  3DF8 A;  4DYQ A;  3LSG A;  4RVB A;  1DUX C;  2V6C A;  3F8F A;  2HTJ A;  3HM5 A;  3QYB A;  4PJL A;  1D1B A;  4CSW A;  4L0Z B;  2R5Y B;  4JK1 X;  3CDI A;  4KIS A;  3L9F A;  2JCV A;  3K2Z A;  2BW3 B;  3OY9 A;  4IO9 F;  2E71 A;  3GWZ A;  1U5T A;  1Y39 A;  1FY7 A;  2MC4 A;  4IQJ A;  2OCE A;  1IDZ A;  3ZR8 X;  3WGH A;  3VFZ A;  2IP2 A;  3KPH A;  3VYU B;  4S0H B;  4CXF A;  1IZ1 A;  1BR4 A;  3T8R A;  2L4M A;  3FUJ A;  2Y69 H;  4IZZ A;  4ZX3 A;  3I9V 2;  3GEZ A;  5IYD J;  4Y6P A;  2EA4 A;  2ZJQ F;  1ONO A;  1S6L A;  2PJP A;  5L3C A;  2R72 A;  1DU0 A;  1KQ0 A;  1B6A A;  1F5T A;  3KEQ A;  4XN1 A;  4M9Z A;  2P81 A;  4JBA A;  5L3D A;  1YG2 A;  4IX7 A;  4A93 J;  3AG2 H;  3BJ6 A;  4XMT A;  3OR1 C;  1EA3 A;  1T08 B;  1LKX A;  3HOZ J;  3OYM A;  1JGS A;  4H4K C;  3CTA A;  5EJC A;  1BOB A;  5ICG A;  4A3D J;  3DBL B;  1B4A A;  3BTC A;  2K02 A;  2ZXI A;  4G94 A;  5JR3 A;  3F23 A;  3LQR A;  3T8V A;  4YEJ A;  2N8G A;  1ONV A;  2VC0 A;  1GV5 A;  1G3W A;  1WZ2 A;  1DDN A;  2EIL H;  1BJZ A;  2KMU A;  4HSR A;  2EPF A;  4XSX F;  3C3W A;  4DZP A;  4BQA A;  4QPE A;  2IGN A;  1W36 D;  4HX4 A;  4M3E A;  3HPG A;  1D0Y A;  5A2Q Z;  1KQ9 A;  1TWH J;  4K2E A;  4Y6R A;  1SAN A;  5IP6 A;  2BXY A;  1BM9 A;  2VPR A;  5IPA A;  3OR2 C;  2FQ3 A;  2VOP A;  2QSF X;  1FT9 A;  1MBG A;  3R0A A;  1MW0 A;  1WPK A;  2PMH A;  2RJI A;  4BHC A;  4UV8 A;  4LIU A;  1Q1V A;  5BOX A;  3T8T A;  1SFK A;  1IC8 A;  4L2L A;  3RJP A;  3AG1 H;  4HYE A;  4KJZ A;  1K4T A;  3EBG A;  4A3M J;  5HDN A;  1XGN A;  4YFK F;  3OSG A;  2HTS A;  1YW8 A;  4BY7 J;  4A5N A;  3NAU A;  5K1Y A;  3F8M A;  4XN3 A;  5LHG A;  1I39 A;  2WAD A;  3CDH A;  3FXK A;  3K2A A;  5EEH A;  2EV6 A;  1QHH D;  2E2H J;  3EBI A;  2MBF A;  1LVA A;  4BH9 A;  4GDF A;  1J9I A;  2M4K A;  3LA3 A;  3LA7 A;  1MMD A;  5ICE A;  2W48 A;  5F1R A;  2LKP A;  2LBF A;  1X2M A;  5FO5 A;  4EJV A;  1UHW A;  2E7X A;  1WVR A;  2DFI A;  2FML A;  3FTY A;  1GXQ A;  2Y9Y A;  4PCQ A;  3A1Y A;  1A6Q A;  5EDN A;  3UR3 C;  1MSF C;  4EAT A;  1SQM A;  3S3M A;  2RNG A;  2PMZ N;  3C2B A;  3F21 A;  2OTJ I;  2KIM A;  2MYS A;  4C9Y A;  2JJ7 A;  1W0T A;  3NEU A;  3H92 A;  4PSW A;  1CGP A;  1ITY A;  4K5M A;  3RKX A;  1RI7 A;  2CUJ A;  2G9W A;  2OU2 A;  4QLC U;  3QYF A;  3ZMZ A;  5HS8 A;  4EGY A;  2XKP A;  4EM0 B;  4JOM A;  2OZ6 A;  5F0C A;  1FYK A;  2QGU A;  4WCG A;  4ZW3 A;  1ZN2 A;  1IRG A;  2K9M A;  5DD8 A;  3L2Q A;  5J4Y A;  3HUG B;  4KT5 C;  1OCO H;  2M2E A;  3PFY A;  3CC4 I;  3FUD A;  2L9S A;  3EET A;  3E6M A;  2HVQ A;  3ZQQ A;  2P7V B;  3LSM A;  2CV2 A;  1FIA A;  1G5A A;  4E4H A;  2HPT A;  1U8B A;  1CF7 B;  5L3B A;  2KP6 A;  2WV1 A;  1X3Z A;  1ETW A;  2O7O A;  3CCE I;  3H0G J;  2FUG 2;  4RBO A;  3RYP A;  3IC7 A;  1REP C;  2LK2 A;  1RR7 A;  3MN2 A;  1JT6 A;  4C3H J;  3H3Z A;  2K4J A;  2XGD A;  2VBW A;  1HOM A;  1HQC A;  3S93 A;  5DM7 F;  1SD4 A;  2R7V A;  1WSU A;  2KJB A;  4BQN A;  1P4W A;  2PJR B;  1S8N A;  4DYC A;  2JUC A;  5FWQ A;  1JKP C;  4HDU A;  5EV7 A;  2CMP A;  2ZME B;  2DJN A;  2JMW A;  2EZL A;  4E7K A;  4CIC A;  3IIE A;  2VKH A;  1NH3 A;  5AON A;  1HW1 A;  4Y6S A;  1OR7 A;  3FXQ A;  3BJA A;  2R7Q A;  4XK4 A;  4XMU A;  4DNC A;  1YJN I;  4C3I J;  3I59 B;  2FNA A;  2VOD A;  4R1H A;  1WKM A;  1Z6T A;  2BHY A;  4OOF A;  3BC8 A;  2KFD A;  3EYY A;  1Z0X A;  3SZG A;  1D8K A;  2VKE A;  5HDK A;  6PAX A;  2IS1 A;  1QRY A;  3UNG C;  2JPB A;  5D4S A;  3HL2 A;  2E2J J;  1DPR A;  5JVT A;  5C44 J;  2F5F A;  4Q4I A;  2O3F A;  4RLQ A;  3L2V A;  1IXC A;  3DKX A;  4R5T A;  2KRH A;  1IRZ A;  2HDW A;  1WJC A;  2HQR A;  1JT0 A;  1O7L A;  4S04 A;  1JTY A;  1VTN C;  1D1A A;  3I54 A;  3HUG A;  1LVK A;  3REO A;  4RLF A;  3QOP A;  1QNT A;  3OS0 A;  3FHZ A;  2E1C A;  4LK0 F;  3OYF A;  1IRF A;  1S72 I;  2GAU A;  3ZCO A;  3BG9 A;  2JD1 A;  2HPO A;  4WX9 A;  1TC3 C;  4XNF A;  2IA0 A;  2W24 A;  2YPR A;  2XQ0 A;  3HGG A;  2IVM A;  3OYG A;  2HEO A;  2XAG A;  1YFH A;  1JUP A;  2CSO A;  1W5T A;  2PUS A;  5EEA A;  2XB5 A;  1ZH5 A;  2HR3 A;  1SVL A;  2NYX A;  3GFM A;  3DKY A;  3TBI A;  1ZLJ A;  2L7F P;  3JSZ A;  3Q0U A;  3WQR A;  4YFX F;  2L02 A;  4FX0 A;  2R7Z J;  3CJQ B;  5LHI A;  3IHU A;  4DW6 A;  3CJR B;  5JBI A;  2BY2 A;  3BPV A;  3K1P A;  1KU9 A;  5LHH A;  3IH3 A;  4L18 B;  3ZHX A;  4Y15 A;  3OYI A;  4GYG A;  5EG0 A;  3FXO A;  3CMM A;  1SG7 A;  1X4O A;  2EFQ A;  2CQ7 A;  2EFP A;  2HOT A;  1W4M A;  1ACI A;  2IW5 A;  1W5C C;  3ZMV A;  1IV8 A;  2K86 A;  4NC7 A;  2P6S A;  3IKV A;  4GFB A;  1XTA A;  2PFB A;  3DPU A;  3CXB A;  4UUS B;  2DA5 A;  4O3M A;  1ZGJ A;  4RDU A;  3H5A A;  1I3A A;  2IEK A;  1HKS A;  3CUQ A;  3GUD A;  1SMT A;  1YS6 A;  2LRE A;  2O03 A;  2DYR H;  3ML6 A;  1XS9 A;  1X1A A;  5F04 A;  2A3S A;  2DAO A;  2QSH X;  2JUG A;  4RB3 C;  3OOU A;  1LNW A;  3BR3 A;  3QU3 A;  1TLH B;  3RCO A;  4IQ4 A;  5KNL A;  1U5T C;  4OIQ F;  2H1L A;  3DLA A;  3BG5 A;  4I0B A;  3CZK A;  3RTR A;  3Q43 A;  1DQU A;  4L9N A;  5GPC A;  2LNB A;  2Z9O A;  2OTL I;  1SD5 A;  1JVS A;  3RPQ A;  3I0T A;  5J1U A;  5C3E J;  4W1U A;  3G6E I;  4RGX A;  2WAQ A;  1O3S A;  1H8A C;  3EQL F;  5J40 A;  1J59 A;  3ZOB A;  4L5J A;  2XDV A;  1YI2 I;  4B4C A;  4XIC A;  1T56 A;  2CRG A;  3QOE A;  2AQF A;  2CUZ A;  4EVI A;  4A3K J;  5DCM B;  2G7U A;  2LLK A;  5EGO B;  1J09 A;  4Y67 A;  4CZC A;  5L3E A;  3VVL A;  1X4P A;  3J80 K;  2MW8 A;  1OIS A;  2KQR A;  3ABT A;  2O5R A;  4R7L A;  3QPL A;  2R4G A;  2KIQ A;  3CF5 F;  2P7C B;  2DA7 A;  5FGM A;  3GZN B;  4HNT A;  3BRO A;  1TBX A;  5GTH C;  4IKF A;  2CYY A;  4FHT A;  3F8N A;  1WI9 A;  2V7F A;  3OIO A;  5JO0 A;  3PFI A;  3ASO H;  2FMY A;  4LMY A;  4DBQ A;  1H0M A;  4LLN A;  1N25 A;  2ISZ A;  2COB A;  3WTT C;  1QZE A;  2LKX A;  4RB1 A;  3SFI A;  2BY0 A;  1R23 A;  1IV6 A;  3FUE A;  4AIC A;  1IUF A;  3E5U A;  4IHS A;  1YO5 C;  3QJX A;  3H5N A;  5E18 F;  1QZY A;  2HKX A;  4HG2 A;  3BG3 A;  1APL C;  2LP0 A;  2OZU A;  2XRN A;  1R1V A;  4HLX A;  2YR2 A;  4B8X A;  2VUM J;  2G0E A;  2FFL A;  3HOT A;  2DU9 A;  4CCM A;  3QU6 A;  1G4D A;  3DEU A;  5CYV A;  3I5U A;  2DQ6 A;  3TOB A;  2D1H A;  1K6Y A;  2ACJ A;  1FPQ A;  3DV8 A;  4DOZ A;  1P9Q C;  4BHP A;  2VLA A;  1XMX A;  4PJJ A;  2KLO A;  3J7Z I;  2ZBK A;  1W7P A;  1JHF A;  3CJN A;  2WZF A;  1EKE A;  3EYI A;  3FTX A;  1NHA A;  4HW0 A;  4NC6 A;  4J00 A;  5GTI C;  1FTZ A;  2VJ5 A;  4G7H F;  2Q1Z B;  1PUF A;  2VJJ A;  3VYR B;  2ESH A;  3O8G A;  3L2W A;  2M34 A;  4I09 A;  3IAM 2;  3V7S A;  1BA5 A;  3O3K A;  2XRL A;  3TQN A;  1S9H A;  2KKO A;  1ZS2 A;  2DK5 A;  1XGO A;  2CQX A;  4LIT A;  3IRR A;  2IA2 A;  4ZQG A;  2GIZ A;  2VQC A;  1TWA J;  3KET A;  5E3N A;  2EGH A;  2R93 J;  2R7R A;  3IRQ A;  4HLY A;  2C6Y A;  3MQ0 A;  4ENK A;  3GTL J;  2NS0 A;  4AVP A;  2YX4 A;  2HS5 A;  2P6T A;  4P5O A;  2XVC A;  4G7Z F;  3QYE A;  2KL4 A;  3HRS A;  4EV0 A;  2B63 J;  4HZF A;  3T0Y A;  1RUN A;  2M0C A;  3D5L A;  1R71 A;  3QPT A;  3KCC A;  2P0W A;  4B09 A;  3KIO A;  4NB5 A;  1JJ8 C;  3ZRG A;  4XMW A;  1VZ0 A;  4YIF A;  1WH7 A;  2VBY A;  2X1E A;  3BR1 A;  1YIJ I;  2E19 A;  3A01 B;  5J8F A;  1SVO A;  4M9X A;  4XNB A;  2E7W A;  1Q1H A;  1UB9 A;  4BUP A;  3I64 A;  4OMY A;  1MH3 A;  3CHR A;  3DTK A;  2E1M B;  3MCZ A;  1MIJ A;  2OJE D;  4ZDP A;  3IWF A;  2JSP A;  4EJT A;  4BE0 A;  5D5V B;  3DEE A;  4OMZ A;  2Z1D A;  1OR7 C;  4IRG A;  4CA0 A;  4ZYG A;  3R0I A;  2CW7 A;  5EEG A;  2EQR A;  2FNP A;  3J81 K;  4HRI A;  2ETH A;  1PJR A;  2QSG X;  5HS7 A;  2HXI A;  1SFE A;  1S29 A;  2CFO A;  3DTE A;  2VE8 A;  2WZG A;  3GCM A;  2OCC H;  3IWZ A;  3OWT A;  4BBS J;  4LLG F;  1UG0 A;  3DFG A;  2R7U A;  3ONQ A;  4I01 A;  1SVM A;  1EH6 A;  3ERE D;  2K4B A;  1XSX A;  2D1V A;  5D5X B;  2QQ9 A;  2WB1 N;  3EUH A;  2DLL A;  1PP7 U;  1RET A;  2VQG A;  5FKL A;  2JA5 J;  1R0K A;  2FSW A;  1L0O C;  5IT3 A;  3U21 A;  1KYW A;  2CQK A;  2QM3 A;  2O8X A;  1K78 B;  4Q4Z F;  2QA4 I;  3AL0 C;  4C3J J;  4BJ6 C;  4ON0 A;  1QO0 D;  2WPG A;  4UNO A;  3COA C;  2VBX A;  1Z6R A;  2E60 A;  5FFX A;  2IXS A;  1JKO C;  4XSZ F;  3N05 A;  3SEZ A;  4FAS D;  2R5Z B;  4B1R A;  3FHN A;  1E2X A;  4ZQH A;  2FRH A;  4C2T A;  2KZV A;  1UMQ A;  3BR0 A;  4D9J A;  5GAG J;  3HSE A;  2LF8 A;  1YQA A;  3FXM A;  4F52 A;  1T95 A;  4P55 A;  2WBM A;  1HDD C;  3GTQ J;  3RC8 A;  4MO7 A;  3KE2 A;  3HB9 A;  4XMZ A;  2KDO A;  2XPU A;  2HPI A;  3D1N I;  4GAE A;  2GM4 A;  5FRM A;  1Z05 A;  3LSI A;  2X6Y A;  4MEX F;  2OA4 A;  1ZR2 A;  2Z16 A;  1X1B A;  4QSH A;  3G3Z A;  4BL0 B;  2W7N A;  4B48 A;  3M1E A;  3A14 A;  3QQA A;  1X58 A;  3WHB A;  3PIO F;  1YJ9 I;  5J6X A;  5D5W B;  2ECC A;  3S32 A;  1Q0L A;  2V1N A;  3DKW A;  3E1S A;  5CJ9 A;  4B3X A;  4EM1 A;  2K7L A;  1QGP A;  2DA4 A;  2DMQ A;  4W97 A;  3CP8 A;  3FBI B;  2CGP A;  5KAI C;  1ETY A;  5FLM J;  3SDG A;  4M72 A;  4BXU A;  3B6C A;  3S1R J;  5ICF A;  1N77 A;  1HXD A;  4A3E J;  5FKN A;  4QUO A;  2LY1 A;  3H9J A;  1F4K A;  3VSK A;  2M7A A;  1ZK8 A;  3M8E A;  4XMY A;  3JAM K;  2YS9 A;  2L2O A;  1Y6I A;  1TNS A;  3ZN1 A;  4Y52 J;  3L1P A;  1AWC A;  3C2G A;  1Z9C A;  2M1B A;  2GXG A;  4XN7 A;  3OV8 A;  3CCR I;  2B0L A;  3S8P A;  4D5F A;  3BTI A;  3CUQ C;  2Y9Z A;  3S17 J;  4P9F A;  4A0X A;  5BPP A;  5K5O A;  3KX2 A;  4B43 A;  2WV0 A;  2JA8 J;  1FMW A;  1MKM A;  3R0J A;  1YRN B;  1E3O C;  3IH4 A;  1SC5 A;  3LQQ A;  1IN8 A;  2XPW A;  2VQH A;  5CVI A;  2O61 A;  3QP5 A;  4KUM A;  2MH9 A;  3TDZ C;  2DO7 A;  3QP6 A;  3H9G A;  4GRI A;  1XX5 A;  5AIQ A;  1RUO A;  2X6X A;  3S2W A;  1WH5 A;  1JKQ C;  2QBY B;  2CJJ A;  2JT1 A;  3JRC A;  5BPI A;  4A69 C;  1UJ8 A;  4R5V A;  5B5E C;  3HTU A;  3LL7 A;  3M3Y J;  1PYV A;  3GZ5 A;  3L7W A;  1NTC A;  2XPY A;  5IY5 H;  3FU6 A;  4BKX A;  4HV5 A;  2QYO A;  4QIW N;  3JW4 A;  4HPQ A;  3A2K A;  1U3E M;  5E8G A;  2QQ8 A;  1WJ5 A;  3M7G A;  3KP6 A;  1T1S A;  4IRI A;  5FKO A;  2CV0 A;  3S2H J;  2VJ8 A;  3HKZ N;  2Y1F A;  4XO4 A;  1P4X A;  2R92 J;  2HI3 A;  1VQ6 I;  3TOA A;  4GAA A;  2L5Q A;  2OQG A;  5H6R A;  2G7H A;  2VQL A;  3WE2 A;  4HNV A;  1KU2 A;  5J3L A;  3AG3 H;  3DU6 A;  2XGX A;  4ZQT A;  4XKW A;  2K27 A;  4ABZ A;  3TP0 A;  4UUV A;  3VDX A;  3BR6 A;  4L9J A;  1RKT A;  2EJR A;  3ZXS A;  1UZC A;  5FB2 A;  2F5D A;  1YIT I;  1BOA A;  3PNY A;  4MLO A;  3D0S A;  3KEY A;  1CQT A;  4UVC A;  3G73 A;  3S16 J;  1AOY A;  4YIR X;  1PDN C;  3FUM A;  4LG0 A;  4XOR A;  1MBF A;  1ZR4 A;  4BJ5 C;  3B7R L;  1WJE A;  5B1A H;  3RDI A;  1ODD A;  1FC3 A;  3BQZ A;  2TCT A;  1LE8 B;  1ZG5 A;  2WAF A;  1T6S A;  1R58 A;  3HOX J;  4IXA A;  3S1M J;  4UXN A;  1HF0 A;  2JSC A;  4G7O F;  1R5I D;  2W4S A;  3IUO A;  4ZZL A;  4RB2 C;  3C7J A;  2CW0 F;  2Y0S N;  5TIS C;  2K3F A;  2XPV A;  1MDM A;  3OOP A;  4XKV A;  4BNC A;  1ORK A;  1Y1V J;  5KHD A;  2IJL A;  2YU9 J;  1TQP A;  2EV5 A;  3HXL A;  3HSF A;  2VIX A;  4CYC A;  1Z7L A;  1Z91 A;  4XND A;  4HX8 A;  2DW4 A;  3EBH A;  3GW2 A;  2ESN A;  1XSD A;  1S3J A;  2M3A A;  2RRE A;  2VBZ A;  1Q0Q A;  3PL8 A;  1NG7 A;  4XOP A;  5TGT A;  3ZQF A;  4ASN A;  1A35 A;  2HYJ A;  3BCB A;  2KRC A;  3BLY A;  4K5P A;  3FKJ A;  5M5Y J;  1R9T J;  3FH5 A;  3UER A;  3K9T A;  1VFC A;  1OMI A;  3FZV A;  4ZYA A;  4MHG A;  1TQI A;  3EUA A;  4ZYH A;  1MNM C;  4OOI A;  3FTZ A;  1O3R A;  1IG7 A;  1J5Y A;  5ILS A;  3V7C A;  3M8F A;  2XIG A;  4RMN A;  3WQS B;  2MSY A;  2R7D A;  2R5Y A;  3Q44 A;  1WRJ A;  2TDX A;  4OU0 A;  2COM A;  3JRD A;  5H6Q A;  2BW3 A;  2EBI A;  3FUH A;  2DT7 B;  2KHM A;  3LAJ A;  2DBB A;  5K7Z A;  1S7E A;  4L9V A;  5D5U B;  4HF0 A;  1ERD A;  1JHH A;  1VQ4 I;  4E7H A;  1X1C A;  4EJW A;  2DXI A;  1R5G A;  4L5E A;  5E3L A;  1I5Z A;  4N9H A;  3C18 A;  5F27 A;  1IAW A;  1MBE A;  2P4W A;  1LEA A;  2FA5 A;  3CZ6 A;  1Y1W J;  4XLN F;  3FK7 A;  4CCN A;  3ESW B;  5CVV A;  4MKT A;  2MLG A;  2XGC A;  5DV5 A;  1TT0 A;  4WXC A;  4I2O A;  1V5G A;  1TP4 A;  4XON A;  2HQ5 A;  2A6T A;  3BTL A;  1ZRE A;  1IN5 A;  4A0Y A;  4HDV A;  3BZ6 A;  4AYB A;  4IRH A;  3JRB A;  3HW2 A;  4F55 A;  3FXR A;  5JLX A;  3EUK L;  1U9O A;  3S1N J;  2FJ1 A;  3PO3 J;  3BY6 A;  3H3V K;  1FBS A;  1R6R A;  5M5W J;  2X6W A;  4O6J A;  4KIG A;  2EFN A;  4J19 A;  2DDA A;  2DTR A;  3K4L A;  2UV1 A;  3TDU C;  2IBD A;  3EUH C;  1XPX A;  4A3L J;  2LRD A;  2DA3 A;  4XLC A;  4UB6 C;  2VC1 A;  1IXS B;  1KGS A;  1JGI A;  2HNH A;  3VOE A;  4ZW7 A;  5LBQ A;  4AWX B;  3HBL A;  3OMY A;  4HST A;  4V2G A;  2EZH A;  2J5O A;  4YII A;  2EA2 A;  4BS9 A;  1F43 A;  4M74 A;  2QUF A;  2XAF A;  3RC3 A;  1U8R A;  1ON1 A;  3PNV A;  1TWF J;  4ENJ A;  3RZO J;  4D0P A;  1EH7 A;  2QEX I;  2M9H A;  1HA8 A;  4ZX4 A;  4BHB A;  1O3T A;  1VQ8 I;  5IYB J;  1JTX A;  3N4M A;  4LG3 A;  4FCA A;  2DA1 A;  2DFF A;  3K4M A;  1R36 A;  4NNJ A;  2DMN A;  1MMA A;  3E5Q A;  1ZRF A;  1XMA A;  2O8K A;  2ID6 A;  5FKK A;  5DLL A;  1JUS A;  5JVG F;  2O0Y A;  1XG1 A;  2NAZ A;  1ZRD A;  4OIP F;  2JVG A;  5JHU A;  1OLT A;  3HOY J;  4U87 A;  3H0D A;  3U2R A;  3H3U A;  4Y33 A;  5BS6 A;  5LGT A;  4MFD A;  4ZN6 A;  3P9C A;  1Z77 A;  1E17 A;  2XSD C;  3TED A;  3K6G A;  2ZXW H;  2L4A A;  1K79 A;  3HDD A;  2L9R A;  2MC3 A;  3CLQ A;  4DBR A;  2E36 A;  5LEK A;  2PEX A;  2Q8K A;  4UY8 I;  2WY8 Q;  4CH7 A;  2ZJR F;  3DU5 A;  2V6E A;  4NUB A;  3Q9S A;  4FET A;  2A6H F;  2H6C A;  3G1L A;  4RA2 A;  2HFH A;  3MZH A;  4G8X A;  3SQN A;  1I1G A;  3BQY A;  2OPT A;  2STW A;  2F2E A;  3JRE A;  3VB2 A;  2BGC A;  2M45 A;  4N4O B;  1LUJ B;  1UG2 A;  2HOE A;  3CUO A;  4MIM A;  4XRS G;  3FF5 A;  2DFE A;  3BTJ A;  3R4K A;  1L3L A;  5IT9 K;  2EIN H;  2DI3 A;  2NS8 A;  4FT8 A;  3CZG A;  4M3B A;  3FH7 A;  2PN6 A;  4X6A J;  2E1O A;  5FLV A;  4MQ9 F;  5F0F A;  4E6K G;  5HS9 A;  5IOZ A;  3O6B B;  1CF7 A;  2RN7 A;  5E3O A;  5JNL A;  2DDB A;  3QPH A;  4E7S A;  4M9S A;  2ME0 A;  1QHG A;  1E3P A;  3R6S A;  5DEQ A;  2QKM B;  2XHK A;  1YS7 A;  4PFO A;  2EIM H;  4ZX5 A;  3KEO A;  1T1R A;  5CVJ A;  1FBU A;  1WWX A;  5M5X J;  1A5J A;  3CIA A;  3KP7 A;  3FIW A;  3MEX A;  1Z3Y A;  2PJR A;  2M8E A;  2VL8 A;  3B6A A;  3W2A A;  2ZME A;  4Q4E A;  4R5X A;  2HVS A;  1UHS A;  4XN9 A;  5HLH A;  4E7Z A;  2KIU A;  3UCQ A;  3GFJ A;  2ISY A;  2QJ1 A;  1RZ4 A;  2XRO A;  4XRF A;  3GTM J;  1P7J A;  2W84 A;  4TV7 A;  3PUU A;  3WU0 A;  2Y2Z A;  3OS2 A;  3CCM I;  3I59 A;  1N78 A;  3FX3 A;  4II2 A;  1VQK I;  5CPR B;  4M71 A;  1IN7 A;  1TW3 A;  1HW5 A;  2XAJ A;  1Z3X A;  2JCY A;  3PSF A;  1ETV A;  4ESF A;  2Y1D A;  5EZG A;  2FE3 A;  3BCA A;  4A3G J;  1B8I B;  1FYM A;  3Q0W A;  4KNY A;  1OCZ H;  2KJC A;  3FK6 A;  1ZRC A;  4FTH A;  2HOS A;  3AAF A;  3CO6 C;  1ONP A;  3J7A O;  3FTV A;  1RIO H;  5IT9 Z;  5E3M A;  2EV0 A;  2JRM A;  4NBQ A;  4N9I A;  2KT0 A;  1MZB A;  1WJA A;  1O3Q A;  1MVY A;  4U0Y A;  4A12 A;  1G3S A;  1FMV A;  4MEY F;  3AKZ A;  3L2R A;  3PQK A;  4KN4 X;  1WQ2 A;  2STT A;  1O57 A;  3HRM A;  1OYW A;  4QPQ A;  1E3H A;  3GLL A;  2R0Q C;  3H35 A;  1WCM J;  2FX0 A;  3BG6 A;  2Y1C A;  3PNT A;  1T0F A;  3Q5F A;  1BR1 A;  2KZG A;  3WTV C;  2MGQ A;  2LC2 A;  2IGO A;  3SHF A;  3QRF F;  3KYD B;  3D5R C;  1SFO J;  3F8B A;  4ZDL A;  3JR9 A;  1P2F A;  1HSJ A;  1SFX A;  4MTE A;  2GQQ A;  3FUL A;  2KDZ A;  2C5Z A;  2IT0 A;  3BG7 A;  1B72 B;  3H5R A;  4LIV A;  4CCJ A;  4E7I A;  1YX3 A;  2ELK A;  5JHF A;  3ZQC A;  1W7P D;  1MW3 A;  3NAR A;  5LFA A;  4BXF A;  2BE5 F;  2HQN A;  5BPD A;  2VPL A;  3RKW A;  2RDP A;  3KZY A;  3CCJ I;  5K7F A;  2PG4 A;  2A5W A;  3BP8 A;  2RVC A;  3B02 A;  4M6X A;  2EK5 A;  2WA0 A;  3GFI A;  2OAZ A;  2H94 A;  4XN5 A;  4XN8 A;  2CQQ A;  1LEB A;  4RAZ A;  3S15 J;  4ZX6 A;  2VT3 A;  4NC8 A;  3ULQ B;  4A6D A;  4UUS A;  3CD6 I;  2RKH A;  5J1R A;  3HOS A;  3FWE A;  1VQP I;  4OIO F;  3NWT A;  3K4B A;  1QBJ A;  3KLN A;  2ZXH A;  4WF2 A;  3AFH A;  1V5F A;  1TTY A;  4I98 B;  1SFU A;  1H3L A;  3FUF A;  2LVS A;  3FBN B;  3BR2 A;  3GZ6 A;  2DPU A;  4XR6 A;  5D6F A;  4KA4 A;  2XSJ C;  3CC2 I;  2FQ4 A;  4M3G A;  3TO6 A;  2P5L C;  1B9N A;  1B9M A;  4WXD A;  3I56 I;  4AR1 A;  1GLN A;  1K6O A;  2GA1 A;  4N4N B;  3LWF A;  2FXA A;  1VQ9 I;  3CME I;  2BY3 A;  3FHE A;  2WAE A;  2X9D A;  1G6N A;  1U2W A;  1XN7 A;  3FIS A;  5EF6 A;  2M4G A;  3HOW J;  5FKM A;  3J80 Z;  3HTS B;  2BYV E;  5DCM A;  2L3D A;  5EGO A;  3FXU A;  1S7O A;  3CMA I;  4EM2 A;  5HNF A;  1LFU P;  3QOD A;  3K10 A;  3ZQI A;  3JT1 A;  1W36 C;  1V55 H;  4FQG A;  2P5K A;  2PMZ A;  3WGI A;  2XF5 A;  3CES A;  1HS6 A;  4RAF A;  3ZP5 A;  4FCY A;  3FMS A;  1MGT A;  3FDY A;  4MQV A;  3TGN A;  4V2F A;  2ZB9 A;  1BR2 A;  3LSK A;  2P5V A;  1AKH B;  2K9S A;  2CFX A;  2L7M P;  4DQ2 A;  2R3S A;  3DPT A;  4UB8 C;  2JN6 A;  1SEU A;  3TL4 X;  3H36 A;  4AYS A;  1H9T A;  5JMW A;  2CU7 A;  1B59 A;  4ZW8 A;  4A3I J;  2DTZ A;  2L01 A;  1T98 A;  2E5Z A;  3GYH X;  1ZHF A;  4C2U A;  4LB5 A;  2RV8 A;  2HPM A;  4GCV A;  1JGG A;  3HYI A;  1GVJ A;  3WTX C;  1XGS A;  4II3 A;  4MTD A;  2NOJ B;  5DYM A;  2XV4 S;  2YX7 A;  3SYT A;  2O7G A;  2F5C A;  4JND A;  4ENM A;  4EJO A;  5D4R A;  4G9Y A;  3L2U A;  4UVA A;  3CZL A;  1UEL B;  1HCR A;  2IS2 A;  5J1Y A;  2BVL A;  4ZTF A;  3FMR A;  4KFC A;  4IHY A;  3G1O A;  3I55 I;  1USS A;  2A05 A;  3ZMD A;  1OQY A;  1FP2 A;  1OCC H;  2A68 F;  1H9G A;  1OCP A;  1MBJ A;  2CQN A;  4B3A A;  1AA7 A;  1P92 A;  4M3F A;  1R49 A;  2FBK A;  1VQ7 I;  3FU0 A;  2CW8 A;  3LFU A;  1MJ9 A;  3BZC A;  2X1D A;  4AIK A;  4CCK A;  4AID A;  2NS7 A;  4YRV A;  3SDB A;  2MLK A;  3GF2 A;  1GVD A;  4IVN A;  4J3B A;  1QVU A;  2ZC2 A;  1D0Z A;  1QQI A;  1JI8 A;  1LDK B;  3CF2 A;  2I5U A;  1OYI A;  3F6O A;  1BW6 A;  4ARF A;  3DEW A;  5IP7 J;  5CVU A;  3W2W A;  3LSR A;  1OPC A;  3CQZ J;  1D1C A;  2Y30 A;  1KQ8 A;  4BEH B;  1DGR M;  3RYR A;  4AR9 A;  2OC6 A;  3ASN H;  3BWG A;  2F5V A;  4N0B A;  3AU9 A;  3J7Y J;  4PU2 A;  4ZZD A;  2MH2 A;  1BI3 A;  3A06 A;  2VJ4 A;  1E0E A;  2EIJ H;  1T38 A;  4CYD A;  3HJE A;  4XLP F;  1XD7 A;  4IPA A;  3E6C C;  3CCU I;  3OIP A;  4XLF A;  4DYR A;  1QA6 A;  3KLO A;  5ILU A;  2BEO A;  1J0R A;  4O5V A;  1K4S A;  2YU3 A;  4WXH A;  1BIA A;  5FRO A;  2H27 A;  4PK4 A;  9ANT A;  4G6T B;  5HOO A;  3MAJ A;  4I02 A;  1ZGA A;  5E1W A;  3JSO A;  3CO7 C;  3W6V A;  3O8H A;  1EV7 A;  3FXL A;  4I6Z A;  2HQA A;  3B7U X;  5JLW A;  3WGG A;  2Z99 A;  4HNU A;  2LTP A;  2W00 A;  1KON A;  4KIT B;  4XL9 A;  4R8H A;  3HZJ A;  4JX4 A;  4U0W A;  3A01 A;  5FFZ A;  2Y0M A;  1IN6 A;  4LGW A;  4AIH A;  1MD0 A;  1ONN A;  3M9A A;  4KIC A;  2XF6 A;  5J4V A;  2F4M B;  3TP3 A;  2ZME C;  3GTO J;  4HOB A;  1VQ5 I;  4RCV A;  2E1N A;  2NVQ J;  3CHP A;  2QCO A;  3J81 Z;  1BI2 A;  2IGK A;  3EPZ A;  1JKR C;  2W57 A;  2M7B A;  3K7A J;  3SZT A;  1J2X A;  3FTW A;  1KU3 A;  4BQQ A;  4XO3 A;  2EFW A;  2Z2S B;  1HLV A;  3V8L A;  4PGH A;  3WOD F;  2F48 A;  5F0H A;  2VE9 A;  1A31 A;  1X3W B;  3NWS A;  1RP3 A;  2QQB A;  3WTY C;  1DU6 A;  1LQ1 A;  3IAS 2;  2R7W A;  1J7K A;  2NVU B;  1VND A;  2Z33 A;  4JP0 A;  1PUE E;  4XM3 A;  4BYY A;  2M0M A;  2JA2 A;  1EH8 A;  4LD5 A;  2HYF A;  2VAS A;  3ZPL A;  4Q5S F; 
#chains in the Genus database with same CATH homology
 1B72 A;  2JV7 A;  5K7Z A;  1S7E A;  3B34 A;  2L7F P;  1X2N A;  3AUA A;  1MW1 A;  3JSZ A;  3Q0U A;  3WQR A;  3B37 A;  2DMU A;  4EEF G;  3GTJ J;  2R7Z J;  3AU8 A;  5DS9 A;  4ZQF A;  5M3M J;  4DW6 A;  3I4M J;  2PGG A;  3MVP A;  5JBI A;  4L5E A;  5E3L A;  3ZHX A;  3IH3 A;  4JX6 A;  2R5Z A;  5EG0 A;  5F27 A;  2C82 A;  4RSY A;  1MBE A;  4D5C A;  1SG7 A;  4JX5 A;  1TWC J;  1Y1W J;  3FK7 A;  4I76 A;  4MKT A;  2Y31 A;  4LUP A;  2XGC A;  2OF7 A;  2XGE A;  2HOT A;  2HXO A;  3SJM A;  1BL0 A;  1XC5 A;  1HDP A;  2HQ5 A;  3GBG A;  4GFB A;  4XMV A;  4FLO A;  3BTL A;  4UUS B;  2DA5 A;  4RDU A;  3JRB A;  2A7O A;  2IEK A;  5C4J J;  3ZQL A;  3TW7 A;  5JLX A;  5IP9 J;  1U9O A;  3S1N J;  1G2H A;  2FJ1 A;  1XS9 A;  3PO3 J;  5F04 A;  4A3B J;  3H3V K;  5DYF A;  3ZI0 A;  2EZI A;  4MFE A;  2LY9 A;  3OOU A;  1ZTR A;  5M5W J;  1QPI A;  2K9Q A;  3BR3 A;  4J19 A;  4XN4 A;  3RQI A;  3FUK A;  4A3L J;  2IBD A;  3JRI A;  3BG5 A;  3CZK A;  2FD5 A;  3S1Q J;  3Q43 A;  2DA3 A;  5HLT A;  2B61 A;  5GPC A;  3FTU A;  4XRS A;  1JGI A;  4AYB N;  3FUI A;  4ZW7 A;  1JVS A;  4AR8 A;  3BR5 A;  3HBL A;  4V2G A;  2EZH A;  5J1U A;  5C3E J;  4W1U A;  1W0U A;  1F43 A;  1JUM A;  2GTQ A;  1H8A C;  3RC3 A;  4QIR A;  3ZOB A;  1TWF J;  4B4C A;  4XIC A;  1WI3 A;  1T56 A;  3RZO J;  2CRG A;  4ZX4 A;  2M9H A;  1VF9 A;  4A3K J;  1GW6 A;  3B7T A;  1IDY A;  5EGO B;  2LLK A;  3S2D J;  4OOE A;  4XID A;  5IYB J;  3ANN A;  1JTX A;  4Y67 A;  4NDL A;  4FCA A;  2DA1 A;  2H8R A;  3VVL A;  2DMN A;  2MW8 A;  1ZKG A;  1GUU A;  3F0C A;  2O8K A;  4R7L A;  1AKH A;  2ID6 A;  5FKK A;  3QPL A;  4K5O A;  3UKG A;  1R0L A;  5DLL A;  1JUS A;  2WAQ N;  2DA7 A;  1XG1 A;  2E2I J;  5GP9 A;  3HOY J;  1TWG J;  3FTS A;  2AHQ A;  4A3F J;  1OCT C;  3IV5 A;  1FJL A;  4MFD A;  1YRN A;  4ZN6 A;  2ECB A;  3OIO A;  3FU3 A;  5JO0 A;  1Z77 A;  2JK3 A;  3Q0V A;  1RES A;  2TRT A;  5JMW A;  2XSD C;  3TED A;  3HDD A;  2COB A;  2L9R A;  4FLQ A;  2YUS A;  2LKX A;  2L7Z A;  3SFI A;  1ETK A;  3JRG A;  4Y7N J;  1IV6 A;  2XB0 X;  3FUE A;  4AIC A;  3HOU J;  1IUF A;  4M3D A;  2ID3 A;  3G1L A;  2NOG A;  1ZQ3 P;  3VPR A;  3QJX A;  5DUL A;  4IHX A;  1IGN A;  3BG3 A;  1APL C;  2LP0 A;  4BY1 J;  1MH4 A;  3BQY A;  2OPT A;  2JWT A;  3JRE A;  2FFL A;  2VUM J;  2G0E A;  1UG2 A;  4MIM A;  4XRS G;  4IHW A;  3BTJ A;  3KED A;  3CHS A;  2DQ6 A;  2NS8 A;  2NVX J;  1RKW A;  3CZG A;  4M3B A;  2JCX A;  3FH7 A;  5K7H A;  5IOY A;  4X6A J;  2E1O A;  4KP7 A;  3DCF A;  5FLV A;  5JMP A;  2VLA A;  5F0F A;  5IOZ A;  1AHD P;  3MKL A;  5E3O A;  3U9W A;  2X48 A;  5JNL A;  4PVB A;  3RZD J;  4FLS A;  3GTG J;  1MW2 A;  2ME0 A;  3JRA A;  1FIP A;  2WZF A;  1FTT A;  4D7M A;  3FTX A;  4AC0 A;  4ZX5 A;  2HOA A;  1T1R A;  2JD0 A;  1Q0H A;  5EZH A;  3CIA A;  5M5X J;  1GT0 C;  1A5J A;  1FTZ A;  1EF4 A;  3FIW A;  1PUF A;  4A03 A;  1ETQ A;  1BA5 A;  3O8G A;  2M34 A;  4XO5 A;  2XRL A;  3FKI J;  3B6A A;  4XN2 A;  3CCY A;  4R5X A;  1U9N A;  1ZS2 A;  4Q4E A;  1UHS A;  3TW6 A;  1JJ6 C;  1FEX A;  3FU5 A;  2CQX A;  4XN9 A;  3UCQ A;  4ZQG A;  2Y1G A;  1OJL A;  1MBH A;  2DA2 A;  2QJ1 A;  3CMY A;  3ANM A;  4X2U A;  1TWA J;  3GTM J;  1P7J A;  5E3N A;  5FJ8 J;  2EGH A;  2R93 J;  3HOV J;  1H19 A;  1LE8 A;  3PUU A;  2Y2Z A;  3GTL J;  2X6O A;  4K5N A;  4DPR A;  2EH3 A;  2K9N A;  4K5L A;  4A3J J;  3UEQ A;  2JCY A;  5F1J A;  5BNG A;  1ETV A;  1MBK A;  2Y1D A;  1ETO A;  5EZG A;  2B63 J;  4A3G J;  1RPW A;  3T0Y A;  1B8I B;  4DZJ A;  2I10 A;  2M0C A;  3Q0W A;  1K5H A;  3BT9 A;  3FK6 A;  3IH2 A;  4FTH A;  2HOS A;  1ONP A;  3FTV A;  3S14 J;  4G12 A;  4XRM A;  3B7S A;  1JJ8 C;  4XMW A;  5E3M A;  3Q3S A;  2MAP A;  1WH7 A;  4A3C J;  3ZHZ A;  3BR1 A;  4CYC B;  1NK3 P;  2E19 A;  2KT0 A;  3A01 B;  3CHQ A;  1MVY A;  5HOD A;  4XNB A;  4M6V A;  3HGY A;  2PL5 A;  1A6I A;  1NK2 P;  2DQM A;  2DMT A;  4LOC A;  3I4N J;  1MH3 A;  3CHR A;  5C4X J;  3M4O J;  1QVT A;  3CDL A;  2R0Q C;  2R59 A;  4IHV A;  1WCM J;  1GDT A;  2GBY A;  2FX0 A;  2JA6 J;  1P7I A;  2Y1C A;  1ZGW A;  1X3W A;  1T33 A;  3E7L A;  4UUT A;  3R0I A;  4C2M J;  2ME6 A;  4DYQ A;  2MGQ A;  2EQR A;  5F08 A;  3LSG A;  4RVB A;  2HXI A;  2WZG A;  3HM5 A;  2AO9 A;  1D5Y A;  1SFO J;  4BBS J;  5IYC J;  3JR9 A;  2R5Y B;  1I50 J;  2H1K A;  2JCV A;  4JYK A;  3FUL A;  2KDZ A;  2C5Z A;  3RKQ A;  1B72 B;  2WB1 N;  1JG9 A;  1RET A;  5FKL A;  1IDZ A;  1VI0 A;  2JA5 J;  1R0K A;  2NVY J;  2ELK A;  2QF7 A;  3ZQC A;  1MW3 A;  3NAR A;  2NVT J;  4S0H B;  4CXF A;  3LSP A;  4C3J J;  3FUJ A;  2WPG A;  4ZX3 A;  5IYD J;  4Y6P A;  2PUS A;  5K7F A;  1JKO C;  1ONO A;  3A02 A;  3LSJ A;  2R5Z B;  5JC1 A;  4B1R A;  5EG0 B;  2R72 A;  4FIS A;  1DU0 A;  4ZQH A;  1I6H J;  1S46 A;  4XN5 A;  4XN1 A;  4XN8 A;  2P81 A;  4XNA A;  1UMQ A;  3BR0 A;  4A93 J;  4XMT A;  2CQQ A;  3JRF A;  3S15 J;  4ZX6 A;  4UUS A;  3HOZ J;  5J1R A;  4A3D J;  1HDD C;  3GTQ J;  2Y1E A;  4MO7 A;  3RC8 A;  3HB9 A;  3BTC A;  4XMZ A;  2XPU A;  3T8V A;  3LNQ A;  2DA6 A;  3D1N I;  2GM4 A;  4GAE A;  2N8G A;  3VVM A;  1H3L A;  1GV5 A;  3FUF A;  1ZR2 A;  2LD5 A;  4ZQE A;  4QSH A;  1LFB A;  1BJZ A;  2LVS A;  3PO2 J;  3BR2 A;  3A14 A;  3QQA A;  1X58 A;  4DZP A;  3WHB A;  4QPE A;  4M3E A;  2FQ4 A;  4M3G A;  4NQW A;  2ECC A;  1Q0L A;  4AR1 A;  1TWH J;  2ZXG A;  4Y6R A;  1SAN A;  1K83 J;  5IP6 A;  1H89 C;  2VPR A;  5IPA A;  2DA4 A;  2DMQ A;  4W97 A;  4FE7 A;  1MBG A;  3FHE A;  2X9D A;  1MW0 A;  3FUN A;  1WPK A;  3FIS A;  5EF6 A;  2RJI A;  3HOW J;  5FKM A;  1ETY A;  5FLM J;  1Q1V A;  3SDG A;  2K40 A;  4IEJ A;  3S1R J;  1IC8 A;  3B6C A;  4L2L A;  3EBG A;  4A3E J;  4A3M J;  5FKN A;  5EGO A;  1K61 A;  4FE4 A;  4QUO A;  2LR8 A;  3OSG A;  3GTP J;  4BY7 J;  1ZK8 A;  2QVW A;  3NAU A;  5HNF A;  2YS9 A;  1LFU P;  3ZQI A;  1H88 C;  3JT1 A;  3K2A A;  4Y52 J;  3L1P A;  2E2H J;  1HS6 A;  3EBI A;  3OSF A;  4FCY A;  4XN7 A;  4V2F A;  2ZB9 A;  4D5F A;  3BTI A;  1AKH B;  2Y9Z A;  2K9S A;  2L7M P;  3S17 J;  4ZW5 A;  5JAZ A;  2JN6 A;  4QME A;  2W48 A;  4AYS A;  1X2M A;  3ZQH A;  1O4X A;  2DN0 A;  2D5V A;  3B2X A;  2CU7 A;  5BPP A;  3FUH A;  4ZW8 A;  4A3I J;  2DTZ A;  3FTY A;  2Y9Y A;  2JA8 J;  4PW4 A;  1YRN B;  1E3O C;  5EDN A;  3IH4 A;  1MSF C;  1SC5 A;  1SQM A;  1ENH A;  2XPW A;  1WGX A;  1JGG A;  2RAE A;  2PMZ N;  3C2B A;  1W0T A;  2JJ7 A;  2O7G A;  4K5M A;  1WH5 A;  1ITY A;  1JKQ C;  4JND A;  4XMX A;  2CJJ A;  3JRC A;  4A69 C;  4R5V A;  3CZL A;  1I3Q J;  4BXX J;  1HCR A;  3M3Y J;  5J1Y A;  1NTC A;  2XPY A;  4IHY A;  2MG4 A;  4AUX A;  3G1O A;  4BKX A;  3FU6 A;  5F0C A;  3ANL A;  4QIW N;  1MSE C;  4ZW3 A;  2O9L A;  1F36 A;  4MS6 A;  1OCP A;  1MBJ A;  4B3A A;  4M3F A;  2LFB A;  1T1S A;  2EZK A;  2M2E A;  2M8G X;  3FU0 A;  3FUD A;  5FKO A;  1BW5 A;  2XPZ A;  3S2H J;  2VJ8 A;  3HKZ N;  2Y1F A;  4XO4 A;  2NS7 A;  2R92 J;  2HI3 A;  2L0K A;  1FIA A;  1G5A A;  4GAA A;  2CUF A;  1GVD A;  1U8B A;  4J3B A;  2HPT A;  1QVU A;  2WV1 A;  4HNV A;  1X3Z A;  1IJW C;  5J3L A;  1ETW A;  2O7O A;  4ZQT A;  1BW6 A;  3H0G J;  4ABZ A;  4BBR J;  4ARF A;  3DEW A;  3TP0 A;  5IP7 J;  4RBO A;  5AEN A;  3G1M A;  3BR6 A;  3LSR A;  2LK2 A;  1RKT A;  1RR7 A;  3CQZ J;  3MN2 A;  2VI6 A;  1JT6 A;  4C3H J;  5M3F J;  3RAS A;  2Y30 A;  4X1E A;  2XGD A;  1HOM A;  4MLO A;  3A03 A;  4AR9 A;  1PUF B;  1CQT A;  3AU9 A;  3S16 J;  4PU2 A;  4DYC A;  5FWQ A;  1JKP C;  5EV7 A;  3A06 A;  3B2P A;  2DJN A;  2CUE A;  2EZL A;  2JMW A;  3PM1 A;  4D7N A;  3FUM A;  1MBF A;  1ZR4 A;  1GV2 A;  3IIE A;  2HDD A;  3B7R L;  1U78 A;  3BQZ A;  2TCT A;  4XK4 A;  4DYR A;  1LE8 B;  1OR7 A;  4Y6S A;  4XMU A;  4C3I J;  2JA7 J;  3HOX J;  2VKV A;  2R70 A;  1B8I A;  3S1M J;  1HF0 A;  3JRH A;  4OOF A;  4QTR A;  1Z0X A;  2Y0S N;  2VKE A;  9ANT A;  2MAO A;  3B3B A;  2XPV A;  3CZE A;  1ORK A;  1ETX A;  1Y1V J;  3LOC A;  3W6V A;  3O8H A;  5EYR A;  4I6Z A;  1QRY A;  5DTD A;  3B7U X;  2YU9 J;  5JLW A;  4ZW6 A;  2LTP A;  2E2J J;  4CYC A;  4JX4 A;  5C44 J;  3A01 A;  2JD2 A;  3QPS A;  4Q4I A;  3FH8 A;  4XND A;  3EBH A;  1ONN A;  4R5T A;  1IRZ A;  3ZQG A;  3TP3 A;  4FLR A;  1JT0 A;  3WQQ A;  3GTO J;  1JTY A;  1Q0Q A;  4RCV A;  5GPA A;  2NVQ J;  3ZHY A;  3WHC A;  3CHP A;  2QCO A;  3ZQF A;  1JKR C;  2HYJ A;  3K7A J;  4K5P A;  2DMP A;  5M5Y J;  1R9T J;  3FH5 A;  3FTW A;  4XO3 A;  1OFC X;  4QHP A;  1VFC A;  2IAI A;  3UER A;  1HLV A;  2HPO A;  3BG9 A;  5F0H A;  2JD1 A;  1MNM C;  1RP3 A;  1TC3 C;  3CHO A;  3FTZ A;  1IG7 A;  1DU6 A;  1AU7 A;  3WQS B;  1VND A;  2XQ0 A;  2MSY A;  3HGG A;  2R5Y A;  4JP0 A;  3Q44 A;  3JRD A;  5HNH A;  1POG A;  1JUP A;  3HEF A;  2GLO A;  2EBI A;  5EEA A;  2XB5 A;  3GTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...