4BKXA

The structure of hdac1 in complex with the dimeric elm2-sant domain of mta1 from the nurd complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
161
Chain Sequence
b'GEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METASTASIS-ASSOCIATED PROTEIN MTA1
publication title Class I Hdacs Share a Common Mechanism of Regulation by Inositol Phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 161
sequence length 169
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bkxA02
1.10.1740.200 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4bkxA01
1LE8B 1GV2A 2LY9A 1JKPC 2RAEA 2NVQJ 2X6OA 3QQAA 4A3CJ 3WHCA 1ZQ3P 1P7JA 2CUFA 3BG9A 2DMNA 1RKWA 4RDUA 4UUSB 4NDLA 1GT0C 1PUFB 2K9NA 4IHYA 5GPCA 1S7EA 1WGXA 5JLWA 4FCYA 4X6AJ 5EGOB 2ME0A 1WI3A 1MH3A 2HOSA 1IUFA 3SDGA 2ELKA 1DU0A 3CCYA 4EEFG 2VPRA 2LLKA 3FK6A 2JMWA 3G1OA 2O9LA 5EZGA 1JKQC 4XICA 3HGGA 2YUSA 4FE4A 4XK4A 3JRAA 3SJMA 3D1NI 3K7AJ 1JT6A 1ENHA 3HEFA 4QSHA 3S2HJ 5M5YJ 2DTZA 2NS7A 5JLXA 2DA2A 4Y7NJ 3HDDA 3GTKJ 3JRBA 5E3MA 3MVPA 2NOGA 2LP0A 4D5CA 5K7HA 3RZDJ 4A3IJ 4W97A 2Y2ZA 1ETOA 2CJJA 3HOWJ 2H8RA 2XB5A 3BR5A 1U78A 4G12A 5BNGA 4M3FA 1TWCJ 2LFBA 2HOTA 3G1MA 4M3EA 1EF4A 1WH5A 1ETQA 1RPWA 2HOAA 3BQYA 2E19A 4A3GJ 3ZOBA 1MSFC 4B3AA 2XGCA 1XC5A 4IHVA 1TWAJ 2AHQA 2XGEA 4C2MJ 2XRLA 5M5WJ 4XRSA 2WB1N 5IYDJ 1FTZA 4AUXA 1LE8A 3GTLJ 3S1MJ 2R0QC 3GBGA 4BBRJ 4AC0A 3S1RJ 1VNDA 3JRCA 1ORKA 5GPAA 1BL0A 1JTXA 3ZQFA 4UUSA 2VKVA 1PUFA 1Z0XA 2HDDA 3FK7A 2NVXJ 5IP7J 1RKTA 5EGOA 4M6VA 2K9SA 1ZK8A 3HM5A 2OPTA 1U8BA 4C3IJ 3FISA 1A6IA 3BG3A 1MBJA 2XSDC 2Y9ZA 2R7ZJ 3IH4A 1JUPA 5GP9A 3NAUA 1W0UA 3VPRA 5F0FA 3HKZN 3O8HA 1QPIA 4AYBN 3GTGJ 5C4XJ 1OFCX 1HDPA 3S1QJ 2JA7J 4MFDA 1FIPA 2CQXA 2GLOA 3S16J 2GM4A 4A3DJ 1IRZA 1XG1A 4L5EA 1JT0A 2NS8A 5M3MJ 1X2MA 1MBEA 5F08A 3OSGA 3BTLA 5IOYA 4I6ZA 2O8KA 5EDNA 1TC3C 1VFCA 4DYQA 5DTDA 3GTPJ 5FKOA 1TWHJ 2FX0A 3NARA 5F1JA 3LSPA 3IH2A 2XPVA 3K2AA 1AKHB 2PMZN 4MFEA 1JUMA 4M3DA 4DZPA 3A01B 1HOMA 4DYCA 3M4OJ 2CU7A 2TRTA 4IHXA 1RESA 2M9HA 1IC8A 1UG2A 1X2NA 1MNMC 3LSRA 5FKLA 3JRFA 1HCRA 2FQ4A 1MSEC 2LVSA 2ZB9A 3QPSA 2M34A 1IJWC 2KT0A 1ETVA 3BR1A 2EZHA 5K7FA 2ID3A 2JN6A 3F0CA 5EZHA 1I3QJ 3BR0A 3ZQHA 2IAIA 2QCOA 4D7NA 2EH3A 3O8GA 1I50J 4Y52J 1ZGWA 2LTPA 3IH3A 4HNVA 1ZTRA 4A3EJ 4BY1J 1O4XA 1IV6A 1CQTA 4BBSJ 9ANTA 2HI3A 5F27A 2DMUA 3GTJJ 1BW5A 2FJ1A 5FJ8J 3HOZJ 4M3GA 1B8IB 1QVTA 3GTMJ 2LR8A 2M2EA 5IP6A 3B6AA 3HB9A 5DS9A 4A3KJ 2B63J 2TCTA 2AO9A 3PO3J 5EF6A 1ETWA 1Z77A 3ZQIA 4QIWN 5IYCJ 3I4MJ 3IV5A 2G0EA 2NVTJ 2COBA 1GVDA 2OF7A 5E3LA 3BTCA 3S14J 1FTTA 4JYKA 2R92J 1Y1WJ 2N8GA 2DN0A 5F0CA 2K9QA 1ETYA 1NTCA 1MBFA 5IPAA 2L7FP 2JK3A 5IOZA 1ITYA 3WHBA 3JRHA 1IDZA 4JX6A 1OCPA 2JA5J 2L7MP 4C3JJ 1WCMJ 1AKHA 3S17J 4C3HJ 3JRDA 2E2IJ 1UHSA 3A01A 2R5ZB 5IP9J 2K40A 2DA7A 5IYBJ 1APLC 2M0CA 3L1PA 2VUMJ 2DMTA 1K61A 4V2FA 2CQQA 5E3NA 2E2JJ 1MH4A 2EQRA 2Y30A 2IEKA 1WPKA 1LFBA 4FTHA 4IHWA 2MG4A 3M3YJ 1JTYA 2EZKA 3RKQA 1OJLA 4I76A 4DYRA 1IG7A 4A3JJ 1POGA 2EZLA 1ETXA 2NVYJ 5HODA 4J19A 4RBOA 4IEJA 2ECBA 2HYJA 1F36A 2DMPA 1B8IA 4ABZA 2Y0SN 1MBHA 1H8AC 1AU7A 2Y31A 3LNQA 1FJLA 4MLOA 3B6CA 5E3OA 4DW6A 1K83J 3BTIA 4QTRA 2ECCA 2JWTA 3CDLA 1Y1VJ 5EEAA 1QVUA 3DCFA 1D5YA 1P7IA 2MSYA 1UMQA 1MBGA 3PM1A 1H88C 2VKEA 2XPUA 2LD5A 2D5VA 3S2DJ 5J1UA 4CYCB 3S15J 4A3BJ 1A5JA 2XB0X 3JRGA 3CMYA 1BW6A 5K7ZA 3Q0UA 1YRNB 3JR9A 4A93J 3HOUJ 3SFIA 2MW8A 1T33A 2M8GX 1JJ6C 1JKOC 3HBLA 4JX5A 2R5ZA 1E3OC 4A69C 5FLMJ 2DA4A 3FIWA 3HGYA 4B4CA 2DA3A 1NK3P 3OOUA 5EYRA 1VF9A 4XRSG 1FIAA 1FEXA 4MO7A 5EG0B 5M3FJ 3LSGA 4FE7A 1JUSA 3Q0VA 1X58A 2JA8J 2L7ZA 2R5YB 2HXOA 1XS9A 1U9NA 3TW6A 2L9RA 1AHDP 4BXXJ 1GV5A 3W6VA 3E7LA 1SFOJ 4GFBA 3BG5A 3GTQJ 4M3BA 3ZQLA 2IBDA 3C2BA 1HDDC 3A02A 5FKNA 2GBYA 2ME6A 3UKGA 3OSFA 2E2HJ 5M5XJ 1GDTA 2O7OA 4LOCA 3LOCA 2EBIA 5FLVA 3PO2J 2ID6A 1JKRC 2DMQA 2MGQA 1IDYA 2CRGA 3TW7A 2HQ5A 5C44J 4XIDA 4FISA 4D5FA 3LSJA 3DEWA 3TEDA 2H1KA 2LKXA 2X48A 2WAQN 2DA1A 1H89C 4BKXA 1RETA 2E1OA 3FKIJ 2LK2A 1SANA 4A3FJ 1TWFJ 3H0GJ 2DJNA 2HXIA 1ZR2A 4V2GA 4S0HB 2YS9A 4BY7J 4CYCA 3H3VK 4B1RA 1R9TJ 1G2HA 1HF0A 2EZIA 1DU6A 5C3EJ 3CQZJ 3S1NJ 2QF7A 4A3MJ 3QPLA 1B72A 1BA5A 1YRNA 2DA6A 4DZJA 2XGDA 3RQIA 5J1YA 5F04A 3BR3A 3ZQGA 3ZQCA 3G1LA 4D7MA 5C4JJ 2R93J 1JJ8C 2P81A 3OIOA 2JJ7A 4X1EA 1F43A 3A03A 1GUUA 1JGGA 3JRIA 3HOXJ 3BT9A 1OCTC 3GTOJ 5FKMA 4UUTA 1HLVA 4W1UA 2XPWA 4XRMA 3MKLA 2YU9J 3HOVJ 1MBKA 1VI0A 5EG0A 3Q3SA 1TWGJ 3I4NJ 1RR7A 3BR6A 2R5YA 1LFUP 2I10A 1QRYA 4JP0A 3BR2A 1Q1VA 1NK2P 3BTJA 3MN2A 5J1RA 1W0TA 2WV1A 1ZR4A 4MIMA 1BJZA 2FD5A 3TP0A 3RZOJ 1I6HJ 4JX4A 1U9OA 5F0HA 3JREA 2DA5A 5FKKA 1WH7A 1ETKA 2CUEA 2VI6A 5J3LA 3BQZA 4A3LJ 2JA6J 3Q0WA 3TP3A 2L0KA 2KDZA 1ZKGA 1IGNA 1T56A 1B72B 2W48A 3HOYJ 2X9DA 2Y9YA
chains in the Genus database with same CATH superfamily
2BYVE 1TQPA 3L9FA 2LY9A 5LEJA 1W7PA 2RAEA 1BI3A 4XQFA 1VQ5I 1Z21A 2KHMA 4NDLA 3ZN1A 1PUFB 4R5XA 1K4SA 2DDAA 2F5FA 5GPCA 2BW3A 5JLWA 4FCYA 4XO4A 4BHCA 2OQRA 3HPHA 4PSWA 3PSFA 2QVWA 1BI2A 2XF6A 4BJ5C 3OYAA 3ISPA 3DQVC 2KFDA 2NNNA 3CJTB 3WQRA 4ZJZA 1HSTA 2E36A 2DBBA 1Y56A 5BOXA 4ZTJA 3K4JA 3ABTA 4PU2A 2M5WA 1A31A 4LLNA 1BBYA 3HHHA 4BQAA 3HGGA 4ZQHA 5HNHA 4HZFA 2RNJA 1JT6A 1ENHA 3WGGA 5K5RA 3FH8A 4QSHA 4KIBA 1MW1A 5D6FA 3BLYA 4Y15A 4FLRA 2NS7A 2QUFA 3JSOA 4Y7NJ 2STTA 4CXFA 3HDDA 3GTKJ 1YI2I 1A35A 2O61A 2AQFA 1H19A 3MVPA 3I64A 4D5CA 3QAHA 5K7HA 1KYWA 2YR2A 3RZDJ 2Y2ZA 1ETOA 2CJJA 3DTEA 3GLLA 3CF5F 2XB5A 2OCEA 2MAOA 2NXNB 4EV0A 4G12A 3VODA 3W2VA 2VONA 3K4CA 5A2QZ 1IRGA 4RB3C 1OR7C 3WQSB 2DW4A 2LFBA 4JQFA 4KMUX 4M3EA 1B6AA 1MD0A 2LDUA 1YW9A 1ETQA 2WAEA 1RPWA 4UVCA 4A3GJ 4KYWA 3B7SA 3FTZA 3C1DA 4XN1A 4AR8A 2ZNYA 4IHVA 1VQ8I 3QYBA 2XGEA 4HPQA 4HLYA 2C6YA 2XPYA 1FTZA 3S1MJ 2I5UA 3CCEI 1ZG1A 3OR2C 4BBRJ 1T0FC 2RV8A 4PFOA 5E18F 2M30A 3QYFA 1HXDA 1VQOI 3CHQA 3I53A 1UELB 1WI9A 1FP1D 4R7LA 3K4BA 5HS7A 4BEHB 3AL0C 1J7KA 2ETHA 4DQ2A 4NC7A 4AR9A 2VBYA 3FWEA 3HM5A 3V8LA 1D1BA 4X2UA 4XMXA 2YU3A 3BG3A 5LHGA 1MKMA 2A68F 1ON2A 1R4NB 4CCOA 2R7ZJ 2W25A 4F52A 1YW8A 2M7BA 2ISYA 2UXNA 5F6FA 4ZW6A 3LSHA 3CLQA 1FSEA 1XSVA 4AYBN 3E6BA 5JHUA 3ML6A 1HDPA 5FB2A 4LFUA 3S16J 3IWFA 2LKSA 2JSCA 3AU9A 1VQMI 4L5IA 4XLHA 1KZHA 2DU9A 1FBUA 5F08A 1ZGJA 3ONQA 3J80Z 1R0LA 1VQLI 5LGTA 4I6ZA 1QHHD 3AKZA 2X1CA 2STWA 1ONVA 2H94A 2IA2A 2GZWA 3B34A 5DTDA 3GTPJ 2O0YA 1AWCA 4GO1A 2QKMB 3NARA 2L54A 1GXPA 1I5ZA 1R7JA 4G8XA 4F93B 5FRMA 5B3SH 1G3SA 3LMMA 2FFLA 2X6XA 4DYCA 1BI1A 2G7UA 2CU7A 1RESA 4XLFA 1IC8A 4Q4EA 5ERIA 1UG0A 3FXQA 3BY6A 4GGGA 4LD5A 3FHEA 3LSRA 1I27A 3OYEA 1OCRH 1HCRA 2JPCA 3L00A 3N05A 4D1QA 4A2UA 3PNYA 3DEEA 3JSPA 5JI6A 3M1CA 5DUKA 2B61A 1XX5A 2JUGA 2HKOA 2VKHA 2Y69H 4XLPF 3IL2A 4XNFA 3QWLA 1D3YA 2DLLA 2CUZA 3O8GA 1I50J 4GYIA 3TO6A 2E7WA 4KIGA 5AIQA 2QSGX 1IXRC 2A7OA 4A3EJ 3SXYA 2LY1A 2DFFA 1G4DA 1FSHA 4Y33A 4AM3A 2DI3A 4G6DA 5FRNA 2BOLA 2XAFA 2FJ1A 2P5LC 1NH3A 1S5LC 3HOZJ 5BPPA 2XF5A 2K02A 1B8IB 1QVTA 4J3BA 4P55A 3GTMJ 3U2RA 4S05A 3R0AA 5DS9A 2IS2A 2IS6A 1SD4A 4LITA 3OOPA 1UB9A 2ACJA 5CVUA 4HSRA 1ONOA 1ACIA 3EQLF 4ZYGA 4IZZA 1CGPA 5ILSA 3OIPA 5KAIC 4AIJA 4XR6A 5JFRA 2COBA 1A04A 5DD4A 3FBNB 5IT9Z 3BTCA 2OV7A 1J5YA 1FTTA 3K1MA 3BWGA 3LSTA 1S9HA 1A36A 2VXDA 4ZW8A 3GFJA 2DK5A 3RC3A 1W4MA 4MEXF 1IN6A 1MBFA 1NTCA 4IHTA 1ITYA 2NYXA 3WHBA 1H9TA 3JRHA 3HKZA 3F6VA 4C3JJ 4EJOA 3FHZA 1J09A 1FNNA 4N4OB 2FOWA 3D0SA 1AKHA 2A5YB 3TOBA 4HV6A 2GAUA 1UHSA 1T95A 3ASOH 3DV8A 4P9UA 2R5ZB 1X1CA 2EPFA 4IRHA 4PUSA 5IYBJ 1APLC 2M0CA 2NVUB 3L1PA 1IAWA 2Z1DA 1Q1HA 1XD7A 3CZGA 2CQQA 2KKOA 2V9KA 3RTRA 2PFBA 3DTKA 4BGDA 1N77A 2ZJRF 4ZN6A 2KIUA 2IEKA 1TTYA 1ZRFA 3JAMZ 3CJRB 1MIJA 3U21A 1IUYA 4EM0B 5BPDA 4PGGA 2EZKA 1OJLA 3I59A 1E17A 1IG7A 2OU2A 3CF2A 2EZLA 3ANLA 1SFUA 2OTLI 4J19A 1R5HA 1V3FA 2ECBA 3P9CA 3OYBA 3J81K 1F36A 2W1OA 5J4VA 1R1TA 3K0LA 5L3EA 4MS6A 4ABZA 2NS0A 1KU2A 3ABLH 4YFNF 1H8AC 1AU7A 2Y1GA 3LNQA 3D5RC 3GEZA 4C9YA 2P5KA 2EIMH 4ENKA 2JUCA 2JZYA 1YFHA 4R5VA 4XNDA 4BUPA 3LSIA 4QTRA 2ECCA 3OS1A 3E97A 2JWTA 1X3ZB 4XN0A 3DCFA 2A05A 3F8CA 4FT8A 3EBIA 3TBIA 3DEUA 3I55I 3G6EI 2PLYA 3PUFA 2D5VA 2A5WA 2MBFA 3HG9A 4K5LA 1WQ2A 4L9JA 3GF2A 4KISA 2QWWA 1WZ2A 4A3BJ 1A5JA 3HIFA 1QPMA 3JRGA 4ZC3A 3CMYA 2R72A 3WU0A 1ZELA 2I8DA 4FETA 3TDUC 4RGUA 3VYTB 4Y13A 1R49A 2XIGA 3Q0UA 4E7SA 1J75A 3KEQA 5JR3A 2ESHA 3BZKA 2CW8A 3QU6A 1Z7LA 1RP3A 1T33A 2DOEA 5JMPA 2K27A 1U5TC 2LC2A 5AONA 1R23A 1V54H 4IOAF 3ZPLA 4U7DA 5DULA 1B1BA 2KRFA 4HX8A 4Q4IA 4A69C 2DQLA 1BR1A 3DU5A 5GAHJ 4U87A 1D0YA 4ASNA 4QPQA 4ZDLA 1XDUA 5H20A 3KP7A 4XRSG 2OD5A 3FUDA 4JOMA 3WQQA 1FEXA 2BY3A 1JKQC 1YG2A 5EG0B 2PJRB 1JHHA 1OCZH 2BY1A 4G9YA 2RVCA 5KNLA 2Z99A 4ITVA 2DJIA 3WGHA 3OYNA 3E6CC 2L7ZA 2R5YB 4XMUA 1U9NA 2ZMEA 2L9RA 1QZYA 2MFZA 4XOPA 5E8IA 4N4NB 3BJAA 3JTGA 2EA4A 3BPXA 3EBGA 2VQCA 2RN7A 2RREA 4ZTFA 3CC4I 2IS4A 3VYSB 1YX3A 2IBDA 2W24A 3F21A 4OOFA 2L5QA 1MW3A 4XORA 2R7WA 3P7NA 3FX3A 5L3GA 3UKGA 2E2HJ 3I5UA 4HDVA 4G7ZF 3RC8A 1IXCA 4G7OF 3KZIC 5LHHA 4HV5A 1IDYA 2CRGA 1Y8QB 2EJRA 1YLFA 4P96A 1YOVB 1H9GA 2MLKA 3CUQC 1V5FA 2CS3A 3DEWA 5DUIA 3O2PE 3E1SA 2Y48A 2QQBA 4PSXA 1H89C 1SANA 4QWQA 1TWFJ 1WJ5A 2DJNA 4S0HB 1WWXA 1LVKA 4YFXF 3WE2A 3RPQA 3ABUA 1YQAA 2QQ9A 2E5NA 3CZEA 3DXJF 4M72A 4KNYA 4IX7A 3S1NJ 2GQQA 3W2AA 3H9QA 1YRNA 3ECHA 2DA6A 4DZJA 3FTXA 2PBIA 5F04A 1Z67A 1UHWA 3G1LA 2PGGA 2DQRA 4HQEA 2R93J 3HOSA 1VQNI 3CO6C 5BMZA 3U1DA 2JJ7A 4BQNA 1F43A 3A03A 3JRIA 3HTUA 2XKPA 2LOOA 3CD6I 2QSHX 3GTOJ 3K4KA 1U0JA 2P5VA 2KQRA 4WXHA 4W1UA 3L2CA 1MBKA 4WF2A 3RPUA 2VBWA 3DPLC 1R5ID 4Y6SA 1FX7A 4V19K 1J59A 1QRYA 3A06A 3BR2A 1FMVA 3KP2A 2FBHA 2H6BA 2WV1A 3EUAA 2J5PA 1C0WA 3PNTA 4XN3A 1U9OA 2DYSH 5F0HA 3KE2A 1UAAA 1XSDA 2EILH 2M3AA 2VI6A 4CHUA 4XN5A 2BHZA 4A3LJ 2JA6J 3Q0WA 3MAJA 2L0KA 4I98B 3E3VA 2QQ8A 3LAPA 2KDZA 3G3ZA 4KA4A 2DXIA 1KGSA 4MTDA 1UHMA 2MH9A 5BS6A 4KUMA 2R4GA 2W48A 1XGNA 3DKYA 2Y9YA 3LWFA 4ZYEA 1LE8B 4IXAA 3CXBA 2V79A 4N9HA 3QQAA 2NVQJ 2CFOA 3HJEA 2CUFA 3BG9A 2IGOA 4RDUA 4MQ9F 4XMYA 4A03A 1R22A 1OCOH 3LA3A 4RB2C 1S7EA 5F64A 3OMYA 1XCVA 3E5QA 4H4KC 4X6AJ 3R0IA 3B37A 5EGOB 4GYGA 4A0YA 1MH3A 3EPZA 2HOSA 3QJXA 2KP6A 1IUFA 4I7HA 3DPUA 4HF1A 3OYIA 4XO5A 2ELKA 3IAS2 2L9SA 2VPRA 4E7HA 4K5NA 2LLKA 3G1OA 5LRSA 3VOEA 5B66C 4XMTA 2Y1CA 4NQWB 5EZGA 3KLNA 4P9FA 5GADJ 4XICA 2VJJA 1LQ1A 2YUSA 2CQKA 3BC8A 2K3FA 4HEA2 2EFOA 4Z2YA 1D1CA 3TMOA 1DQUA 3HEFA 3CHPA 3T8TA 3S2HJ 2A6TA 5D4SA 4RB1A 3BJ6A 5E8GA 1K7AA 4U0YA 1YS6A 2BY0A 1VQKI 5E3MA 1PVEA 1S72I 2ZBKA 1OISA 4A3IJ 4W97A 1LPQA 4PGHA 3ZCOA 1MNDA 3CDHA 2ZJQF 4LJZF 3LSKA 1H3LA 5LBQA 3FF5A 4ZX4A 2EK5A 3H1CA 4FX4A 3G1MA 2F48A 1WH5A 4EMSA 4ZYHA 3HOTA 1X3WA 2HOAA 2V6EA 2E19A 1IN4A 1GW6A 2R7SA 3FU6A 1XC5A 1ZRCA 3F8BA 1LB2A 1TWAJ 3I0TA 1XGSA 2OAZA 5E79C 2AHQA 2R59A 2M8EA 2QGUA 1HW5A 2XRLA 2DPDA 4FCAA 1IRFA 2WB1N 1STZA 2M45A 3K70D 3CJQB 3CP8A 1SD5A 2EFQA 2OZUA 2R7RA 1FP2A 5E20A 3VYUB 4E7ZA 4L9VA 3GBGA 2R0QC 1U8RA 1LFPA 2PMHA 2F5CA 3JRCA 4RM2A 2O6GE 2Q2EB 4BE1A 1HW1A 1SD7A 2XUBA 3ZQFA 5JAZA 3VVLA 2VKVA 1OKRA 2Z2SB 1Z0XA 2ZNZA 4L5JA 1PUFA 5E1ZB 1CF7B 1MW2A 4IVNA 2IRFG 2V1XA 1N25A 1HA8A 4LGWA 3SZGA 4M6VA 5D5WB 2K9SA 3ERMA 3PIOF 3J7ZI 2OPTA 4HNUA 3TOAA 4C3IJ 1YS7A 1V5EA 3V7SA 1MMDA 4ON0A 4XNBA 2XSDC 1XB4A 3DWLE 3M8FA 3IH4A 1JUPA 5GP9A 1F5TA 3B7TA 2DAOA 4PJNA 1ZLKA 4KFCA 3G4SI 4OMZA 1P92A 1QPIA 3GTGJ 3RKWA 1YITI 3T8RA 1SAUA 1FYMA 1R36A 1IRXA 3S1QJ 2JA7J 5D5UB 1FIPA 2CQXA 2GM4A 5HNFA 4A3DJ 4CA0A 1IN5A 4YEJA 1WSUA 1PJRA 5E1XA 3CC2I 1TT0A 2L02A 2DT7B 1MBEA 3X2QH 3BTLA 5CQGA 4RM3A 2W84A 2VT3A 1I3AA 2X6YA 3I3LA 2KLOA 2VASA 5KK1A 4GCVA 3FUHA 4R8HA 2CFXA 1U5TB 2LSOA 2OC6A 3FUKA 1TWHJ 2VQLA 5F1JA 1WJBA 3LSPA 4F91B 3K2AA 1N75A 3IC7A 4BH9A 4B44A 4OIOF 4M3DA 2XROA 4E7KA 1G6NA 3A01B 3GX4X 2TRTA 1UZCA 3OYFA 1TW2A 2D1HA 3F3XA 4OIQF 1U3EM 3CCSI 4OOEA 5LD2C 4B09A 1DDNA 2BVLA 5FO5A 5H6QA 1SQMA 1UFMA 2ZB9A 2M34A 3LFUA 2KT0A 2JD0A 3V7RA 3QOPA 2EZHA 4E6KG 2OTJI 3F0CA 3KP3A 1K6YA 2IVMA 3FXLA 3LQRA 2EV6A 2W7NA 3ZQHA 2NRAC 1XSXA 2EH3A 3MCZA 4EM1A 2WV0A 3IH3A 4HNVA 4BACA 5D4RA 4BEHA 2H27A 1VTNC 5JVTA 4BY1J 1IV6A 1CQTA 2L3DA 4PDKA 1SMYF 2FF4A 2HI3A 5LGUA 2CWEA 5F27A 2DMUA 2H6CA 5FD6A 2IS1A 3WTZA 3OL4A 1K6OA 3CZKA 1U2WA 2P8TA 1TNSA 4DNCA 4C2UA 3T8VA 3B02A 4LIVA 4E4HA 2R7TA 4QPOA 2GA1A 4FHTA 4XM3A 2TCTA 2HDWA 4AR1A 3GO5A 4EGZA 1K78B 2M1BA 3ZQIA 4QIWN 1MJBA 2AXLA 2GOXB 3I4MJ 2G0EA 4ESBA 2NVTJ 1SFEA 2HKXA 1GVDA 1Q0QA 2OF7A 2CUJA 4M73A 5E3LA 5JC1A 3S14J 1DGWY 4NB5A 2PQ8A 3C18A 2W57A 1Y1WJ 1FBSA 2N8GA 3CHRA 5F0CA 5DM7F 2JVGA 1T39A 3RCOA 3MZ8A 3RYRA 2K9QA 2O8XA 2ZFUA 4UV8A 1ZN2A 2TDXA 2JRMA 3L2UA 2VOOA 3RJPA 4CCNA 1IDZA 1OCPA 3PNVA 2K4BA 4II2A 1WCMJ 2FSWA 3CMMA 1JE8A 1G5AA 2M0MA 4C3HJ 4NC8A 3JRDA 2E2IJ 2XAJA 1QZEA 3TO7A 3PSIA 4FLSA 3ZHYA 2HOEA 4NC6A 2NAZA 4ZYAA 4UB8C 1J0RA 1EH8A 3ULQB 2XRNA 3EUKL 2R7FA 2BBYA 4EQQA 4AYSA 2PI0A 3W3CA 3PUUA 2ZSHB 2BY2A 2KZGA 2MD0A 4V2FA 1K61A 1MDMB 3S8PA 1ONPA 2K7LA 3WTXC 2XVCA 2PMZA 2BGCA 2JT1A 3A2KA 2RQPA 1JG9A 3GMEA 4XSZF 3IAM2 3A4CA 4IOCF 3RASA 2E1NA 2OJED 2UXXA 2NVYJ 5HODA 4PZJA 2COMA 1QZZA 3WTVC 3VDXA 4OOIA 2X4HA 2HYJA 4Z6YA 3PJRA 1B8IA 2X51A 2W00A 4ARFA 1OQYA 1G3WA 3J7AO 3WU1B 3HSRA 2JVHA 4KITB 4DW6A 3BTIA 2DCEA 4XN7A 3VB2A 1VQ7I 3QODA 3CDLA 3ANMA 1Y1VJ 3U9WA 1QBJA 1P7IA 1D0XA 1Z1DA 1UMQA 1MBGA 3PM1A 2D1VA 2H1LA 2IGMA 3K10A 4YFKF 1O3TA 3DP7A 4II3A 2E34A 1DP3A 2KPMA 3HXLA 3S2DJ 5FFZA 4G7HF 5J1UA 3ZHZA 5J4YA 1B59A 3MKZA 4K5MA 2XDVA 2XB0X 2BXYA 4RAZA 1ZYRF 5J6XA 4YIIA 1HS6A 2XAUA 4IJAA 3HSEA 2M87A 2FXAA 3F6OA 4R5TA 3ZMDA 4A93J 1BR4A 1MMGA 2EIKH 4A5NA 1IXSB 2KL4A 3ZN0A 2R7XA 4S04A 1KU7A 4OU0A 1FBQA 4A0XA 1HKSA 4ZH4F 5FGMA 2IGKA 2R5ZA 2JSPA 3HUGB 1E3OC 4ZW5A 2GWRA 4Y3OA 4B4CA 2X85A 4MQVA 2HVSA 1HKTA 1JGIA 2DTRA 3SZPA 2KDOA 4BE0A 3OOUA 2VIXA 3F8MA 1VF9A 4XLAA 4ESFA 4MO7A 5M3FJ 4FE7A 1BI0A 5HDGA 4RGXA 2VQGA 3CZ6A 3IP4B 4EATA 2HXOA 2IXSA 2HGCA 2HPOA 1USTA 3PUBA 1AHDP 1L3LA 2O3FA 4E7LA 4BS9A 4ZDPA 4J01A 3E7LA 1SFOJ 4GFBA 5J8FA 1YX5A 2DT6A 3RIRA 3OR1C 4PK4A 2F2EA 1HDDC 1O57A 2KISA 2GBYA 3BP8A 4P1WA 5FKNA 4BU2A 1K4TA 1D8KA 5M5XJ 5D5VB 1GDTA 4QUOA 3ZI0A 5DYFA 3PO2J 2IP2A 3F72A 4JK1X 4M9ZA 3KP6A 3WG7H 2DQMA 3TO9A 3KYCB 2B9SA 5C44J 2C5ZA 4N9IA 1UCRA 2Z33A 2NOJB 1YE9A 2HS5A 2H1KA 1QHGA 3OYKA 2X48A 1X3ZA 4FX0A 3OL3A 4CZZA 1YTYA 2CV0A 3ZQQA 1RETA 2E1OA 2KRHA 3H0GJ 2JCXA 1LDDA 2WTEA 2PX9A 4MTEA 2YS9A 4ZW7A 3CHOA 3H3VK 2A3SA 1G2HA 3UERA 4ENMA 5JMWA 1MW7A 4CCMA 1HF0A 2L4MA 2Y0SA 2VB6A 3VFZA 5C3EJ 3CQZJ 1IZ1A 1B72A 3QPLA 2G7HA 2XGDA 5TJJA 3KEDA 4HOBA 4EJUA 3BR3A 3RI4A 2A6EF 3V8KA 1T8IA 2GIVA 2V9VA 1JGGA 3DLAA 3HOXJ 3L09A 3BT9A 1FZPB 4TV7A 1OCTC 3OYJA 3MEXA 4KT6A 1KA8A 3FXJA 1R6RA 4ESJA 4WCGA 1FC3A 2BEOA 4IL6C 2VC0A 3HOVJ 1G59A 3AAFA 1VI0A 4RLQA 5EG0A 2PJRA 2BZTA 3GUDA 4RCVA 2F6CA 1TWGJ 2AQEA 5TISC 4EVIA 2R5YA 2I10A 3AFHA 2L4AA 2ZJPF 3LL7A 3LQQA 1Q1VA 4LB5A 3FU0A 1OR7A 1NK2P 3HHGA 3D5SC 1ZH5A 5J1RA 1MW0A 4RAFA 2JD2A 3WE3A 2CQNA 3K4NA 1ZR4A 4MIMA 3B2PA 4FLQA 5KCMA 1BJZA 3BG6A 4JX4A 2DA5A 2R7OA 1EH7A 4QMEA 3HYIA 2CH0A 3NEUA 3GZNB 5TGTA 2K86A 4CGZA 4UHTA 2Y1FA 4QLCU 4ZQEA 1X4PA 3MKYB 1SEUA 3I54A 4IQ4A 4GDFA 1ONNA 1P4AA 3I4PA 4JNDA 2O5RA 1B72B 1E2XA 4YELA 2XPWA 1QGPA 2X9DA 1T0FA 3IKTA 1YO5C 3GZ6A 1GV2A 4QHPA 4G6TB 1JKPC 3FUIA 5A2QK 3FUFA 1LJ9A 4ENJA 2X6OA 4A3CJ 2FBKA 1Z3XA 1ZQ3P 4BHBA 3Q43A 1RKWA 4UUSB 1OCCH 4PVBA 3KPHA 1IO2A 3FXRA 3AG2H 5AENA 3SDGA 3RKYA 3CCRI 1DU0A 2MC4A 1MJ9A 3G71I 3CCYA 4OINF 3CTAA 3FK6A 2JMWA 5FLXZ 4MGRA 2WAQA 4EJVA 4LMYA 2XAGA 3ESWB 1BN5A 2LMDA 4FE4A 4XK4A 3JRAA 3MKWB 1HKQA 4WXCA 1VQPI 2HZTA 3K7AJ 4XLNF 1YYVA 1SVOA 1BR2A 3TKYA 5M5YJ 2UUZA 2HPMA 3ZMTA 2BHYA 2XF7A 3EYYA 2FNAA 5HDKA 2NOGA 1LDJA 1QA6A 4F7ZA 2WY7Q 1PP8F 3UNGC 1D0ZA 3GVAA 3Q9VA 4ZQTA 3DPTA 4AVPA 3HOWJ 2H8RA 3CUOA 3CHSA 1Z6RA 3M9AA 1WRJA 4ZZDA 4XKVA 1U78A 3FXMA 2F4OB 3QPHA 1ON1A 3FUEA 1A6QA 1FY7A 2K4JA 1KYZA 4M3FA 1X19A 2HYFA 4AWXB 2HOTA 1SG7A 1P6RA 1EF4A 3I56I 3FUNA 5DCMB 1YW7A 4U88A 1RR8C 1S3JA 4UUVA 4R79A 3CIAA 4BQOA 3AL0B 2AXTC 3ZOBA 1IN7A 4B3AA 1X4OA 2PMUA 1OYIA 3IIEA 3B7UX 3DBLB 3J80K 2BE5F 4XRSA 1ZREA 4XN4A 2HR3A 3VEPA 4AUXA 1LE8A 3GTLJ 1S6LA 3O3KA 3ZGKA 3GW2A 1BOBA 1T98A 3FUJA 2LH9A 2VJIA 3S2WA 4HYEA 3S1RJ 4KP7A 1VNDA 3CCQI 2EFNA 2V7FA 4CSWA 1OPCA 2XAHA 3BDDA 4XN9A 4A6EA 2Q8KA 1S46A 3KYDB 3F23A 2EFWA 2XAQA 1RKTA 5FFXA 1XTAA 2FMYA 5EGOA 1JVSA 5JNLA 5B1BH 2QBYB 2KZVA 2X1EA 5CLSA 3P9KA 3FTWA 4KDPA 1V5GA 4DBRA 2WADA 1W1WE 4IQJA 1S7AA 3FISA 4Q5SF 1A6IA 1WVRA 4CCJA 2VQHA 2DFIA 1MBJA 4NQWA 2R70A 2HQRA 2QKLB 3V8JA 1KQ9A 2EINH 1W0UA 1XGMA 2GXAA 3VPRA 3ANNA 4XMWA 2DFHA 5F0FA 3SEZA 3HKZN 1K79A 2WBMA 3ZMZA 5C4XJ 3G2BA 4HAMA 5E17F 1Z6TA 2G9WA 2KIFA 4I01A 1I1SA 2IPQX 1F9NA 1IRZA 2JPBA 5HVQC 1JT0A 2NS8A 2CGPA 3ZHXA 5M3MJ 3CLOA 3EBHA 2GIZA 5KVRA 2GTQA 2V9PA 3N4MA 4U0WA 1UJ8A 2O8KA 4CICA 1TC3C 3UCQA 1SFXA 3L7WA 3H3UA 1Z3YA 5D6EA 3KLOA 5FKOA 1YJWI 3WODF 3V7CA 2EFPA 3EETA 1XGOA 2FX0A 4PJJA 3IH2A 2XPVA 3E5XA 2E71A 5CVRA 4MFEA 2HFHA 1W5TA 1JUMA 4IKFA 1M1EB 2ZXWH 3M4OJ 4BL0B 2LRDA 3QP6A 2E7XA 4IHXA 1O7FA 1BC8C 1X2NA 1MNMC 4LG0B 4CH7A 3S3OA 3BPVA 3JRFA 4BXFA 4IO9F 2FQ4A 3KZZA 2GXGA 1MVYA 2LVSA 3DTIA 4I99C 3QPSA 3IRQA 1ZGAA 3RSNA 1ETVA 3BR1A 1Y0UA 3AG1H 5EZHA 1J9IA 5CPRB 3KCCA 3BR0A 2Q2EA 3WTSC 1RIOH 2IAIA 2R7VA 1T1RA 4QIRA 3BG7A 2QJ1A 3FTVA 2P6SA 1CF7A 4BAYA 1ZGWA 2LTPA 4A12A 3PIPF 1O4XA 5H6RA 4FLOA 4HRIA 3HPGA 1KQ8A 2E1MC 2Z5UA 5EV7A 3J7YJ 2VE9A 4JBAA 2F4IA 2VT2A 2HPTA 1BW5A 5DM6F 5FJ8J 2ZXIA 3K6GA 4M3GA 2EV0A 4L18B 1LNWA 2PG4A 1OYWA 3MZYA 2QSFX 2M2EA 3RKXA 5IP6A 1BM9A 3B6AA 3HB9A 3FTUA 3BOQA 3D5LA 2B63J 1REPC 5D8KB 1JGSA 2AO9A 5EF6A 1ETWA 1Z7UA 2LKPA 3JAMK 4XN2A 1X3UA 4EM2A 3IV5A 1RRJA 4B3XA 3HSFA 1HBXG 2P7CB 2RQQA 1XN7A 3PQKA 3FKJA 2D2WA 2J5OA 4JYKA 2R92J 1MJAA 5D5XB 2DN0A 2XV4S 1MMNA 1ULYA 1ZHFA 1Y8RB 5ILVA 2ADUA 2MLGA 5IOZA 3DBRB 2RGVA 5CVJA 1EV7A 3FULA 2V26A 3F8FA 1FT9A 1U5TA 3CMEI 4AICA 4KJZA 1VZ0A 4MKTA 2JA5J 2QENA 2VKDA 4YIRX 1RUNA 3IRRA 3S17J 3HTSB 4D9JA 1JHFA 4I02A 4BDYA 4P5OA 3A01A 4Y6PA 1D1AA 2K40A 1Y0NA 1IW7F 5HLHA 1FOWA 2FBIA 3MZHA 1SC5A 5HLGA 4BE2A 2ZC2A 4CYDA 1P4XA 3HRUA 2DODA 2K5CA 2ZCWA 1Q0HA 2LNBA 4J00A 1XMKA 1MH4A 3U1KA 1YHQI 3JTHA 2WAFA 1DP7P 4GRIA 3DF8A 4I0BA 5GTIC 3ZRGA 3R4KA 2MG4A 1FOXA 3M3YJ 1JTYA 3RKQA 2EB7A 2PN6A 2VE8A 4DYRA 2IA1A 4A3JJ 1POGA 4WX9A 1R00A 5DLLA 5DEQA 1TBXA 1YJ9I 3HL2A 2IGNA 2HQAA 3QYEA 4L0YB 3ELKA 2UWMA 2R7QA 5CJ9A 4G94A 1VQ6I 2OUMA 3LA7A 1YIOA 1ZG3A 1VQ9I 2LREA 3B6CA 3GXOA 3PFIA 4DJAA 1K78A 2W85A 1IV8A 2WC2A 3EUHA 3TDZC 1O7LA 5EEAA 1QVUA 2K3PA 1HW2A 2LY2A 1WJCA 4IHSA 2MSYA 1GLNA 1H88C 2VXZA 3GYHX 2XPUA 4I0AA 1RC9A 2DYRH 1TLHB 4CYCB 3NWTA 3VYRB 3CESA 3S15J 4HF0A 3I71A 3ROUA 2LBFB 4OMYA 4XNAA 1BC7C 1BW6A 3EDPA 3Q5FA 4DPRA 2HPIA 5K7ZA 1RUOA 4RVBA 2UZKA 4M71A 4LK1F 3HRSA 3HC7A 4RS8A 3SFIA 2ZFWA 3HOUJ 4GXOA 4ENNA 1JJ6C 4CO8A 2WY8Q 4CCLA 4M6XA 2CV1A 5ICFA 3HBLA 3BZCA 5FLMJ 1TZLA 2DA4A 3E6DA 3FZVA 3FIWA 3HGYA 2HVRA 2GA2A 4HF2A 2DA3A 1NK3P 2VPLA 2Y1EA 1G3YA 4Y17A 1LEAA 2Y0MA 3J81Z 5ILUA 2V4JC 3SHFA 2VL8A 5EYRA 1MZBA 4L2LA 1MDMA 1FIAA 4C30A 5L3FA 1BIAA 1JUSA 2HYGD 1X58A 4BDZA 3FM3A 4RA2A 5JHFA 5CYVA 2LYCA 3CUQB 1XS9A 4XSXF 3TW6A 3H3ZA 1KU3A 3W6JB 3BG5A 3BCAA 4M3BA 4Y67A 1X1BA 3B3BA 2HNHA 4HA8A 2XQ0A 3C2BA 3A02A 5BPIA 4XKWA 3FM5A 5L3BA 3LSMA 2ME6A 3OSFA 2EGHA 4WK8F 5GAGJ 3LOCA 2EBIA 5FLVA 2VJ8A 4KN7X 1P4WA 4HBLA 4BHPA 5K1YA 1Q0LA 2MGQA 3TW7A 2HQ5A 3CP2A 3H5RA 4KT5C 5HLTA 2AS5F 1LEBA 4L9NA 4XIDA 4RMNA 3OWTA 4RSYA 1O3SA 4D5FA 2M7AA 3LSJA 4OIRF 3TEDA 2DA1A 1W7PB 4UV9A 1USSA 3ZR8X 4YG2F 4A3FJ 5LFAA 3KFWX 2MAPA 1WFXA 4V2GA 1W7PD 3M7GA 4HQMA 2BW3B 3GFMA 4KIFA 1R9TJ 4HNTA 1DU6A 3CC7I 2JCVA 1Y39A 3MWMA 3FMRA 2QF7A 4I09A 4OAZA 5K5QA 3RQIA 1IF1A 2DK8A 5J1YA 4NBQA 3ZQCA 1OYYA 1FYKA 3J7AY 4AVZA 3DKXA 2HDCA 2VODA 1JJ8C 2KMUA 1FMWA 1N78A 3M07A 2HTJA 2QZ8A 3OIOA 2L01A 2LF8A 3I9V2 3HUGA 1GUUA 4ANJA 5CQEA 2IT0A 2DQ6A 4NNJA 2MH2A 3CDIA 4UUTA 3KX2A 3OYMA 4XRMA 3A0HC 5EEGA 1K5HA 3CCUI 3Q3SA 2ISZA 3QPTA 1G3TA 1TW3A 3FXKA 3GLXA 2QLZA 3WG9A 4AIDA 1BIBA 2L7KA 1RR7A 3BR6A 1LFUP 3E6MA 4JP0A 3ZXSA 3MN2A 4XKBA 5B1AH 5FD5A 2X0LA 1E3PA 4UXNA 2ZMEC 3RZOJ 2R7DA 3PFYA 3ERED 5H2FC 3GFIA 3C2HA 1WH7A 3L2WA 5EJCA 1F4KA 2ZXGA 1R71A 2JCYA 3H35A 2XPZA 4ZQGA 4HG2A 4B48A 2MC3A 3M1EA 3RDIA 5JBIA 1ZKGA 1T56A 3FDYA 4DIQA 1DGRM 3S93A 1LVAA 2FU4A 3R61A 2NNYA 1W36C 3HOYJ 4U7BA 1D5VA 2OCCH 3IWZA 4RAYA 4CZCA 4PW4A 2P7VB 4MNUA 1BOAA 2JRTA 3F9KA 5BQTA 3A0BC 3ABMH 1ZG5A 1I1GA 1PDNC 3K4MA 4R1HA 3WHCA 2RNGA 1P7JA 5HS9A 3OS0A 2DMNA 3KP4A 1GT0C 2RKHA 4B43A 3F8NA 2K9NA 4NUBA 4UVBA 4IHYA 5B5EC 1WGXA 4LIUA 3V4GA 3OYLA 2E1MB 3T5XA 2MD5A 4DGWB 2ME0A 2FUG2 5TRDA 1WI3A 1SVLA 1X1AA 2HWVA 2XC7A 1T08B 2K9LA 5EEHA 3T0YA 2QEXI 1WJFA 2KIQA 3GWZA 1SAXA 1VQ4I 3H92A 4EEFG 4YRVA 4NHJA 3VSKA 3DKWA 3S3NA 3H0DA 2O9LA 3SQNA 3TGNA 4PJ0C 3FHNA 3GZ5A 1W5SA 2P6TA 3IHUA 1O3QA 3KEYA 5DCFA 2QM3A 3Q44A 3UEQA 3KZYA 3SJMA 2JQ7A 3D1NI 1NHAA 1S7OA 2KJCA 5LLQA 3ZMVA 2P0WA 4IPAA 2DTZA 4LB6B 2Y1DA 5JVGF 5JLXA 5L3CA 4OIPF 1R4MB 2DA2A 4HSTA 4UNOA 3JRBA 4XLCA 3M8JA 2F5DA 2YPRA 2LP0A 2CMPA 1NG6A 4M9SA 5HDNA 1TNTA 1B9MA 2FMLA 3W6KB 1X1PA 4XOTA 1XCBA 1FLIA 3BR5A 1GVJA 2RDPA 2WZGA 5BNGA 1V55H 1ZRDA 1TWCJ 3WTUC 3FU3A 1Z91A 3FXUA 2EIJH 4IRIA 2CYYA 1FWZA 1MGTA 2EA2A 4CUGA 4G6QA 2KIMA 3BQYA 2RJIA 3FH7A 2W4SA 2W82A 4ZW3A 2K9MA 3BJOA 1FYLA 1MSFC 1RNLA 2YSRA 2IA0A 3FTSA 2XGCA 5ICEA 3JCUC 1X1DA 3CCLI 3K4LA 1JXSA 4C2MJ 5M5WJ 3H5AA 2BV6A 2QYOA 5IYDJ 2ESNA 3R0JA 1I39A 3A1YA 1MNEA 1SD6A 4HW0A 2O03A 3FBIB 4AC0A 4WWCA 4B47A 3TQNA 1ORKA 3ASNH 5GPAA 1BL0A 1JTXA 3WTTC 4UUSA 2HDDA 3FK7A 5J47A 2NVXJ 4DOZA 5IP7J 2HEOA 2ZO4A 3WU2C 3ZQ7A 3SFZA 4LLLA 2ZKZA 3I58A 3VSLA 4PFPA 1DPUA 1KQ0A 1ZK8A 3K70C 3GFLA 1U8BA 2KRCA 6PAXA 2CW0F 1IN8A 5KHDA 4E7JA 1SC7A 4X0GA 1RI7A 2BVMA 2Y9ZA 2FNPA 1RZ4A 1ZARA 3DFGA 2ZJ2A 3NAUA 3R6SA 1XDSA 2YX7A 5CKTA 1WJDA 3O8HA 3FMQA 3IKVA 4BYYA 4EGYA 3SDBA 4XKCA 1EA3A 4UVAA 1OFCX 4MFDA 2GLOA 1XG1A 2HU9A 4L5EA 2DPUA 1E3HA 1Y6IA 1X2MA 4U0VA 5HOOA 2XGXA 3K9TA 2OZ6A 4BXUA 3OSGA 4L0ZB 5IOYA 4XL9A 4YIFA 5EDNA 1VFCA 3W2WA 3UR3C 4DYQA 3AG4H 5ICGA 3P5JA 5J40A 3OYDA 4EJTA 4UY8I 5LRRA 3MD2A 1P2FA 4XLEA 1AKHB 3H5NA 2F5EA 2PMZN 3OV8A 5DCMA 4HLXA 1WJEA 3RYPA 4DZPA 1HOMA 4XRFA 3G73A 2WPGA 4FQGA 2M9HA 1B9NA 1UG2A 1EJ9A 5FKLA 1PYVA 2E5ZA 3ZMUA 1MSEC 3V42A 2ELJA 3TL4X 1IJWC 3CMAI 2A6HF 2FEZA 3QRFF 5K7FA 2VN2A 2ID3A 2JN6A 3ECOA 4IRGA 2PL5A 3T1BA 2OQGA 1MMSA 2ICWG 1I3QJ 2QCOA 4D7NA 3JT1A 1ERDA 4Y52J 2Y75A 4HDUA 4A0ZA 2H8WA 5FROA 4F3QA 5J8CA 2A07F 1ZTRA 3C3WA 1WHUA 3DBHB 1W5CC 4BBSJ 2QBYA 1S29A 2EV5A 3I59B 2E1CA 9ANTA 2R3SA 3NQOA 1R1VA 3HRTA 4IF4A 3GTJJ 2GXBA 2WB1A 2DFEA 2CG4A 3OS2A 4Y4RA 3QP5A 4Q47A 1SVMA 4A6DA 2Z16A 4OAYA 2LR8A 3BCBA 2WA0A 4ZDOA 2PJPA 4KICA 4D0PA 3KETA 4ZX5A 4A3KJ 1OLTA 2WZFA 3OYGA 2H09A 3PO3J 1Z77A 4BQQA 1T1SA 5IYCJ 3A14A 3REOA 1KONA 1FOYA 2BXZA 3S32A 4XO3A 3AG3H 3LA2A 3K1NA 3RQ4A 4KN4X 1QNTA 3S3MA 3N97A 2ZXJA 1SFKA 4HX4A 5GAEJ 3K1PA 4Y6RA 3FMSA 2RC4A 5HS8A 3QU3A 3FUMA 4XMVA 3L2QA 4F92B 1YJNI 1ETYA 4LLGF 1EKEA 5IPAA 2O7GA 2DOFA 1J2XA 2JK3A 2DDBA 2L7FP 2X1DA 4OWRB 4BJ6C 3L2RA 1R58A 2MABA 2VBZA 4JX6A 4L9TA 4LK0F 2L7MP 3B7RL 2GOMA 5CVVA 2D45A 5LGNA 3K69A 3L2VA 2L9NA 3DLLF 3HRMA 3EUHC 2L2OA 2IW5A 1LUJB 2FOKA 5IP9J 1QQIA 2ZXHA 1ZLJA 2DA7A 4RGRA 3ABKH 4UB6C 4LG0A 4H0EA 2HVQA 2VUMJ 1QU3A 2DMTA 2DT5A 2LF7A 4AIHA 1GHCA 2CW7A 1XPXA 4N0BA 5DD8A 4PJMA 1HC8A 3O6BB 2XKOA 4M9XA 2F4MB 3SYTA 5E3NA 2E2JJ 4ZQFA 1T38A 1TQIA 3H9JA 2EQRA 4LG3A 2Y30A 3WGIA 2VJ4A 5HLIA 4AU7A 1WPKA 2C82A 3AU8A 1L0OC 2B7EA 2ZMEB 1LFBA 4FTHA 4IHWA 1S8NA 2CO5A 5CVIA 4KMFA 4XN8A 2JTVA 2A61A 3PL8A 1AOYA 1E0EA 4AD9A 4I76A 1P9QC 3IUOA 2KJBA 2XASA 2P4WA 4XBFA 1ETXA 4RBOA 2JA2A 4IEJA 1V4RA 3OY9A 5GTHC 1TP4A 4PJLA 3JSZA 4M74A 2OBPA 5AIPA 2DMPA 1B4AA 5K5OA 3P9IA 2MYSA 2Y0SN 1MBHA 2FQ3A 1KU9A 2Y31A 1FJLA 2IJLA 3KP5A 2ELHA 4MLOA 2V6CA 5E3OA 1K83J 1W36D 3BZ6A 2Z9OA 2VJ5A 1D5YA 5DV5A 1XMXA 2HTSA 2VKEA 5DDGA 2LD5A 3OIQA 3SZTA 5IT9K 3KYLA 2HQNA 1FOKA 2Q0OA 3GCMA 2V1NA 2JD1A 5ICCA 4RAGA 4HX7A 4M6YA 2K85A 1YRNB 2JV7A 3JR9A 5F1RA 2XSJC 3FU5A 2L9VA 2MW8A 1EH6A 2M8GX 1O3RA 4AIKA 2E35A 3WTWC 3DU6A 3JW4A 2A69F 1JKOC 3QOEA 4JX5A 4CDGA 4GAAA 3KEOA 3ZP5A 5L3DA 4ZX3A 5KAFC 3B2XA 1TQMA 3H9GA 4Q48A 3HW2A 3CCVI 1T2KA 1U6GA 3VWBA 3E0JB 1OMIA 4O6JA 1TL8A 1YIJI 3LSGA 3Q0VA 2CSOA 1T6SA 2JA8J 3LAJA 4QPEA 4XMZA 4FASD 3RPUD 3NWSA 1R0KA 4MHGA 3OYHA 4BXXJ 2QVOA 3VVMA 1GV5A 1HSJA 2FE3A 4DBQA 3W6VA 4PCQA 3GTQJ 1MMAA 3FXOA 3ZQLA 2M4GA 1BJAA 3HZJA 2ZSIB 4A5MA 3SEQA 1R5GA 2UV1A 2CV2A 5LEKA 2O7OA 4LOCA 3CCJI 5IY5H 1I6XA 4K5OA 4K5PA 2ID6A 3K2ZA 1JKRC 2DMQA 2Z3YA 5D8LB 4I2OA 3H36A 3MQ0A 1G8XA 2FA5A 3B73A 4RB0A 4O5VA 4ZZLA 4FISA 1NG7A 3Q9SA 2LG4A 4ZYDA 4AYBA 2LKXA 2WAQN 1GXQA 4O3MA 1SMTA 1ODDA 4BKXA 1PP7U 3FKIJ 2LK2A 4ETSA 3WTYC 1ZR2A 2HXIA 2WWYA 2HZDA 3FTYA 3C2GA 2M4KA 2CQ7A 1H0MA 1WKMA 4BY7J 4CYCA 4B1RA 1ZS2A 1Z05A 4BNCA 2EZIA 3BROA 2LBFA 1R1UA 4A3MJ 4LUPA 1JI8A 1BA5A 3OYCA 3R60A 2EWNA 5ED4A 5JO0A 3ZQGA 1HQCA 4D7MA 5C4JJ 4EJWA 3NRVA 2XHKA 2P81A 2MA3A 1LDKB 2X6WA 3M8EA 2VLAA 1LKXA 4F55A 4MEYF 4X1EA 1TT5B 2V1DA 4BJTA 2R7UA 1PUEE 5FKMA 5DYMA 4Q4ZF 2QA4I 3KIOA 4WXDA 1HLVA 5FWQA 5E1WA 2OA4A 3F22A 3MKLA 4E7IA 2YU9J 4E70A 1DPRA 3CZLA 3E5UA 4XONA 2Q1ZB 2QQAA 3I4NJ 3MFKA 3EYIA 3CO7C 3CUQA 5FLXK 4RLFA 3BTJA 4C2TA 2YX4A 3MMYB 2B0LA 4K2EA 1W0TA 3AUAA 1QO0D 4GAEA 4B8XA 3FH5A 2FD5A 2FRHA 1AA7A 3TP0A 3ZMSA 1WJAA 1I6HJ 2E60A 3U9GA 3JREA 3C7JA 2PUSA 4ZX6A 4RGSA 5FKKA 2VOPA 1F1ZA 1XMAA 1ETKA 2VC1A 2PEXA 2CUEA 1Z9CA 1DUXC 1X3WB 5J3LA 3BQZA 3COAC 2DO7A 2VBXA 1ZAOA 3TP3A 1D8JA 3CJNA 1IGNA 2DOAA 2V1UA 4CCKA 1FPQA 3PQJA 5LHIA 3LFKA 2F5VA 5IT3A 3CCMI
chains in the Genus database with same CATH topology
1LE8B 1GV2A 4PW4A 4QHPA 2LY9A 1JKPC 3FUIA 3FUFA 2RAEA 2NVQJ 2X6OA 3QQAA 4A3CJ 3WHCA 1ZQ3P 1P7JA 2CUFA 3BG9A 2DMNA 1RKWA 4RDUA 4UUSB 3Q43A 4NDLA 1GT0C 1PUFB 4R5XA 4A03A 2K9NA 4PVBA 4IHYA 5GPCA 1S7EA 1WGXA 5JLWA 4FCYA 4X6AJ 3R0IA 4XO4A 3B37A 5EGOB 2ME0A 2QVWA 1WI3A 5AENA 1MH3A 2HOSA 3QJXA 1IUFA 3SDGA 4XO5A 2ELKA 3T0YA 3WQRA 1DU0A 3CCYA 4EEFG 2VPRA 4K5NA 2LLKA 3FK6A 2JMWA 3G1OA 2O9LA 4PU2A 4XMTA 2Y1CA 5EZGA 1JKQC 4XICA 4ZQHA 3HGGA 2YUSA 3Q44A 4FE4A 4XK4A 3JRAA 3UEQA 5HNHA 3SJMA 3D1NI 3K7AJ 1JT6A 1ENHA 3HEFA 3CHPA 3FH8A 4QSHA 3S2HJ 5M5YJ 2DTZA 1MW1A 2Y1DA 4FLRA 2NS7A 5JLXA 2DA2A 4Y7NJ 3HDDA 3GTKJ 4CXFA 3JRBA 1H19A 5E3MA 3MVPA 2NOGA 2LP0A 4D5CA 5K7HA 3RZDJ 4A3IJ 4W97A 2Y2ZA 1ETOA 4ZQTA 2CJJA 3HOWJ 2H8RA 3CHSA 2XB5A 3BR5A 2MAOA 1U78A 4G12A 2WZGA 5BNGA 3FUEA 4M3FA 1H3LA 3WQSB 1TWCJ 3FU3A 2LFBA 2HOTA 4ZX4A 1SG7A 3G1MA 4M3EA 1EF4A 1WH5A 3FUNA 1ETQA 1RPWA 1X3WA 2HOAA 3BQYA 2RJIA 3CIAA 3FH7A 2E19A 4A3GJ 4ZW3A 3ZOBA 3B7SA 3FTZA 4XN1A 4AR8A 1MSFC 3FTSA 1GW6A 4B3AA 3FU6A 2XGCA 1XC5A 4IHVA 3IIEA 1TWAJ 3B7UX 2R59A 4FCAA 2AHQA 2XGEA 4C2MJ 2XRLA 5M5WJ 4XRSA 2WB1N 5IYDJ 4XN4A 2XPYA 1FTZA 4AUXA 1LE8A 3GTLJ 3S1MJ 2R0QC 3FUJA 3GBGA 4BBRJ 4AC0A 3S1RJ 4KP7A 1VNDA 3JRCA 1ORKA 5GPAA 1BL0A 5JAZA 1JTXA 3ZQFA 3CHQA 3VVLA 4UUSA 4XN9A 2VKVA 1PUFA 1MW2A 1Z0XA 2HDDA 1S46A 3FK7A 2NVXJ 5IP7J 4R7LA 1RKTA 5EGOA 1JVSA 5JNLA 4M6VA 2K9SA 4AR9A 1ZK8A 3HM5A 3FTWA 2OPTA 1U8BA 4C3IJ 4X2UA 4XMXA 3FISA 1A6IA 4XNBA 3BG3A 1MBJA 2XSDC 2Y9ZA 2R70A 4NQWA 2R7ZJ 3IH4A 1JUPA 5GP9A 3NAUA 1W0UA 3B7TA 3VPRA 3ANNA 4XMWA 5F0FA 3HKZN 3O8HA 1QPIA 4AYBN 3GTGJ 4ZW6A 5C4XJ 1OFCX 1HDPA 3S1QJ 2JA7J 4MFDA 1FIPA 2CQXA 2GLOA 3S16J 2GM4A 5HNFA 4A3DJ 1IRZA 1XG1A 4L5EA 1JT0A 3AU9A 2NS8A 3ZHXA 5M3MJ 3EBHA 1X2MA 1MBEA 2GTQA 5F08A 3OSGA 1R0LA 3BTLA 5IOYA 4I6ZA 2O8KA 5EDNA 1TC3C 1VFCA 3UCQA 4DYQA 3B34A 5DTDA 3GTPJ 3FUHA 5FKOA 3FUKA 1TWHJ 2FX0A 3NARA 5F1JA 3LSPA 3IH2A 2XPVA 3K2AA 1AKHB 2PMZN 4MFEA 1JUMA 4M3DA 4DZPA 2FFLA 3A01B 1HOMA 4DYCA 3M4OJ 2WPGA 2CU7A 2TRTA 4IHXA 1RESA 4Q4EA 2M9HA 1IC8A 1UG2A 1X2NA 1MNMC 3FHEA 3LSRA 4OOEA 5FKLA 3JRFA 1HCRA 1SQMA 2FQ4A 1MSEC 1MVYA 2LVSA 2ZB9A 3QPSA 2M34A 1IJWC 2JD0A 2KT0A 1ETVA 3BR1A 2EZHA 5K7FA 2ID3A 2JN6A 3F0CA 2B61A 5EZHA 2PL5A 1T1RA 1I3QJ 3BR0A 3ZQHA 2IAIA 2QCOA 4QIRA 4D7NA 2QJ1A 2EH3A 3FTVA 3JT1A 3O8GA 1I50J 4Y52J 1ZGWA 2LTPA 3IH3A 2A7OA 4HNVA 1ZTRA 4A3EJ 4BY1J 1O4XA 1IV6A 1CQTA 4BBSJ 4FLOA 9ANTA 2HI3A 5F27A 2DMUA 5EV7A 2HPTA 3GTJJ 1BW5A 2FJ1A 5FJ8J 3HOZJ 3CZKA 5BPPA 4M3GA 1B8IB 1QVTA 4J3BA 3GTMJ 2LR8A 2M2EA 3T8VA 5IP6A 3B6AA 3HB9A 3UERA 5DS9A 4ZX5A 4A3KJ 2WZFA 3FTUA 2B63J 1ONOA 2TCTA 2AO9A 4AR1A 3PO3J 5EF6A 1ETWA 1Z77A 3ZQIA 4QIWN 4XN2A 1T1SA 5IYCJ 3I4MJ 3IV5A 3A14A 2G0EA 2NVTJ 2COBA 4XO3A 1GVDA 1Q0QA 2OF7A 5JC1A 5E3LA 3BTCA 3S14J 1FTTA 4JYKA 2R92J 1Y1WJ 2N8GA 2DN0A 3CHRA 5F0CA 4Y6RA 3FUMA 4XMVA 4ZW8A 2K9QA 3RC3A 1ETYA 1NTCA 1MBFA 5IPAA 2L7FP 2JK3A 5IOZA 1ITYA 2O7GA 3WHBA 3FULA 3JRHA 4AICA 1IDZA 4JX6A 1OCPA 4MKTA 2JA5J 2L7MP 4C3JJ 3B7RL 1WCMJ 1AKHA 3S17J 1G5AA 4C3HJ 3JRDA 2E2IJ 1UHSA 3A01A 4FLSA 2R5ZB 4Y6PA 3ZHYA 5IP9J 2K40A 2DA7A 5IYBJ 1APLC 2M0CA 3L1PA 1SC5A 4AYSA 2VUMJ 2DMTA 3CZGA 3PUUA 1K61A 4V2FA 2CQQA 1Q0HA 5E3NA 2E2JJ 1ONPA 4ZQFA 1MH4A 4ZN6A 2EQRA 2Y30A 2C82A 3AU8A 2IEKA 1WPKA 1LFBA 4FTHA 4IHWA 2MG4A 1JG9A 3M3YJ 4XN8A 1JTYA 2EZKA 3RKQA 1OJLA 4I76A 4DYRA 1IG7A 3RASA 4A3JJ 1POGA 2EZLA 3ANLA 1ETXA 2NVYJ 5HODA 4J19A 5DLLA 4RBOA 4IEJA 3JSZA 2ECBA 2HYJA 1F36A 2DMPA 4MS6A 1B8IA 4ABZA 4ARFA 2Y0SN 1MBHA 1H8AC 1AU7A 2Y31A 2Y1GA 3LNQA 1FJLA 4MLOA 3B6CA 5E3OA 4DW6A 1K83J 3BTIA 4R5VA 4XN7A 4XNDA 4QTRA 2ECCA 2JWTA 3CDLA 3ANMA 1Y1VJ 3U9WA 5EEAA 1QVUA 3DCFA 1D5YA 1P7IA 2MSYA 1UMQA 1MBGA 3PM1A 1H88C 3EBIA 2VKEA 2XPUA 2LD5A 2D5VA 3S2DJ 4K5LA 5J1UA 3ZHZA 4CYCB 3S15J 4A3BJ 1A5JA 2JD1A 4K5MA 2XB0X 3JRGA 4XNAA 3CMYA 1BW6A 2R72A 4DPRA 1HS6A 5K7ZA 3Q0UA 1YRNB 2JV7A 3JR9A 4RVBA 4R5TA 4A93J 3HOUJ 3FU5A 3SFIA 2MW8A 1RP3A 1T33A 2M8GX 1JJ6C 5JMPA 1JKOC 5DULA 3HBLA 4JX5A 2R5ZA 4Q4IA 1E3OC 4A69C 4GAAA 5FLMJ 2DA4A 4ZW5A 4ZX3A 3FIWA 3HGYA 4B4CA 3B2XA 2DA3A 1NK3P 1JGIA 2Y1EA 3OOUA 4L2LA 5EYRA 1VF9A 4XRSG 1FIAA 3FUDA 3WQQA 1FEXA 4MO7A 5EG0B 5M3FJ 3LSGA 4FE7A 1JUSA 3Q0VA 1X58A 2JA8J 2L7ZA 2R5YB 4QPEA 4XMZA 2HXOA 1XS9A 4XMUA 1U9NA 2HPOA 3TW6A 2L9RA 1AHDP 1R0KA 4BXXJ 3VVMA 1GV5A 3W6VA 3E7LA 1SFOJ 4GFBA 3BG5A 3GTQJ 3EBGA 4M3BA 4Y67A 3ZQLA 2IBDA 3B3BA 4OOFA 1MW3A 3C2BA 2XQ0A 1HDDC 3A02A 5FKNA 2GBYA 2ME6A 3UKGA 3OSFA 2E2HJ 2EGHA 5M5XJ 1GDTA 4QUOA 2O7OA 4LOCA 3ZI0A 3LOCA 5DYFA 2EBIA 5FLVA 3PO2J 2ID6A 2VJ8A 4K5OA 4K5PA 3RC8A 1JKRC 2DMQA 2DQMA 1Q0LA 2MGQA 1IDYA 2CRGA 3TW7A 2HQ5A 5C44J 2C5ZA 5HLTA 4XIDA 4RSYA 4FISA 4D5FA 3LSJA 3DEWA 3TEDA 2H1KA 2LKXA 2X48A 2WAQN 1X3ZA 2DA1A 1H89C 4BKXA 1RETA 2E1OA 3FKIJ 2LK2A 1SANA 4A3FJ 1TWFJ 3H0GJ 2DJNA 2HXIA 1ZR2A 2JCXA 2MAPA 4V2GA 4S0HB 3FTYA 2YS9A 4ZW7A 3CHOA 4BY7J 4CYCA 3H3VK 4B1RA 1R9TJ 1G2HA 1ZS2A 2JCVA 1HF0A 2EZIA 1DU6A 5C3EJ 3CZEA 3CQZJ 3S1NJ 2QF7A 4A3MJ 3QPLA 1B72A 4LUPA 1BA5A 1YRNA 2DA6A 4DZJA 2XGDA 3RQIA 5J1YA 3FTXA 3KEDA 5JO0A 5F04A 3BR3A 3ZQGA 3ZQCA 3G1LA 4D7MA 2PGGA 5C4JJ 2R93J 1JJ8C 2P81A 2VLAA 3OIOA 2JJ7A 4X1EA 1F43A 3A03A 1GUUA 1JGGA 3JRIA 3HOXJ 2DQ6A 3BT9A 1OCTC 3GTOJ 5FKMA 4UUTA 1HLVA 5FWQA 4W1UA 2XPWA 4XRMA 3MKLA 2YU9J 3HOVJ 1MBKA 1K5HA 1VI0A 5EG0A 3CZLA 3Q3SA 4RCVA 1TWGJ 3I4NJ 4Y6SA 1RR7A 3BR6A 2R5YA 1LFUP 2I10A 1QRYA 4JP0A 3BR2A 3A06A 1Q1VA 3FU0A 5JMWA 1OR7A 1NK2P 3BTJA 3MN2A 5J1RA 1W0TA 1MW0A 2JD2A 2WV1A 3AUAA 4GAEA 1ZR4A 4MIMA 3B2PA 3FH5A 4FLQA 1BJZA 2FD5A 3TP0A 3RZOJ 1I6HJ 4JX4A 1U9OA 5F0HA 3JREA 2PUSA 4ZX6A 2DA5A 5FKKA 1WH7A 4QMEA 1ETKA 2ZXGA 2CUEA 2JCYA 2XPZA 4ZQGA 2VI6A 5J3LA 2Y1FA 3BQZA 4XN5A 4A3LJ 4ZQEA 2JA6J 3Q0WA 3TP3A 2L0KA 1ONNA 5JBIA 2KDZA 1ZKGA 1IGNA 1T56A 4JNDA 1B72B 2W48A 3HOYJ 2X9DA 2Y9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE8 B;  1GV2 A;  2LY9 A;  1JKP C;  2RAE A;  2NVQ J;  2X6O A;  3QQA A;  4A3C J;  3WHC A;  1ZQ3 P;  1P7J A;  2CUF A;  3BG9 A;  2DMN A;  1RKW A;  4RDU A;  4UUS B;  4NDL A;  1GT0 C;  1PUF B;  2K9N A;  4IHY A;  5GPC A;  1S7E A;  1WGX A;  5JLW A;  4FCY A;  4X6A J;  5EGO B;  2ME0 A;  1WI3 A;  1MH3 A;  2HOS A;  1IUF A;  3SDG A;  2ELK A;  1DU0 A;  3CCY A;  4EEF G;  2VPR A;  2LLK A;  3FK6 A;  2JMW A;  3G1O A;  2O9L A;  5EZG A;  1JKQ C;  4XIC A;  3HGG A;  2YUS A;  4FE4 A;  4XK4 A;  3JRA A;  3SJM A;  3D1N I;  3K7A J;  1JT6 A;  1ENH A;  3HEF A;  4QSH A;  3S2H J;  5M5Y J;  2DTZ A;  2NS7 A;  5JLX A;  2DA2 A;  4Y7N J;  3HDD A;  3GTK J;  3JRB A;  5E3M A;  3MVP A;  2NOG A;  2LP0 A;  4D5C A;  5K7H A;  3RZD J;  4A3I J;  4W97 A;  2Y2Z A;  1ETO A;  2CJJ A;  3HOW J;  2H8R A;  2XB5 A;  3BR5 A;  1U78 A;  4G12 A;  5BNG A;  4M3F A;  1TWC J;  2LFB A;  2HOT A;  3G1M A;  4M3E A;  1EF4 A;  1WH5 A;  1ETQ A;  1RPW A;  2HOA A;  3BQY A;  2E19 A;  4A3G J;  3ZOB A;  1MSF C;  4B3A A;  2XGC A;  1XC5 A;  4IHV A;  1TWA J;  2AHQ A;  2XGE A;  4C2M J;  2XRL A;  5M5W J;  4XRS A;  2WB1 N;  5IYD J;  1FTZ A;  4AUX A;  1LE8 A;  3GTL J;  3S1M J;  2R0Q C;  3GBG A;  4BBR J;  4AC0 A;  3S1R J;  1VND A;  3JRC A;  1ORK A;  5GPA A;  1BL0 A;  1JTX A;  3ZQF A;  4UUS A;  2VKV A;  1PUF A;  1Z0X A;  2HDD A;  3FK7 A;  2NVX J;  5IP7 J;  1RKT A;  5EGO A;  4M6V A;  2K9S A;  1ZK8 A;  3HM5 A;  2OPT A;  1U8B A;  4C3I J;  3FIS A;  1A6I A;  3BG3 A;  1MBJ A;  2XSD C;  2Y9Z A;  2R7Z J;  3IH4 A;  1JUP A;  5GP9 A;  3NAU A;  1W0U A;  3VPR A;  5F0F A;  3HKZ N;  3O8H A;  1QPI A;  4AYB N;  3GTG J;  5C4X J;  1OFC X;  1HDP A;  3S1Q J;  2JA7 J;  4MFD A;  1FIP A;  2CQX A;  2GLO A;  3S16 J;  2GM4 A;  4A3D J;  1IRZ A;  1XG1 A;  4L5E A;  1JT0 A;  2NS8 A;  5M3M J;  1X2M A;  1MBE A;  5F08 A;  3OSG A;  3BTL A;  5IOY A;  4I6Z A;  2O8K A;  5EDN A;  1TC3 C;  1VFC A;  4DYQ A;  5DTD A;  3GTP J;  5FKO A;  1TWH J;  2FX0 A;  3NAR A;  5F1J A;  3LSP A;  3IH2 A;  2XPV A;  3K2A A;  1AKH B;  2PMZ N;  4MFE A;  1JUM A;  4M3D A;  4DZP A;  3A01 B;  1HOM A;  4DYC A;  3M4O J;  2CU7 A;  2TRT A;  4IHX A;  1RES A;  2M9H A;  1IC8 A;  1UG2 A;  1X2N A;  1MNM C;  3LSR A;  5FKL A;  3JRF A;  1HCR A;  2FQ4 A;  1MSE C;  2LVS A;  2ZB9 A;  3QPS A;  2M34 A;  1IJW C;  2KT0 A;  1ETV A;  3BR1 A;  2EZH A;  5K7F A;  2ID3 A;  2JN6 A;  3F0C A;  5EZH A;  1I3Q J;  3BR0 A;  3ZQH A;  2IAI A;  2QCO A;  4D7N A;  2EH3 A;  3O8G A;  1I50 J;  4Y52 J;  1ZGW A;  2LTP A;  3IH3 A;  4HNV A;  1ZTR A;  4A3E J;  4BY1 J;  1O4X A;  1IV6 A;  1CQT A;  4BBS J;  9ANT A;  2HI3 A;  5F27 A;  2DMU A;  3GTJ J;  1BW5 A;  2FJ1 A;  5FJ8 J;  3HOZ J;  4M3G A;  1B8I B;  1QVT A;  3GTM J;  2LR8 A;  2M2E A;  5IP6 A;  3B6A A;  3HB9 A;  5DS9 A;  4A3K J;  2B63 J;  2TCT A;  2AO9 A;  3PO3 J;  5EF6 A;  1ETW A;  1Z77 A;  3ZQI A;  4QIW N;  5IYC J;  3I4M J;  3IV5 A;  2G0E A;  2NVT J;  2COB A;  1GVD A;  2OF7 A;  5E3L A;  3BTC A;  3S14 J;  1FTT A;  4JYK A;  2R92 J;  1Y1W J;  2N8G A;  2DN0 A;  5F0C A;  2K9Q A;  1ETY A;  1NTC A;  1MBF A;  5IPA A;  2L7F P;  2JK3 A;  5IOZ A;  1ITY A;  3WHB A;  3JRH A;  1IDZ A;  4JX6 A;  1OCP A;  2JA5 J;  2L7M P;  4C3J J;  1WCM J;  1AKH A;  3S17 J;  4C3H J;  3JRD A;  2E2I J;  1UHS A;  3A01 A;  2R5Z B;  5IP9 J;  2K40 A;  2DA7 A;  5IYB J;  1APL C;  2M0C A;  3L1P A;  2VUM J;  2DMT A;  1K61 A;  4V2F A;  2CQQ A;  5E3N A;  2E2J J;  1MH4 A;  2EQR A;  2Y30 A;  2IEK A;  1WPK A;  1LFB A;  4FTH A;  4IHW A;  2MG4 A;  3M3Y J;  1JTY A;  2EZK A;  3RKQ A;  1OJL A;  4I76 A;  4DYR A;  1IG7 A;  4A3J J;  1POG A;  2EZL A;  1ETX A;  2NVY J;  5HOD A;  4J19 A;  4RBO A;  4IEJ A;  2ECB A;  2HYJ A;  1F36 A;  2DMP A;  1B8I A;  4ABZ A;  2Y0S N;  1MBH A;  1H8A C;  1AU7 A;  2Y31 A;  3LNQ A;  1FJL A;  4MLO A;  3B6C A;  5E3O A;  4DW6 A;  1K83 J;  3BTI A;  4QTR A;  2ECC A;  2JWT A;  3CDL A;  1Y1V J;  5EEA A;  1QVU A;  3DCF A;  1D5Y A;  1P7I A;  2MSY A;  1UMQ A;  1MBG A;  3PM1 A;  1H88 C;  2VKE A;  2XPU A;  2LD5 A;  2D5V A;  3S2D J;  5J1U A;  4CYC B;  3S15 J;  4A3B J;  1A5J A;  2XB0 X;  3JRG A;  3CMY A;  1BW6 A;  5K7Z A;  3Q0U A;  1YRN B;  3JR9 A;  4A93 J;  3HOU J;  3SFI A;  2MW8 A;  1T33 A;  2M8G X;  1JJ6 C;  1JKO C;  3HBL A;  4JX5 A;  2R5Z A;  1E3O C;  4A69 C;  5FLM J;  2DA4 A;  3FIW A;  3HGY A;  4B4C A;  2DA3 A;  1NK3 P;  3OOU A;  5EYR A;  1VF9 A;  4XRS G;  1FIA A;  1FEX A;  4MO7 A;  5EG0 B;  5M3F J;  3LSG A;  4FE7 A;  1JUS A;  3Q0V A;  1X58 A;  2JA8 J;  2L7Z A;  2R5Y B;  2HXO A;  1XS9 A;  1U9N A;  3TW6 A;  2L9R A;  1AHD P;  4BXX J;  1GV5 A;  3W6V A;  3E7L A;  1SFO J;  4GFB A;  3BG5 A;  3GTQ J;  4M3B A;  3ZQL A;  2IBD A;  3C2B A;  1HDD C;  3A02 A;  5FKN A;  2GBY A;  2ME6 A;  3UKG A;  3OSF A;  2E2H J;  5M5X J;  1GDT A;  2O7O A;  4LOC A;  3LOC A;  2EBI A;  5FLV A;  3PO2 J;  2ID6 A;  1JKR C;  2DMQ A;  2MGQ A;  1IDY A;  2CRG A;  3TW7 A;  2HQ5 A;  5C44 J;  4XID A;  4FIS A;  4D5F A;  3LSJ A;  3DEW A;  3TED A;  2H1K A;  2LKX A;  2X48 A;  2WAQ N;  2DA1 A;  1H89 C;  4BKX A;  1RET A;  2E1O A;  3FKI J;  2LK2 A;  1SAN A;  4A3F J;  1TWF J;  3H0G J;  2DJN A;  2HXI A;  1ZR2 A;  4V2G A;  4S0H B;  2YS9 A;  4BY7 J;  4CYC A;  3H3V K;  4B1R A;  1R9T J;  1G2H A;  1HF0 A;  2EZI A;  1DU6 A;  5C3E J;  3CQZ J;  3S1N J;  2QF7 A;  4A3M J;  3QPL A;  1B72 A;  1BA5 A;  1YRN A;  2DA6 A;  4DZJ A;  2XGD A;  3RQI A;  5J1Y A;  5F04 A;  3BR3 A;  3ZQG A;  3ZQC A;  3G1L A;  4D7M A;  5C4J J;  2R93 J;  1JJ8 C;  2P81 A;  3OIO A;  2JJ7 A;  4X1E A;  1F43 A;  3A03 A;  1GUU A;  1JGG A;  3JRI A;  3HOX J;  3BT9 A;  1OCT C;  3GTO J;  5FKM A;  4UUT A;  1HLV A;  4W1U A;  2XPW A;  4XRM A;  3MKL A;  2YU9 J;  3HOV J;  1MBK A;  1VI0 A;  5EG0 A;  3Q3S A;  1TWG J;  3I4N J;  1RR7 A;  3BR6 A;  2R5Y A;  1LFU P;  2I10 A;  1QRY A;  4JP0 A;  3BR2 A;  1Q1V A;  1NK2 P;  3BTJ A;  3MN2 A;  5J1R A;  1W0T A;  2WV1 A;  1ZR4 A;  4MIM A;  1BJZ A;  2FD5 A;  3TP0 A;  3RZO J;  1I6H J;  4JX4 A;  1U9O A;  5F0H A;  3JRE A;  2DA5 A;  5FKK A;  1WH7 A;  1ETK A;  2CUE A;  2VI6 A;  5J3L A;  3BQZ A;  4A3L J;  2JA6 J;  3Q0W A;  3TP3 A;  2L0K A;  2KDZ A;  1ZKG A;  1IGN A;  1T56 A;  1B72 B;  2W48 A;  3HOY J;  2X9D A;  2Y9Y A; 
#chains in the Genus database with same CATH topology
 2BYV E;  1TQP A;  3L9F A;  2LY9 A;  5LEJ A;  1W7P A;  2RAE A;  1BI3 A;  4XQF A;  1VQ5 I;  1Z21 A;  2KHM A;  4NDL A;  3ZN1 A;  1PUF B;  4R5X A;  1K4S A;  2DDA A;  2F5F A;  5GPC A;  2BW3 A;  5JLW A;  4FCY A;  4XO4 A;  4BHC A;  2OQR A;  3HPH A;  4PSW A;  3PSF A;  2QVW A;  1BI2 A;  2XF6 A;  4BJ5 C;  3OYA A;  3ISP A;  3DQV C;  2KFD A;  2NNN A;  3CJT B;  3WQR A;  4ZJZ A;  1HST A;  2E36 A;  2DBB A;  1Y56 A;  5BOX A;  4ZTJ A;  3K4J A;  3ABT A;  4PU2 A;  2M5W A;  1A31 A;  4LLN A;  1BBY A;  3HHH A;  4BQA A;  3HGG A;  4ZQH A;  5HNH A;  4HZF A;  2RNJ A;  1JT6 A;  1ENH A;  3WGG A;  5K5R A;  3FH8 A;  4QSH A;  4KIB A;  1MW1 A;  5D6F A;  3BLY A;  4Y15 A;  4FLR A;  2NS7 A;  2QUF A;  3JSO A;  4Y7N J;  2STT A;  4CXF A;  3HDD A;  3GTK J;  1YI2 I;  1A35 A;  2O61 A;  2AQF A;  1H19 A;  3MVP A;  3I64 A;  4D5C A;  3QAH A;  5K7H A;  1KYW A;  2YR2 A;  3RZD J;  2Y2Z A;  1ETO A;  2CJJ A;  3DTE A;  3GLL A;  3CF5 F;  2XB5 A;  2OCE A;  2MAO A;  2NXN B;  4EV0 A;  4G12 A;  3VOD A;  3W2V A;  2VON A;  3K4C A;  5A2Q Z;  1IRG A;  4RB3 C;  1OR7 C;  3WQS B;  2DW4 A;  2LFB A;  4JQF A;  4KMU X;  4M3E A;  1B6A A;  1MD0 A;  2LDU A;  1YW9 A;  1ETQ A;  2WAE A;  1RPW A;  4UVC A;  4A3G J;  4KYW A;  3B7S A;  3FTZ A;  3C1D A;  4XN1 A;  4AR8 A;  2ZNY A;  4IHV A;  1VQ8 I;  3QYB A;  2XGE A;  4HPQ A;  4HLY A;  2C6Y A;  2XPY A;  1FTZ A;  3S1M J;  2I5U A;  3CCE I;  1ZG1 A;  3OR2 C;  4BBR J;  1T0F C;  2RV8 A;  4PFO A;  5E18 F;  2M30 A;  3QYF A;  1HXD A;  1VQO I;  3CHQ A;  3I53 A;  1UEL B;  1WI9 A;  1FP1 D;  4R7L A;  3K4B A;  5HS7 A;  4BEH B;  3AL0 C;  1J7K A;  2ETH A;  4DQ2 A;  4NC7 A;  4AR9 A;  2VBY A;  3FWE A;  3HM5 A;  3V8L A;  1D1B A;  4X2U A;  4XMX A;  2YU3 A;  3BG3 A;  5LHG A;  1MKM A;  2A68 F;  1ON2 A;  1R4N B;  4CCO A;  2R7Z J;  2W25 A;  4F52 A;  1YW8 A;  2M7B A;  2ISY A;  2UXN A;  5F6F A;  4ZW6 A;  3LSH A;  3CLQ A;  1FSE A;  1XSV A;  4AYB N;  3E6B A;  5JHU A;  3ML6 A;  1HDP A;  5FB2 A;  4LFU A;  3S16 J;  3IWF A;  2LKS A;  2JSC A;  3AU9 A;  1VQM I;  4L5I A;  4XLH A;  1KZH A;  2DU9 A;  1FBU A;  5F08 A;  1ZGJ A;  3ONQ A;  3J80 Z;  1R0L A;  1VQL I;  5LGT A;  4I6Z A;  1QHH D;  3AKZ A;  2X1C A;  2STW A;  1ONV A;  2H94 A;  2IA2 A;  2GZW A;  3B34 A;  5DTD A;  3GTP J;  2O0Y A;  1AWC A;  4GO1 A;  2QKM B;  3NAR A;  2L54 A;  1GXP A;  1I5Z A;  1R7J A;  4G8X A;  4F93 B;  5FRM A;  5B3S H;  1G3S A;  3LMM A;  2FFL A;  2X6X A;  4DYC A;  1BI1 A;  2G7U A;  2CU7 A;  1RES A;  4XLF A;  1IC8 A;  4Q4E A;  5ERI A;  1UG0 A;  3FXQ A;  3BY6 A;  4GGG A;  4LD5 A;  3FHE A;  3LSR A;  1I27 A;  3OYE A;  1OCR H;  1HCR A;  2JPC A;  3L00 A;  3N05 A;  4D1Q A;  4A2U A;  3PNY A;  3DEE A;  3JSP A;  5JI6 A;  3M1C A;  5DUK A;  2B61 A;  1XX5 A;  2JUG A;  2HKO A;  2VKH A;  2Y69 H;  4XLP F;  3IL2 A;  4XNF A;  3QWL A;  1D3Y A;  2DLL A;  2CUZ A;  3O8G A;  1I50 J;  4GYI A;  3TO6 A;  2E7W A;  4KIG A;  5AIQ A;  2QSG X;  1IXR C;  2A7O A;  4A3E J;  3SXY A;  2LY1 A;  2DFF A;  1G4D A;  1FSH A;  4Y33 A;  4AM3 A;  2DI3 A;  4G6D A;  5FRN A;  2BOL A;  2XAF A;  2FJ1 A;  2P5L C;  1NH3 A;  1S5L C;  3HOZ J;  5BPP A;  2XF5 A;  2K02 A;  1B8I B;  1QVT A;  4J3B A;  4P55 A;  3GTM J;  3U2R A;  4S05 A;  3R0A A;  5DS9 A;  2IS2 A;  2IS6 A;  1SD4 A;  4LIT A;  3OOP A;  1UB9 A;  2ACJ A;  5CVU A;  4HSR A;  1ONO A;  1ACI A;  3EQL F;  4ZYG A;  4IZZ A;  1CGP A;  5ILS A;  3OIP A;  5KAI C;  4AIJ A;  4XR6 A;  5JFR A;  2COB A;  1A04 A;  5DD4 A;  3FBN B;  5IT9 Z;  3BTC A;  2OV7 A;  1J5Y A;  1FTT A;  3K1M A;  3BWG A;  3LST A;  1S9H A;  1A36 A;  2VXD A;  4ZW8 A;  3GFJ A;  2DK5 A;  3RC3 A;  1W4M A;  4MEX F;  1IN6 A;  1MBF A;  1NTC A;  4IHT A;  1ITY A;  2NYX A;  3WHB A;  1H9T A;  3JRH A;  3HKZ A;  3F6V A;  4C3J J;  4EJO A;  3FHZ A;  1J09 A;  1FNN A;  4N4O B;  2FOW A;  3D0S A;  1AKH A;  2A5Y B;  3TOB A;  4HV6 A;  2GAU A;  1UHS A;  1T95 A;  3ASO H;  3DV8 A;  4P9U A;  2R5Z B;  1X1C A;  2EPF A;  4IRH A;  4PUS A;  5IYB J;  1APL C;  2M0C A;  2NVU B;  3L1P A;  1IAW A;  2Z1D A;  1Q1H A;  1XD7 A;  3CZG A;  2CQQ A;  2KKO A;  2V9K A;  3RTR A;  2PFB A;  3DTK A;  4BGD A;  1N77 A;  2ZJR F;  4ZN6 A;  2KIU A;  2IEK A;  1TTY A;  1ZRF A;  3JAM Z;  3CJR B;  1MIJ A;  3U21 A;  1IUY A;  4EM0 B;  5BPD A;  4PGG A;  2EZK A;  1OJL A;  3I59 A;  1E17 A;  1IG7 A;  2OU2 A;  3CF2 A;  2EZL A;  3ANL A;  1SFU A;  2OTL I;  4J19 A;  1R5H A;  1V3F A;  2ECB A;  3P9C A;  3OYB A;  3J81 K;  1F36 A;  2W1O A;  5J4V A;  1R1T A;  3K0L A;  5L3E A;  4MS6 A;  4ABZ A;  2NS0 A;  1KU2 A;  3ABL H;  4YFN F;  1H8A C;  1AU7 A;  2Y1G A;  3LNQ A;  3D5R C;  3GEZ A;  4C9Y A;  2P5K A;  2EIM H;  4ENK A;  2JUC A;  2JZY A;  1YFH A;  4R5V A;  4XND A;  4BUP A;  3LSI A;  4QTR A;  2ECC A;  3OS1 A;  3E97 A;  2JWT A;  1X3Z B;  4XN0 A;  3DCF A;  2A05 A;  3F8C A;  4FT8 A;  3EBI A;  3TBI A;  3DEU A;  3I55 I;  3G6E I;  2PLY A;  3PUF A;  2D5V A;  2A5W A;  2MBF A;  3HG9 A;  4K5L A;  1WQ2 A;  4L9J A;  3GF2 A;  4KIS A;  2QWW A;  1WZ2 A;  4A3B J;  1A5J A;  3HIF A;  1QPM A;  3JRG A;  4ZC3 A;  3CMY A;  2R72 A;  3WU0 A;  1ZEL A;  2I8D A;  4FET A;  3TDU C;  4RGU A;  3VYT B;  4Y13 A;  1R49 A;  2XIG A;  3Q0U A;  4E7S A;  1J75 A;  3KEQ A;  5JR3 A;  2ESH A;  3BZK A;  2CW8 A;  3QU6 A;  1Z7L A;  1RP3 A;  1T33 A;  2DOE A;  5JMP A;  2K27 A;  1U5T C;  2LC2 A;  5AON A;  1R23 A;  1V54 H;  4IOA F;  3ZPL A;  4U7D A;  5DUL A;  1B1B A;  2KRF A;  4HX8 A;  4Q4I A;  4A69 C;  2DQL A;  1BR1 A;  3DU5 A;  5GAH J;  4U87 A;  1D0Y A;  4ASN A;  4QPQ A;  4ZDL A;  1XDU A;  5H20 A;  3KP7 A;  4XRS G;  2OD5 A;  3FUD A;  4JOM A;  3WQQ A;  1FEX A;  2BY3 A;  1JKQ C;  1YG2 A;  5EG0 B;  2PJR B;  1JHH A;  1OCZ H;  2BY1 A;  4G9Y A;  2RVC A;  5KNL A;  2Z99 A;  4ITV A;  2DJI A;  3WGH A;  3OYN A;  3E6C C;  2L7Z A;  2R5Y B;  4XMU A;  1U9N A;  2ZME A;  2L9R A;  1QZY A;  2MFZ A;  4XOP A;  5E8I A;  4N4N B;  3BJA A;  3JTG A;  2EA4 A;  3BPX A;  3EBG A;  2VQC A;  2RN7 A;  2RRE A;  4ZTF A;  3CC4 I;  2IS4 A;  3VYS B;  1YX3 A;  2IBD A;  2W24 A;  3F21 A;  4OOF A;  2L5Q A;  1MW3 A;  4XOR A;  2R7W A;  3P7N A;  3FX3 A;  5L3G A;  3UKG A;  2E2H J;  3I5U A;  4HDV A;  4G7Z F;  3RC8 A;  1IXC A;  4G7O F;  3KZI C;  5LHH A;  4HV5 A;  1IDY A;  2CRG A;  1Y8Q B;  2EJR A;  1YLF A;  4P96 A;  1YOV B;  1H9G A;  2MLK A;  3CUQ C;  1V5F A;  2CS3 A;  3DEW A;  5DUI A;  3O2P E;  3E1S A;  2Y48 A;  2QQB A;  4PSX A;  1H89 C;  1SAN A;  4QWQ A;  1TWF J;  1WJ5 A;  2DJN A;  4S0H B;  1WWX A;  1LVK A;  4YFX F;  3WE2 A;  3RPQ A;  3ABU A;  1YQA A;  2QQ9 A;  2E5N A;  3CZE A;  3DXJ F;  4M72 A;  4KNY A;  4IX7 A;  3S1N J;  2GQQ A;  3W2A A;  3H9Q A;  1YRN A;  3ECH A;  2DA6 A;  4DZJ A;  3FTX A;  2PBI A;  5F04 A;  1Z67 A;  1UHW A;  3G1L A;  2PGG A;  2DQR A;  4HQE A;  2R93 J;  3HOS A;  1VQN I;  3CO6 C;  5BMZ A;  3U1D A;  2JJ7 A;  4BQN A;  1F43 A;  3A03 A;  3JRI A;  3HTU A;  2XKP A;  2LOO A;  3CD6 I;  2QSH X;  3GTO J;  3K4K A;  1U0J A;  2P5V A;  2KQR A;  4WXH A;  4W1U A;  3L2C A;  1MBK A;  4WF2 A;  3RPU A;  2VBW A;  3DPL C;  1R5I D;  4Y6S A;  1FX7 A;  4V19 K;  1J59 A;  1QRY A;  3A06 A;  3BR2 A;  1FMV A;  3KP2 A;  2FBH A;  2H6B A;  2WV1 A;  3EUA A;  2J5P A;  1C0W A;  3PNT A;  4XN3 A;  1U9O A;  2DYS H;  5F0H A;  3KE2 A;  1UAA A;  1XSD A;  2EIL H;  2M3A A;  2VI6 A;  4CHU A;  4XN5 A;  2BHZ A;  4A3L J;  2JA6 J;  3Q0W A;  3MAJ A;  2L0K A;  4I98 B;  3E3V A;  2QQ8 A;  3LAP A;  2KDZ A;  3G3Z A;  4KA4 A;  2DXI A;  1KGS A;  4MTD A;  1UHM A;  2MH9 A;  5BS6 A;  4KUM A;  2R4G A;  2W48 A;  1XGN A;  3DKY A;  2Y9Y A;  3LWF A;  4ZYE A;  1LE8 B;  4IXA A;  3CXB A;  2V79 A;  4N9H A;  3QQA A;  2NVQ J;  2CFO A;  3HJE A;  2CUF A;  3BG9 A;  2IGO A;  4RDU A;  4MQ9 F;  4XMY A;  4A03 A;  1R22 A;  1OCO H;  3LA3 A;  4RB2 C;  1S7E A;  5F64 A;  3OMY A;  1XCV A;  3E5Q A;  4H4K C;  4X6A J;  3R0I A;  3B37 A;  5EGO B;  4GYG A;  4A0Y A;  1MH3 A;  3EPZ A;  2HOS A;  3QJX A;  2KP6 A;  1IUF A;  4I7H A;  3DPU A;  4HF1 A;  3OYI A;  4XO5 A;  2ELK A;  3IAS 2;  2L9S A;  2VPR A;  4E7H A;  4K5N A;  2LLK A;  3G1O A;  5LRS A;  3VOE A;  5B66 C;  4XMT A;  2Y1C A;  4NQW B;  5EZG A;  3KLN A;  4P9F A;  5GAD J;  4XIC A;  2VJJ A;  1LQ1 A;  2YUS A;  2CQK A;  3BC8 A;  2K3F A;  4HEA 2;  2EFO A;  4Z2Y A;  1D1C A;  3TMO A;  1DQU A;  3HEF A;  3CHP A;  3T8T A;  3S2H J;  2A6T A;  5D4S A;  4RB1 A;  3BJ6 A;  5E8G A;  1K7A A;  4U0Y A;  1YS6 A;  2BY0 A;  1VQK I;  5E3M A;  1PVE A;  1S72 I;  2ZBK A;  1OIS A;  4A3I J;  4W97 A;  1LPQ A;  4PGH A;  3ZCO A;  1MND A;  3CDH A;  2ZJQ F;  4LJZ F;  3LSK A;  1H3L A;  5LBQ A;  3FF5 A;  4ZX4 A;  2EK5 A;  3H1C A;  4FX4 A;  3G1M A;  2F48 A;  1WH5 A;  4EMS A;  4ZYH A;  3HOT A;  1X3W A;  2HOA A;  2V6E A;  2E19 A;  1IN4 A;  1GW6 A;  2R7S A;  3FU6 A;  1XC5 A;  1ZRC A;  3F8B A;  1LB2 A;  1TWA J;  3I0T A;  1XGS A;  2OAZ A;  5E79 C;  2AHQ A;  2R59 A;  2M8E A;  2QGU A;  1HW5 A;  2XRL A;  2DPD A;  4FCA A;  1IRF A;  2WB1 N;  1STZ A;  2M45 A;  3K70 D;  3CJQ B;  3CP8 A;  1SD5 A;  2EFQ A;  2OZU A;  2R7R A;  1FP2 A;  5E20 A;  3VYU B;  4E7Z A;  4L9V A;  3GBG A;  2R0Q C;  1U8R A;  1LFP A;  2PMH A;  2F5C A;  3JRC A;  4RM2 A;  2O6G E;  2Q2E B;  4BE1 A;  1HW1 A;  1SD7 A;  2XUB A;  3ZQF A;  5JAZ A;  3VVL A;  2VKV A;  1OKR A;  2Z2S B;  1Z0X A;  2ZNZ A;  4L5J A;  1PUF A;  5E1Z B;  1CF7 B;  1MW2 A;  4IVN A;  2IRF G;  2V1X A;  1N25 A;  1HA8 A;  4LGW A;  3SZG A;  4M6V A;  5D5W B;  2K9S A;  3ERM A;  3PIO F;  3J7Z I;  2OPT A;  4HNU A;  3TOA A;  4C3I J;  1YS7 A;  1V5E A;  3V7S A;  1MMD A;  4ON0 A;  4XNB A;  2XSD C;  1XB4 A;  3DWL E;  3M8F A;  3IH4 A;  1JUP A;  5GP9 A;  1F5T A;  3B7T A;  2DAO A;  4PJN A;  1ZLK A;  4KFC A;  3G4S I;  4OMZ A;  1P92 A;  1QPI A;  3GTG J;  3RKW A;  1YIT I;  3T8R A;  1SAU A;  1FYM A;  1R36 A;  1IRX A;  3S1Q J;  2JA7 J;  5D5U B;  1FIP A;  2CQX A;  2GM4 A;  5HNF A;  4A3D J;  4CA0 A;  1IN5 A;  4YEJ A;  1WSU A;  1PJR A;  5E1X A;  3CC2 I;  1TT0 A;  2L02 A;  2DT7 B;  1MBE A;  3X2Q H;  3BTL A;  5CQG A;  4RM3 A;  2W84 A;  2VT3 A;  1I3A A;  2X6Y A;  3I3L A;  2KLO A;  2VAS A;  5KK1 A;  4GCV A;  3FUH A;  4R8H A;  2CFX A;  1U5T B;  2LSO A;  2OC6 A;  3FUK A;  1TWH J;  2VQL A;  5F1J A;  1WJB A;  3LSP A;  4F91 B;  3K2A A;  1N75 A;  3IC7 A;  4BH9 A;  4B44 A;  4OIO F;  4M3D A;  2XRO A;  4E7K A;  1G6N A;  3A01 B;  3GX4 X;  2TRT A;  1UZC A;  3OYF A;  1TW2 A;  2D1H A;  3F3X A;  4OIQ F;  1U3E M;  3CCS I;  4OOE A;  5LD2 C;  4B09 A;  1DDN A;  2BVL A;  5FO5 A;  5H6Q A;  1SQM A;  1UFM A;  2ZB9 A;  2M34 A;  3LFU A;  2KT0 A;  2JD0 A;  3V7R A;  3QOP A;  2EZH A;  4E6K G;  2OTJ I;  3F0C A;  3KP3 A;  1K6Y A;  2IVM A;  3FXL A;  3LQR A;  2EV6 A;  2W7N A;  3ZQH A;  2NRA C;  1XSX A;  2EH3 A;  3MCZ A;  4EM1 A;  2WV0 A;  3IH3 A;  4HNV A;  4BAC A;  5D4R A;  4BEH A;  2H27 A;  1VTN C;  5JVT A;  4BY1 J;  1IV6 A;  1CQT A;  2L3D A;  4PDK A;  1SMY F;  2FF4 A;  2HI3 A;  5LGU A;  2CWE A;  5F27 A;  2DMU A;  2H6C A;  5FD6 A;  2IS1 A;  3WTZ A;  3OL4 A;  1K6O A;  3CZK A;  1U2W A;  2P8T A;  1TNS A;  4DNC A;  4C2U A;  3T8V A;  3B02 A;  4LIV A;  4E4H A;  2R7T A;  4QPO A;  2GA1 A;  4FHT A;  4XM3 A;  2TCT A;  2HDW A;  4AR1 A;  3GO5 A;  4EGZ A;  1K78 B;  2M1B A;  3ZQI A;  4QIW N;  1MJB A;  2AXL A;  2GOX B;  3I4M J;  2G0E A;  4ESB A;  2NVT J;  1SFE A;  2HKX A;  1GVD A;  1Q0Q A;  2OF7 A;  2CUJ A;  4M73 A;  5E3L A;  5JC1 A;  3S14 J;  1DGW Y;  4NB5 A;  2PQ8 A;  3C18 A;  2W57 A;  1Y1W J;  1FBS A;  2N8G A;  3CHR A;  5F0C A;  5DM7 F;  2JVG A;  1T39 A;  3RCO A;  3MZ8 A;  3RYR A;  2K9Q A;  2O8X A;  2ZFU A;  4UV8 A;  1ZN2 A;  2TDX A;  2JRM A;  3L2U A;  2VOO A;  3RJP A;  4CCN A;  1IDZ A;  1OCP A;  3PNV A;  2K4B A;  4II2 A;  1WCM J;  2FSW A;  3CMM A;  1JE8 A;  1G5A A;  2M0M A;  4C3H J;  4NC8 A;  3JRD A;  2E2I J;  2XAJ A;  1QZE A;  3TO7 A;  3PSI A;  4FLS A;  3ZHY A;  2HOE A;  4NC6 A;  2NAZ A;  4ZYA A;  4UB8 C;  1J0R A;  1EH8 A;  3ULQ B;  2XRN A;  3EUK L;  2R7F A;  2BBY A;  4EQQ A;  4AYS A;  2PI0 A;  3W3C A;  3PUU A;  2ZSH B;  2BY2 A;  2KZG A;  2MD0 A;  4V2F A;  1K61 A;  1MDM B;  3S8P A;  1ONP A;  2K7L A;  3WTX C;  2XVC A;  2PMZ A;  2BGC A;  2JT1 A;  3A2K A;  2RQP A;  1JG9 A;  3GME A;  4XSZ F;  3IAM 2;  3A4C A;  4IOC F;  3RAS A;  2E1N A;  2OJE D;  2UXX A;  2NVY J;  5HOD A;  4PZJ A;  2COM A;  1QZZ A;  3WTV C;  3VDX A;  4OOI A;  2X4H A;  2HYJ A;  4Z6Y A;  3PJR A;  1B8I A;  2X51 A;  2W00 A;  4ARF A;  1OQY A;  1G3W A;  3J7A O;  3WU1 B;  3HSR A;  2JVH A;  4KIT B;  4DW6 A;  3BTI A;  2DCE A;  4XN7 A;  3VB2 A;  1VQ7 I;  3QOD A;  3CDL A;  3ANM A;  1Y1V J;  3U9W A;  1QBJ A;  1P7I A;  1D0X A;  1Z1D A;  1UMQ A;  1MBG A;  3PM1 A;  2D1V A;  2H1L A;  2IGM A;  3K10 A;  4YFK F;  1O3T A;  3DP7 A;  4II3 A;  2E34 A;  1DP3 A;  2KPM A;  3HXL A;  3S2D J;  5FFZ A;  4G7H F;  5J1U A;  3ZHZ A;  5J4Y A;  1B59 A;  3MKZ A;  4K5M A;  2XDV A;  2XB0 X;  2BXY A;  4RAZ A;  1ZYR F;  5J6X A;  4YII A;  1HS6 A;  2XAU A;  4IJA A;  3HSE A;  2M87 A;  2FXA A;  3F6O A;  4R5T A;  3ZMD A;  4A93 J;  1BR4 A;  1MMG A;  2EIK H;  4A5N A;  1IXS B;  2KL4 A;  3ZN0 A;  2R7X A;  4S04 A;  1KU7 A;  4OU0 A;  1FBQ A;  4A0X A;  1HKS A;  4ZH4 F;  5FGM A;  2IGK A;  2R5Z A;  2JSP A;  3HUG B;  1E3O C;  4ZW5 A;  2GWR A;  4Y3O A;  4B4C A;  2X85 A;  4MQV A;  2HVS A;  1HKT A;  1JGI A;  2DTR A;  3SZP A;  2KDO A;  4BE0 A;  3OOU A;  2VIX A;  3F8M A;  1VF9 A;  4XLA A;  4ESF A;  4MO7 A;  5M3F J;  4FE7 A;  1BI0 A;  5HDG A;  4RGX A;  2VQG A;  3CZ6 A;  3IP4 B;  4EAT A;  2HXO A;  2IXS A;  2HGC A;  2HPO A;  1UST A;  3PUB A;  1AHD P;  1L3L A;  2O3F A;  4E7L A;  4BS9 A;  4ZDP A;  4J01 A;  3E7L A;  1SFO J;  4GFB A;  5J8F A;  1YX5 A;  2DT6 A;  3RIR A;  3OR1 C;  4PK4 A;  2F2E A;  1HDD C;  1O57 A;  2KIS A;  2GBY A;  3BP8 A;  4P1W A;  5FKN A;  4BU2 A;  1K4T A;  1D8K A;  5M5X J;  5D5V B;  1GDT A;  4QUO A;  3ZI0 A;  5DYF A;  3PO2 J;  2IP2 A;  3F72 A;  4JK1 X;  4M9Z A;  3KP6 A;  3WG7 H;  2DQM A;  3TO9 A;  3KYC B;  2B9S A;  5C44 J;  2C5Z A;  4N9I A;  1UCR A;  2Z33 A;  2NOJ B;  1YE9 A;  2HS5 A;  2H1K A;  1QHG A;  3OYK A;  2X48 A;  1X3Z A;  4FX0 A;  3OL3 A;  4CZZ A;  1YTY A;  2CV0 A;  3ZQQ A;  1RET A;  2E1O A;  2KRH A;  3H0G J;  2JCX A;  1LDD A;  2WTE A;  2PX9 A;  4MTE A;  2YS9 A;  4ZW7 A;  3CHO A;  3H3V K;  2A3S A;  1G2H A;  3UER A;  4ENM A;  5JMW A;  1MW7 A;  4CCM A;  1HF0 A;  2L4M A;  2Y0S A;  2VB6 A;  3VFZ A;  5C3E J;  3CQZ J;  1IZ1 A;  1B72 A;  3QPL A;  2G7H A;  2XGD A;  5TJJ A;  3KED A;  4HOB A;  4EJU A;  3BR3 A;  3RI4 A;  2A6E F;  3V8K A;  1T8I A;  2GIV A;  2V9V A;  1JGG A;  3DLA A;  3HOX J;  3L09 A;  3BT9 A;  1FZP B;  4TV7 A;  1OCT C;  3OYJ A;  3MEX A;  4KT6 A;  1KA8 A;  3FXJ A;  1R6R A;  4ESJ A;  4WCG A;  1FC3 A;  2BEO A;  4IL6 C;  2VC0 A;  3HOV J;  1G59 A;  3AAF A;  1VI0 A;  4RLQ A;  5EG0 A;  2PJR A;  2BZT A;  3GUD A;  4RCV A;  2F6C A;  1TWG J;  2AQE A;  5TIS C;  4EVI A;  2R5Y A;  2I10 A;  3AFH A;  2L4A A;  2ZJP F;  3LL7 A;  3LQQ A;  1Q1V A;  4LB5 A;  3FU0 A;  1OR7 A;  1NK2 P;  3HHG A;  3D5S C;  1ZH5 A;  5J1R A;  1MW0 A;  4RAF A;  2JD2 A;  3WE3 A;  2CQN A;  3K4N A;  1ZR4 A;  4MIM A;  3B2P A;  4FLQ A;  5KCM A;  1BJZ A;  3BG6 A;  4JX4 A;  2DA5 A;  2R7O A;  1EH7 A;  4QME A;  3HYI A;  2CH0 A;  3NEU A;  3GZN B;  5TGT A;  2K86 A;  4CGZ A;  4UHT A;  2Y1F A;  4QLC U;  4ZQE A;  1X4P A;  3MKY B;  1SEU A;  3I54 A;  4IQ4 A;  4GDF A;  1ONN A;  1P4A A;  3I4P A;  4JND A;  2O5R A;  1B72 B;  1E2X A;  4YEL A;  2XPW A;  1QGP A;  2X9D A;  1T0F A;  3IKT A;  1YO5 C;  3GZ6 A;  1GV2 A;  4QHP A;  4G6T B;  1JKP C;  3FUI A;  5A2Q K;  3FUF A;  1LJ9 A;  4ENJ A;  2X6O A;  4A3C J;  2FBK A;  1Z3X A;  1ZQ3 P;  4BHB A;  3Q43 A;  1RKW A;  4UUS B;  1OCC H;  4PVB A;  3KPH A;  1IO2 A;  3FXR A;  3AG2 H;  5AEN A;  3SDG A;  3RKY A;  3CCR I;  1DU0 A;  2MC4 A;  1MJ9 A;  3G71 I;  3CCY A;  4OIN F;  3CTA A;  3FK6 A;  2JMW A;  5FLX Z;  4MGR A;  2WAQ A;  4EJV A;  4LMY A;  2XAG A;  3ESW B;  1BN5 A;  2LMD A;  4FE4 A;  4XK4 A;  3JRA A;  3MKW B;  1HKQ A;  4WXC A;  1VQP I;  2HZT A;  3K7A J;  4XLN F;  1YYV A;  1SVO A;  1BR2 A;  3TKY A;  5M5Y J;  2UUZ A;  2HPM A;  3ZMT A;  2BHY A;  2XF7 A;  3EYY A;  2FNA A;  5HDK A;  2NOG A;  1LDJ A;  1QA6 A;  4F7Z A;  2WY7 Q;  1PP8 F;  3UNG C;  1D0Z A;  3GVA A;  3Q9V A;  4ZQT A;  3DPT A;  4AVP A;  3HOW J;  2H8R A;  3CUO A;  3CHS A;  1Z6R A;  3M9A A;  1WRJ A;  4ZZD A;  4XKV A;  1U78 A;  3FXM A;  2F4O B;  3QPH A;  1ON1 A;  3FUE A;  1A6Q A;  1FY7 A;  2K4J A;  1KYZ A;  4M3F A;  1X19 A;  2HYF A;  4AWX B;  2HOT A;  1SG7 A;  1P6R A;  1EF4 A;  3I56 I;  3FUN A;  5DCM B;  1YW7 A;  4U88 A;  1RR8 C;  1S3J A;  4UUV A;  4R79 A;  3CIA A;  4BQO A;  3AL0 B;  2AXT C;  3ZOB A;  1IN7 A;  4B3A A;  1X4O A;  2PMU A;  1OYI A;  3IIE A;  3B7U X;  3DBL B;  3J80 K;  2BE5 F;  4XRS A;  1ZRE A;  4XN4 A;  2HR3 A;  3VEP A;  4AUX A;  1LE8 A;  3GTL J;  1S6L A;  3O3K A;  3ZGK A;  3GW2 A;  1BOB A;  1T98 A;  3FUJ A;  2LH9 A;  2VJI A;  3S2W A;  4HYE A;  3S1R J;  4KP7 A;  1VND A;  3CCQ I;  2EFN A;  2V7F A;  4CSW A;  1OPC A;  2XAH A;  3BDD A;  4XN9 A;  4A6E A;  2Q8K A;  1S46 A;  3KYD B;  3F23 A;  2EFW A;  2XAQ A;  1RKT A;  5FFX A;  1XTA A;  2FMY A;  5EGO A;  1JVS A;  5JNL A;  5B1B H;  2QBY B;  2KZV A;  2X1E A;  5CLS A;  3P9K A;  3FTW A;  4KDP A;  1V5G A;  4DBR A;  2WAD A;  1W1W E;  4IQJ A;  1S7A A;  3FIS A;  4Q5S F;  1A6I A;  1WVR A;  4CCJ A;  2VQH A;  2DFI A;  1MBJ A;  4NQW A;  2R70 A;  2HQR A;  2QKL B;  3V8J A;  1KQ9 A;  2EIN H;  1W0U A;  1XGM A;  2GXA A;  3VPR A;  3ANN A;  4XMW A;  2DFH A;  5F0F A;  3SEZ A;  3HKZ N;  1K79 A;  2WBM A;  3ZMZ A;  5C4X J;  3G2B A;  4HAM A;  5E17 F;  1Z6T A;  2G9W A;  2KIF A;  4I01 A;  1I1S A;  2IPQ X;  1F9N A;  1IRZ A;  2JPB A;  5HVQ C;  1JT0 A;  2NS8 A;  2CGP A;  3ZHX A;  5M3M J;  3CLO A;  3EBH A;  2GIZ A;  5KVR A;  2GTQ A;  2V9P A;  3N4M A;  4U0W A;  1UJ8 A;  2O8K A;  4CIC A;  1TC3 C;  3UCQ A;  1SFX A;  3L7W A;  3H3U A;  1Z3Y A;  5D6E A;  3KLO A;  5FKO A;  1YJW I;  3WOD F;  3V7C A;  2EFP A;  3EET A;  1XGO A;  2FX0 A;  4PJJ A;  3IH2 A;  2XPV A;  3E5X A;  2E71 A;  5CVR A;  4MFE A;  2HFH A;  1W5T A;  1JUM A;  4IKF A;  1M1E B;  2ZXW H;  3M4O J;  4BL0 B;  2LRD A;  3QP6 A;  2E7X A;  4IHX A;  1O7F A;  1BC8 C;  1X2N A;  1MNM C;  4LG0 B;  4CH7 A;  3S3O A;  3BPV A;  3JRF A;  4BXF A;  4IO9 F;  2FQ4 A;  3KZZ A;  2GXG A;  1MVY A;  2LVS A;  3DTI A;  4I99 C;  3QPS A;  3IRQ A;  1ZGA A;  3RSN A;  1ETV A;  3BR1 A;  1Y0U A;  3AG1 H;  5EZH A;  1J9I A;  5CPR B;  3KCC A;  3BR0 A;  2Q2E A;  3WTS C;  1RIO H;  2IAI A;  2R7V A;  1T1R A;  4QIR A;  3BG7 A;  2QJ1 A;  3FTV A;  2P6S A;  1CF7 A;  4BAY A;  1ZGW A;  2LTP A;  4A12 A;  3PIP F;  1O4X A;  5H6R A;  4FLO A;  4HRI A;  3HPG A;  1KQ8 A;  2E1M C;  2Z5U A;  5EV7 A;  3J7Y J;  2VE9 A;  4JBA A;  2F4I A;  2VT2 A;  2HPT A;  1BW5 A;  5DM6 F;  5FJ8 J;  2ZXI A;  3K6G A;  4M3G A;  2EV0 A;  4L18 B;  1LNW A;  2PG4 A;  1OYW A;  3MZY A;  2QSF X;  2M2E A;  3RKX A;  5IP6 A;  1BM9 A;  3B6A A;  3HB9 A;  3FTU A;  3BOQ A;  3D5L A;  2B63 J;  1REP C;  5D8K B;  1JGS A;  2AO9 A;  5EF6 A;  1ETW A;  1Z7U A;  2LKP A;  3JAM K;  4XN2 A;  1X3U A;  4EM2 A;  3IV5 A;  1RRJ A;  4B3X A;  3HSF A;  1HBX G;  2P7C B;  2RQQ A;  1XN7 A;  3PQK A;  3FKJ A;  2D2W A;  2J5O A;  4JYK A;  2R92 J;  1MJA A;  5D5X B;  2DN0 A;  2XV4 S;  1MMN A;  1ULY A;  1ZHF A;  1Y8R B;  5ILV A;  2ADU A;  2MLG A;  5IOZ A;  3DBR B;  2RGV A;  5CVJ A;  1EV7 A;  3FUL A;  2V26 A;  3F8F A;  1FT9 A;  1U5T A;  3CME I;  4AIC A;  4KJZ A;  1VZ0 A;  4MKT A;  2JA5 J;  2QEN A;  2VKD A;  4YIR X;  1RUN A;  3IRR A;  3S17 J;  3HTS B;  4D9J A;  1JHF A;  4I02 A;  4BDY A;  4P5O A;  3A01 A;  4Y6P A;  1D1A A;  2K40 A;  1Y0N A;  1IW7 F;  5HLH A;  1FOW A;  2FBI A;  3MZH A;  1SC5 A;  5HLG A;  4BE2 A;  2ZC2 A;  4CYD A;  1P4X A;  3HRU A;  2DOD A;  2K5C A;  2ZCW A;  1Q0H A;  2LNB A;  4J00 A;  1XMK A;  1MH4 A;  3U1K A;  1YHQ I;  3JTH A;  2WAF A;  1DP7 P;  4GRI A;  3DF8 A;  4I0B A;  5GTI C;  3ZRG A;  3R4K A;  2MG4 A;  1FOX A;  3M3Y J;  1JTY A;  3RKQ A;  2EB7 A;  2PN6 A;  2VE8 A;  4DYR A;  2IA1 A;  4A3J J;  1POG A;  4WX9 A;  1R00 A;  5DLL A;  5DEQ A;  1TBX A;  1YJ9 I;  3HL2 A;  2IGN A;  2HQA A;  3QYE A;  4L0Y B;  3ELK A;  2UWM A;  2R7Q A;  5CJ9 A;  4G94 A;  1VQ6 I;  2OUM A;  3LA7 A;  1YIO A;  1ZG3 A;  1VQ9 I;  2LRE A;  3B6C A;  3GXO A;  3PFI A;  4DJA A;  1K78 A;  2W85 A;  1IV8 A;  2WC2 A;  3EUH A;  3TDZ C;  1O7L A;  5EEA A;  1QVU A;  2K3P A;  1HW2 A;  2LY2 A;  1WJC A;  4IHS A;  2MSY A;  1GLN A;  1H88 C;  2VXZ A;  3GYH X;  2XPU A;  4I0A A;  1RC9 A;  2DYR H;  1TLH B;  4CYC B;  3NWT A;  3VYR B;  3CES A;  3S15 J;  4HF0 A;  3I71 A;  3ROU A;  2LBF B;  4OMY A;  4XNA A;  1BC7 C;  1BW6 A;  3EDP A;  3Q5F A;  4DPR A;  2HPI A;  5K7Z A;  1RUO A;  4RVB A;  2UZK A;  4M71 A;  4LK1 F;  3HRS A;  3HC7 A;  4RS8 A;  3SFI A;  2ZFW A;  3HOU J;  4GXO A;  4ENN A;  1JJ6 C;  4CO8 A;  2WY8 Q;  4CCL A;  4M6X A;  2CV1 A;  5ICF A;  3HBL A;  3BZC A;  5FLM J;  1TZL A;  2DA4 A;  3E6D A;  3FZV A;  3FIW A;  3HGY A;  2HVR A;  2GA2 A;  4HF2 A;  2DA3 A;  1NK3 P;  2VPL A;  2Y1E A;  1G3Y A;  4Y17 A;  1LEA A;  2Y0M A;  3J81 Z;  5ILU A;  2V4J C;  3SHF A;  2VL8 A;  5EYR A;  1MZB A;  4L2L A;  1MDM A;  1FIA A;  4C30 A;  5L3F A;  1BIA A;  1JUS A;  2HYG D;  1X58 A;  4BDZ A;  3FM3 A;  4RA2 A;  5JHF A;  5CYV A;  2LYC A;  3CUQ B;  1XS9 A;  4XSX F;  3TW6 A;  3H3Z A;  1KU3 A;  3W6J B;  3BG5 A;  3BCA A;  4M3B A;  4Y67 A;  1X1B A;  3B3B A;  2HNH A;  4HA8 A;  2XQ0 A;  3C2B A;  3A02 A;  5BPI A;  4XKW A;  3FM5 A;  5L3B A;  3LSM A;  2ME6 A;  3OSF A;  2EGH A;  4WK8 F;  5GAG J;  3LOC A;  2EBI A;  5FLV A;  2VJ8 A;  4KN7 X;  1P4W A;  4HBL A;  4BHP A;  5K1Y A;  1Q0L A;  2MGQ A;  3TW7 A;  2HQ5 A;  3CP2 A;  3H5R A;  4KT5 C;  5HLT A;  2AS5 F;  1LEB A;  4L9N A;  4XID A;  4RMN A;  3OWT A;  4RSY A;  1O3S A;  4D5F A;  2M7A A;  3LSJ A;  4OIR F;  3TED A;  2DA1 A;  1W7P B;  4UV9 A;  1USS A;  3ZR8 X;  4YG2 F;  4A3F J;  5LFA A;  3KFW X;  2MAP A;  1WFX A;  4V2G A;  1W7P D;  3M7G A;  4HQM A;  2BW3 B;  3GFM A;  4KIF A;  1R9T J;  4HNT A;  1DU6 A;  3CC7 I;  2JCV A;  1Y39 A;  3MWM A;  3FMR A;  2QF7 A;  4I09 A;  4OAZ A;  5K5Q A;  3RQI A;  1IF1 A;  2DK8 A;  5J1Y A;  4NBQ A;  3ZQC A;  1OYY A;  1FYK A;  3J7A Y;  4AVZ A;  3DKX A;  2HDC A;  2VOD A;  1JJ8 C;  2KMU A;  1FMW A;  1N78 A;  3M07 A;  2HTJ A;  2QZ8 A;  3OIO A;  2L01 A;  2LF8 A;  3I9V 2;  3HUG A;  1GUU A;  4ANJ A;  5CQE A;  2IT0 A;  2DQ6 A;  4NNJ A;  2MH2 A;  3CDI A;  4UUT A;  3KX2 A;  3OYM A;  4XRM A;  3A0H C;  5EEG A;  1K5H A;  3CCU I;  3Q3S A;  2ISZ A;  3QPT A;  1G3T A;  1TW3 A;  3FXK A;  3GLX A;  2QLZ A;  3WG9 A;  4AID A;  1BIB A;  2L7K A;  1RR7 A;  3BR6 A;  1LFU P;  3E6M A;  4JP0 A;  3ZXS A;  3MN2 A;  4XKB A;  5B1A H;  5FD5 A;  2X0L A;  1E3P A;  4UXN A;  2ZME C;  3RZO J;  2R7D A;  3PFY A;  3ERE D;  5H2F C;  3GFI A;  3C2H A;  1WH7 A;  3L2W A;  5EJC A;  1F4K A;  2ZXG A;  1R71 A;  2JCY A;  3H35 A;  2XPZ A;  4ZQG A;  4HG2 A;  4B48 A;  2MC3 A;  3M1E A;  3RDI A;  5JBI A;  1ZKG A;  1T56 A;  3FDY A;  4DIQ A;  1DGR M;  3S93 A;  1LVA A;  2FU4 A;  3R61 A;  2NNY A;  1W36 C;  3HOY J;  4U7B A;  1D5V A;  2OCC H;  3IWZ A;  4RAY A;  4CZC A;  4PW4 A;  2P7V B;  4MNU A;  1BOA A;  2JRT A;  3F9K A;  5BQT A;  3A0B C;  3ABM H;  1ZG5 A;  1I1G A;  1PDN C;  3K4M A;  4R1H A;  3WHC A;  2RNG A;  1P7J A;  5HS9 A;  3OS0 A;  2DMN A;  3KP4 A;  1GT0 C;  2RKH A;  4B43 A;  3F8N A;  2K9N A;  4NUB A;  4UVB A;  4IHY A;  5B5E C;  1WGX A;  4LIU A;  3V4G A;  3OYL A;  2E1M B;  3T5X A;  2MD5 A;  4DGW B;  2ME0 A;  2FUG 2;  5TRD A;  1WI3 A;  1SVL A;  1X1A A;  2HWV A;  2XC7 A;  1T08 B;  2K9L A;  5EEH A;  3T0Y A;  2QEX I;  1WJF A;  2KIQ A;  3GWZ A;  1SAX A;  1VQ4 I;  3H92 A;  4EEF G;  4YRV A;  4NHJ A;  3VSK A;  3DKW A;  3S3N A;  3H0D A;  2O9L A;  3SQN A;  3TGN A;  4PJ0 C;  3FHN A;  3GZ5 A;  1W5S A;  2P6T A;  3IHU A;  1O3Q A;  3KEY A;  5DCF A;  2QM3 A;  3Q44 A;  3UEQ A;  3KZY A;  3SJM A;  2JQ7 A;  3D1N I;  1NHA A;  1S7O A;  2KJC A;  5LLQ A;  3ZMV A;  2P0W A;  4IPA A;  2DTZ A;  4LB6 B;  2Y1D A;  5JVG F;  5JLX A;  5L3C A;  4OIP F;  1R4M B;  2DA2 A;  4HST A;  4UNO A;  3JRB A;  4XLC A;  3M8J A;  2F5D A;  2YPR A;  2LP0 A;  2CMP A;  1NG6 A;  4M9S A;  5HDN A;  1TNT A;  1B9M A;  2FML A;  3W6K B;  1X1P A;  4XOT A;  1XCB A;  1FLI A;  3BR5 A;  1GVJ A;  2RDP A;  2WZG A;  5BNG A;  1V55 H;  1ZRD A;  1TWC J;  3WTU C;  3FU3 A;  1Z91 A;  3FXU A;  2EIJ H;  4IRI A;  2CYY A;  1FWZ A;  1MGT A;  2EA2 A;  4CUG A;  4G6Q A;  2KIM A;  3BQY A;  2RJI A;  3FH7 A;  2W4S A;  2W82 A;  4ZW3 A;  2K9M A;  3BJO A;  1FYL A;  1MSF C;  1RNL A;  2YSR A;  2IA0 A;  3FTS A;  2XGC A;  5ICE A;  3JCU C;  1X1D A;  3CCL I;  3K4L A;  1JXS A;  4C2M J;  5M5W J;  3H5A A;  2BV6 A;  2QYO A;  5IYD J;  2ESN A;  3R0J A;  1I39 A;  3A1Y A;  1MNE A;  1SD6 A;  4HW0 A;  2O03 A;  3FBI B;  4AC0 A;  4WWC A;  4B47 A;  3TQN A;  1ORK A;  3ASN H;  5GPA A;  1BL0 A;  1JTX A;  3WTT C;  4UUS A;  2HDD A;  3FK7 A;  5J47 A;  2NVX J;  4DOZ A;  5IP7 J;  2HEO A;  2ZO4 A;  3WU2 C;  3ZQ7 A;  3SFZ A;  4LLL A;  2ZKZ A;  3I58 A;  3VSL A;  4PFP A;  1DPU A;  1KQ0 A;  1ZK8 A;  3K70 C;  3GFL A;  1U8B A;  2KRC A;  6PAX A;  2CW0 F;  1IN8 A;  5KHD A;  4E7J A;  1SC7 A;  4X0G A;  1RI7 A;  2BVM A;  2Y9Z A;  2FNP A;  1RZ4 A;  1ZAR A;  3DFG A;  2ZJ2 A;  3NAU A;  3R6S A;  1XDS A;  2YX7 A;  5CKT A;  1WJD A;  3O8H A;  3FMQ A;  3IKV A;  4BYY A;  4EGY A;  3SDB A;  4XKC A;  1EA3 A;  4UVA A;  1OFC X;  4MFD A;  2GLO A;  1XG1 A;  2HU9 A;  4L5E A;  2DPU A;  1E3H A;  1Y6I A;  1X2M A;  4U0V A;  5HOO A;  2XGX A;  3K9T A;  2OZ6 A;  4BXU A;  3OSG A;  4L0Z B;  5IOY A;  4XL9 A;  4YIF A;  5EDN A;  1VFC A;  3W2W A;  3UR3 C;  4DYQ A;  3AG4 H;  5ICG A;  3P5J A;  5J40 A;  3OYD A;  4EJT A;  4UY8 I;  5LRR A;  3MD2 A;  1P2F A;  4XLE A;  1AKH B;  3H5N A;  2F5E A;  2PMZ N;  3OV8 A;  5DCM A;  4HLX A;  1WJE A;  3RYP A;  4DZP A;  1HOM A;  4XRF A;  3G73 A;  2WPG A;  4FQG A;  2M9H A;  1B9N A;  1UG2 A;  1EJ9 A;  5FKL A;  1PYV A;  2E5Z A;  3ZMU A;  1MSE C;  3V42 A;  2ELJ A;  3TL4 X;  1IJW C;  3CMA I;  2A6H F;  2FEZ A;  3QRF F;  5K7F A;  2VN2 A;  2ID3 A;  2JN6 A;  3ECO A;  4IRG A;  2PL5 A;  3T1B A;  2OQG A;  1MMS A;  2ICW G;  1I3Q J;  2QCO A;  4D7N A;  3JT1 A;  1ERD A;  4Y52 J;  2Y75 A;  4HDU A;  4A0Z A;  2H8W A;  5FRO A;  4F3Q A;  5J8C A;  2A07 F;  1ZTR A;  3C3W A;  1WHU A;  3DBH B;  1W5C C;  4BBS J;  2QBY A;  1S29 A;  2EV5 A;  3I59 B;  2E1C A;  9ANT A;  2R3S A;  3NQO A;  1R1V A;  3HRT A;  4IF4 A;  3GTJ J;  2GXB A;  2WB1 A;  2DFE A;  2CG4 A;  3OS2 A;  4Y4R A;  3QP5 A;  4Q47 A;  1SVM A;  4A6D A;  2Z16 A;  4OAY A;  2LR8 A;  3BCB A;  2WA0 A;  4ZDO A;  2PJP A;  4KIC A;  4D0P A;  3KET A;  4ZX5 A;  4A3K J;  1OLT A;  2WZF A;  3OYG A;  2H09 A;  3PO3 J;  1Z77 A;  4BQQ A;  1T1S A;  5IYC J;  3A14 A;  3REO A;  1KON A;  1FOY A;  2BXZ A;  3S32 A;  4XO3 A;  3AG3 H;  3LA2 A;  3K1N A;  3RQ4 A;  4KN4 X;  1QNT A;  3S3M A;  3N97 A;  2ZXJ A;  1SFK A;  4HX4 A;  5GAE J;  3K1P A;  4Y6R A;  3FMS A;  2RC4 A;  5HS8 A;  3QU3 A;  3FUM A;  4XMV A;  3L2Q A;  4F92 B;  1YJN I;  1ETY A;  4LLG F;  1EKE A;  5IPA A;  2O7G A;  2DOF A;  1J2X A;  2JK3 A;  2DDB A;  2L7F P;  2X1D A;  4OWR B;  4BJ6 C;  3L2R A;  1R58 A;  2MAB A;  2VBZ A;  4JX6 A;  4L9T A;  4LK0 F;  2L7M P;  3B7R L;  2GOM A;  5CVV A;  2D45 A;  5LGN A;  3K69 A;  3L2V A;  2L9N A;  3DLL F;  3HRM A;  3EUH C;  2L2O A;  2IW5 A;  1LUJ B;  2FOK A;  5IP9 J;  1QQI A;  2ZXH A;  1ZLJ A;  2DA7 A;  4RGR A;  3ABK H;  4UB6 C;  4LG0 A;  4H0E A;  2HVQ A;  2VUM J;  1QU3 A;  2DMT A;  2DT5 A;  2LF7 A;  4AIH A;  1GHC A;  2CW7 A;  1XPX A;  4N0B A;  5DD8 A;  4PJM A;  1HC8 A;  3O6B B;  2XKO A;  4M9X A;  2F4M B;  3SYT A;  5E3N A;  2E2J J;  4ZQF A;  1T38 A;  1TQI A;  3H9J A;  2EQR A;  4LG3 A;  2Y30 A;  3WGI A;  2VJ4 A;  5HLI A;  4AU7 A;  1WPK A;  2C82 A;  3AU8 A;  1L0O C;  2B7E A;  2ZME B;  1LFB A;  4FTH A;  4IHW A;  1S8N A;  2CO5 A;  5CVI A;  4KMF A;  4XN8 A;  2JTV A;  2A61 A;  3PL8 A;  1AOY A;  1E0E A;  4AD9 A;  4I76 A;  1P9Q C;  3IUO A;  2KJB A;  2XAS A;  2P4W A;  4XBF A;  1ETX A;  4RBO A;  2JA2 A;  4IEJ A;  1V4R A;  3OY9 A;  5GTH C;  1TP4 A;  4PJL A;  3JSZ A;  4M74 A;  2OBP A;  5AIP A;  2DMP A;  1B4A A;  5K5O A;  3P9I A;  2MYS A;  2Y0S N;  1MBH A;  2FQ3 A;  1KU9 A;  2Y31 A;  1FJL A;  2IJL A;  3KP5 A;  2ELH A;  4MLO A;  2V6C A;  5E3O A;  1K83 J;  1W36 D;  3BZ6 A;  2Z9O A;  2VJ5 A;  1D5Y A;  5DV5 A;  1XMX A;  2HTS A;  2VKE A;  5DDG A;  2LD5 A;  3OIQ A;  3SZT A;  5IT9 K;  3KYL A;  2HQN A;  1FOK A;  2Q0O A;  3GCM A;  2V1N A;  2JD1 A;  5ICC A;  4RAG A;  4HX7 A;  4M6Y A;  2K85 A;  1YRN B;  2JV7 A;  3JR9 A;  5F1R A;  2XSJ C;  3FU5 A;  2L9V A;  2MW8 A;  1EH6 A;  2M8G X;  1O3R A;  4AIK A;  2E35 A;  3WTW C;  3DU6 A;  3JW4 A;  2A69 F;  1JKO C;  3QOE A;  4JX5 A;  4CDG A;  4GAA A;  3KEO A;  3ZP5 A;  5L3D A;  4ZX3 A;  5KAF C;  3B2X A;  1TQM A;  3H9G A;  4Q48 A;  3HW2 A;  3CCV I;  1T2K A;  1U6G A;  3VWB A;  3E0J B;  1OMI A;  4O6J A;  1TL8 A;  1YIJ I;  3LSG A;  3Q0V A;  2CSO A;  1T6S A;  2JA8 J;  3LAJ A;  4QPE A;  4XMZ A;  4FAS D;  3RPU D;  3NWS A;  1R0K A;  4MHG A;  3OYH A;  4BXX J;  2QVO A;  3VVM A;  1GV5 A;  1HSJ A;  2FE3 A;  4DBQ A;  3W6V A;  4PCQ A;  3GTQ J;  1MMA A;  3FXO A;  3ZQL A;  2M4G A;  1BJA A;  3HZJ A;  2ZSI B;  4A5M A;  3SEQ A;  1R5G A;  2UV1 A;  2CV2 A;  5LEK A;  2O7O A;  4LOC A;  3CCJ I;  5IY5 H;  1I6X A;  4K5O A;  4K5P A;  2ID6 A;  3K2Z A;  1JKR C;  2DMQ A;  2Z3Y A;  5D8L B;  4I2O A;  3H36 A;  3MQ0 A;  1G8X A;  2FA5 A;  3B73 A;  4RB0 A;  4O5V A;  4ZZL A;  4FIS A;  1NG7 A;  3Q9S A;  2LG4 A;  4ZYD A;  4AYB A;  2LKX A;  2WAQ N;  1GXQ A;  4O3M A;  1SMT A;  1ODD A;  4BKX A;  1PP7 U;  3FKI J;  2LK2 A;  4ETS A;  3WTY C;  1ZR2 A;  2HXI A;  2WWY A;  2HZD A;  3FTY A;  3C2G A;  2M4K A;  2CQ7 A;  1H0M A;  1WKM A;  4BY7 J;  4CYC A;  4B1R A;  1ZS2 A;  1Z05 A;  4BNC A;  2EZI A;  3BRO A;  2LBF A;  1R1U A;  4A3M J;  4LUP A;  1JI8 A;  1BA5 A;  3OYC A;  3R60 A;  2EWN A;  5ED4 A;  5JO0 A;  3ZQG A;  1HQC A;  4D7M A;  5C4J J;  4EJW A;  3NRV A;  2XHK A;  2P81 A;  2MA3 A;  1LDK B;  2X6W A;  3M8E A;  2VLA A;  1LKX A;  4F55 A;  4MEY F;  4X1E A;  1TT5 B;  2V1D A;  4BJT A;  2R7U A;  1PUE E;  5FKM A;  5DYM A;  4Q4Z F;  2QA4 I;  3KIO A;  4WXD A;  1HLV A;  5FWQ A;  5E1W A;  2OA4 A;  3F22 A;  3MKL A;  4E7I A;  2YU9 J;  4E70 A;  1DPR A;  3CZL A;  3E5U A;  4XON A;  2Q1Z B;  2QQA A;  3I4N J;  3MFK A;  3EYI A;  3CO7 C;  3CUQ A;  5FLX K;  4RLF A;  3BTJ A;  4C2T A;  2YX4 A;  3MMY B;  2B0L A;  4K2E A;  1W0T A;  3AUA A;  1QO0 D;  4GAE A;  4B8X A;  3FH5 A;  2FD5 A;  2FRH A;  1AA7 A;  3TP0 A;  3ZMS A;  1WJA A;  1I6H J;  2E60 A;  3U9G A;  3JRE A;  3C7J A;  2PUS A;  4ZX6 A;  4RGS A;  5FKK A;  2VOP A;  1F1Z A;  1XMA A;  1ETK A;  2VC1 A;  2PEX A;  2CUE A;  1Z9C A;  1DUX C;  1X3W B;  5J3L A;  3BQZ A;  3COA C;  2DO7 A;  2VBX A;  1ZAO A;  3TP3 A;  1D8J A;  3CJN A;  1IGN A;  2DOA A;  2V1U A;  4CCK A;  1FPQ A;  3PQJ A;  5LHI A;  3LFK A;  2F5V A;  5IT3 A;  3CCM I; 
#chains in the Genus database with same CATH homology
 1LE8 B;  1GV2 A;  4PW4 A;  4QHP A;  2LY9 A;  1JKP C;  3FUI A;  3FUF A;  2RAE A;  2NVQ J;  2X6O A;  3QQA A;  4A3C J;  3WHC A;  1ZQ3 P;  1P7J A;  2CUF A;  3BG9 A;  2DMN A;  1RKW A;  4RDU A;  4UUS B;  3Q43 A;  4NDL A;  1GT0 C;  1PUF B;  4R5X A;  4A03 A;  2K9N A;  4PVB A;  4IHY A;  5GPC A;  1S7E A;  1WGX A;  5JLW A;  4FCY A;  4X6A J;  3R0I A;  4XO4 A;  3B37 A;  5EGO B;  2ME0 A;  2QVW A;  1WI3 A;  5AEN A;  1MH3 A;  2HOS A;  3QJX A;  1IUF A;  3SDG A;  4XO5 A;  2ELK A;  3T0Y A;  3WQR A;  1DU0 A;  3CCY A;  4EEF G;  2VPR A;  4K5N A;  2LLK A;  3FK6 A;  2JMW A;  3G1O A;  2O9L A;  4PU2 A;  4XMT A;  2Y1C A;  5EZG A;  1JKQ C;  4XIC A;  4ZQH A;  3HGG A;  2YUS A;  3Q44 A;  4FE4 A;  4XK4 A;  3JRA A;  3UEQ A;  5HNH A;  3SJM A;  3D1N I;  3K7A J;  1JT6 A;  1ENH A;  3HEF A;  3CHP A;  3FH8 A;  4QSH A;  3S2H J;  5M5Y J;  2DTZ A;  1MW1 A;  2Y1D A;  4FLR A;  2NS7 A;  5JLX A;  2DA2 A;  4Y7N J;  3HDD A;  3GTK J;  4CXF A;  3JRB A;  1H19 A;  5E3M A;  3MVP A;  2NOG A;  2LP0 A;  4D5C A;  5K7H A;  3RZD J;  4A3I J;  4W97 A;  2Y2Z A;  1ETO A;  4ZQT A;  2CJJ A;  3HOW J;  2H8R A;  3CHS A;  2XB5 A;  3BR5 A;  2MAO A;  1U78 A;  4G12 A;  2WZG A;  5BNG A;  3FUE A;  4M3F A;  1H3L A;  3WQS B;  1TWC J;  3FU3 A;  2LFB A;  2HOT A;  4ZX4 A;  1SG7 A;  3G1M A;  4M3E A;  1EF4 A;  1WH5 A;  3FUN A;  1ETQ A;  1RPW A;  1X3W A;  2HOA A;  3BQY A;  2RJI A;  3CIA A;  3FH7 A;  2E19 A;  4A3G J;  4ZW3 A;  3ZOB A;  3B7S A;  3FTZ A;  4XN1 A;  4AR8 A;  1MSF C;  3FTS A;  1GW6 A;  4B3A A;  3FU6 A;  2XGC A;  1XC5 A;  4IHV A;  3IIE A;  1TWA J;  3B7U X;  2R59 A;  4FCA A;  2AHQ A;  2XGE A;  4C2M J;  2XRL A;  5M5W J;  4XRS A;  2WB1 N;  5IYD J;  4XN4 A;  2XPY A;  1FTZ A;  4AUX A;  1LE8 A;  3GTL J;  3S1M J;  2R0Q C;  3FUJ A;  3GBG A;  4BBR J;  4AC0 A;  3S1R J;  4KP7 A;  1VND A;  3JRC A;  1ORK A;  5GPA A;  1BL0 A;  5JAZ A;  1JTX A;  3ZQF A;  3CHQ A;  3VVL A;  4UUS A;  4XN9 A;  2VKV A;  1PUF A;  1MW2 A;  1Z0X A;  2HDD A;  1S46 A;  3FK7 A;  2NVX J;  5IP7 J;  4R7L A;  1RKT A;  5EGO A;  1JVS A;  5JNL A;  4M6V A;  2K9S A;  4AR9 A;  1ZK8 A;  3HM5 A;  3FTW A;  2OPT A;  1U8B A;  4C3I J;  4X2U A;  4XMX A;  3FIS A;  1A6I A;  4XNB A;  3BG3 A;  1MBJ A;  2XSD C;  2Y9Z A;  2R70 A;  4NQW A;  2R7Z J;  3IH4 A;  1JUP A;  5GP9 A;  3NAU A;  1W0U A;  3B7T A;  3VPR A;  3ANN A;  4XMW A;  5F0F A;  3HKZ N;  3O8H A;  1QPI A;  4AYB N;  3GTG J;  4ZW6 A;  5C4X J;  1OFC X;  1HDP A;  3S1Q J;  2JA7 J;  4MFD A;  1FIP A;  2CQX A;  2GLO A;  3S16 J;  2GM4 A;  5HNF A;  4A3D J;  1IRZ A;  1XG1 A;  4L5E A;  1JT0 A;  3AU9 A;  2NS8 A;  3ZHX A;  5M3M J;  3EBH A;  1X2M A;  1MBE A;  2GTQ A;  5F08 A;  3OSG A;  1R0L A;  3BTL A;  5IOY A;  4I6Z A;  2O8K A;  5EDN A;  1TC3 C;  1VFC A;  3UCQ A;  4DYQ A;  3B34 A;  5DTD A;  3GTP J;  3FUH A;  5FKO A;  3FUK A;  1TWH J;  2FX0 A;  3NAR A;  5F1J A;  3LSP A;  3IH2 A;  2XPV A;  3K2A A;  1AKH B;  2PMZ N;  4MFE A;  1JUM A;  4M3D A;  4DZP A;  2FFL A;  3A01 B;  1HOM A;  4DYC A;  3M4O J;  2WPG A;  2CU7 A;  2TRT A;  4IHX A;  1RES A;  4Q4E A;  2M9H A;  1IC8 A;  1UG2 A;  1X2N A;  1MNM C;  3FHE A;  3LSR A;  4OOE A;  5FKL A;  3JRF A;  1HCR A;  1SQM A;  2FQ4 A;  1MSE C;  1MVY A;  2LVS A;  2ZB9 A;  3QPS A;  2M34 A;  1IJW C;  2JD0 A;  2KT0 A;  1ETV A;  3BR1 A;  2EZH A;  5K7F A;  2ID3 A;  2JN6 A;  3F0C A;  2B61 A;  5EZH A;  2PL5 A;  1T1R A;  1I3Q J;  3BR0 A;  3ZQH A;  2IAI A;  2QCO A;  4QIR A;  4D7N A;  2QJ1 A;  2EH3 A;  3FTV A;  3JT1 A;  3O8G A;  1I50 J;  4Y52 J;  1ZGW A;  2LTP A;  3IH3 A;  2A7O A;  4HNV A;  1ZTR A;  4A3E J;  4BY1 J;  1O4X A;  1IV6 A;  1CQT A;  4BBS J;  4FLO A;  9ANT A;  2HI3 A;  5F27 A;  2DMU A;  5EV7 A;  2HPT A;  3GTJ J;  1BW5 A;  2FJ1 A;  5FJ8 J;  3HOZ J;  3CZK A;  5BPP A;  4M3G A;  1B8I B;  1QVT A;  4J3B A;  3GTM J;  2LR8 A;  2M2E A;  3T8V A;  5IP6 A;  3B6A A;  3HB9 A;  3UER A;  5DS9 A;  4ZX5 A;  4A3K J;  2WZF A;  3FTU A;  2B63 J;  1ONO A;  2TCT A;  2AO9 A;  4AR1 A;  3PO3 J;  5EF6 A;  1ETW A;  1Z77 A;  3ZQI A;  4QIW N;  4XN2 A;  1T1S A;  5IYC J;  3I4M J;  3IV5 A;  3A14 A;  2G0E A;  2NVT J;  2COB A;  4XO3 A;  1GVD A;  1Q0Q A;  2OF7 A;  5JC1 A;  5E3L A;  3BTC A;  3S14 J;  1FTT A;  4JYK A;  2R92 J;  1Y1W J;  2N8G A;  2DN0 A;  3CHR A;  5F0C A;  4Y6R A;  3FUM A;  4XMV A;  4ZW8 A;  2K9Q A;  3RC3 A;  1ETY A;  1NTC A;  1MBF A;  5IPA A;  2L7F P;  2JK3 A;  5IOZ A;  1ITY A;  2O7G A;  3WHB A;  3FUL A;  3JRH A;  4AIC A;  1IDZ A;  4JX6 A;  1OCP A;  4MKT A;  2JA5 J;  2L7M P;  4C3J J;  3B7R L;  1WCM J;  1AKH A;  3S17 J;  1G5A A;  4C3H J;  3JRD A;  2E2I J;  1UHS A;  3A01 A;  4FLS A;  2R5Z B;  4Y6P A;  3ZHY A;  5IP9 J;  2K40 A;  2DA7 A;  5IYB J;  1APL C;  2M0C A;  3L1P A;  1SC5 A;  4AYS A;  2VUM J;  2DMT A;  3CZG A;  3PUU A;  1K61 A;  4V2F A;  2CQQ A;  1Q0H A;  5E3N A;  2E2J J;  1ONP A;  4ZQF A;  1MH4 A;  4ZN6 A;  2EQR A;  2Y30 A;  2C82 A;  3AU8 A;  2IEK A;  1WPK A;  1LFB A;  4FTH A;  4IHW A;  2MG4 A;  1JG9 A;  3M3Y J;  4XN8 A;  1JTY A;  2EZK A;  3RKQ A;  1OJL A;  4I76 A;  4DYR A;  1IG7 A;  3RAS A;  4A3J J;  1POG A;  2EZL A;  3ANL A;  1ETX A;  2NVY J;  5HOD A;  4J19 A;  5DLL A;  4RBO A;  4IEJ A;  3JSZ A;  2ECB A;  2HYJ A;  1F36 A;  2DMP A;  4MS6 A;  1B8I A;  4ABZ A;  4ARF A;  2Y0S N;  1MBH A;  1H8A C;  1AU7 A;  2Y31 A;  2Y1G A;  3LNQ A;  1FJL A;  4MLO A;  3B6C A;  5E3O A;  4DW6 A;  1K83 J;  3BTI A;  4R5V A;  4XN7 A;  4XND A;  4QTR A;  2ECC A;  2JWT A;  3CDL A;  3ANM A;  1Y1V J;  3U9W A;  5EEA A;  1QVU A;  3DCF A;  1D5Y A;  1P7I A;  2MSY A;  1UMQ A;  1MBG A;  3PM1 A;  1H88 C;  3EBI A;  2VKE A;  2XPU A;  2LD5 A;  2D5V A;  3S2D J;  4K5L A;  5J1U A;  3ZHZ A;  4CYC B;  3S15 J;  4A3B J;  1A5J A;  2JD1 A;  4K5M A;  2XB0 X;  3JRG A;  4XNA A;  3CMY A;  1BW6 A;  2R72 A;  4DPR A;  1HS6 A;  5K7Z A;  3Q0U A;  1YRN B;  2JV7 A;  3JR9 A;  4RVB A;  4R5T A;  4A93 J;  3HOU J;  3FU5 A;  3SFI A;  2MW8 A;  1RP3 A;  1T33 A;  2M8G X;  1JJ6 C;  5JMP A;  1JKO C;  5DUL A;  3HBL A;  4JX5 A;  2R5Z A;  4Q4I A;  1E3O C;  4A69 C;  4GAA A;  5FLM J;  2DA4 A;  4ZW5 A;  4ZX3 A;  3FIW A;  3HGY A;  4B4C A;  3B2X A;  2DA3 A;  1NK3 P;  1JGI A;  2Y1E A;  3OOU A;  4L2L A;  5EYR A;  1VF9 A;  4XRS G;  1FIA A;  3FUD A;  3WQQ A;  1FEX A;  4MO7 A;  5EG0 B;  5M3F J;  3LSG A;  4FE7 A;  1JUS A;  3Q0V A;  1X58 A;  2JA8 J;  2L7Z A;  2R5Y B;  4QPE A;  4XMZ A;  2HXO A;  1XS9 A;  4XMU A;  1U9N A;  2HPO A;  3TW6 A;  2L9R A;  1AHD P;  1R0K A;  4BXX J;  3VVM A;  1GV5 A;  3W6V A;  3E7L A;  1SFO J;  4GFB A;  3BG5 A;  3GTQ J;  3EBG A;  4M3B A;  4Y67 A;  3ZQL A;  2IBD A;  3B3B A;  4OOF A;  1MW3 A;  3C2B A;  2XQ0 A;  1HDD C;  3A02 A;  5FKN A;  2GBY A;  2ME6 A;  3UKG A;  3OSF A;  2E2H J;  2EGH A;  5M5X J;  1GDT A;  4QUO A;  2O7O A;  4LOC A;  3ZI0 A;  3LOC A;  5DYF A;  2EBI A;  5FLV A;  3PO2 J;  2ID6 A;  2VJ8 A;  4K5O A;  4K5P A;  3RC8 A;  1JKR C;  2DMQ A;  2DQM A;  1Q0L A;  2MGQ A;  1IDY A;  2CRG A;  3TW7 A;  2HQ5 A;  5C44 J;  2C5Z A;  5HLT A;  4XID A;  4RSY A;  4FIS A;  4D5F A;  3LSJ A;  3DEW A;  3TED A;  2H1K A;  2LKX A;  2X48 A;  2WAQ N;  1X3Z A;  2DA1 A;  1H89 C;  4BKX A;  1RET A;  2E1O A;  3FKI J;  2LK2 A;  1SAN A;  4A3F J;  1TWF J;  3H0G J;  2DJN A;  2HXI A;  1ZR2 A;  2JCX A;  2MAP A;  4V2G A;  4S0H B;  3FTY A;  2YS9 A;  4ZW7 A;  3CHO A;  4BY7 J;  4CYC A;  3H3V K;  4B1R A;  1R9T J;  1G2H A;  1ZS2 A;  2JCV A;  1HF0 A;  2EZI A;  1DU6 A;  5C3E J;  3CZE A;  3CQZ J;  3S1N J;  2QF7 A;  4A3M J;  3QPL A;  1B72 A;  4LUP A;  1BA5 A;  1YRN A;  2DA6 A;  4DZJ A;  2XGD A;  3RQI A;  5J1Y A;  3FTX A;  3KED A;  5JO0 A;  5F04 A;  3BR3 A;  3ZQG A;  3ZQC A;  3G1L A;  4D7M A;  2PGG A;  5C4J J;  2R93 J;  1JJ8 C;  2P81 A;  2VLA A;  3OIO A;  2JJ7 A;  4X1E A;  1F43 A;  3A03 A;  1GUU A;  1JGG A;  3JRI A;  3HOX J;  2DQ6 A;  3BT9 A;  1OCT C;  3GTO J;  5FKM A;  4UUT A;  1HLV A;  5FWQ A;  4W1U A;  2XPW A;  4XRM A;  3MKL A;  2YU9 J;  3HOV J;  1MBK A;  1K5H A;  1VI0 A;  5EG0 A;  3CZL A;  3Q3S A;  4RCV A;  1TWG J;  3I4N J;  4Y6S A;  1RR7 A;  3BR6 A;  2R5Y A;  1LFU P;  2I10 A;  1QRY A;  4JP0 A;  3BR2 A;  3A06 A;  1Q1V A;  3FU0 A;  5JMW A;  1OR7 A;  1NK2 P;  3BTJ A;  3MN2 A;  5J1R A;  1W0T A;  1MW0 A;  2JD2 A;  2WV1 A;  3AUA A;  4GAE A;  1ZR4 A;  4MIM A;  3B2P A;  3FH5 A;  4FLQ A;  1BJZ A;  2FD5 A;  3TP0 A;  3RZO J;  1I6H J;  4JX4 A;  1U9O A;  5F0H A;  3JRE A;  2PUS A;  4ZX6 A;  2DA5 A;  5FKK A;  1WH7 A;  4QME A;  1ETK A;  2ZXG A;  2CUE A;  2JCY A;  2XPZ A;  4ZQG A;  2VI6 A;  5J3L A;  2Y1F A;  3BQZ A;  4XN5 A;  4A3L J;  4ZQE A;  2JA6 J;  3Q0W A;  3TP3 A;  2L0K A;  1ONN A;  5JBI A;  2KDZ A;  1ZKG A;  1IGN A;  1T56 A;  4JND A;  1B72 B;  2W48 A;  3HOY J;  2X9D A;  2Y9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...