4BKXA

The structure of hdac1 in complex with the dimeric elm2-sant domain of mta1 from the nurd complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
161
Chain Sequence
GEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords METASTASIS-ASSOCIATED PROTEIN MTA1
publication title Class I Hdacs Share a Common Mechanism of Regulation by Inositol Phosphates.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 161
sequence length 169
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bkxA02
1.10.1740.200 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4bkxA01
2EBIA 3SDGA 2HOSA 2HOAA 4DZPA 1BL0A 1RETA 5FKMA 3RKQA 1QPIA 4B4CA 2COBA 2DTZA 2IBDA 2JA8J 1POGA 4X1EA 3A01B 2ELKA 5E3NA 1TC3C 2O7OA 1MH3A 3HOZJ 5FKLA 1MBJA 4B3AA 4DZJA 2CRGA 5EG0A 2ID6A 3JREA 5BNGA 4BY7J 2O9LA 3JRBA 3OSFA 4XRMA 1NK2P 1W0UA 5M5XJ 4MFDA 1MSEC 2GBYA 4G12A 2GM4A 1IG7A 1IRZA 4FE7A 4LOCA 2CQXA 2R7ZJ 3HOUJ 2R92J 4UUSB 2ECBA 2X48A 5M5YJ 5JLWA 2Y9ZA 1BW6A 1IV6A 5FLVA 5FKKA 3BT9A 3S14J 1QVUA 4IHVA 1AKHB 3HB9A 1U78A 3HOWJ 5J1RA 3PO2J 5IYBJ 2H8RA 2ZB9A 1W0TA 4IEJA 3S16J 2HOTA 2JJ7A 2DMUA 2LKXA 5JLXA 4FISA 5J1UA 1S7EA 3H0GJ 1O4XA 2YUSA 2CJJA 2JMWA 4XICA 4Y7NJ 4A3CJ 3FIWA 5DTDA 1AU7A 1TWFJ 4A3IJ 1Z0XA 3GBGA 2DA6A 1ETVA 2ID3A 4DYRA 3A01A 1ENHA 3GTMJ 3GTPJ 1H88C 3S1RJ 2XPUA 1GT0C 3IH2A 1WPKA 2CQQA 2P81A 3GTOJ 3K7AJ 3LOCA 4EEFG 2EZKA 3HBLA 2LTPA 1FTZA 1IC8A 1XG1A 4C3HJ 2H1KA 1FJLA 2Y30A 4GFBA 3G1OA 3JRDA 4MFEA 1BA5A 4AUXA 1IUFA 4JX4A 4UUSA 2R0QC 2NVTJ 3JRFA 2DMTA 2B63J 4IHXA 2CUEA 1I6HJ 2ECCA 3DEWA 3IH3A 1AKHA 1HLVA 5E3LA 3HEFA 4XK4A 3LSRA 2HXOA 1U9OA 1UG2A 2O8KA 4BBSJ 2DMNA 4JX6A 1WH5A 5EYRA 2G0EA 3GTQJ 1ETYA 1MBEA 4QTRA 4A3LJ 2K9SA 3M4OJ 3JRGA 1F43A 3BR2A 1ZR4A 1JGGA 5C44J 1NTCA 3PM1A 2VKEA 1H89C 1JKOC 1UHSA 1QRYA 3MVPA 4XRSG 3H3VK 3FK6A 3BTLA 2NS7A 4DYQA 4CYCB 3JRIA 1HF0A 3TW7A 3BR0A 3BG9A 3O8HA 3ZQCA 2EZLA 2XPWA 4M3DA 3ZOBA 2NOGA 4A3MJ 1ZK8A 2LK2A 4V2FA 5K7HA 1LE8B 4BKXA 1JTYA 2K9QA 5EZGA 3GTLJ 2NVQJ 5M5WJ 1TWCJ 3HDDA 4L5EA 1JJ6C 1JKRC 3W6VA 3LNQA 4IHWA 3HOXJ 3BQZA 1QVTA 3NAUA 1HOMA 1F36A 4AYBN 5E3MA 5J3LA 2DMQA 5FKNA 1E3OC 5EZHA 1HDPA 2EQRA 3MKLA 4C2MJ 2L7MP 1ZTRA 4UUTA 1BW5A 3NARA 2WV1A 2XSDC 4NDLA 2VUMJ 3TP0A 1ORKA 2R5ZB 1XC5A 2WB1N 5FJ8J 2D5VA 1APLC 2M0CA 2IEKA 5IYCJ 3JR9A 2MGQA 4B1RA 5IP7J 1VF9A 4CYCA 2YU9J 4ABZA 1ETKA 3RZDJ 4D7MA 2GLOA 3FISA 1R9TJ 2JWTA 2E2IJ 5K7ZA 1DU6A 2XB5A 1LE8A 1X58A 3BTIA 2LY9A 2HQ5A 2OF7A 2OPTA 2TRTA 1OCTC 1P7IA 1K83J 1P7JA 1B8IB 1ETWA 2CUFA 3I4NJ 1JUPA 3D1NI 3S1MJ 3HKZN 5J1YA 4A3JJ 3ZQLA 2M9HA 5GPCA 3BR1A 2TCTA 5IP9J 1MBHA 1Z77A 2LP0A 4I76A 1IDZA 2LR8A 3BTJA 1MBGA 2HI3A 3QQAA 2R93J 1UMQA 3RZOJ 2MSYA 4V2GA 3PO3J 1K61A 3CCYA 3HM5A 1YRNB 1RPWA 3S15J 3CDLA 4BXXJ 2R5ZA 4FTHA 2K40A 4MIMA 1JTXA 1Y1WJ 1SANA 4BBRJ 2ME0A 9ANTA 2M8GX 2Y31A 3Q0WA 1RKWA 3S1QJ 2DJNA 3JRHA 4D5CA 1RESA 2DA2A 2VI6A 1MSFC 5F0HA 2M2EA 1MBFA 3QPSA 4J19A 2I10A 4JP0A 1GVDA 2DA3A 3K2AA 2DA5A 4A3FJ 3BR5A 5K7FA 3BTCA 4W97A 5HODA 4A3EJ 3ZQFA 2X6OA 5EEAA 4XIDA 1NK3P 3GTKJ 1WI3A 2AO9A 3LSJA 3VPRA 2DA7A 2YS9A 1JJ8C 4M3EA 1B8IA 2RAEA 2EZHA 3HOVJ 5F1JA 5C4JJ 3Q0UA 1LFUP 2IAIA 4M3FA 2NVYJ 5F08A 4BY1J 4MLOA 2LFBA 5GPAA 2JA5J 3FKIJ 3OOUA 1GV5A 1PUFB 3WHBA 1JKQC 3E7LA 1ETXA 4RDUA 5EGOB 3TP3A 1XS9A 3CQZJ 3IV5A 1WH7A 4Y52J 4DW6A 2Y9YA 1TWAJ 2WAQN 1X2MA 1MNMC 4QSHA 3S17J 1FIAA 1YRNA 1HCRA 2HXIA 1ZQ3P 2KT0A 1VNDA 2LD5A 2XGCA 3BR6A 4C3IJ 2Y2ZA 5FLMJ 1EF4A 5IPAA 3ZQHA 2JK3A 4A93J 3A03A 4JX5A 4D7NA 5FKOA 4A3DJ 1JUSA 2NVXJ 1U8BA 1U9NA 1X2NA 1OCPA 3L1PA 2VPRA 1I3QJ 3MN2A 3FK7A 2XRLA 1GV2A 1BJZA 3ZQIA 2FJ1A 3Q0VA 1ZKGA 3A02A 3BQYA 3F0CA 4FE4A 2XB0X 1G2HA 2N8GA 2W48A 1I50J 4M3BA 2FQ4A 3SFIA 2EZIA 4DYCA 3CMYA 1T56A 2X9DA 2KDZA 2L7ZA 4M3GA 1SFOJ 2M34A 2CU7A 2JN6A 2R5YB 1OFCX 2DMPA 5IP6A 3Q3SA 3UKGA 5F27A 2L9RA 1CQTA 1HDDC 3HOYJ 1PUFA 5IYDJ 4C3JJ 4D5FA 1A6IA 5EGOA 5M3MJ 1ETOA 2E1OA 2MG4A 2Y0SN 5IOZA 5F0CA 4XRSA 1GDTA 2DA1A 3GTGJ 2MW8A 1RR7A 5C4XJ 4A3BJ 3ZQGA 1FIPA 5IOYA 1MBKA 3GTJJ 3HGGA 1MH4A 2L7FP 4M6VA 3B6CA 2QF7A 3QPLA 4FCYA 1JT6A 1WCMJ 1IGNA 1WGXA 1DU0A 4A69C 3OSGA 1JUMA 2DA4A 4S0HB 2EH3A 1B72B 1LFBA 1JKPC 1ETQA 3S1NJ 3LSGA 2LLKA 3DCFA 3JRAA 5F0FA 3C2BA 2E2HJ 3BG5A 3IH4A 1ZGWA 1FEXA 1IDYA 1IJWC 2JA6J 5F04A 2ME6A 1OJLA 2E2JJ 1TWGJ 2AHQA 4JYKA 5DS9A 4AC0A 5M3FJ 2DN0A 4X6AJ 4QIWN 1VFCA 4A3GJ 5E3OA 2L0KA 1H8AC 1ZR2A 1Q1VA 2VKVA 5EG0B 2R5YA 4A3KJ 2E19A 4IHYA 1T33A 4I6ZA 2HYJA 5EDNA 3HGYA 5EF6A 3S2DJ 4HNVA 5GP9A 1Y1VJ 3I4MJ 1FTTA 5C3EJ 2XPVA 2XGEA 3OIOA 4W1UA 3LSPA 3M3YJ 1A5JA 3TEDA 1D5YA 3BR3A 3TW6A 2QCOA 3G1MA 2HDDA 1JT0A 1VI0A 3B6AA 2FD5A 1RKTA 2PMZN 1AHDP 3RQIA 3JRCA 3BG3A 3SJMA 2NS8A 3O8GA 3WHCA 2FX0A 1GUUA 2K9NA 2XGDA 1TWHJ 4MO7A 4RBOA 1B72A 3G1LA 1ITYA 2LVSA 2JA7J 3S2HJ
chains in the Genus database with same CATH superfamily
4IHTA 1W7PB 1DGRM 4UV9A 3B34A 2HQAA 2HOAA 2W00A 4DZPA 1S7OA 5JHUA 3KETA 3QAHA 3QYBA 3K4MA 1IN7A 3R0IA 5E1XA 3OWTA 4EM1A 1QPIA 1SD7A 4RB2C 2FNPA 1POGA 3TBIA 3CZGA 2W4SA 3WQRA 2V26A 4ZN6A 3HOZJ 1UHWA 2B0LA 4UB6C 3K4NA 1S6LA 5FKLA 3J80K 3HRUA 4PZJA 4B3AA 1P4XA 3M1EA 1J09A 2CRGA 2M8EA 2L02A 5IT9Z 1LDDA 4BY7J 2O9LA 1W0UA 1B9MA 3LA2A 1G3YA 4BJ5C 2EFOA 4G7HF 2D1VA 3JW4A 2G7UA 3J7YJ 3HOUJ 4K2EA 3DEEA 2XF5A 4U87A 5M5YJ 5JLWA 3GFLA 1GXQA 1SQMA 3BT9A 3H36A 3E6CC 1QVUA 2HKOA 2JSCA 4RB0A 1NG7A 3CCRI 3AU9A 2GAUA 3AAFA 3BDDA 2H8RA 2P7VB 1T39A 1J2XA 2VPLA 2QQBA 2LH9A 4XM3A 4HW0A 5J1UA 1S7EA 2VKDA 2RNJA 3CC7I 2E1MB 2L54A 4XMZA 3ZMZA 2L01A 2CW7A 1W7PA 3FIWA 2OCEA 3K0LA 2ZJRF 4KNYA 3WU2C 3GYHX 4KN4X 2MC3A 1IXRC 3JTGA 1FMWA 3LFUA 1W1WE 2BY0A 4CYDA 1SVOA 1H88C 4XO4A 3IC7A 4QLCU 4BHBA 1ZG5A 2IGNA 4IVNA 2L4AA 3K6GA 2PGGA 4XN4A 4MHGA 2HVRA 3HBLA 5ICFA 2O03A 3EYYA 1XG1A 2H1KA 1FJLA 4GFBA 3B2XA 5CVRA 2X51A 4WCGA 4ITVA 1G5AA 4QUOA 3CJTB 4FLRA 4ESFA 4L18B 3S3MA 3RPUD 3H35A 3PQKA 2ISZA 1I6HJ 2ECCA 3Q44A 3DEWA 4PSWA 3UEQA 5TISC 3SZTA 1HLVA 2HXOA 2IVMA 1U9OA 3CIAA 5HLGA 4B44A 3KCCA 1LEAA 1MNDA 2NOJB 1MMGA 3B3BA 3CCJI 3AG3H 2BEOA 4N9HA 2GZWA 1H9GA 4XMUA 2VOOA 3MEXA 3K69A 1FSEA 5GTHC 4EATA 2HPMA 4P96A 1ZRCA 5C44J 3ZR8X 5A2QZ 3VOEA 3A0BC 3A4CA 1H89C 4M9XA 4QPEA 3L7WA 2BY3A 3RPQA 1FT9A 1NHAA 2F4MB 3PQJA 2RV8A 5IT3A 1HF0A 2OTLI 3FUEA 3ZMSA 2Q0OA 2XSJC 4M3DA 3PJRA 4HOBA 2NOGA 3KP6A 2UZKA 1ZK8A 4HG2A 2ISYA 1LB2A 2PFBA 3CMMA 2XDVA 4V2FA 3J81K 2CFXA 1FZPB 1JTYA 2HNHA 1D0XA 2K9QA 3HUGA 2X6YA 3DTIA 2DFIA 4AU7A 1ZN2A 1K4SA 2NVQJ 5EEGA 3CCUI 1T38A 2OU2A 2X1CA 5KCMA 4YIFA 2R7UA 4WWCA 3BQZA 1HA8A 4AYBN 2VODA 1R22A 1BBYA 2VQHA 4PK4A 1UELB 3KPHA 3HOTA 2ZJ2A 2V1DA 2IGOA 2DYSH 3PFIA 5K5QA 1LEBA 5EZHA 3RC8A 4LLLA 1R00A 2KKOA 2IW5A 2EWNA 2F2EA 4PSXA 1PUEE 5ILUA 4XLFA 3FUHA 3DTKA 2WV1A 4NC7A 2VUMJ 4I98B 5HVQC 1XC5A 1E2XA 2VT2A 2WB1N 2NXNB 1BR4A 3LSMA 1APLC 1YJWI 1RI7A 2M0CA 3O2PE 3FU0A 1L3LA 2YU9J 1PVEA 1V5EA 4AVZA 5DCFA 3U1KA 1K6YA 2XAHA 2VIXA 4D7MA 2R7SA 4OIRF 2JA2A 4K5PA 3FISA 4P5OA 1XGMA 1R9TJ 4U0VA 3VSKA 3FUIA 2F5FA 1Y0NA 3WG9A 5D5WB 3M07A 3CCSI 1X58A 2C5ZA 3FXQA 1KU3A 3V7RA 1G3WA 1OCTC 4R5XA 4D1QA 2QENA 3BZKA 1B8IB 4RLQA 1ETWA 2CUFA 1JUPA 2DAOA 1TTYA 2FBKA 2VE8A 3HKZN 5F6FA 5J1YA 4A3JJ 3ZQLA 1BC7C 2E5NA 2JV7A 3FH5A 3DKWA 3BR1A 2XASA 1MJAA 2DO7A 3KZZA 3HSFA 5IP9J 4PJMA 3ABUA 5FROA 1PP7U 4ENKA 1Z77A 4LLGF 2IJLA 3GUDA 1Z6TA 3OYJA 4CHUA 3FH8A 3LSKA 2IS1A 1WHUA 1Z6RA 1MBGA 3QQAA 4IJAA 5ICGA 2R93J 4V2GA 3PO3J 4Y15A 4X0GA 3CCYA 1W7PD 2CO5A 3RCOA 3RSNA 3COAC 2WPGA 2V9PA 1BIAA 2ZJPF 2A69F 2A6TA 1D8KA 2HPIA 3ZGKA 3BLYA 3GCMA 2CV1A 4FTHA 2K40A 5LHIA 1JTXA 1Y1WJ 3I53A 1SANA 5DCMB 1YIJI 1R0KA 2UXNA 2VJIA 9ANTA 2DPDA 1O57A 1MW0A 3FULA 1MSFC 3WTWC 3CCEI 3RJPA 3CDHA 1DPUA 2IP2A 3RC3A 1MBFA 1F1ZA 3MFKA 3D0SA 2KIMA 3C18A 1S9HA 4Y13A 5HODA 2GTQA 3BPXA 1FP2A 2JZYA 2L3DA 2X6OA 5EEAA 3FBIB 2PBIA 5FRMA 4KDPA 1JJ8C 1XMXA 5HLTA 4B48A 1B8IA 1XCBA 4YEJA 1R5HA 2NRAC 5D8LB 1HKSA 1LFUP 1S7AA 1V5GA 1XGOA 4AYBA 4EGZA 1UG0A 1SD4A 1TQMA 4P1WA 2NVYJ 5F08A 4DIQA 4RAZA 4E7KA 3O3KA 3QRFF 4BNCA 3ABMH 2PUSA 3FTWA 3NRVA 3OOUA 1GV5A 5DUKA 1JHFA 3QYEA 3WHBA 3J7ZI 5E1WA 5IT9K 1QPMA 1ETXA 1I5ZA 4RDUA 5J47A 3TP3A 3K70D 1J5YA 1XS9A 5K5RA 2VL8A 4DW6A 3OYFA 1TWAJ 3DKXA 3IRQA 2FU4A 4WX9A 1GW6A 1MNMC 1FIAA 2A07F 2LF7A 2HXIA 3H3UA 1ZQ3P 3P9KA 3SYTA 5DLLA 1LNWA 3CCVI 3BR6A 2VXZA 2JVHA 3ML6A 1EF4A 3QU6A 5DCMA 3G2BA 3JSPA 3D5LA 1X4PA 3E5QA 4XOPA 4M9ZA 1REPC 5FKOA 4A3DJ 3S1MJ 5GAEJ 1JUSA 3U9GA 2L7KA 3L2WA 2NVXJ 2ESHA 2AXTC 5TRDA 1X2NA 3OYAA 3JAMZ 2VPRA 1I3QJ 3FK7A 3MN2A 4G6DA 3F22A 2PMHA 2HU9A 2W57A 2X85A 5B3SH 4ZJZA 1SG7A 4F7ZA 3F0CA 3RDIA 4RS8A 5HLHA 4LLNA 4KFCA 1G2HA 1I50J 4PJNA 1X1AA 4M3BA 2EZIA 3CC2I 2STTA 3AU8A 1XDUA 1Y8RB 5HDNA 3DPTA 1BM9A 2L7ZA 1IXCA 4KIBA 1R1UA 4BJTA 1SFOJ 2M34A 2R5YB 3HOYJ 2L9RA 5LFAA 1CQTA 4XN5A 2JTVA 4GRIA 4C3JJ 5ICEA 2DTRA 1EH7A 4F92B 5M3MJ 1ETOA 3LL7A 4FLSA 1UCRA 4PUSA 3E0JB 1GVJA 2V4JC 1YO5C 3GTGJ 3R61A 4LG0B 1RR7A 5C4XJ 4A3BJ 3ZQGA 4E7ZA 3GTJJ 4M6VA 2FQ3A 2GIZA 4ZW5A 4F93B 4BEHB 3FX3A 1YG2A 1T2KA 1G3SA 3B7RL 1HW2A 3CHOA 4XSXF 3GEZA 3RKWA 2A68F 1QZEA 3BPVA 3WGGA 1J9IA 3L2UA 2OC6A 1ZG1A 4PGGA 4H0EA 3I4PA 4Y3OA 2CQKA 1BIBA 2KDOA 5DD4A 3IKTA 4KICA 4XNBA 4CUGA 4I0BA 1LFBA 3IL2A 1ETQA 3LSGA 4F55A 3H9QA 5D6EA 3FHZA 3BOQA 2EFQA 4XBFA 2PN6A 3C2BA 3QP6A 2ZKZA 1ZGWA 5A2QK 4M6XA 5E17F 3EQLF 4ZC3A 4ZX5A 1OJLA 3M9AA 4KIFA 4KMUX 2BVLA 1WJEA 2YU3A 3L2RA 4IX7A 4AR8A 1W4MA 3V7CA 4JYKA 3DF8A 1HXDA 3KP3A 3KP4A 2DPUA 3HYIA 4OWRB 3B73A 5E3OA 1H8AC 5BOXA 2R5YA 5LEJA 2MYSA 2W25A 3E1SA 1Q0HA 2Y48A 3P7NA 4UY8I 4XQFA 3N97A 2H6BA 2R4GA 3S2DJ 1X3ZB 3BJ6A 4L5IA 3OS2A 5JNLA 4CCNA 3MKZA 5C3EJ 2I5UA 3GO5A 2RVCA 3QOPA 4W1UA 2BXYA 4LG0A 4JOMA 3S2WA 3VVLA 4XMYA 4GCVA 3TMOA 3BR3A 3GZ6A 1YITI 4IF4A 1J59A 1VQ7I 4BEHA 4E7LA 3KE2A 1AHDP 4FLQA 3CUOA 1S5LC 1BJAA 5HDKA 2NS8A 4GYIA 1G4DA 4OOEA 3CP8A 2HPTA 2NNYA 2E34A 2P6TA 3FWEA 1E17A 1TWHJ 3I0TA 3G1LA 4R8HA 3HHHA 3S2HJ 1G8XA 2EBIA 3SDGA 5FLXZ 4IZZA 2HOSA 3DFGA 2QVOA 3OL3A 1IO2A 1XGSA 2R59A 2FFLA 1YQAA 3IWZA 3FUDA 2DTZA 2IBDA 3FMRA 5J4VA 3IRRA 2JA8J 3ZHYA 4X1EA 3KX2A 1D5VA 3CESA 3E3VA 1VQ5I 2O0YA 3EETA 3VB2A 1SFEA 5JC1A 1WRJA 3W2AA 2Z5UA 1V54H 2IPQX 3C7JA 4DZJA 4L0YB 3OY9A 2F6CA 2ZXJA 1ZLJA 3JREA 2EILH 1YHQI 3WG7H 2Q1ZB 4XN7A 4XRMA 3EDPA 5HNHA 1XN7A 1X3ZA 3JSOA 2VJ8A 2P8TA 2M7AA 2PX9A 3AFHA 3TOAA 2MH2A 3FXKA 3MD2A 4XNAA 2X48A 4E7JA 4BDZA 5E8IA 4HDUA 2Y9ZA 5CQGA 1AOYA 2ELJA 5FKKA 4PU2A 4PJ0C 1BI3A 3FM5A 3T5XA 4ZX3A 3T0YA 1U78A 1T6SA 4UVCA 2CGPA 3X2QH 5D5XB 4RM2A 3CTAA 2ZB9A 4A5NA 4JNDA 4NUBA 2JJ7A 2DMUA 3I59A 2GWRA 1SC7A 2LKXA 4FISA 2H6CA 4BE1A 4EQQA 1LVKA 2YUSA 4IRHA 3Q43A 5H6QA 2STWA 4A3CJ 5DTDA 1SVMA 1R71A 4BQOA 1L0OC 1TWFJ 1OKRA 4XKCA 2O3FA 1OISA 2BV6A 3QP5A 3CCMI 1LPQA 1I39A 2DA6A 1ETVA 4U88A 4FHTA 5IY5H 2GIVA 4DYRA 3S3NA 3FMQA 1P4WA 3IP4B 1F5TA 3S1RJ 1GT0C 2EIMH 2BHZA 2LF8A 2JUGA 2CQQA 5E1ZB 1XSXA 1QGPA 4PFPA 3ZQ7A 5BPPA 3QPTA 1S3JA 4AIKA 3K4KA 2LTPA 1Z21A 1FTZA 1HKTA 4MTDA 4Y6PA 4MQVA 4C3HJ 1Q1HA 1X19A 1OYWA 2BBYA 3TO7A 1BA5A 2R7FA 3ECOA 3GVAA 1ZHFA 2AXLA 2EFWA 2Y1EA 1Y39A 1A36A 2HOEA 4DQ2A 2E35A 3EYIA 5LBQA 4C2UA 4RB3C 5LGNA 5FWQA 1UB9A 3KEOA 3F8BA 4A2UA 2K85A 2E1NA 3HEFA 3KP2A 3LSRA 4FX4A 4IHSA 1KQ9A 2H94A 2O8KA 4XN1A 4ZW3A 1Z67A 2DMNA 2ZCWA 3T8RA 3F72A 3FUKA 2CW8A 3CUQC 3GFJA 3PUFA 1WH5A 1HBXG 2DXIA 1D0ZA 5EYRA 3RYPA 3LAJA 3GF2A 5CVUA 3GTQJ 1ETYA 3A0HC 1O3SA 2K9MA 2XVCA 4AICA 3ISPA 2Z33A 2W85A 3L00A 1OPCA 4A3LJ 3M4OJ 1G3TA 1IRXA 3BR2A 1JGGA 2MD0A 1NTCA 2EV5A 2VKEA 1JKOC 1QO0D 3MVPA 4XRSG 2LC2A 2ZFWA 3F21A 1K6OA 2ESNA 4OOIA 3E5XA 3BTLA 4OIQF 2DLLA 3E6DA 5JI6A 3JRIA 2CSOA 3BR0A 3O8HA 3ABLH 2XPWA 3H1CA 3ZOBA 2KIQA 4A3MJ 2LK2A 3JAMK 2DK5A 5B5EC 1RR8C 2DOFA 1VQ8I 1MZBA 3ANNA 4WK8F 4MS6A 4XN9A 2OAZA 1R58A 4BKXA 1B6AA 4ENJA 2EJRA 3CDIA 3Q5FA 2VJ5A 1STZA 3WU0A 1KYWA 3GTLJ 4E70A 2PJRB 1TWCJ 4BUPA 3HDDA 4LK1F 2V79A 1JKRC 1I1GA 3LNQA 5KAFC 5ED4A 1IN5A 3HOXJ 1VQNI 3PNYA 3BZ6A 3I71A 5DEQA 4G6QA 1TQPA 4HX4A 3N05A 2DMQA 2D1HA 3I56I 1E3OC 2Z16A 4M9SA 4DJAA 2CUJA 4BGDA 4U7BA 3SEQA 1XD7A 3CP2A 3MKLA 4IRGA 4C2MJ 4BL0B 4XONA 3AL0B 2LG4A 2DQRA 2IGKA 2JD0A 1XMAA 2PI0A 4PCQA 4NDLA 1ONVA 3TL4X 2R5ZB 2DFEA 3DP7A 4UVAA 2YX4A 5FJ8J 2OV7A 1R4NB 1T0FA 4JQFA 4BS9A 2IEKA 3MMYB 5IYCJ 3K1PA 2MGQA 3E6MA 5IP7J 1W5CC 5F1RA 4DOZA 5L3FA 5HNFA 4EM0B 1ETKA 4B3XA 3FHEA 2QEXI 5JMPA 3QYFA 2GLOA 4BDYA 2E2IJ 2DODA 4LJZF 4A0XA 2XB5A 1SMTA 5LLQA 4FCAA 3EUKL 5FD6A 3QPHA 2HZTA 2HQ5A 4WXDA 1V5FA 1KQ0A 4WF2A 1M1EB 2TRTA 4XLNF 2ZO4A 1QHHD 1P7IA 4AVPA 1R7JA 1K83J 1AA7A 2QKMB 2PJRA 1I3AA 3D1NI 3W6KB 2EV0A 3FTYA 2M9HA 4QPQA 3A2KA 2HZDA 4FQGA 1X1PA 4XRFA 2V9VA 2E60A 3FTSA 4EM2A 1MBHA 3IKVA 3H5RA 4KT6A 4P9UA 2IT0A 3HTSB 1N75A 1P92A 4I76A 1Y8QB 4HDVA 3KYLA 5BQTA 4XKVA 2DOEA 2HI3A 5BPIA 1FBSA 2O7GA 4HNTA 3RZOJ 2EFPA 5HS8A 1X1CA 2EINH 1RIOH 1Z9CA 3HM5A 1O7FA 2ADUA 4ZDPA 5DDGA 3RASA 4CCLA 1IN4A 2R5ZA 1JGIA 4MIMA 5EV7A 1QU3A 3OYEA 5E79C 4RAGA 1ERDA 4LG3A 2ME0A 1V4RA 1WKMA 3PNVA 4UVBA 2M8GX 2ELHA 2NNNA 1RKWA 2Y31A 4HRIA 5D5VB 1DP7P 2DJNA 3FU3A 1SEUA 4ZDOA 4D5CA 5F0HA 5DV5A 3BCAA 2UWMA 1WJAA 2UXXA 4J19A 1GVDA 3K2AA 5FLXK 3FXOA 2NAZA 5K7FA 4IQJA 2LOOA 1WI3A 5CVJA 5JHFA 2DDAA 4PGHA 3L2CA 1RUOA 2JD1A 3VPRA 2DA7A 5HDGA 2F5DA 4KITB 1QZYA 1YYVA 2EZHA 5EEHA 2MAOA 1RZ4A 3HOVJ 5C4JJ 3ZCOA 1K4TA 3ULQB 2M4GA 1MDMB 4HQMA 1U0JA 2LFBA 4RAFA 2JA5J 2OCCH 3BY6A 3S8PA 1SAXA 2WY7Q 4OAYA 3ZQQA 2JVGA 4Q4ZF 5EGOB 3IV5A 1DPRA 1OMIA 1MVYA 4LITA 3FXLA 4L9NA 4XLHA 2QJ1A 1X2MA 2XC7A 1HCRA 1VNDA 2A61A 2HYFA 2XGCA 3KLOA 1YW7A 2VBWA 5ILSA 1N78A 4ZQEA 1T08B 1OYYA 4RCVA 1W5SA 2JK3A 1TW3A 5CLSA 4KP7A 2MBFA 2JRMA 1YOVB 3H92A 2X1DA 4L9TA 1U8BA 1U9NA 4Q4IA 1JXSA 2LBFB 1OCPA 3WQSB 3DTEA 3VWBA 4CCJA 4OIOF 2H1LA 2OZUA 4XR6A 2RQPA 2XRLA 4I2OA 2WA0A 2JD2A 1BJZA 2RN7A 3ZQIA 3S93A 4NHJA 3OYBA 2XV4S 2FJ1A 3E97A 4CSWA 4UV8A 3OYNA 4MNUA 2XB0X 2Y0SA 3WE2A 4EMSA 1VTNC 2W48A 1BOBA 3ZN1A 4D0PA 3CMYA 3REOA 1H3LA 1MW7A 3QWLA 2GXGA 2R7XA 5J6XA 3BROA 1LJ9A 4I0AA 1MDMA 2JPBA 3DU5A 1DGWY 5IP6A 1MJ9A 2HGCA 3T1BA 2WBMA 2LKSA 5IYDJ 2ZNYA 1IZ1A 4XNFA 1W5TA 4D5FA 2Y1CA 3D5RC 5EGOA 3OYIA 3JSZA 2HWVA 2MG4A 1LDKB 5IOZA 5F0CA 4ARFA 1WI9A 2VASA 2R3SA 3F6OA 4HBLA 3WTTC 5AIPA 2L7FP 4XKBA 1U8RA 3EPZA 4C30A 4II2A 4HSTA 2G7HA 4FCYA 1FLIA 3OR1C 4ZZDA 3DWLE 1YLFA 3WE3A 3WTZA 3G71I 4AD9A 3OV8A 3GLLA 2O6GE 1JT6A 2EV6A 4LB6B 2D45A 2CV2A 1USTA 2V1UA 3FXUA 3OIQA 4A69C 2JCYA 1JUMA 5CKTA 2LBFA 2XAJA 1D1AA 2F5VA 4ANJA 1OR7C 4HSRA 1B72B 1JKPC 4LFUA 4LIUA 4RGXA 3SDBA 4KISA 3OYDA 1SFXA 3SXYA 4EGYA 2LLKA 1OQYA 2A6HF 3DCFA 4YFNF 2B9SA 1WJ5A 4XLCA 3DXJF 4XLAA 2E2HJ 4HNUA 3MKYB 4MQ9F 4XMTA 4ETSA 1IDYA 2LNBA 4YIRX 4N4OB 2R72A 3VYSB 3E5UA 4XN8A 5KAIC 3OS1A 4Y4RA 2QGUA 2NYXA 1YS6A 1ODDA 2AHQA 2YX7A 5ILVA 2OQGA 2L9NA 1VQ4I 3AUAA 4QIWN 1FNNA 2K02A 2M1BA 3ESWB 4O6JA 2KZVA 1Q1VA 1WJBA 2VKVA 3A06A 2GA2A 2QBYB 1YE9A 2HYJA 4D9JA 5KHDA 2O61A 5JMWA 1Y56A 4HNVA 2VB6A 1ZRDA 1G6NA 5H6RA 3G73A 2X4HA 3MZ8A 4RSYA 3KIOA 2XPVA 2XGEA 3KZYA 4KUMA 3DEUA 2W7NA 3M8FA 2PJPA 3FH7A 3M3YJ 1X4OA 5L3BA 3TW6A 5LRSA 1O3TA 4K5MA 3F3XA 3F23A 1ULYA 3B6AA 1J0RA 3NWTA 4A12A 2FD5A 4IHYA 1CF7B 2KL4A 3G3ZA 2F5CA 4R5VA 3KEDA 5K1YA 3BG3A 2V7FA 1EV7A 3O8GA 4DGWB 1LQ1A 1W36D 2Y1DA 1XDSA 3WHCA 2OD5A 1GUUA 1O7LA 2K4JA 2HDCA 2JT1A 4MO7A 2X6WA 2XHKA 1B72A 1ITYA 4UHTA 4RA2A 4I01A 4N9IA 1U3EM 1KA8A 4B8XA 1WQ2A 2XUBA 4ZQFA 1FSHA 5HOOA 2H09A 2CH0A 3S3OA 1HQCA 3L09A 3I64A 5DM6F 4QIRA 2BOLA 3A01B 3CCQI 5E3NA 2O7OA 4F3QA 3K4LA 1MH3A 3K10A 2JSPA 2MD5A 4IOCF 2XKOA 3EUHC 4U7DA 3K4CA 4CDGA 3OYCA 4HLYA 2M5WA 4P55A 1QQIA 2DOAA 2LYCA 4BXFA 3LSIA 2MA3A 3ZPLA 3NQOA 3FBNB 2QBYA 3CC4I 3AKZA 1P9QC 4YFXF 2ETHA 3ZHXA 5J8FA 3R60A 3JRBA 1IV8A 3OSFA 3GFMA 5M5XJ 1ON2A 4HPQA 3FXMA 4G12A 4O5VA 3H5NA 4EJTA 4FE7A 4XSZF 1IRZA 5CQEA 1F9NA 1TT0A 2A5WA 2L5QA 2R92J 4UUSB 2ECBA 5DM7F 2DT7B 2KRCA 3HC7A 1BW6A 5FFXA 4LB5A 5FLVA 4Q5SF 3DQVC 4ESBA 3C2GA 1AKHB 3HB9A 3HOWJ 2ZBKA 1CF7A 2R70A 4K5NA 1W0TA 4C9YA 3CZ6A 5JR3A 1FYLA 2HOTA 2IA2A 3B37A 1HSJA 2AS5F 4BACA 3H0GJ 3K1MA 3ECHA 3HOSA 2CJJA 3TQNA 4XICA 4HQEA 3R6SA 3I9V2 3HG9A 4XO5A 2IXSA 4LUPA 1R6RA 1IUYA 2KRHA 5FD5A 3KZIC 1AU7A 4A3IJ 2HQRA 1Y0UA 1Z0XA 3GBGA 5L3EA 5GADJ 3A01A 2E5ZA 2V1XA 3GTMJ 3GTPJ 2PL5A 4E7IA 2XPUA 4J00A 4Y6SA 3ASOH 3IH2A 1WPKA 4BQQA 2P81A 2VKHA 4HF2A 2BE5F 1IN6A 3K7AJ 1G59A 1N77A 3LOCA 4U0YA 2EZKA 2VBZA 4M73A 2FRHA 1IC8A 2Y30A 4BAYA 2RNGA 3BJOA 3JRDA 2K4BA 4AUXA 1BR2A 4JX4A 4UUSA 2VONA 4EV0A 3KYDB 4E4HA 2P7CB 3JRFA 5AONA 2DMTA 2J5PA 4IHXA 1FBUA 1P2FA 3IH3A 3ZP5A 4ZDLA 4OIPF 2QQ9A 4TV7A 1AKHA 1VZ0A 5E3LA 4F52A 1QA6A 1UG2A 4BBSJ 1BI2A 1S46A 4L9VA 1TZLA 5LGUA 3DLAA 1HKQA 3DBHB 4ZTJA 2G0EA 2VJ4A 4RGSA 1MBEA 2BZTA 4HF0A 4EJUA 2YPRA 1U6GA 3QOEA 4E7HA 2DCEA 2E36A 2K9SA 2MLKA 1XSDA 3P9IA 4AIJA 1Q0LA 3WTVC 2EA2A 3JRGA 5DULA 1ZR4A 2ZMEC 1H0MA 5B1AH 2FMLA 3FF5A 2JQ7A 3H9JA 3PM1A 2FBIA 4ENNA 1UHSA 4KJZA 2CW0F 3PUBA 2GXBA 3FU6A 1QRYA 5ICCA 4XN2A 2CG4A 2DFFA 5DUIA 4FASD 4IRIA 3H3VK 4OOFA 3FK6A 1YJ9I 4DYQA 4Q48A 2E7XA 3TW7A 1JGSA 2HKXA 3QU3A 5H20A 1ZARA 4RB1A 3SEZA 3CZKA 1JHHA 1LDJA 1MKMA 4Q4EA 3CCLI 4KA4A 5K7HA 2XROA 1LE8B 1NH3A 4ZZLA 1DP3A 1PJRA 3BG7A 1H19A 2R7VA 1XSVA 1MIJA 2F5EA 2OJED 2MAPA 5M5WJ 4LD5A 4L5EA 1JJ6C 1VQMI 4OAZA 3CMAI 1QVTA 3IHUA 3MQ0A 5E3MA 5J3LA 1I6XA 2WADA 5FKNA 1TP4A 4BHPA 2FXAA 4K5LA 2P5KA 2CS3A 4IL6C 3C1DA 3VODA 1HDPA 1ZYRF 1TW2A 2R7QA 4BXUA 2L7MP 2V1NA 1CGPA 1BW5A 2B7EA 2DBBA 2ZXWH 3DKYA 3FUJA 1FWZA 1S72I 4BU2A 2HFHA 1FOKA 5KK1A 3J81Z 2XSDC 1V3FA 4YELA 2YSRA 3TP0A 2W1OA 2D2WA 3ZMDA 4II3A 3M1CA 2EK5A 3HSRA 5D8KB 2D5VA 1RC9A 2QSGX 3EBIA 2WZGA 3JR9A 3DV8A 4B1RA 2EPFA 1FOYA 4CO8A 1J75A 1WZ2A 2QVWA 4BH9A 4R1HA 1S29A 2BYVE 1QNTA 2DFHA 4ABZA 4A03A 2JCVA 3QODA 4ESJA 3WTXC 1P6RA 4A6EA 1FY7A 3PFYA 2K3PA 2NS0A 1TQIA 3V7SA 3A14A 2JWTA 3OYHA 5K7ZA 1DU6A 1Z3XA 4ZW6A 2RGVA 1HW1A 3GMEA 2P4WA 2XAGA 3HL2A 1LE8A 3BTIA 1JE8A 2LY9A 3HRSA 3N4MA 2FE3A 2O5RA 3GZNB 3VDXA 2XAUA 3I4NJ 1WSUA 2KMUA 1JG9A 2MLGA 3H5AA 2HR3A 5GPCA 2TCTA 1BOAA 4BQAA 1IAWA 4LGWA 2EFNA 2R7OA 1R49A 1RUNA 3H9GA 3MCZA 2LR8A 4Q47A 1UMQA 2MSYA 2Z1DA 1K61A 4GXOA 2FA5A 2M87A 4ASNA 3F8CA 3DPLC 3S15J 1MMNA 4DNCA 2VQLA 3ROUA 2IRFG 3ZN0A 3OS0A 4MEXF 1FYMA 4BXXJ 2ZFUA 1MJBA 2E71A 2KQRA 1ZAOA 4HX8A 3CD6I 2FOWA 2VLAA 1D1CA 1MW1A 2Y1GA 4BBRJ 3WODF 3LQQA 3SZGA 1R1VA 3Q0WA 2BY1A 3H0DA 4QMEA 3V8LA 3JRHA 4YIIA 5E20A 2WWYA 2VI6A 3ABKH 2PLYA 1XPXA 3ASNH 2M2EA 1A6QA 2ZC2A 2WV0A 1OCZH 1R36A 3QPSA 2BY2A 2DA3A 2PMUA 2DA5A 3UNGC 1Z05A 4A3FJ 4A3EJ 3BTCA 4W97A 1EKEA 5BPDA 3ZQFA 1NK3P 4XIDA 3GTKJ 3ABTA 4G8XA 1T8IA 3K4BA 3LSJA 1YW8A 3CJQB 4FX0A 4LMYA 5FFZA 2WAFA 3FU5A 2LY1A 2VBXA 4QHPA 2RAEA 5HS9A 3Q0UA 2FUG2 4G94A 2IAIA 4AWXB 1TL8A 2RKHA 4M3FA 4RMNA 4A6DA 4L0ZB 4ZYHA 3F8NA 5KNLA 4GO1A 1BN5A 2WC2A 3FKIJ 4HA8A 4P9FA 3H3ZA 1JKQC 3ERED 4XORA 3W6JB 3PIPF 3E7LA 3U9WA 2QQ8A 2ZJQF 5CJ9A 1WH7A 2QYOA 2VC1A 3AG4H 5LEKA 1E3PA 3FTUA 1YX3A 1O3RA 1HW5A 1Z91A 1NG6A 3BP8A 4FLOA 3B7TA 1DQUA 1FYKA 4AIDA 4C3IJ 5FLMJ 4EJOA 2OBPA 4IQ4A 2RJIA 5IPAA 1ON1A 4JBAA 4N4NB 3OR2C 3OOPA 2K86A 1PYVA 2Y75A 4BJ6C 1ZGAA 2O8XA 4A93J 2GOXB 4RM3A 3RKXA 4KT5C 4Z6YA 1FOWA 2CUZA 3CHQA 2COMA 4XKWA 3TO6A 3ZXSA 2LDUA 2HYGD 5JAZA 1KU7A 4XNDA 1SMYF 3G6EI 3M7GA 1LKXA 1ZKGA 3WQQA 4HV6A 4FE4A 2L4MA 4CCMA 2R7WA 3ANLA 2N8GA 3RYRA 1OCRH 4ZQTA 2G9WA 2FQ4A 4FETA 2HS5A 4DYCA 4ZYAA 3ONQA 2M4KA 4Y33A 4M6YA 3CUQB 5CPRB 3L2QA 4HEA2 2DW4A 4GYGA 1MMSA 1K78B 3Q9SA 2CU7A 2JN6A 4R79A 1OFCX 2DMPA 2PQ8A 3CMEI 3UKGA 1HOMA 1HDDC 1E0EA 4HAMA 2HDWA 2IGMA 2FNAA 4L2LA 1A6IA 1WJCA 4BQNA 4CGZA 2E1OA 2Y0SN 1LUJB 1VQOI 1XB4A 4KIGA 2R7RA 1GDTA 2DA1A 4G7OF 2GQQA 1TNTA 3FUNA 1MBKA 3NEUA 3HGGA 3UR3C 3B7UX 2VN2A 1HC8A 1B59A 2L9SA 1VQ6I 2XQ0A 2B61A 2QF7A 3QPLA 2Z3YA 5FGMA 4CCOA 4HF1A 3FKJA 4J01A 4RGRA 3EBHA 3OL4A 3R0AA 2XKPA 4DPRA 3B7SA 4XMVA 3ZMTA 2EA4A 5J4YA 3LAPA 4M74A 2DA4A 2L2OA 4IXAA 4S0HB 2P6SA 4CXFA 1GHCA 1USSA 3S1NJ 3DBRB 4NC8A 4BE0A 1MGTA 1JVSA 2K27A 3K1NA 5LRRA 4PW4A 5F0FA 2PG4A 4I7HA 1UZCA 4CICA 1D0YA 1IJWC 2DYRH 3HUGB 4KMFA 1KONA 2ME6A 2FBHA 4I99C 4CA0A 5TJJA 3FHNA 2QA4I 5JBIA 3HTUA 4KYWA 4QWQA 1TWGJ 1YI2I 5DS9A 4AC0A 2DN0A 3OYKA 3VYUB 4X6AJ 1V55H 3CUQA 1VFCA 2DT5A 3C3WA 4DBRA 4A3GJ 2HVQA 4A5MA 1K78A 1ZLKA 1ZR2A 2RQQA 3SZPA 2PMZA 4BE2A 4A3KJ 5EG0B 4I6ZA 2FOKA 3U21A 4XL9A 3ZRGA 4ZH4F 1Y6IA 4GAEA 3CZLA 5EF6A 5J40A 1QBJA 5GP9A 1Y1VJ 3OYGA 2HVSA 3I4MJ 3PNTA 4NQWB 1FTTA 2WZFA 2Z2SB 3CF2A 3OIOA 3LSPA 3WTUC 3IAS2 1P4AA 3L9FA 2P5LC 2OUMA 1D5YA 3FTVA 2QCOA 3G1MA 4MKTA 1JT0A 2M30A 1T98A 1RKTA 3FUMA 3RQIA 2ZXGA 1F4KA 1D1BA 2E1CA 1BR1A 1KU2A 2MFZA 4EVIA 1MNEA 2FX0A 1MMDA 1KU9A 3P9CA 4AIHA 5J8CA 4RBOA 4B43A 3U1DA 1R4MB 3F8MA 2JA7J 3C2HA 3TKYA 1AWCA 3S32A 1K7AA 1S8NA 5CYVA 1BL0A 1RETA 2VC0A 5FKMA 1YTYA 3AG2H 3PIOF 2QSHX 2VOPA 3KFWX 4KN7X 1H9TA 3RKQA 2LY2A 4B4CA 2COBA 4RGUA 3PL8A 4UXNA 4R7LA 1HSTA 4ZYDA 4UUVA 1DUXC 2ELKA 3VSLA 1TC3C 3FZVA 4L5JA 4ZX6A 1LFPA 2LRDA 3MWMA 3ELKA 3FMSA 3ZMVA 1MBJA 4NC6A 1OYIA 4OU0A 4RLFA 1ZS2A 5EG0A 2ID6A 3V4GA 5BNGA 3A1YA 1IF1A 3LMMA 3FXJA 3GX4X 1NK2P 1R23A 1YFHA 4MFDA 1MSEC 1R1TA 2GBYA 4CZZA 2GM4A 1IG7A 3TO9A 4S05A 4LOCA 4NQWA 4XN0A 2CQXA 3RKYA 2GOMA 2F4OB 2R7ZJ 2P0WA 4R5TA 5FRNA 3HXLA 1ONNA 1SAUA 1IV6A 1WWXA 1SFKA 2Q2EB 4N0BA 4C2TA 4IHVA 3S14J 1RP3A 3ANMA 1ONOA 5GAGJ 5J1RA 3LQRA 3PO2J 5IYBJ 5DYFA 6PAXA 4IEJA 3S16J 2P5VA 1ONPA 5JLXA 3EBGA 1X1BA 1FBQA 2DDBA 3E6BA 4CH7A 1O4XA 2C82A 2QQAA 4PFOA 2DQMA 2IA1A 3IAM2 2JMWA 3IWFA 4PJLA 4Y7NJ 4S04A 2Q8KA 3GXOA 4AYSA 4MEYF 3TOBA 2OA4A 3RIRA 2M7BA 2R7TA 4PVBA 2MC4A 3K4JA 4I09A 4L9JA 2DJIA 2ID3A 5F64A 1ENHA 3GW2A 3DPUA 3MZYA 2H8WA 2BGCA 3KP7A 1OCOH 1EH8A 3SHFA 3GTOJ 2XF7A 5D4RA 1ACIA 4MTEA 4EEFG 1D3YA 3I54A 3CXBA 4EJVA 3BCBA 4ZYEA 2FSWA 3EUAA 2HEOA 2XPZA 1YW9A 2M3AA 3M8JA 3ZI0A 2Y0MA 2Z9OA 2ACJA 2QSFX 3G1OA 2IA0A 4QPOA 4MFEA 5EJCA 5DYMA 1XGNA 1IUFA 4LK0F 3JTHA 5DD8A 2R0QC 2NVTJ 1E3HA 2DK8A 3FUFA 2B63J 2CUEA 4GAAA 1N25A 2ICWG 3IUOA 2Q2EA 4E6KG 4I02A 4GDFA 4BYYA 2DI3A 4XK4A 2FEZA 5JVTA 4BHCA 2W84A 1A04A 1ZRFA 3JCUC 3BJAA 4JX6A 1KQ8A 5LGTA 1IN8A 3W2WA 4XN3A 4YFKF 2Y69H 3V42A 3V8JA 1RNLA 4H4KC 4QTRA 2XAFA 1F43A 4Y17A 1WJDA 1KGSA 5B1BH 1OLTA 2V6CA 4B09A 1MD0A 3CLQA 5HLIA 2LSOA 2K9LA 1X1DA 2IS2A 3LSTA 2DQLA 3VYTB 1R5GA 2NS7A 2Z99A 4CYCB 2OZ6A 5CVIA 3BG9A 5LHGA 4X2UA 3I3LA 3ZQCA 2QUFA 2EZLA 4RAYA 2A6EF 5AENA 5D4SA 2LREA 4PDKA 3TDUC 4ZTFA 2FMYA 4G7ZF 4XMXA 4G9YA 4OINF 5EZGA 5JO0A 2IS6A 3UERA 2XAQA 1R5ID 3KLNA 5AIQA 3FXRA 3WTSC 2EGHA 3W6VA 5FB2A 2UUZA 2JPCA 2F4IA 2XGXA 4IHWA 3NAUA 4NNJA 2WB1A 1F36A 2XRNA 3PSIA 1EA3A 4AM3A 2A05A 2CYYA 1Z3YA 5TGTA 2KP6A 3OMYA 2VJJA 2EQRA 3FTZA 1O3QA 2KHMA 1UFMA 1ZTRA 4NB5A 4ENMA 2W24A 3HPGA 4UUTA 5L3CA 4NBQA 2DQ6A 2R7DA 1Z1DA 1YS7A 3KP5A 3NARA 1EH6A 2X0LA 1J7KA 1DDNA 3JT1A 2WTEA 1FOXA 2X6XA 2KJCA 1YX5A 1ORKA 3Q9VA 1IRFA 4FT8A 4K5OA 4AR1A 1KZHA 4E7SA 3HIFA 4XO3A 2A5YB 3MAJA 4OMYA 3HKZA 3T8TA 2BW3B 3HJEA 2V6EA 1XMKA 1VF9A 4CYCA 1HS6A 1X3WB 2J5OA 5BS6A 3K9TA 3J80Z 4JK1X 2KIFA 5JFRA 3OYMA 3RZDJ 3HRMA 1K5HA 4IOAF 5L3DA 3I55I 2PEXA 5L3GA 1IRGA 4UB8C 2M0MA 4HV5A 2QZ8A 3HHGA 2A3SA 2OF7A 3GZ5A 4HLXA 2OPTA 3CO6C 3PUUA 1VQ9I 1P7JA 1FP1D 1TNSA 2VT3A 4MGRA 4V19K 2OQRA 3W2VA 3CHPA 1UAAA 2EIKH 3HZJA 2KPMA 2X1EA 1SD5A 3J7AY 2A7OA 4WXHA 3B2PA 2ZNZA 1OR7A 3LFKA 1SVLA 3F6VA 3FDYA 3ZMUA 4HYEA 2WAEA 1XTAA 1U2WA 2LP0A 2WY8Q 4OMZA 1IDZA 3BTJA 3WGHA 1XCVA 2Y1FA 1T1SA 3IIEA 2BXZA 2JUCA 1VQLI 1Q0QA 2AQFA 5K5OA 1WVRA 2UV1A 3I5UA 4AR9A 2TDXA 1YRNB 1RPWA 2I8DA 1I1SA 3CDLA 3VFZA 1MW2A 5HS7A 3DU6A 3D5SC 1C0WA 3TDZC 2CQNA 2CWEA 5ERIA 4CZCA 4LIVA 1JI8A 1BI1A 5BMZA 3K2ZA 2KZGA 2VE9A 2BW3A 3HPHA 3S1QJ 2MH9A 3BG6A 1X3WA 2HQNA 1RESA 2DA2A 1U5TC 1TLHB 4ON0A 3WGIA 3WU1B 2RDPA 3CJNA 1T1RA 4ZQGA 2K7LA 2I10A 2KIUA 4JP0A 3CO7C 3BR5A 4HZFA 2LMDA 3CHSA 2XF6A 1PDNC 3HRTA 2AO9A 2NVUB 2EB7A 3I58A 2KISA 2YS9A 4M3EA 2AQEA 5LHHA 3W3CA 5F1JA 3SFZA 4B47A 5JVGF 3SQNA 5GAHJ 1A35A 1LVAA 1B1BA 3J7AO 3U2RA 4GGGA 4A0YA 4BY1J 3MKWB 4U0WA 4MLOA 3KEQA 5GPAA 3MZHA 5E18F 1QZZA 1Z7UA 1PUFB 1SC5A 4O3MA 2YR2A 3KYCB 2VBYA 1UHMA 1WJFA 3CQZJ 2KLOA 3I59B 3RQ4A 4Y52J 2XIGA 2Y9YA 1UJ8A 2WAQN 4ZW8A 3VEPA 2DT6A 4QSHA 3S17J 1VQKI 4IO9F 1YRNA 2ZXIA 3VYRB 2KT0A 2LD5A 3FM3A 2Y2ZA 3EUHA 2CV0A 1KYZA 3HW2A 3LWFA 3ZQHA 3A03A 4JX5A 4D7NA 3M8EA 4IPAA 1PP8F 3L1PA 3WTYC 3R0JA 3FTXA 1Z7LA 2K5CA 1FC3A 1GV2A 1FPQA 4M72A 2QM3A 4RVBA 2VXDA 3CZEA 3TGNA 3F8FA 1WFXA 3A02A 3Q0VA 3BQYA 1FX7A 1TBXA 4CCKA 2KJBA 3SFIA 2ZSIB 3OYLA 4IKFA 3LSHA 1T56A 3OIPA 2ZXHA 2GXAA 4EJWA 3QJXA 4XLEA 2X9DA 4G6TB 2KDZA 1T0FC 2K3FA 3CJRB 4M3GA 2JCXA 3Q3SA 5F27A 1PUFA 1U5TB 1X3UA 3ZHZA 3O6BB 3DLLF 2RC4A 1EJ9A 2HPOA 5FO5A 1TT5B 2MABA 2ZMEB 4F91B 2KFDA 3LA7A 1YIOA 4XRSA 2RREA 1OCCH 2ZSHB 2CFOA 2LKPA 2MW8A 4PJJA 1FIPA 5IOYA 3RI4A 5LD2C 3ERMA 1MH4A 1MMAA 3L2VA 1B4AA 3RPUA 2XPYA 2BVMA 3B02A 3B6CA 2M45A 5E8GA 1YJNI 2V9KA 2DU9A 1WCMJ 4Z2YA 1R0LA 1IGNA 1WGXA 1DU0A 3OSGA 3CHRA 2EH3A 1IW7F 4J3BA 1VQPI 2QWWA 1BC8C 3GLXA 4XOTA 1SFUA 3CF5F 2QLZA 1QHGA 3R4KA 4YRVA 3JRAA 5B66C 3T8VA 2E7WA 4ZW7A 3BG5A 3IH4A 3AL0C 4XLPF 1MW3A 4M71A 1FEXA 3CLOA 1ZH5A 4YG2F 2JA6J 5F04A 4Y6RA 4DBQA 3LA3A 1T95A 5H2FC 2E2JJ 4XMWA 5GTIC 1XX5A 5M3FJ 1ZELA 4WXCA 2F48A 5D5UB 4Y67A 2L0KA 2E19A 3F9KA 1T33A 1FMVA 3P5JA 1SD6A 3PSFA 1U5TA 3RTRA 3K70C 2C6YA 4A0ZA 5EDNA 1D8JA 2E1MC 3GWZA 3HGYA 2FF4A 4ZYGA 1GXPA 1W36C 2BHYA 2WAQA 2VQGA 2ZMEA 3V8KA 1K79A 1I27A 3HSEA 1ZREA 2VQCA 2IS4A 3DBLB 1A5JA 3TEDA 3BZCA 2OTJI 1GLNA 2QKLB 4ZX4A 3UCQA 2CQ7A 2HDDA 3G4SI 4ZQHA 1RRJA 1VI0A 2CMPA 2JRTA 3BWGA 2EIJH 4UNOA 2HTJA 1A31A 1ZG3A 2PMZN 3GFIA 2W82A 1B9NA 3JRCA 3SJMA 2GA1A 5CVVA 2L9VA 4HX7A 5D6FA 3NWSA 3AG1H 2KRFA 1IXSB 2K9NA 5KVRA 1BI0A 2XGDA 2HTSA 3KEYA 2H27A 2LVSA 1ZGJA 3VVMA 3BC8A
chains in the Genus database with same CATH topology
2EBIA 3SDGA 2HOSA 3B34A 2HOAA 4DZPA 1BL0A 1RETA 5FKMA 2R59A 2FFLA 4ZQFA 3R0IA 3RKQA 3FUDA 1QPIA 4B4CA 2COBA 2DTZA 2IBDA 4R7LA 2JA8J 3ZHYA 4QIRA 1POGA 4X1EA 3A01B 2ELKA 5E3NA 1TC3C 2O7OA 3CZGA 3WQRA 1MH3A 4ZN6A 4ZX6A 3HOZJ 5JC1A 5FKLA 1MBJA 4B3AA 4DZJA 1ZS2A 2CRGA 5EG0A 2ID6A 3JREA 5BNGA 4BY7J 4XN7A 3ZHXA 2O9LA 3JRBA 3OSFA 4XRMA 1NK2P 1W0UA 5HNHA 5M5XJ 1X3ZA 4MFDA 1MSEC 2GBYA 4G12A 2GM4A 1IG7A 1IRZA 4FE7A 2VJ8A 4LOCA 4NQWA 2CQXA 2R7ZJ 3HOUJ 2R92J 4UUSB 2ECBA 4R5TA 4XNAA 2X48A 5M5YJ 5JLWA 1ONNA 2Y9ZA 1BW6A 1IV6A 5FLVA 1SQMA 5FKKA 3BT9A 1RP3A 3S14J 4PU2A 1QVUA 4IHVA 3ANMA 4ZX3A 1AKHB 1ONOA 3T0YA 3HB9A 1U78A 3HOWJ 5J1RA 3AU9A 3PO2J 5IYBJ 2R70A 4K5NA 5DYFA 2H8RA 2ZB9A 1W0TA 4IEJA 3S16J 4JNDA 2HOTA 2JJ7A 2DMUA 1ONPA 2LKXA 3B37A 5JLXA 4FISA 3EBGA 5J1UA 1S7EA 3H0GJ 4XMZA 1O4XA 2YUSA 2C82A 2CJJA 2DQMA 3Q43A 2JMWA 4XICA 4Y7NJ 4A3CJ 3FIWA 4XO5A 4AYSA 4LUPA 5DTDA 1AU7A 1TWFJ 4A3IJ 1Z0XA 3GBGA 2DA6A 1ETVA 4PVBA 2ID3A 4DYRA 3A01A 1ENHA 3GTMJ 3GTPJ 2PL5A 1H88C 4XO4A 3S1RJ 2XPUA 1GT0C 4Y6SA 3IH2A 1WPKA 2CQQA 2P81A 3GTOJ 3K7AJ 3LOCA 2PGGA 4EEFG 4XN4A 5BPPA 2EZKA 3HBLA 2LTPA 1FTZA 2XPZA 1IC8A 1XG1A 4Y6PA 4C3HJ 2H1KA 3ZI0A 1FJLA 2Y30A 4GFBA 3G1OA 3JRDA 3B2XA 4MFEA 1BA5A 4AUXA 1G5AA 2Y1EA 4QUOA 1IUFA 4FLRA 4JX4A 4UUSA 2R0QC 2NVTJ 3JRFA 3FUFA 2DMTA 2B63J 4IHXA 2CUEA 1I6HJ 4GAAA 2ECCA 3Q44A 3DEWA 3IH3A 5FWQA 3UEQA 1AKHA 1HLVA 5E3LA 3HEFA 4XK4A 3LSRA 4XN1A 2HXOA 1U9OA 1UG2A 2O8KA 3CIAA 4BBSJ 2DMNA 4ZW3A 1S46A 4JX6A 3FUKA 3B3BA 1WH5A 5EYRA 2G0EA 3GTQJ 1ETYA 1MBEA 4XMUA 4AICA 4QTRA 4A3LJ 2K9SA 1Q0LA 3M4OJ 5DULA 3JRGA 1F43A 3BR2A 1ZR4A 1JGGA 5C44J 1NTCA 3PM1A 2VKEA 1H89C 1JKOC 1UHSA 3FU6A 4QPEA 4XN2A 1QRYA 3MVPA 4XRSG 3H3VK 4OOFA 3FK6A 3BTLA 2NS7A 4DYQA 4CYCB 3JRIA 1HF0A 3TW7A 3FUEA 3BR0A 3BG9A 3O8HA 4X2UA 3ZQCA 2EZLA 2XPWA 4M3DA 3ZOBA 2NOGA 5AENA 4A3MJ 1ZK8A 2LK2A 3CZKA 3ANNA 4V2FA 4Q4EA 4MS6A 4XN9A 5K7HA 1LE8B 4BKXA 1JTYA 2K9QA 4XMXA 5EZGA 5JO0A 3UERA 1H19A 3GTLJ 2MAPA 2NVQJ 5M5WJ 1TWCJ 3HDDA 2EGHA 4L5EA 1JJ6C 1JKRC 3W6VA 3LNQA 4IHWA 3HOXJ 3BQZA 1QVTA 3NAUA 1HOMA 1F36A 4AYBN 5E3MA 5J3LA 2DMQA 5FKNA 1E3OC 4K5LA 5EZHA 3RC8A 1HDPA 2EQRA 3FTZA 3MKLA 4C2MJ 2L7MP 1ZTRA 2DQ6A 4UUTA 1BW5A 3FUJA 2JD0A 3JT1A 3NARA 3FUHA 2WV1A 2XSDC 4NDLA 2VUMJ 3TP0A 1ORKA 2R5ZB 1XC5A 2WB1N 4K5OA 5FJ8J 4AR1A 2D5VA 1APLC 2M0CA 2IEKA 4XO3A 3EBIA 5IYCJ 3JR9A 2MGQA 4B1RA 2WZGA 5IP7J 3FU0A 1VF9A 4CYCA 2QVWA 1HS6A 2YU9J 5HNFA 4A03A 4ABZA 1ETKA 2JCVA 3RZDJ 3FHEA 5JMPA 4D7MA 1K5HA 2GLOA 4K5PA 3FISA 3A14A 1R9TJ 2JWTA 2E2IJ 3FUIA 5K7ZA 1DU6A 4ZW6A 2XB5A 1LE8A 4FCAA 1X58A 3BTIA 2C5ZA 2LY9A 2HQ5A 2OF7A 2OPTA 2TRTA 1OCTC 1P7IA 3PUUA 1K83J 1P7JA 1B8IB 1ETWA 2CUFA 3I4NJ 1JUPA 3D1NI 3S1MJ 3HKZN 1JG9A 3FH5A 3CHPA 5J1YA 4A3JJ 3ZQLA 2M9HA 2JV7A 5GPCA 3FTYA 3BR1A 2TCTA 3FTSA 2A7OA 5IP9J 3B2PA 1MBHA 1OR7A 1Z77A 2LP0A 4I76A 1IDZA 2LR8A 3BTJA 3FH8A 2Y1FA 1MBGA 2HI3A 3QQAA 1T1SA 3IIEA 2R93J 1UMQA 3RZOJ 2MSYA 4V2GA 3PO3J 1Q0QA 1K61A 2O7GA 3CCYA 2WPGA 3HM5A 4AR9A 1YRNB 3RASA 1RPWA 3S15J 3CDLA 4BXXJ 1MW2A 2R5ZA 4FTHA 2K40A 1JGIA 4MIMA 1JTXA 1Y1WJ 5EV7A 1SANA 2VLAA 1R0KA 1MW1A 2Y1GA 4BBRJ 2ME0A 9ANTA 2M8GX 2Y31A 3Q0WA 1RKWA 3S1QJ 4QMEA 1MW0A 3FULA 2DJNA 3JRHA 3FU3A 1X3WA 4D5CA 1RESA 2DA2A 2VI6A 1MSFC 5F0HA 2M2EA 3RC3A 1T1RA 1MBFA 3QPSA 4J19A 4ZQGA 2I10A 4JP0A 1GVDA 2DA3A 3K2AA 2DA5A 4A3FJ 3BR5A 5K7FA 3BTCA 4W97A 5HODA 4A3EJ 3ZQFA 2X6OA 5EEAA 4XIDA 1NK3P 3GTKJ 3CHSA 1WI3A 2AO9A 3LSJA 3FU5A 2JD1A 3VPRA 2DA7A 2YS9A 1JJ8C 5HLTA 4QHPA 4M3EA 1B8IA 2RAEA 2EZHA 2MAOA 3HOVJ 5F1JA 5C4JJ 3Q0UA 1LFUP 2IAIA 4M3FA 2NVYJ 5F08A 4BY1J 4MLOA 2LFBA 5GPAA 2JA5J 3FKIJ 2PUSA 3FTWA 3OOUA 1GV5A 1PUFB 3WHBA 1JKQC 1SC5A 3E7LA 3U9WA 1ETXA 4RDUA 5EGOB 3TP3A 1XS9A 2GTQA 3CQZJ 3IV5A 1WH7A 4Y52J 4DW6A 2Y9YA 1TWAJ 2WAQN 1MVYA 1GW6A 4ZW8A 2QJ1A 1X2MA 3FTUA 1MNMC 4QSHA 3S17J 1FIAA 1YRNA 1HCRA 4FLOA 2HXIA 1ZQ3P 2KT0A 1VNDA 2LD5A 3B7TA 5DLLA 2XGCA 3BR6A 4C3IJ 2Y2ZA 5FLMJ 1EF4A 2RJIA 5IPAA 4ZQEA 4RCVA 3ZQHA 2JK3A 4A93J 3A03A 4JX5A 4D7NA 5FKOA 4A3DJ 4KP7A 1JUSA 2NVXJ 1U8BA 4Q4IA 1U9NA 1X2NA 1OCPA 3WQSB 3L1PA 2VPRA 1I3QJ 3MN2A 3FK7A 3CHQA 3FTXA 2XRLA 1GV2A 2JD2A 5JAZA 1BJZA 4XNDA 3ZQIA 4RVBA 3CZEA 2FJ1A 3Q0VA 1ZKGA 3A02A 1SG7A 3WQQA 3BQYA 3F0CA 4FE4A 2XB0X 1G2HA 3ANLA 2N8GA 2W48A 1I50J 4ZQTA 4M3BA 2FQ4A 3SFIA 2EZIA 4DYCA 3CMYA 1T56A 1H3LA 3AU8A 3QJXA 2X9DA 2KDZA 2L7ZA 4M3GA 2JCXA 1SFOJ 2M34A 2CU7A 2JN6A 2R5YB 1OFCX 2DMPA 5IP6A 3Q3SA 3UKGA 5F27A 2L9RA 1CQTA 1HDDC 3HOYJ 1PUFA 4XN5A 5IYDJ 4C3JJ 3ZHZA 2HPOA 4D5FA 2Y1CA 1A6IA 4L2LA 5EGOA 5M3MJ 1ETOA 2E1OA 3JSZA 2MG4A 4FLSA 2Y0SN 5IOZA 5F0CA 4XRSA 4ARFA 1GDTA 2DA1A 3GTGJ 2MW8A 1RR7A 5C4XJ 4A3BJ 3ZQGA 3FUNA 1FIPA 5IOYA 1MBKA 3GTJJ 3HGGA 1MH4A 2L7FP 4M6VA 3B7UX 4ZW5A 2XPYA 2XQ0A 2B61A 3B6CA 2QF7A 3QPLA 4FCYA 3B7RL 3CHOA 3EBHA 1JT6A 1WCMJ 1R0LA 1IGNA 1WGXA 1DU0A 4DPRA 4A69C 3OSGA 2JCYA 3B7SA 1JUMA 4XMVA 2DA4A 4S0HB 4XNBA 3CHRA 2EH3A 1B72B 4J3BA 1LFBA 1JKPC 4CXFA 1ETQA 3S1NJ 3LSGA 2LLKA 3DCFA 1JVSA 4PW4A 3T8VA 3JRAA 5F0FA 3C2BA 4ZW7A 2E2HJ 3BG5A 3IH4A 1ZGWA 4XMTA 1MW3A 1FEXA 1IDYA 1IJWC 2JA6J 2R72A 5F04A 4Y6RA 4XN8A 2ME6A 1OJLA 4ZX5A 4AR8A 5JBIA 2E2JJ 4XMWA 1TWGJ 2AHQA 4JYKA 5DS9A 4AC0A 5M3FJ 2DN0A 4X6AJ 3AUAA 4QIWN 1VFCA 4A3GJ 5E3OA 2L0KA 1H8AC 1ZR2A 4Y67A 1Q1VA 2VKVA 5EG0B 2R5YA 4A3KJ 3A06A 2E19A 4IHYA 1T33A 4I6ZA 2HYJA 1Q0HA 5EDNA 3HGYA 4GAEA 5JMWA 3CZLA 5EF6A 3S2DJ 4HNVA 5GP9A 1Y1VJ 4RSYA 3I4MJ 1FTTA 2WZFA 5JNLA 5C3EJ 2XPVA 2XGEA 3VVLA 3OIOA 4W1UA 3LSPA 3M3YJ 3FH7A 1A5JA 3TEDA 1D5YA 3BR3A 3TW6A 3FTVA 4K5MA 4ZX4A 2QCOA 3G1MA 3UCQA 2HDDA 4MKTA 4ZQHA 1JT0A 1VI0A 3B6AA 2FD5A 1RKTA 2PMZN 1AHDP 4FLQA 3FUMA 3RQIA 4R5VA 2ZXGA 3KEDA 3JRCA 3BG3A 3SJMA 2NS8A 3O8GA 2Y1DA 4OOEA 3WHCA 2FX0A 2HPTA 1GUUA 2K9NA 2XGDA 1TWHJ 4MO7A 4RBOA 1B72A 3G1LA 1ITYA 3VVMA 2LVSA 4R5XA 2JA7J 3S2HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBI A;  3SDG A;  2HOS A;  2HOA A;  4DZP A;  1BL0 A;  1RET A;  5FKM A;  3RKQ A;  1QPI A;  4B4C A;  2COB A;  2DTZ A;  2IBD A;  2JA8 J;  1POG A;  4X1E A;  3A01 B;  2ELK A;  5E3N A;  1TC3 C;  2O7O A;  1MH3 A;  3HOZ J;  5FKL A;  1MBJ A;  4B3A A;  4DZJ A;  2CRG A;  5EG0 A;  2ID6 A;  3JRE A;  5BNG A;  4BY7 J;  2O9L A;  3JRB A;  3OSF A;  4XRM A;  1NK2 P;  1W0U A;  5M5X J;  4MFD A;  1MSE C;  2GBY A;  4G12 A;  2GM4 A;  1IG7 A;  1IRZ A;  4FE7 A;  4LOC A;  2CQX A;  2R7Z J;  3HOU J;  2R92 J;  4UUS B;  2ECB A;  2X48 A;  5M5Y J;  5JLW A;  2Y9Z A;  1BW6 A;  1IV6 A;  5FLV A;  5FKK A;  3BT9 A;  3S14 J;  1QVU A;  4IHV A;  1AKH B;  3HB9 A;  1U78 A;  3HOW J;  5J1R A;  3PO2 J;  5IYB J;  2H8R A;  2ZB9 A;  1W0T A;  4IEJ A;  3S16 J;  2HOT A;  2JJ7 A;  2DMU A;  2LKX A;  5JLX A;  4FIS A;  5J1U A;  1S7E A;  3H0G J;  1O4X A;  2YUS A;  2CJJ A;  2JMW A;  4XIC A;  4Y7N J;  4A3C J;  3FIW A;  5DTD A;  1AU7 A;  1TWF J;  4A3I J;  1Z0X A;  3GBG A;  2DA6 A;  1ETV A;  2ID3 A;  4DYR A;  3A01 A;  1ENH A;  3GTM J;  3GTP J;  1H88 C;  3S1R J;  2XPU A;  1GT0 C;  3IH2 A;  1WPK A;  2CQQ A;  2P81 A;  3GTO J;  3K7A J;  3LOC A;  4EEF G;  2EZK A;  3HBL A;  2LTP A;  1FTZ A;  1IC8 A;  1XG1 A;  4C3H J;  2H1K A;  1FJL A;  2Y30 A;  4GFB A;  3G1O A;  3JRD A;  4MFE A;  1BA5 A;  4AUX A;  1IUF A;  4JX4 A;  4UUS A;  2R0Q C;  2NVT J;  3JRF A;  2DMT A;  2B63 J;  4IHX A;  2CUE A;  1I6H J;  2ECC A;  3DEW A;  3IH3 A;  1AKH A;  1HLV A;  5E3L A;  3HEF A;  4XK4 A;  3LSR A;  2HXO A;  1U9O A;  1UG2 A;  2O8K A;  4BBS J;  2DMN A;  4JX6 A;  1WH5 A;  5EYR A;  2G0E A;  3GTQ J;  1ETY A;  1MBE A;  4QTR A;  4A3L J;  2K9S A;  3M4O J;  3JRG A;  1F43 A;  3BR2 A;  1ZR4 A;  1JGG A;  5C44 J;  1NTC A;  3PM1 A;  2VKE A;  1H89 C;  1JKO C;  1UHS A;  1QRY A;  3MVP A;  4XRS G;  3H3V K;  3FK6 A;  3BTL A;  2NS7 A;  4DYQ A;  4CYC B;  3JRI A;  1HF0 A;  3TW7 A;  3BR0 A;  3BG9 A;  3O8H A;  3ZQC A;  2EZL A;  2XPW A;  4M3D A;  3ZOB A;  2NOG A;  4A3M J;  1ZK8 A;  2LK2 A;  4V2F A;  5K7H A;  1LE8 B;  4BKX A;  1JTY A;  2K9Q A;  5EZG A;  3GTL J;  2NVQ J;  5M5W J;  1TWC J;  3HDD A;  4L5E A;  1JJ6 C;  1JKR C;  3W6V A;  3LNQ A;  4IHW A;  3HOX J;  3BQZ A;  1QVT A;  3NAU A;  1HOM A;  1F36 A;  4AYB N;  5E3M A;  5J3L A;  2DMQ A;  5FKN A;  1E3O C;  5EZH A;  1HDP A;  2EQR A;  3MKL A;  4C2M J;  2L7M P;  1ZTR A;  4UUT A;  1BW5 A;  3NAR A;  2WV1 A;  2XSD C;  4NDL A;  2VUM J;  3TP0 A;  1ORK A;  2R5Z B;  1XC5 A;  2WB1 N;  5FJ8 J;  2D5V A;  1APL C;  2M0C A;  2IEK A;  5IYC J;  3JR9 A;  2MGQ A;  4B1R A;  5IP7 J;  1VF9 A;  4CYC A;  2YU9 J;  4ABZ A;  1ETK A;  3RZD J;  4D7M A;  2GLO A;  3FIS A;  1R9T J;  2JWT A;  2E2I J;  5K7Z A;  1DU6 A;  2XB5 A;  1LE8 A;  1X58 A;  3BTI A;  2LY9 A;  2HQ5 A;  2OF7 A;  2OPT A;  2TRT A;  1OCT C;  1P7I A;  1K83 J;  1P7J A;  1B8I B;  1ETW A;  2CUF A;  3I4N J;  1JUP A;  3D1N I;  3S1M J;  3HKZ N;  5J1Y A;  4A3J J;  3ZQL A;  2M9H A;  5GPC A;  3BR1 A;  2TCT A;  5IP9 J;  1MBH A;  1Z77 A;  2LP0 A;  4I76 A;  1IDZ A;  2LR8 A;  3BTJ A;  1MBG A;  2HI3 A;  3QQA A;  2R93 J;  1UMQ A;  3RZO J;  2MSY A;  4V2G A;  3PO3 J;  1K61 A;  3CCY A;  3HM5 A;  1YRN B;  1RPW A;  3S15 J;  3CDL A;  4BXX J;  2R5Z A;  4FTH A;  2K40 A;  4MIM A;  1JTX A;  1Y1W J;  1SAN A;  4BBR J;  2ME0 A;  9ANT A;  2M8G X;  2Y31 A;  3Q0W A;  1RKW A;  3S1Q J;  2DJN A;  3JRH A;  4D5C A;  1RES A;  2DA2 A;  2VI6 A;  1MSF C;  5F0H A;  2M2E A;  1MBF A;  3QPS A;  4J19 A;  2I10 A;  4JP0 A;  1GVD A;  2DA3 A;  3K2A A;  2DA5 A;  4A3F J;  3BR5 A;  5K7F A;  3BTC A;  4W97 A;  5HOD A;  4A3E J;  3ZQF A;  2X6O A;  5EEA A;  4XID A;  1NK3 P;  3GTK J;  1WI3 A;  2AO9 A;  3LSJ A;  3VPR A;  2DA7 A;  2YS9 A;  1JJ8 C;  4M3E A;  1B8I A;  2RAE A;  2EZH A;  3HOV J;  5F1J A;  5C4J J;  3Q0U A;  1LFU P;  2IAI A;  4M3F A;  2NVY J;  5F08 A;  4BY1 J;  4MLO A;  2LFB A;  5GPA A;  2JA5 J;  3FKI J;  3OOU A;  1GV5 A;  1PUF B;  3WHB A;  1JKQ C;  3E7L A;  1ETX A;  4RDU A;  5EGO B;  3TP3 A;  1XS9 A;  3CQZ J;  3IV5 A;  1WH7 A;  4Y52 J;  4DW6 A;  2Y9Y A;  1TWA J;  2WAQ N;  1X2M A;  1MNM C;  4QSH A;  3S17 J;  1FIA A;  1YRN A;  1HCR A;  2HXI A;  1ZQ3 P;  2KT0 A;  1VND A;  2LD5 A;  2XGC A;  3BR6 A;  4C3I J;  2Y2Z A;  5FLM J;  1EF4 A;  5IPA A;  3ZQH A;  2JK3 A;  4A93 J;  3A03 A;  4JX5 A;  4D7N A;  5FKO A;  4A3D J;  1JUS A;  2NVX J;  1U8B A;  1U9N A;  1X2N A;  1OCP A;  3L1P A;  2VPR A;  1I3Q J;  3MN2 A;  3FK7 A;  2XRL A;  1GV2 A;  1BJZ A;  3ZQI A;  2FJ1 A;  3Q0V A;  1ZKG A;  3A02 A;  3BQY A;  3F0C A;  4FE4 A;  2XB0 X;  1G2H A;  2N8G A;  2W48 A;  1I50 J;  4M3B A;  2FQ4 A;  3SFI A;  2EZI A;  4DYC A;  3CMY A;  1T56 A;  2X9D A;  2KDZ A;  2L7Z A;  4M3G A;  1SFO J;  2M34 A;  2CU7 A;  2JN6 A;  2R5Y B;  1OFC X;  2DMP A;  5IP6 A;  3Q3S A;  3UKG A;  5F27 A;  2L9R A;  1CQT A;  1HDD C;  3HOY J;  1PUF A;  5IYD J;  4C3J J;  4D5F A;  1A6I A;  5EGO A;  5M3M J;  1ETO A;  2E1O A;  2MG4 A;  2Y0S N;  5IOZ A;  5F0C A;  4XRS A;  1GDT A;  2DA1 A;  3GTG J;  2MW8 A;  1RR7 A;  5C4X J;  4A3B J;  3ZQG A;  1FIP A;  5IOY A;  1MBK A;  3GTJ J;  3HGG A;  1MH4 A;  2L7F P;  4M6V A;  3B6C A;  2QF7 A;  3QPL A;  4FCY A;  1JT6 A;  1WCM J;  1IGN A;  1WGX A;  1DU0 A;  4A69 C;  3OSG A;  1JUM A;  2DA4 A;  4S0H B;  2EH3 A;  1B72 B;  1LFB A;  1JKP C;  1ETQ A;  3S1N J;  3LSG A;  2LLK A;  3DCF A;  3JRA A;  5F0F A;  3C2B A;  2E2H J;  3BG5 A;  3IH4 A;  1ZGW A;  1FEX A;  1IDY A;  1IJW C;  2JA6 J;  5F04 A;  2ME6 A;  1OJL A;  2E2J J;  1TWG J;  2AHQ A;  4JYK A;  5DS9 A;  4AC0 A;  5M3F J;  2DN0 A;  4X6A J;  4QIW N;  1VFC A;  4A3G J;  5E3O A;  2L0K A;  1H8A C;  1ZR2 A;  1Q1V A;  2VKV A;  5EG0 B;  2R5Y A;  4A3K J;  2E19 A;  4IHY A;  1T33 A;  4I6Z A;  2HYJ A;  5EDN A;  3HGY A;  5EF6 A;  3S2D J;  4HNV A;  5GP9 A;  1Y1V J;  3I4M J;  1FTT A;  5C3E J;  2XPV A;  2XGE A;  3OIO A;  4W1U A;  3LSP A;  3M3Y J;  1A5J A;  3TED A;  1D5Y A;  3BR3 A;  3TW6 A;  2QCO A;  3G1M A;  2HDD A;  1JT0 A;  1VI0 A;  3B6A A;  2FD5 A;  1RKT A;  2PMZ N;  1AHD P;  3RQI A;  3JRC A;  3BG3 A;  3SJM A;  2NS8 A;  3O8G A;  3WHC A;  2FX0 A;  1GUU A;  2K9N A;  2XGD A;  1TWH J;  4MO7 A;  4RBO A;  1B72 A;  3G1L A;  1ITY A;  2LVS A;  2JA7 J;  3S2H J; 
#chains in the Genus database with same CATH topology
 4IHT A;  1W7P B;  1DGR M;  4UV9 A;  3B34 A;  2HQA A;  2HOA A;  2W00 A;  4DZP A;  1S7O A;  5JHU A;  3KET A;  3QAH A;  3QYB A;  3K4M A;  1IN7 A;  3R0I A;  5E1X A;  3OWT A;  4EM1 A;  1QPI A;  1SD7 A;  4RB2 C;  2FNP A;  1POG A;  3TBI A;  3CZG A;  2W4S A;  3WQR A;  2V26 A;  4ZN6 A;  3HOZ J;  1UHW A;  2B0L A;  4UB6 C;  3K4N A;  1S6L A;  5FKL A;  3J80 K;  3HRU A;  4PZJ A;  4B3A A;  1P4X A;  3M1E A;  1J09 A;  2CRG A;  2M8E A;  2L02 A;  5IT9 Z;  1LDD A;  4BY7 J;  2O9L A;  1W0U A;  1B9M A;  3LA2 A;  1G3Y A;  4BJ5 C;  2EFO A;  4G7H F;  2D1V A;  3JW4 A;  2G7U A;  3J7Y J;  3HOU J;  4K2E A;  3DEE A;  2XF5 A;  4U87 A;  5M5Y J;  5JLW A;  3GFL A;  1GXQ A;  1SQM A;  3BT9 A;  3H36 A;  3E6C C;  1QVU A;  2HKO A;  2JSC A;  4RB0 A;  1NG7 A;  3CCR I;  3AU9 A;  2GAU A;  3AAF A;  3BDD A;  2H8R A;  2P7V B;  1T39 A;  1J2X A;  2VPL A;  2QQB A;  2LH9 A;  4XM3 A;  4HW0 A;  5J1U A;  1S7E A;  2VKD A;  2RNJ A;  3CC7 I;  2E1M B;  2L54 A;  4XMZ A;  3ZMZ A;  2L01 A;  2CW7 A;  1W7P A;  3FIW A;  2OCE A;  3K0L A;  2ZJR F;  4KNY A;  3WU2 C;  3GYH X;  4KN4 X;  2MC3 A;  1IXR C;  3JTG A;  1FMW A;  3LFU A;  1W1W E;  2BY0 A;  4CYD A;  1SVO A;  1H88 C;  4XO4 A;  3IC7 A;  4QLC U;  4BHB A;  1ZG5 A;  2IGN A;  4IVN A;  2L4A A;  3K6G A;  2PGG A;  4XN4 A;  4MHG A;  2HVR A;  3HBL A;  5ICF A;  2O03 A;  3EYY A;  1XG1 A;  2H1K A;  1FJL A;  4GFB A;  3B2X A;  5CVR A;  2X51 A;  4WCG A;  4ITV A;  1G5A A;  4QUO A;  3CJT B;  4FLR A;  4ESF A;  4L18 B;  3S3M A;  3RPU D;  3H35 A;  3PQK A;  2ISZ A;  1I6H J;  2ECC A;  3Q44 A;  3DEW A;  4PSW A;  3UEQ A;  5TIS C;  3SZT A;  1HLV A;  2HXO A;  2IVM A;  1U9O A;  3CIA A;  5HLG A;  4B44 A;  3KCC A;  1LEA A;  1MND A;  2NOJ B;  1MMG A;  3B3B A;  3CCJ I;  3AG3 H;  2BEO A;  4N9H A;  2GZW A;  1H9G A;  4XMU A;  2VOO A;  3MEX A;  3K69 A;  1FSE A;  5GTH C;  4EAT A;  2HPM A;  4P96 A;  1ZRC A;  5C44 J;  3ZR8 X;  5A2Q Z;  3VOE A;  3A0B C;  3A4C A;  1H89 C;  4M9X A;  4QPE A;  3L7W A;  2BY3 A;  3RPQ A;  1FT9 A;  1NHA A;  2F4M B;  3PQJ A;  2RV8 A;  5IT3 A;  1HF0 A;  2OTL I;  3FUE A;  3ZMS A;  2Q0O A;  2XSJ C;  4M3D A;  3PJR A;  4HOB A;  2NOG A;  3KP6 A;  2UZK A;  1ZK8 A;  4HG2 A;  2ISY A;  1LB2 A;  2PFB A;  3CMM A;  2XDV A;  4V2F A;  3J81 K;  2CFX A;  1FZP B;  1JTY A;  2HNH A;  1D0X A;  2K9Q A;  3HUG A;  2X6Y A;  3DTI A;  2DFI A;  4AU7 A;  1ZN2 A;  1K4S A;  2NVQ J;  5EEG A;  3CCU I;  1T38 A;  2OU2 A;  2X1C A;  5KCM A;  4YIF A;  2R7U A;  4WWC A;  3BQZ A;  1HA8 A;  4AYB N;  2VOD A;  1R22 A;  1BBY A;  2VQH A;  4PK4 A;  1UEL B;  3KPH A;  3HOT A;  2ZJ2 A;  2V1D A;  2IGO A;  2DYS H;  3PFI A;  5K5Q A;  1LEB A;  5EZH A;  3RC8 A;  4LLL A;  1R00 A;  2KKO A;  2IW5 A;  2EWN A;  2F2E A;  4PSX A;  1PUE E;  5ILU A;  4XLF A;  3FUH A;  3DTK A;  2WV1 A;  4NC7 A;  2VUM J;  4I98 B;  5HVQ C;  1XC5 A;  1E2X A;  2VT2 A;  2WB1 N;  2NXN B;  1BR4 A;  3LSM A;  1APL C;  1YJW I;  1RI7 A;  2M0C A;  3O2P E;  3FU0 A;  1L3L A;  2YU9 J;  1PVE A;  1V5E A;  4AVZ A;  5DCF A;  3U1K A;  1K6Y A;  2XAH A;  2VIX A;  4D7M A;  2R7S A;  4OIR F;  2JA2 A;  4K5P A;  3FIS A;  4P5O A;  1XGM A;  1R9T J;  4U0V A;  3VSK A;  3FUI A;  2F5F A;  1Y0N A;  3WG9 A;  5D5W B;  3M07 A;  3CCS I;  1X58 A;  2C5Z A;  3FXQ A;  1KU3 A;  3V7R A;  1G3W A;  1OCT C;  4R5X A;  4D1Q A;  2QEN A;  3BZK A;  1B8I B;  4RLQ A;  1ETW A;  2CUF A;  1JUP A;  2DAO A;  1TTY A;  2FBK A;  2VE8 A;  3HKZ N;  5F6F A;  5J1Y A;  4A3J J;  3ZQL A;  1BC7 C;  2E5N A;  2JV7 A;  3FH5 A;  3DKW A;  3BR1 A;  2XAS A;  1MJA A;  2DO7 A;  3KZZ A;  3HSF A;  5IP9 J;  4PJM A;  3ABU A;  5FRO A;  1PP7 U;  4ENK A;  1Z77 A;  4LLG F;  2IJL A;  3GUD A;  1Z6T A;  3OYJ A;  4CHU A;  3FH8 A;  3LSK A;  2IS1 A;  1WHU A;  1Z6R A;  1MBG A;  3QQA A;  4IJA A;  5ICG A;  2R93 J;  4V2G A;  3PO3 J;  4Y15 A;  4X0G A;  3CCY A;  1W7P D;  2CO5 A;  3RCO A;  3RSN A;  3COA C;  2WPG A;  2V9P A;  1BIA A;  2ZJP F;  2A69 F;  2A6T A;  1D8K A;  2HPI A;  3ZGK A;  3BLY A;  3GCM A;  2CV1 A;  4FTH A;  2K40 A;  5LHI A;  1JTX A;  1Y1W J;  3I53 A;  1SAN A;  5DCM B;  1YIJ I;  1R0K A;  2UXN A;  2VJI A;  9ANT A;  2DPD A;  1O57 A;  1MW0 A;  3FUL A;  1MSF C;  3WTW C;  3CCE I;  3RJP A;  3CDH A;  1DPU A;  2IP2 A;  3RC3 A;  1MBF A;  1F1Z A;  3MFK A;  3D0S A;  2KIM A;  3C18 A;  1S9H A;  4Y13 A;  5HOD A;  2GTQ A;  3BPX A;  1FP2 A;  2JZY A;  2L3D A;  2X6O A;  5EEA A;  3FBI B;  2PBI A;  5FRM A;  4KDP A;  1JJ8 C;  1XMX A;  5HLT A;  4B48 A;  1B8I A;  1XCB A;  4YEJ A;  1R5H A;  2NRA C;  5D8L B;  1HKS A;  1LFU P;  1S7A A;  1V5G A;  1XGO A;  4AYB A;  4EGZ A;  1UG0 A;  1SD4 A;  1TQM A;  4P1W A;  2NVY J;  5F08 A;  4DIQ A;  4RAZ A;  4E7K A;  3O3K A;  3QRF F;  4BNC A;  3ABM H;  2PUS A;  3FTW A;  3NRV A;  3OOU A;  1GV5 A;  5DUK A;  1JHF A;  3QYE A;  3WHB A;  3J7Z I;  5E1W A;  5IT9 K;  1QPM A;  1ETX A;  1I5Z A;  4RDU A;  5J47 A;  3TP3 A;  3K70 D;  1J5Y A;  1XS9 A;  5K5R A;  2VL8 A;  4DW6 A;  3OYF A;  1TWA J;  3DKX A;  3IRQ A;  2FU4 A;  4WX9 A;  1GW6 A;  1MNM C;  1FIA A;  2A07 F;  2LF7 A;  2HXI A;  3H3U A;  1ZQ3 P;  3P9K A;  3SYT A;  5DLL A;  1LNW A;  3CCV I;  3BR6 A;  2VXZ A;  2JVH A;  3ML6 A;  1EF4 A;  3QU6 A;  5DCM A;  3G2B A;  3JSP A;  3D5L A;  1X4P A;  3E5Q A;  4XOP A;  4M9Z A;  1REP C;  5FKO A;  4A3D J;  3S1M J;  5GAE J;  1JUS A;  3U9G A;  2L7K A;  3L2W A;  2NVX J;  2ESH A;  2AXT C;  5TRD A;  1X2N A;  3OYA A;  3JAM Z;  2VPR A;  1I3Q J;  3FK7 A;  3MN2 A;  4G6D A;  3F22 A;  2PMH A;  2HU9 A;  2W57 A;  2X85 A;  5B3S H;  4ZJZ A;  1SG7 A;  4F7Z A;  3F0C A;  3RDI A;  4RS8 A;  5HLH A;  4LLN A;  4KFC A;  1G2H A;  1I50 J;  4PJN A;  1X1A A;  4M3B A;  2EZI A;  3CC2 I;  2STT A;  3AU8 A;  1XDU A;  1Y8R B;  5HDN A;  3DPT A;  1BM9 A;  2L7Z A;  1IXC A;  4KIB A;  1R1U A;  4BJT A;  1SFO J;  2M34 A;  2R5Y B;  3HOY J;  2L9R A;  5LFA A;  1CQT A;  4XN5 A;  2JTV A;  4GRI A;  4C3J J;  5ICE A;  2DTR A;  1EH7 A;  4F92 B;  5M3M J;  1ETO A;  3LL7 A;  4FLS A;  1UCR A;  4PUS A;  3E0J B;  1GVJ A;  2V4J C;  1YO5 C;  3GTG J;  3R61 A;  4LG0 B;  1RR7 A;  5C4X J;  4A3B J;  3ZQG A;  4E7Z A;  3GTJ J;  4M6V A;  2FQ3 A;  2GIZ A;  4ZW5 A;  4F93 B;  4BEH B;  3FX3 A;  1YG2 A;  1T2K A;  1G3S A;  3B7R L;  1HW2 A;  3CHO A;  4XSX F;  3GEZ A;  3RKW A;  2A68 F;  1QZE A;  3BPV A;  3WGG A;  1J9I A;  3L2U A;  2OC6 A;  1ZG1 A;  4PGG A;  4H0E A;  3I4P A;  4Y3O A;  2CQK A;  1BIB A;  2KDO A;  5DD4 A;  3IKT A;  4KIC A;  4XNB A;  4CUG A;  4I0B A;  1LFB A;  3IL2 A;  1ETQ A;  3LSG A;  4F55 A;  3H9Q A;  5D6E A;  3FHZ A;  3BOQ A;  2EFQ A;  4XBF A;  2PN6 A;  3C2B A;  3QP6 A;  2ZKZ A;  1ZGW A;  5A2Q K;  4M6X A;  5E17 F;  3EQL F;  4ZC3 A;  4ZX5 A;  1OJL A;  3M9A A;  4KIF A;  4KMU X;  2BVL A;  1WJE A;  2YU3 A;  3L2R A;  4IX7 A;  4AR8 A;  1W4M A;  3V7C A;  4JYK A;  3DF8 A;  1HXD A;  3KP3 A;  3KP4 A;  2DPU A;  3HYI A;  4OWR B;  3B73 A;  5E3O A;  1H8A C;  5BOX A;  2R5Y A;  5LEJ A;  2MYS A;  2W25 A;  3E1S A;  1Q0H A;  2Y48 A;  3P7N A;  4UY8 I;  4XQF A;  3N97 A;  2H6B A;  2R4G A;  3S2D J;  1X3Z B;  3BJ6 A;  4L5I A;  3OS2 A;  5JNL A;  4CCN A;  3MKZ A;  5C3E J;  2I5U A;  3GO5 A;  2RVC A;  3QOP A;  4W1U A;  2BXY A;  4LG0 A;  4JOM A;  3S2W A;  3VVL A;  4XMY A;  4GCV A;  3TMO A;  3BR3 A;  3GZ6 A;  1YIT I;  4IF4 A;  1J59 A;  1VQ7 I;  4BEH A;  4E7L A;  3KE2 A;  1AHD P;  4FLQ A;  3CUO A;  1S5L C;  1BJA A;  5HDK A;  2NS8 A;  4GYI A;  1G4D A;  4OOE A;  3CP8 A;  2HPT A;  2NNY A;  2E34 A;  2P6T A;  3FWE A;  1E17 A;  1TWH J;  3I0T A;  3G1L A;  4R8H A;  3HHH A;  3S2H J;  1G8X A;  2EBI A;  3SDG A;  5FLX Z;  4IZZ A;  2HOS A;  3DFG A;  2QVO A;  3OL3 A;  1IO2 A;  1XGS A;  2R59 A;  2FFL A;  1YQA A;  3IWZ A;  3FUD A;  2DTZ A;  2IBD A;  3FMR A;  5J4V A;  3IRR A;  2JA8 J;  3ZHY A;  4X1E A;  3KX2 A;  1D5V A;  3CES A;  3E3V A;  1VQ5 I;  2O0Y A;  3EET A;  3VB2 A;  1SFE A;  5JC1 A;  1WRJ A;  3W2A A;  2Z5U A;  1V54 H;  2IPQ X;  3C7J A;  4DZJ A;  4L0Y B;  3OY9 A;  2F6C A;  2ZXJ A;  1ZLJ A;  3JRE A;  2EIL H;  1YHQ I;  3WG7 H;  2Q1Z B;  4XN7 A;  4XRM A;  3EDP A;  5HNH A;  1XN7 A;  1X3Z A;  3JSO A;  2VJ8 A;  2P8T A;  2M7A A;  2PX9 A;  3AFH A;  3TOA A;  2MH2 A;  3FXK A;  3MD2 A;  4XNA A;  2X48 A;  4E7J A;  4BDZ A;  5E8I A;  4HDU A;  2Y9Z A;  5CQG A;  1AOY A;  2ELJ A;  5FKK A;  4PU2 A;  4PJ0 C;  1BI3 A;  3FM5 A;  3T5X A;  4ZX3 A;  3T0Y A;  1U78 A;  1T6S A;  4UVC A;  2CGP A;  3X2Q H;  5D5X B;  4RM2 A;  3CTA A;  2ZB9 A;  4A5N A;  4JND A;  4NUB A;  2JJ7 A;  2DMU A;  3I59 A;  2GWR A;  1SC7 A;  2LKX A;  4FIS A;  2H6C A;  4BE1 A;  4EQQ A;  1LVK A;  2YUS A;  4IRH A;  3Q43 A;  5H6Q A;  2STW A;  4A3C J;  5DTD A;  1SVM A;  1R71 A;  4BQO A;  1L0O C;  1TWF J;  1OKR A;  4XKC A;  2O3F A;  1OIS A;  2BV6 A;  3QP5 A;  3CCM I;  1LPQ A;  1I39 A;  2DA6 A;  1ETV A;  4U88 A;  4FHT A;  5IY5 H;  2GIV A;  4DYR A;  3S3N A;  3FMQ A;  1P4W A;  3IP4 B;  1F5T A;  3S1R J;  1GT0 C;  2EIM H;  2BHZ A;  2LF8 A;  2JUG A;  2CQQ A;  5E1Z B;  1XSX A;  1QGP A;  4PFP A;  3ZQ7 A;  5BPP A;  3QPT A;  1S3J A;  4AIK A;  3K4K A;  2LTP A;  1Z21 A;  1FTZ A;  1HKT A;  4MTD A;  4Y6P A;  4MQV A;  4C3H J;  1Q1H A;  1X19 A;  1OYW A;  2BBY A;  3TO7 A;  1BA5 A;  2R7F A;  3ECO A;  3GVA A;  1ZHF A;  2AXL A;  2EFW A;  2Y1E A;  1Y39 A;  1A36 A;  2HOE A;  4DQ2 A;  2E35 A;  3EYI A;  5LBQ A;  4C2U A;  4RB3 C;  5LGN A;  5FWQ A;  1UB9 A;  3KEO A;  3F8B A;  4A2U A;  2K85 A;  2E1N A;  3HEF A;  3KP2 A;  3LSR A;  4FX4 A;  4IHS A;  1KQ9 A;  2H94 A;  2O8K A;  4XN1 A;  4ZW3 A;  1Z67 A;  2DMN A;  2ZCW A;  3T8R A;  3F72 A;  3FUK A;  2CW8 A;  3CUQ C;  3GFJ A;  3PUF A;  1WH5 A;  1HBX G;  2DXI A;  1D0Z A;  5EYR A;  3RYP A;  3LAJ A;  3GF2 A;  5CVU A;  3GTQ J;  1ETY A;  3A0H C;  1O3S A;  2K9M A;  2XVC A;  4AIC A;  3ISP A;  2Z33 A;  2W85 A;  3L00 A;  1OPC A;  4A3L J;  3M4O J;  1G3T A;  1IRX A;  3BR2 A;  1JGG A;  2MD0 A;  1NTC A;  2EV5 A;  2VKE A;  1JKO C;  1QO0 D;  3MVP A;  4XRS G;  2LC2 A;  2ZFW A;  3F21 A;  1K6O A;  2ESN A;  4OOI A;  3E5X A;  3BTL A;  4OIQ F;  2DLL A;  3E6D A;  5JI6 A;  3JRI A;  2CSO A;  3BR0 A;  3O8H A;  3ABL H;  2XPW A;  3H1C A;  3ZOB A;  2KIQ A;  4A3M J;  2LK2 A;  3JAM K;  2DK5 A;  5B5E C;  1RR8 C;  2DOF A;  1VQ8 I;  1MZB A;  3ANN A;  4WK8 F;  4MS6 A;  4XN9 A;  2OAZ A;  1R58 A;  4BKX A;  1B6A A;  4ENJ A;  2EJR A;  3CDI A;  3Q5F A;  2VJ5 A;  1STZ A;  3WU0 A;  1KYW A;  3GTL J;  4E70 A;  2PJR B;  1TWC J;  4BUP A;  3HDD A;  4LK1 F;  2V79 A;  1JKR C;  1I1G A;  3LNQ A;  5KAF C;  5ED4 A;  1IN5 A;  3HOX J;  1VQN I;  3PNY A;  3BZ6 A;  3I71 A;  5DEQ A;  4G6Q A;  1TQP A;  4HX4 A;  3N05 A;  2DMQ A;  2D1H A;  3I56 I;  1E3O C;  2Z16 A;  4M9S A;  4DJA A;  2CUJ A;  4BGD A;  4U7B A;  3SEQ A;  1XD7 A;  3CP2 A;  3MKL A;  4IRG A;  4C2M J;  4BL0 B;  4XON A;  3AL0 B;  2LG4 A;  2DQR A;  2IGK A;  2JD0 A;  1XMA A;  2PI0 A;  4PCQ A;  4NDL A;  1ONV A;  3TL4 X;  2R5Z B;  2DFE A;  3DP7 A;  4UVA A;  2YX4 A;  5FJ8 J;  2OV7 A;  1R4N B;  1T0F A;  4JQF A;  4BS9 A;  2IEK A;  3MMY B;  5IYC J;  3K1P A;  2MGQ A;  3E6M A;  5IP7 J;  1W5C C;  5F1R A;  4DOZ A;  5L3F A;  5HNF A;  4EM0 B;  1ETK A;  4B3X A;  3FHE A;  2QEX I;  5JMP A;  3QYF A;  2GLO A;  4BDY A;  2E2I J;  2DOD A;  4LJZ F;  4A0X A;  2XB5 A;  1SMT A;  5LLQ A;  4FCA A;  3EUK L;  5FD6 A;  3QPH A;  2HZT A;  2HQ5 A;  4WXD A;  1V5F A;  1KQ0 A;  4WF2 A;  1M1E B;  2TRT A;  4XLN F;  2ZO4 A;  1QHH D;  1P7I A;  4AVP A;  1R7J A;  1K83 J;  1AA7 A;  2QKM B;  2PJR A;  1I3A A;  3D1N I;  3W6K B;  2EV0 A;  3FTY A;  2M9H A;  4QPQ A;  3A2K A;  2HZD A;  4FQG A;  1X1P A;  4XRF A;  2V9V A;  2E60 A;  3FTS A;  4EM2 A;  1MBH A;  3IKV A;  3H5R A;  4KT6 A;  4P9U A;  2IT0 A;  3HTS B;  1N75 A;  1P92 A;  4I76 A;  1Y8Q B;  4HDV A;  3KYL A;  5BQT A;  4XKV A;  2DOE A;  2HI3 A;  5BPI A;  1FBS A;  2O7G A;  4HNT A;  3RZO J;  2EFP A;  5HS8 A;  1X1C A;  2EIN H;  1RIO H;  1Z9C A;  3HM5 A;  1O7F A;  2ADU A;  4ZDP A;  5DDG A;  3RAS A;  4CCL A;  1IN4 A;  2R5Z A;  1JGI A;  4MIM A;  5EV7 A;  1QU3 A;  3OYE A;  5E79 C;  4RAG A;  1ERD A;  4LG3 A;  2ME0 A;  1V4R A;  1WKM A;  3PNV A;  4UVB A;  2M8G X;  2ELH A;  2NNN A;  1RKW A;  2Y31 A;  4HRI A;  5D5V B;  1DP7 P;  2DJN A;  3FU3 A;  1SEU A;  4ZDO A;  4D5C A;  5F0H A;  5DV5 A;  3BCA A;  2UWM A;  1WJA A;  2UXX A;  4J19 A;  1GVD A;  3K2A A;  5FLX K;  3FXO A;  2NAZ A;  5K7F A;  4IQJ A;  2LOO A;  1WI3 A;  5CVJ A;  5JHF A;  2DDA A;  4PGH A;  3L2C A;  1RUO A;  2JD1 A;  3VPR A;  2DA7 A;  5HDG A;  2F5D A;  4KIT B;  1QZY A;  1YYV A;  2EZH A;  5EEH A;  2MAO A;  1RZ4 A;  3HOV J;  5C4J J;  3ZCO A;  1K4T A;  3ULQ B;  2M4G A;  1MDM B;  4HQM A;  1U0J A;  2LFB A;  4RAF A;  2JA5 J;  2OCC H;  3BY6 A;  3S8P A;  1SAX A;  2WY7 Q;  4OAY A;  3ZQQ A;  2JVG A;  4Q4Z F;  5EGO B;  3IV5 A;  1DPR A;  1OMI A;  1MVY A;  4LIT A;  3FXL A;  4L9N A;  4XLH A;  2QJ1 A;  1X2M A;  2XC7 A;  1HCR A;  1VND A;  2A61 A;  2HYF A;  2XGC A;  3KLO A;  1YW7 A;  2VBW A;  5ILS A;  1N78 A;  4ZQE A;  1T08 B;  1OYY A;  4RCV A;  1W5S A;  2JK3 A;  1TW3 A;  5CLS A;  4KP7 A;  2MBF A;  2JRM A;  1YOV B;  3H92 A;  2X1D A;  4L9T A;  1U8B A;  1U9N A;  4Q4I A;  1JXS A;  2LBF B;  1OCP A;  3WQS B;  3DTE A;  3VWB A;  4CCJ A;  4OIO F;  2H1L A;  2OZU A;  4XR6 A;  2RQP A;  2XRL A;  4I2O A;  2WA0 A;  2JD2 A;  1BJZ A;  2RN7 A;  3ZQI A;  3S93 A;  4NHJ A;  3OYB A;  2XV4 S;  2FJ1 A;  3E97 A;  4CSW A;  4UV8 A;  3OYN A;  4MNU A;  2XB0 X;  2Y0S A;  3WE2 A;  4EMS A;  1VTN C;  2W48 A;  1BOB A;  3ZN1 A;  4D0P A;  3CMY A;  3REO A;  1H3L A;  1MW7 A;  3QWL A;  2GXG A;  2R7X A;  5J6X A;  3BRO A;  1LJ9 A;  4I0A A;  1MDM A;  2JPB A;  3DU5 A;  1DGW Y;  5IP6 A;  1MJ9 A;  2HGC A;  3T1B A;  2WBM A;  2LKS A;  5IYD J;  2ZNY A;  1IZ1 A;  4XNF A;  1W5T A;  4D5F A;  2Y1C A;  3D5R C;  5EGO A;  3OYI A;  3JSZ A;  2HWV A;  2MG4 A;  1LDK B;  5IOZ A;  5F0C A;  4ARF A;  1WI9 A;  2VAS A;  2R3S A;  3F6O A;  4HBL A;  3WTT C;  5AIP A;  2L7F P;  4XKB A;  1U8R A;  3EPZ A;  4C30 A;  4II2 A;  4HST A;  2G7H A;  4FCY A;  1FLI A;  3OR1 C;  4ZZD A;  3DWL E;  1YLF A;  3WE3 A;  3WTZ A;  3G71 I;  4AD9 A;  3OV8 A;  3GLL A;  2O6G E;  1JT6 A;  2EV6 A;  4LB6 B;  2D45 A;  2CV2 A;  1UST A;  2V1U A;  3FXU A;  3OIQ A;  4A69 C;  2JCY A;  1JUM A;  5CKT A;  2LBF A;  2XAJ A;  1D1A A;  2F5V A;  4ANJ A;  1OR7 C;  4HSR A;  1B72 B;  1JKP C;  4LFU A;  4LIU A;  4RGX A;  3SDB A;  4KIS A;  3OYD A;  1SFX A;  3SXY A;  4EGY A;  2LLK A;  1OQY A;  2A6H F;  3DCF A;  4YFN F;  2B9S A;  1WJ5 A;  4XLC A;  3DXJ F;  4XLA A;  2E2H J;  4HNU A;  3MKY B;  4MQ9 F;  4XMT A;  4ETS A;  1IDY A;  2LNB A;  4YIR X;  4N4O B;  2R72 A;  3VYS B;  3E5U A;  4XN8 A;  5KAI C;  3OS1 A;  4Y4R A;  2QGU A;  2NYX A;  1YS6 A;  1ODD A;  2AHQ A;  2YX7 A;  5ILV A;  2OQG A;  2L9N A;  1VQ4 I;  3AUA A;  4QIW N;  1FNN A;  2K02 A;  2M1B A;  3ESW B;  4O6J A;  2KZV A;  1Q1V A;  1WJB A;  2VKV A;  3A06 A;  2GA2 A;  2QBY B;  1YE9 A;  2HYJ A;  4D9J A;  5KHD A;  2O61 A;  5JMW A;  1Y56 A;  4HNV A;  2VB6 A;  1ZRD A;  1G6N A;  5H6R A;  3G73 A;  2X4H A;  3MZ8 A;  4RSY A;  3KIO A;  2XPV A;  2XGE A;  3KZY A;  4KUM A;  3DEU A;  2W7N A;  3M8F A;  2PJP A;  3FH7 A;  3M3Y J;  1X4O A;  5L3B A;  3TW6 A;  5LRS A;  1O3T A;  4K5M A;  3F3X A;  3F23 A;  1ULY A;  3B6A A;  1J0R A;  3NWT A;  4A12 A;  2FD5 A;  4IHY A;  1CF7 B;  2KL4 A;  3G3Z A;  2F5C A;  4R5V A;  3KED A;  5K1Y A;  3BG3 A;  2V7F A;  1EV7 A;  3O8G A;  4DGW B;  1LQ1 A;  1W36 D;  2Y1D A;  1XDS A;  3WHC A;  2OD5 A;  1GUU A;  1O7L A;  2K4J A;  2HDC A;  2JT1 A;  4MO7 A;  2X6W A;  2XHK A;  1B72 A;  1ITY A;  4UHT A;  4RA2 A;  4I01 A;  4N9I A;  1U3E M;  1KA8 A;  4B8X A;  1WQ2 A;  2XUB A;  4ZQF A;  1FSH A;  5HOO A;  2H09 A;  2CH0 A;  3S3O A;  1HQC A;  3L09 A;  3I64 A;  5DM6 F;  4QIR A;  2BOL A;  3A01 B;  3CCQ I;  5E3N A;  2O7O A;  4F3Q A;  3K4L A;  1MH3 A;  3K10 A;  2JSP A;  2MD5 A;  4IOC F;  2XKO A;  3EUH C;  4U7D A;  3K4C A;  4CDG A;  3OYC A;  4HLY A;  2M5W A;  4P55 A;  1QQI A;  2DOA A;  2LYC A;  4BXF A;  3LSI A;  2MA3 A;  3ZPL A;  3NQO A;  3FBN B;  2QBY A;  3CC4 I;  3AKZ A;  1P9Q C;  4YFX F;  2ETH A;  3ZHX A;  5J8F A;  3R60 A;  3JRB A;  1IV8 A;  3OSF A;  3GFM A;  5M5X J;  1ON2 A;  4HPQ A;  3FXM A;  4G12 A;  4O5V A;  3H5N A;  4EJT A;  4FE7 A;  4XSZ F;  1IRZ A;  5CQE A;  1F9N A;  1TT0 A;  2A5W A;  2L5Q A;  2R92 J;  4UUS B;  2ECB A;  5DM7 F;  2DT7 B;  2KRC A;  3HC7 A;  1BW6 A;  5FFX A;  4LB5 A;  5FLV A;  4Q5S F;  3DQV C;  4ESB A;  3C2G A;  1AKH B;  3HB9 A;  3HOW J;  2ZBK A;  1CF7 A;  2R70 A;  4K5N A;  1W0T A;  4C9Y A;  3CZ6 A;  5JR3 A;  1FYL A;  2HOT A;  2IA2 A;  3B37 A;  1HSJ A;  2AS5 F;  4BAC A;  3H0G J;  3K1M A;  3ECH A;  3HOS A;  2CJJ A;  3TQN A;  4XIC A;  4HQE A;  3R6S A;  3I9V 2;  3HG9 A;  4XO5 A;  2IXS A;  4LUP A;  1R6R A;  1IUY A;  2KRH A;  5FD5 A;  3KZI C;  1AU7 A;  4A3I J;  2HQR A;  1Y0U A;  1Z0X A;  3GBG A;  5L3E A;  5GAD J;  3A01 A;  2E5Z A;  2V1X A;  3GTM J;  3GTP J;  2PL5 A;  4E7I A;  2XPU A;  4J00 A;  4Y6S A;  3ASO H;  3IH2 A;  1WPK A;  4BQQ A;  2P81 A;  2VKH A;  4HF2 A;  2BE5 F;  1IN6 A;  3K7A J;  1G59 A;  1N77 A;  3LOC A;  4U0Y A;  2EZK A;  2VBZ A;  4M73 A;  2FRH A;  1IC8 A;  2Y30 A;  4BAY A;  2RNG A;  3BJO A;  3JRD A;  2K4B A;  4AUX A;  1BR2 A;  4JX4 A;  4UUS A;  2VON A;  4EV0 A;  3KYD B;  4E4H A;  2P7C B;  3JRF A;  5AON A;  2DMT A;  2J5P A;  4IHX A;  1FBU A;  1P2F A;  3IH3 A;  3ZP5 A;  4ZDL A;  4OIP F;  2QQ9 A;  4TV7 A;  1AKH A;  1VZ0 A;  5E3L A;  4F52 A;  1QA6 A;  1UG2 A;  4BBS J;  1BI2 A;  1S46 A;  4L9V A;  1TZL A;  5LGU A;  3DLA A;  1HKQ A;  3DBH B;  4ZTJ A;  2G0E A;  2VJ4 A;  4RGS A;  1MBE A;  2BZT A;  4HF0 A;  4EJU A;  2YPR A;  1U6G A;  3QOE A;  4E7H A;  2DCE A;  2E36 A;  2K9S A;  2MLK A;  1XSD A;  3P9I A;  4AIJ A;  1Q0L A;  3WTV C;  2EA2 A;  3JRG A;  5DUL A;  1ZR4 A;  2ZME C;  1H0M A;  5B1A H;  2FML A;  3FF5 A;  2JQ7 A;  3H9J A;  3PM1 A;  2FBI A;  4ENN A;  1UHS A;  4KJZ A;  2CW0 F;  3PUB A;  2GXB A;  3FU6 A;  1QRY A;  5ICC A;  4XN2 A;  2CG4 A;  2DFF A;  5DUI A;  4FAS D;  4IRI A;  3H3V K;  4OOF A;  3FK6 A;  1YJ9 I;  4DYQ A;  4Q48 A;  2E7X A;  3TW7 A;  1JGS A;  2HKX A;  3QU3 A;  5H20 A;  1ZAR A;  4RB1 A;  3SEZ A;  3CZK A;  1JHH A;  1LDJ A;  1MKM A;  4Q4E A;  3CCL I;  4KA4 A;  5K7H A;  2XRO A;  1LE8 B;  1NH3 A;  4ZZL A;  1DP3 A;  1PJR A;  3BG7 A;  1H19 A;  2R7V A;  1XSV A;  1MIJ A;  2F5E A;  2OJE D;  2MAP A;  5M5W J;  4LD5 A;  4L5E A;  1JJ6 C;  1VQM I;  4OAZ A;  3CMA I;  1QVT A;  3IHU A;  3MQ0 A;  5E3M A;  5J3L A;  1I6X A;  2WAD A;  5FKN A;  1TP4 A;  4BHP A;  2FXA A;  4K5L A;  2P5K A;  2CS3 A;  4IL6 C;  3C1D A;  3VOD A;  1HDP A;  1ZYR F;  1TW2 A;  2R7Q A;  4BXU A;  2L7M P;  2V1N A;  1CGP A;  1BW5 A;  2B7E A;  2DBB A;  2ZXW H;  3DKY A;  3FUJ A;  1FWZ A;  1S72 I;  4BU2 A;  2HFH A;  1FOK A;  5KK1 A;  3J81 Z;  2XSD C;  1V3F A;  4YEL A;  2YSR A;  3TP0 A;  2W1O A;  2D2W A;  3ZMD A;  4II3 A;  3M1C A;  2EK5 A;  3HSR A;  5D8K B;  2D5V A;  1RC9 A;  2QSG X;  3EBI A;  2WZG A;  3JR9 A;  3DV8 A;  4B1R A;  2EPF A;  1FOY A;  4CO8 A;  1J75 A;  1WZ2 A;  2QVW A;  4BH9 A;  4R1H A;  1S29 A;  2BYV E;  1QNT A;  2DFH A;  4ABZ A;  4A03 A;  2JCV A;  3QOD A;  4ESJ A;  3WTX C;  1P6R A;  4A6E A;  1FY7 A;  3PFY A;  2K3P A;  2NS0 A;  1TQI A;  3V7S A;  3A14 A;  2JWT A;  3OYH A;  5K7Z A;  1DU6 A;  1Z3X A;  4ZW6 A;  2RGV A;  1HW1 A;  3GME A;  2P4W A;  2XAG A;  3HL2 A;  1LE8 A;  3BTI A;  1JE8 A;  2LY9 A;  3HRS A;  3N4M A;  2FE3 A;  2O5R A;  3GZN B;  3VDX A;  2XAU A;  3I4N J;  1WSU A;  2KMU A;  1JG9 A;  2MLG A;  3H5A A;  2HR3 A;  5GPC A;  2TCT A;  1BOA A;  4BQA A;  1IAW A;  4LGW A;  2EFN A;  2R7O A;  1R49 A;  1RUN A;  3H9G A;  3MCZ A;  2LR8 A;  4Q47 A;  1UMQ A;  2MSY A;  2Z1D A;  1K61 A;  4GXO A;  2FA5 A;  2M87 A;  4ASN A;  3F8C A;  3DPL C;  3S15 J;  1MMN A;  4DNC A;  2VQL A;  3ROU A;  2IRF G;  3ZN0 A;  3OS0 A;  4MEX F;  1FYM A;  4BXX J;  2ZFU A;  1MJB A;  2E71 A;  2KQR A;  1ZAO A;  4HX8 A;  3CD6 I;  2FOW A;  2VLA A;  1D1C A;  1MW1 A;  2Y1G A;  4BBR J;  3WOD F;  3LQQ A;  3SZG A;  1R1V A;  3Q0W A;  2BY1 A;  3H0D A;  4QME A;  3V8L A;  3JRH A;  4YII A;  5E20 A;  2WWY A;  2VI6 A;  3ABK H;  2PLY A;  1XPX A;  3ASN H;  2M2E A;  1A6Q A;  2ZC2 A;  2WV0 A;  1OCZ H;  1R36 A;  3QPS A;  2BY2 A;  2DA3 A;  2PMU A;  2DA5 A;  3UNG C;  1Z05 A;  4A3F J;  4A3E J;  3BTC A;  4W97 A;  1EKE A;  5BPD A;  3ZQF A;  1NK3 P;  4XID A;  3GTK J;  3ABT A;  4G8X A;  1T8I A;  3K4B A;  3LSJ A;  1YW8 A;  3CJQ B;  4FX0 A;  4LMY A;  5FFZ A;  2WAF A;  3FU5 A;  2LY1 A;  2VBX A;  4QHP A;  2RAE A;  5HS9 A;  3Q0U A;  2FUG 2;  4G94 A;  2IAI A;  4AWX B;  1TL8 A;  2RKH A;  4M3F A;  4RMN A;  4A6D A;  4L0Z B;  4ZYH A;  3F8N A;  5KNL A;  4GO1 A;  1BN5 A;  2WC2 A;  3FKI J;  4HA8 A;  4P9F A;  3H3Z A;  1JKQ C;  3ERE D;  4XOR A;  3W6J B;  3PIP F;  3E7L A;  3U9W A;  2QQ8 A;  2ZJQ F;  5CJ9 A;  1WH7 A;  2QYO A;  2VC1 A;  3AG4 H;  5LEK A;  1E3P A;  3FTU A;  1YX3 A;  1O3R A;  1HW5 A;  1Z91 A;  1NG6 A;  3BP8 A;  4FLO A;  3B7T A;  1DQU A;  1FYK A;  4AID A;  4C3I J;  5FLM J;  4EJO A;  2OBP A;  4IQ4 A;  2RJI A;  5IPA A;  1ON1 A;  4JBA A;  4N4N B;  3OR2 C;  3OOP A;  2K86 A;  1PYV A;  2Y75 A;  4BJ6 C;  1ZGA A;  2O8X A;  4A93 J;  2GOX B;  4RM3 A;  3RKX A;  4KT5 C;  4Z6Y A;  1FOW A;  2CUZ A;  3CHQ A;  2COM A;  4XKW A;  3TO6 A;  3ZXS A;  2LDU A;  2HYG D;  5JAZ A;  1KU7 A;  4XND A;  1SMY F;  3G6E I;  3M7G A;  1LKX A;  1ZKG A;  3WQQ A;  4HV6 A;  4FE4 A;  2L4M A;  4CCM A;  2R7W A;  3ANL A;  2N8G A;  3RYR A;  1OCR H;  4ZQT A;  2G9W A;  2FQ4 A;  4FET A;  2HS5 A;  4DYC A;  4ZYA A;  3ONQ A;  2M4K A;  4Y33 A;  4M6Y A;  3CUQ B;  5CPR B;  3L2Q A;  4HEA 2;  2DW4 A;  4GYG A;  1MMS A;  1K78 B;  3Q9S A;  2CU7 A;  2JN6 A;  4R79 A;  1OFC X;  2DMP A;  2PQ8 A;  3CME I;  3UKG A;  1HOM A;  1HDD C;  1E0E A;  4HAM A;  2HDW A;  2IGM A;  2FNA A;  4L2L A;  1A6I A;  1WJC A;  4BQN A;  4CGZ A;  2E1O A;  2Y0S N;  1LUJ B;  1VQO I;  1XB4 A;  4KIG A;  2R7R A;  1GDT A;  2DA1 A;  4G7O F;  2GQQ A;  1TNT A;  3FUN A;  1MBK A;  3NEU A;  3HGG A;  3UR3 C;  3B7U X;  2VN2 A;  1HC8 A;  1B59 A;  2L9S A;  1VQ6 I;  2XQ0 A;  2B61 A;  2QF7 A;  3QPL A;  2Z3Y A;  5FGM A;  4CCO A;  4HF1 A;  3FKJ A;  4J01 A;  4RGR A;  3EBH A;  3OL4 A;  3R0A A;  2XKP A;  4DPR A;  3B7S A;  4XMV A;  3ZMT A;  2EA4 A;  5J4Y A;  3LAP A;  4M74 A;  2DA4 A;  2L2O A;  4IXA A;  4S0H B;  2P6S A;  4CXF A;  1GHC A;  1USS A;  3S1N J;  3DBR B;  4NC8 A;  4BE0 A;  1MGT A;  1JVS A;  2K27 A;  3K1N A;  5LRR A;  4PW4 A;  5F0F A;  2PG4 A;  4I7H A;  1UZC A;  4CIC A;  1D0Y A;  1IJW C;  2DYR H;  3HUG B;  4KMF A;  1KON A;  2ME6 A;  2FBH A;  4I99 C;  4CA0 A;  5TJJ A;  3FHN A;  2QA4 I;  5JBI A;  3HTU A;  4KYW A;  4QWQ A;  1TWG J;  1YI2 I;  5DS9 A;  4AC0 A;  2DN0 A;  3OYK A;  3VYU B;  4X6A J;  1V55 H;  3CUQ A;  1VFC A;  2DT5 A;  3C3W A;  4DBR A;  4A3G J;  2HVQ A;  4A5M A;  1K78 A;  1ZLK A;  1ZR2 A;  2RQQ A;  3SZP A;  2PMZ A;  4BE2 A;  4A3K J;  5EG0 B;  4I6Z A;  2FOK A;  3U21 A;  4XL9 A;  3ZRG A;  4ZH4 F;  1Y6I A;  4GAE A;  3CZL A;  5EF6 A;  5J40 A;  1QBJ A;  5GP9 A;  1Y1V J;  3OYG A;  2HVS A;  3I4M J;  3PNT A;  4NQW B;  1FTT A;  2WZF A;  2Z2S B;  3CF2 A;  3OIO A;  3LSP A;  3WTU C;  3IAS 2;  1P4A A;  3L9F A;  2P5L C;  2OUM A;  1D5Y A;  3FTV A;  2QCO A;  3G1M A;  4MKT A;  1JT0 A;  2M30 A;  1T98 A;  1RKT A;  3FUM A;  3RQI A;  2ZXG A;  1F4K A;  1D1B A;  2E1C A;  1BR1 A;  1KU2 A;  2MFZ A;  4EVI A;  1MNE A;  2FX0 A;  1MMD A;  1KU9 A;  3P9C A;  4AIH A;  5J8C A;  4RBO A;  4B43 A;  3U1D A;  1R4M B;  3F8M A;  2JA7 J;  3C2H A;  3TKY A;  1AWC A;  3S32 A;  1K7A A;  1S8N A;  5CYV A;  1BL0 A;  1RET A;  2VC0 A;  5FKM A;  1YTY A;  3AG2 H;  3PIO F;  2QSH X;  2VOP A;  3KFW X;  4KN7 X;  1H9T A;  3RKQ A;  2LY2 A;  4B4C A;  2COB A;  4RGU A;  3PL8 A;  4UXN A;  4R7L A;  1HST A;  4ZYD A;  4UUV A;  1DUX C;  2ELK A;  3VSL A;  1TC3 C;  3FZV A;  4L5J A;  4ZX6 A;  1LFP A;  2LRD A;  3MWM A;  3ELK A;  3FMS A;  3ZMV A;  1MBJ A;  4NC6 A;  1OYI A;  4OU0 A;  4RLF A;  1ZS2 A;  5EG0 A;  2ID6 A;  3V4G A;  5BNG A;  3A1Y A;  1IF1 A;  3LMM A;  3FXJ A;  3GX4 X;  1NK2 P;  1R23 A;  1YFH A;  4MFD A;  1MSE C;  1R1T A;  2GBY A;  4CZZ A;  2GM4 A;  1IG7 A;  3TO9 A;  4S05 A;  4LOC A;  4NQW A;  4XN0 A;  2CQX A;  3RKY A;  2GOM A;  2F4O B;  2R7Z J;  2P0W A;  4R5T A;  5FRN A;  3HXL A;  1ONN A;  1SAU A;  1IV6 A;  1WWX A;  1SFK A;  2Q2E B;  4N0B A;  4C2T A;  4IHV A;  3S14 J;  1RP3 A;  3ANM A;  1ONO A;  5GAG J;  5J1R A;  3LQR A;  3PO2 J;  5IYB J;  5DYF A;  6PAX A;  4IEJ A;  3S16 J;  2P5V A;  1ONP A;  5JLX A;  3EBG A;  1X1B A;  1FBQ A;  2DDB A;  3E6B A;  4CH7 A;  1O4X A;  2C82 A;  2QQA A;  4PFO A;  2DQM A;  2IA1 A;  3IAM 2;  2JMW A;  3IWF A;  4PJL A;  4Y7N J;  4S04 A;  2Q8K A;  3GXO A;  4AYS A;  4MEY F;  3TOB A;  2OA4 A;  3RIR A;  2M7B A;  2R7T A;  4PVB A;  2MC4 A;  3K4J A;  4I09 A;  4L9J A;  2DJI A;  2ID3 A;  5F64 A;  1ENH A;  3GW2 A;  3DPU A;  3MZY A;  2H8W A;  2BGC A;  3KP7 A;  1OCO H;  1EH8 A;  3SHF A;  3GTO J;  2XF7 A;  5D4R A;  1ACI A;  4MTE A;  4EEF G;  1D3Y A;  3I54 A;  3CXB A;  4EJV A;  3BCB A;  4ZYE A;  2FSW A;  3EUA A;  2HEO A;  2XPZ A;  1YW9 A;  2M3A A;  3M8J A;  3ZI0 A;  2Y0M A;  2Z9O A;  2ACJ A;  2QSF X;  3G1O A;  2IA0 A;  4QPO A;  4MFE A;  5EJC A;  5DYM A;  1XGN A;  1IUF A;  4LK0 F;  3JTH A;  5DD8 A;  2R0Q C;  2NVT J;  1E3H A;  2DK8 A;  3FUF A;  2B63 J;  2CUE A;  4GAA A;  1N25 A;  2ICW G;  3IUO A;  2Q2E A;  4E6K G;  4I02 A;  4GDF A;  4BYY A;  2DI3 A;  4XK4 A;  2FEZ A;  5JVT A;  4BHC A;  2W84 A;  1A04 A;  1ZRF A;  3JCU C;  3BJA A;  4JX6 A;  1KQ8 A;  5LGT A;  1IN8 A;  3W2W A;  4XN3 A;  4YFK F;  2Y69 H;  3V42 A;  3V8J A;  1RNL A;  4H4K C;  4QTR A;  2XAF A;  1F43 A;  4Y17 A;  1WJD A;  1KGS A;  5B1B H;  1OLT A;  2V6C A;  4B09 A;  1MD0 A;  3CLQ A;  5HLI A;  2LSO A;  2K9L A;  1X1D A;  2IS2 A;  3LST A;  2DQL A;  3VYT B;  1R5G A;  2NS7 A;  2Z99 A;  4CYC B;  2OZ6 A;  5CVI A;  3BG9 A;  5LHG A;  4X2U A;  3I3L A;  3ZQC A;  2QUF A;  2EZL A;  4RAY A;  2A6E F;  5AEN A;  5D4S A;  2LRE A;  4PDK A;  3TDU C;  4ZTF A;  2FMY A;  4G7Z F;  4XMX A;  4G9Y A;  4OIN F;  5EZG A;  5JO0 A;  2IS6 A;  3UER A;  2XAQ A;  1R5I D;  3KLN A;  5AIQ A;  3FXR A;  3WTS C;  2EGH A;  3W6V A;  5FB2 A;  2UUZ A;  2JPC A;  2F4I A;  2XGX A;  4IHW A;  3NAU A;  4NNJ A;  2WB1 A;  1F36 A;  2XRN A;  3PSI A;  1EA3 A;  4AM3 A;  2A05 A;  2CYY A;  1Z3Y A;  5TGT A;  2KP6 A;  3OMY A;  2VJJ A;  2EQR A;  3FTZ A;  1O3Q A;  2KHM A;  1UFM A;  1ZTR A;  4NB5 A;  4ENM A;  2W24 A;  3HPG A;  4UUT A;  5L3C A;  4NBQ A;  2DQ6 A;  2R7D A;  1Z1D A;  1YS7 A;  3KP5 A;  3NAR A;  1EH6 A;  2X0L A;  1J7K A;  1DDN A;  3JT1 A;  2WTE A;  1FOX A;  2X6X A;  2KJC A;  1YX5 A;  1ORK A;  3Q9V A;  1IRF A;  4FT8 A;  4K5O A;  4AR1 A;  1KZH A;  4E7S A;  3HIF A;  4XO3 A;  2A5Y B;  3MAJ A;  4OMY A;  3HKZ A;  3T8T A;  2BW3 B;  3HJE A;  2V6E A;  1XMK A;  1VF9 A;  4CYC A;  1HS6 A;  1X3W B;  2J5O A;  5BS6 A;  3K9T A;  3J80 Z;  4JK1 X;  2KIF A;  5JFR A;  3OYM A;  3RZD J;  3HRM A;  1K5H A;  4IOA F;  5L3D A;  3I55 I;  2PEX A;  5L3G A;  1IRG A;  4UB8 C;  2M0M A;  4HV5 A;  2QZ8 A;  3HHG A;  2A3S A;  2OF7 A;  3GZ5 A;  4HLX A;  2OPT A;  3CO6 C;  3PUU A;  1VQ9 I;  1P7J A;  1FP1 D;  1TNS A;  2VT3 A;  4MGR A;  4V19 K;  2OQR A;  3W2V A;  3CHP A;  1UAA A;  2EIK H;  3HZJ A;  2KPM A;  2X1E A;  1SD5 A;  3J7A Y;  2A7O A;  4WXH A;  3B2P A;  2ZNZ A;  1OR7 A;  3LFK A;  1SVL A;  3F6V A;  3FDY A;  3ZMU A;  4HYE A;  2WAE A;  1XTA A;  1U2W A;  2LP0 A;  2WY8 Q;  4OMZ A;  1IDZ A;  3BTJ A;  3WGH A;  1XCV A;  2Y1F A;  1T1S A;  3IIE A;  2BXZ A;  2JUC A;  1VQL I;  1Q0Q A;  2AQF A;  5K5O A;  1WVR A;  2UV1 A;  3I5U A;  4AR9 A;  2TDX A;  1YRN B;  1RPW A;  2I8D A;  1I1S A;  3CDL A;  3VFZ A;  1MW2 A;  5HS7 A;  3DU6 A;  3D5S C;  1C0W A;  3TDZ C;  2CQN A;  2CWE A;  5ERI A;  4CZC A;  4LIV A;  1JI8 A;  1BI1 A;  5BMZ A;  3K2Z A;  2KZG A;  2VE9 A;  2BW3 A;  3HPH A;  3S1Q J;  2MH9 A;  3BG6 A;  1X3W A;  2HQN A;  1RES A;  2DA2 A;  1U5T C;  1TLH B;  4ON0 A;  3WGI A;  3WU1 B;  2RDP A;  3CJN A;  1T1R A;  4ZQG A;  2K7L A;  2I10 A;  2KIU A;  4JP0 A;  3CO7 C;  3BR5 A;  4HZF A;  2LMD A;  3CHS A;  2XF6 A;  1PDN C;  3HRT A;  2AO9 A;  2NVU B;  2EB7 A;  3I58 A;  2KIS A;  2YS9 A;  4M3E A;  2AQE A;  5LHH A;  3W3C A;  5F1J A;  3SFZ A;  4B47 A;  5JVG F;  3SQN A;  5GAH J;  1A35 A;  1LVA A;  1B1B A;  3J7A O;  3U2R A;  4GGG A;  4A0Y A;  4BY1 J;  3MKW B;  4U0W A;  4MLO A;  3KEQ A;  5GPA A;  3MZH A;  5E18 F;  1QZZ A;  1Z7U A;  1PUF B;  1SC5 A;  4O3M A;  2YR2 A;  3KYC B;  2VBY A;  1UHM A;  1WJF A;  3CQZ J;  2KLO A;  3I59 B;  3RQ4 A;  4Y52 J;  2XIG A;  2Y9Y A;  1UJ8 A;  2WAQ N;  4ZW8 A;  3VEP A;  2DT6 A;  4QSH A;  3S17 J;  1VQK I;  4IO9 F;  1YRN A;  2ZXI A;  3VYR B;  2KT0 A;  2LD5 A;  3FM3 A;  2Y2Z A;  3EUH A;  2CV0 A;  1KYZ A;  3HW2 A;  3LWF A;  3ZQH A;  3A03 A;  4JX5 A;  4D7N A;  3M8E A;  4IPA A;  1PP8 F;  3L1P A;  3WTY C;  3R0J A;  3FTX A;  1Z7L A;  2K5C A;  1FC3 A;  1GV2 A;  1FPQ A;  4M72 A;  2QM3 A;  4RVB A;  2VXD A;  3CZE A;  3TGN A;  3F8F A;  1WFX A;  3A02 A;  3Q0V A;  3BQY A;  1FX7 A;  1TBX A;  4CCK A;  2KJB A;  3SFI A;  2ZSI B;  3OYL A;  4IKF A;  3LSH A;  1T56 A;  3OIP A;  2ZXH A;  2GXA A;  4EJW A;  3QJX A;  4XLE A;  2X9D A;  4G6T B;  2KDZ A;  1T0F C;  2K3F A;  3CJR B;  4M3G A;  2JCX A;  3Q3S A;  5F27 A;  1PUF A;  1U5T B;  1X3U A;  3ZHZ A;  3O6B B;  3DLL F;  2RC4 A;  1EJ9 A;  2HPO A;  5FO5 A;  1TT5 B;  2MAB A;  2ZME B;  4F91 B;  2KFD A;  3LA7 A;  1YIO A;  4XRS A;  2RRE A;  1OCC H;  2ZSH B;  2CFO A;  2LKP A;  2MW8 A;  4PJJ A;  1FIP A;  5IOY A;  3RI4 A;  5LD2 C;  3ERM A;  1MH4 A;  1MMA A;  3L2V A;  1B4A A;  3RPU A;  2XPY A;  2BVM A;  3B02 A;  3B6C A;  2M45 A;  5E8G A;  1YJN I;  2V9K A;  2DU9 A;  1WCM J;  4Z2Y A;  1R0L A;  1IGN A;  1WGX A;  1DU0 A;  3OSG A;  3CHR A;  2EH3 A;  1IW7 F;  4J3B A;  1VQP I;  2QWW A;  1BC8 C;  3GLX A;  4XOT A;  1SFU A;  3CF5 F;  2QLZ A;  1QHG A;  3R4K A;  4YRV A;  3JRA A;  5B66 C;  3T8V A;  2E7W A;  4ZW7 A;  3BG5 A;  3IH4 A;  3AL0 C;  4XLP F;  1MW3 A;  4M71 A;  1FEX A;  3CLO A;  1ZH5 A;  4YG2 F;  2JA6 J;  5F04 A;  4Y6R A;  4DBQ A;  3LA3 A;  1T95 A;  5H2F C;  2E2J J;  4XMW A;  5GTI C;  1XX5 A;  5M3F J;  1ZEL A;  4WXC A;  2F48 A;  5D5U B;  4Y67 A;  2L0K A;  2E19 A;  3F9K A;  1T33 A;  1FMV A;  3P5J A;  1SD6 A;  3PSF A;  1U5T A;  3RTR A;  3K70 C;  2C6Y A;  4A0Z A;  5EDN A;  1D8J A;  2E1M C;  3GWZ A;  3HGY A;  2FF4 A;  4ZYG A;  1GXP A;  1W36 C;  2BHY A;  2WAQ A;  2VQG A;  2ZME A;  3V8K A;  1K79 A;  1I27 A;  3HSE A;  1ZRE A;  2VQC A;  2IS4 A;  3DBL B;  1A5J A;  3TED A;  3BZC A;  2OTJ I;  1GLN A;  2QKL B;  4ZX4 A;  3UCQ A;  2CQ7 A;  2HDD A;  3G4S I;  4ZQH A;  1RRJ A;  1VI0 A;  2CMP A;  2JRT A;  3BWG A;  2EIJ H;  4UNO A;  2HTJ A;  1A31 A;  1ZG3 A;  2PMZ N;  3GFI A;  2W82 A;  1B9N A;  3JRC A;  3SJM A;  2GA1 A;  5CVV A;  2L9V A;  4HX7 A;  5D6F A;  3NWS A;  3AG1 H;  2KRF A;  1IXS B;  2K9N A;  5KVR A;  1BI0 A;  2XGD A;  2HTS A;  3KEY A;  2H27 A;  2LVS A;  1ZGJ A;  3VVM A;  3BC8 A; 
#chains in the Genus database with same CATH homology
 2EBI A;  3SDG A;  2HOS A;  3B34 A;  2HOA A;  4DZP A;  1BL0 A;  1RET A;  5FKM A;  2R59 A;  2FFL A;  4ZQF A;  3R0I A;  3RKQ A;  3FUD A;  1QPI A;  4B4C A;  2COB A;  2DTZ A;  2IBD A;  4R7L A;  2JA8 J;  3ZHY A;  4QIR A;  1POG A;  4X1E A;  3A01 B;  2ELK A;  5E3N A;  1TC3 C;  2O7O A;  3CZG A;  3WQR A;  1MH3 A;  4ZN6 A;  4ZX6 A;  3HOZ J;  5JC1 A;  5FKL A;  1MBJ A;  4B3A A;  4DZJ A;  1ZS2 A;  2CRG A;  5EG0 A;  2ID6 A;  3JRE A;  5BNG A;  4BY7 J;  4XN7 A;  3ZHX A;  2O9L A;  3JRB A;  3OSF A;  4XRM A;  1NK2 P;  1W0U A;  5HNH A;  5M5X J;  1X3Z A;  4MFD A;  1MSE C;  2GBY A;  4G12 A;  2GM4 A;  1IG7 A;  1IRZ A;  4FE7 A;  2VJ8 A;  4LOC A;  4NQW A;  2CQX A;  2R7Z J;  3HOU J;  2R92 J;  4UUS B;  2ECB A;  4R5T A;  4XNA A;  2X48 A;  5M5Y J;  5JLW A;  1ONN A;  2Y9Z A;  1BW6 A;  1IV6 A;  5FLV A;  1SQM A;  5FKK A;  3BT9 A;  1RP3 A;  3S14 J;  4PU2 A;  1QVU A;  4IHV A;  3ANM A;  4ZX3 A;  1AKH B;  1ONO A;  3T0Y A;  3HB9 A;  1U78 A;  3HOW J;  5J1R A;  3AU9 A;  3PO2 J;  5IYB J;  2R70 A;  4K5N A;  5DYF A;  2H8R A;  2ZB9 A;  1W0T A;  4IEJ A;  3S16 J;  4JND A;  2HOT A;  2JJ7 A;  2DMU A;  1ONP A;  2LKX A;  3B37 A;  5JLX A;  4FIS A;  3EBG A;  5J1U A;  1S7E A;  3H0G J;  4XMZ A;  1O4X A;  2YUS A;  2C82 A;  2CJJ A;  2DQM A;  3Q43 A;  2JMW A;  4XIC A;  4Y7N J;  4A3C J;  3FIW A;  4XO5 A;  4AYS A;  4LUP A;  5DTD A;  1AU7 A;  1TWF J;  4A3I J;  1Z0X A;  3GBG A;  2DA6 A;  1ETV A;  4PVB A;  2ID3 A;  4DYR A;  3A01 A;  1ENH A;  3GTM J;  3GTP J;  2PL5 A;  1H88 C;  4XO4 A;  3S1R J;  2XPU A;  1GT0 C;  4Y6S A;  3IH2 A;  1WPK A;  2CQQ A;  2P81 A;  3GTO J;  3K7A J;  3LOC A;  2PGG A;  4EEF G;  4XN4 A;  5BPP A;  2EZK A;  3HBL A;  2LTP A;  1FTZ A;  2XPZ A;  1IC8 A;  1XG1 A;  4Y6P A;  4C3H J;  2H1K A;  3ZI0 A;  1FJL A;  2Y30 A;  4GFB A;  3G1O A;  3JRD A;  3B2X A;  4MFE A;  1BA5 A;  4AUX A;  1G5A A;  2Y1E A;  4QUO A;  1IUF A;  4FLR A;  4JX4 A;  4UUS A;  2R0Q C;  2NVT J;  3JRF A;  3FUF A;  2DMT A;  2B63 J;  4IHX A;  2CUE A;  1I6H J;  4GAA A;  2ECC A;  3Q44 A;  3DEW A;  3IH3 A;  5FWQ A;  3UEQ A;  1AKH A;  1HLV A;  5E3L A;  3HEF A;  4XK4 A;  3LSR A;  4XN1 A;  2HXO A;  1U9O A;  1UG2 A;  2O8K A;  3CIA A;  4BBS J;  2DMN A;  4ZW3 A;  1S46 A;  4JX6 A;  3FUK A;  3B3B A;  1WH5 A;  5EYR A;  2G0E A;  3GTQ J;  1ETY A;  1MBE A;  4XMU A;  4AIC A;  4QTR A;  4A3L J;  2K9S A;  1Q0L A;  3M4O J;  5DUL A;  3JRG A;  1F43 A;  3BR2 A;  1ZR4 A;  1JGG A;  5C44 J;  1NTC A;  3PM1 A;  2VKE A;  1H89 C;  1JKO C;  1UHS A;  3FU6 A;  4QPE A;  4XN2 A;  1QRY A;  3MVP A;  4XRS G;  3H3V K;  4OOF A;  3FK6 A;  3BTL A;  2NS7 A;  4DYQ A;  4CYC B;  3JRI A;  1HF0 A;  3TW7 A;  3FUE A;  3BR0 A;  3BG9 A;  3O8H A;  4X2U A;  3ZQC A;  2EZL A;  2XPW A;  4M3D A;  3ZOB A;  2NOG A;  5AEN A;  4A3M J;  1ZK8 A;  2LK2 A;  3CZK A;  3ANN A;  4V2F A;  4Q4E A;  4MS6 A;  4XN9 A;  5K7H A;  1LE8 B;  4BKX A;  1JTY A;  2K9Q A;  4XMX A;  5EZG A;  5JO0 A;  3UER A;  1H19 A;  3GTL J;  2MAP A;  2NVQ J;  5M5W J;  1TWC J;  3HDD A;  2EGH A;  4L5E A;  1JJ6 C;  1JKR C;  3W6V A;  3LNQ A;  4IHW A;  3HOX J;  3BQZ A;  1QVT A;  3NAU A;  1HOM A;  1F36 A;  4AYB N;  5E3M A;  5J3L A;  2DMQ A;  5FKN A;  1E3O C;  4K5L A;  5EZH A;  3RC8 A;  1HDP A;  2EQR A;  3FTZ A;  3MKL A;  4C2M J;  2L7M P;  1ZTR A;  2DQ6 A;  4UUT A;  1BW5 A;  3FUJ A;  2JD0 A;  3JT1 A;  3NAR A;  3FUH A;  2WV1 A;  2XSD C;  4NDL A;  2VUM J;  3TP0 A;  1ORK A;  2R5Z B;  1XC5 A;  2WB1 N;  4K5O A;  5FJ8 J;  4AR1 A;  2D5V A;  1APL C;  2M0C A;  2IEK A;  4XO3 A;  3EBI A;  5IYC J;  3JR9 A;  2MGQ A;  4B1R A;  2WZG A;  5IP7 J;  3FU0 A;  1VF9 A;  4CYC A;  2QVW A;  1HS6 A;  2YU9 J;  5HNF A;  4A03 A;  4ABZ A;  1ETK A;  2JCV A;  3RZD J;  3FHE A;  5JMP A;  4D7M A;  1K5H A;  2GLO A;  4K5P A;  3FIS A;  3A14 A;  1R9T J;  2JWT A;  2E2I J;  3FUI A;  5K7Z A;  1DU6 A;  4ZW6 A;  2XB5 A;  1LE8 A;  4FCA A;  1X58 A;  3BTI A;  2C5Z A;  2LY9 A;  2HQ5 A;  2OF7 A;  2OPT A;  2TRT A;  1OCT C;  1P7I A;  3PUU A;  1K83 J;  1P7J A;  1B8I B;  1ETW A;  2CUF A;  3I4N J;  1JUP A;  3D1N I;  3S1M J;  3HKZ N;  1JG9 A;  3FH5 A;  3CHP A;  5J1Y A;  4A3J J;  3ZQL A;  2M9H A;  2JV7 A;  5GPC A;  3FTY A;  3BR1 A;  2TCT A;  3FTS A;  2A7O A;  5IP9 J;  3B2P A;  1MBH A;  1OR7 A;  1Z77 A;  2LP0 A;  4I76 A;  1IDZ A;  2LR8 A;  3BTJ A;  3FH8 A;  2Y1F A;  1MBG A;  2HI3 A;  3QQA A;  1T1S A;  3IIE A;  2R93 J;  1UMQ A;  3RZO J;  2MSY A;  4V2G A;  3PO3 J;  1Q0Q A;  1K61 A;  2O7G A;  3CCY A;  2WPG A;  3HM5 A;  4AR9 A;  1YRN B;  3RAS A;  1RPW A;  3S15 J;  3CDL A;  4BXX J;  1MW2 A;  2R5Z A;  4FTH A;  2K40 A;  1JGI A;  4MIM A;  1JTX A;  1Y1W J;  5EV7 A;  1SAN A;  2VLA A;  1R0K A;  1MW1 A;  2Y1G A;  4BBR J;  2ME0 A;  9ANT A;  2M8G X;  2Y31 A;  3Q0W A;  1RKW A;  3S1Q J;  4QME A;  1MW0 A;  3FUL A;  2DJN A;  3JRH A;  3FU3 A;  1X3W A;  4D5C A;  1RES A;  2DA2 A;  2VI6 A;  1MSF C;  5F0H A;  2M2E A;  3RC3 A;  1T1R A;  1MBF A;  3QPS A;  4J19 A;  4ZQG A;  2I10 A;  4JP0 A;  1GVD A;  2DA3 A;  3K2A A;  2DA5 A;  4A3F J;  3BR5 A;  5K7F A;  3BTC A;  4W97 A;  5HOD A;  4A3E J;  3ZQF A;  2X6O A;  5EEA A;  4XID A;  1NK3 P;  3GTK J;  3CHS A;  1WI3 A;  2AO9 A;  3LSJ A;  3FU5 A;  2JD1 A;  3VPR A;  2DA7 A;  2YS9 A;  1JJ8 C;  5HLT A;  4QHP A;  4M3E A;  1B8I A;  2RAE A;  2EZH A;  2MAO A;  3HOV J;  5F1J A;  5C4J J;  3Q0U A;  1LFU P;  2IAI A;  4M3F A;  2NVY J;  5F08 A;  4BY1 J;  4MLO A;  2LFB A;  5GPA A;  2JA5 J;  3FKI J;  2PUS A;  3FTW A;  3OOU A;  1GV5 A;  1PUF B;  3WHB A;  1JKQ C;  1SC5 A;  3E7L A;  3U9W A;  1ETX A;  4RDU A;  5EGO B;  3TP3 A;  1XS9 A;  2GTQ A;  3CQZ J;  3IV5 A;  1WH7 A;  4Y52 J;  4DW6 A;  2Y9Y A;  1TWA J;  2WAQ N;  1MVY A;  1GW6 A;  4ZW8 A;  2QJ1 A;  1X2M A;  3FTU A;  1MNM C;  4QSH A;  3S17 J;  1FIA A;  1YRN A;  1HCR A;  4FLO A;  2HXI A;  1ZQ3 P;  2KT0 A;  1VND A;  2LD5 A;  3B7T A;  5DLL A;  2XGC A;  3BR6 A;  4C3I J;  2Y2Z A;  5FLM J;  1EF4 A;  2RJI A;  5IPA A;  4ZQE A;  4RCV A;  3ZQH A;  2JK3 A;  4A93 J;  3A03 A;  4JX5 A;  4D7N A;  5FKO A;  4A3D J;  4KP7 A;  1JUS A;  2NVX J;  1U8B A;  4Q4I A;  1U9N A;  1X2N A;  1OCP A;  3WQS B;  3L1P A;  2VPR A;  1I3Q J;  3MN2 A;  3FK7 A;  3CHQ A;  3FTX A;  2XRL A;  1GV2 A;  2JD2 A;  5JAZ A;  1BJZ A;  4XND A;  3ZQI A;  4RVB A;  3CZE A;  2FJ1 A;  3Q0V A;  1ZKG A;  3A02 A;  1SG7 A;  3WQQ A;  3BQY A;  3F0C A;  4FE4 A;  2XB0 X;  1G2H A;  3ANL A;  2N8G A;  2W48 A;  1I50 J;  4ZQT A;  4M3B A;  2FQ4 A;  3SFI A;  2EZI A;  4DYC A;  3CMY A;  1T56 A;  1H3L A;  3AU8 A;  3QJX A;  2X9D A;  2KDZ A;  2L7Z A;  4M3G A;  2JCX A;  1SFO J;  2M34 A;  2CU7 A;  2JN6 A;  2R5Y B;  1OFC X;  2DMP A;  5IP6 A;  3Q3S A;  3UKG A;  5F27 A;  2L9R A;  1CQT A;  1HDD C;  3HOY J;  1PUF A;  4XN5 A;  5IYD J;  4C3J J;  3ZHZ A;  2HPO A;  4D5F A;  2Y1C A;  1A6I A;  4L2L A;  5EGO A;  5M3M J;  1ETO A;  2E1O A;  3JSZ A;  2MG4 A;  4FLS A;  2Y0S N;  5IOZ A;  5F0C A;  4XRS A;  4ARF A;  1GDT A;  2DA1 A;  3GTG J;  2MW8 A;  1RR7 A;  5C4X J;  4A3B J;  3ZQG A;  3FUN A;  1FIP A;  5IOY A;  1MBK A;  3GTJ J;  3HGG A;  1MH4 A;  2L7F P;  4M6V A;  3B7U X;  4ZW5 A;  2XPY A;  2XQ0 A;  2B61 A;  3B6C A;  2QF7 A;  3QPL A;  4FCY A;  3B7R L;  3CHO A;  3EBH A;  1JT6 A;  1WCM J;  1R0L A;  1IGN A;  1WGX A;  1DU0 A;  4DPR A;  4A69 C;  3OSG A;  2JCY A;  3B7S A;  1JUM A;  4XMV A;  2DA4 A;  4S0H B;  4XNB A;  3CHR A;  2EH3 A;  1B72 B;  4J3B A;  1LFB A;  1JKP C;  4CXF A;  1ETQ A;  3S1N J;  3LSG A;  2LLK A;  3DCF A;  1JVS A;  4PW4 A;  3T8V A;  3JRA A;  5F0F A;  3C2B A;  4ZW7 A;  2E2H J;  3BG5 A;  3IH4 A;  1ZGW A;  4XMT A;  1MW3 A;  1FEX A;  1IDY A;  1IJW C;  2JA6 J;  2R72 A;  5F04 A;  4Y6R A;  4XN8 A;  2ME6 A;  1OJL A;  4ZX5 A;  4AR8 A;  5JBI A;  2E2J J;  4XMW A;  1TWG J;  2AHQ A;  4JYK A;  5DS9 A;  4AC0 A;  5M3F J;  2DN0 A;  4X6A J;  3AUA A;  4QIW N;  1VFC A;  4A3G J;  5E3O A;  2L0K A;  1H8A C;  1ZR2 A;  4Y67 A;  1Q1V A;  2VKV A;  5EG0 B;  2R5Y A;  4A3K J;  3A06 A;  2E19 A;  4IHY A;  1T33 A;  4I6Z A;  2HYJ A;  1Q0H A;  5EDN A;  3HGY A;  4GAE A;  5JMW A;  3CZL A;  5EF6 A;  3S2D J;  4HNV A;  5GP9 A;  1Y1V J;  4RSY A;  3I4M J;  1FTT A;  2WZF A;  5JNL A;  5C3E J;  2XPV A;  2XGE A;  3VVL A;  3OIO A;  4W1U A;  3LSP A;  3M3Y J;  3FH7 A;  1A5J A;  3TED A;  1D5Y A;  3BR3 A;  3TW6 A;  3FTV A;  4K5M A;  4ZX4 A;  2QCO A;  3G1M A;  3UCQ A;  2HDD A;  4MKT A;  4ZQH A;  1JT0 A;  1VI0 A;  3B6A A;  2FD5 A;  1RKT A;  2PMZ N;  1AHD P;  4FLQ A;  3FUM A;  3RQI A;  4R5V A;  2ZXG A;  3KED A;  3JRC A;  3BG3 A;  3SJM A;  2NS8 A;  3O8G A;  2Y1D A;  4OOE A;  3WHC A;  2FX0 A;  2HPT A;  1GUU A;  2K9N A;  2XGD A;  1TWH J;  4MO7 A;  4RBO A;  1B72 A;  3G1L A;  1ITY A;  3VVM A;  2LVS A;  4R5X A;  2JA7 J;  3S2H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...