4BKXA

The structure of hdac1 in complex with the dimeric elm2-sant domain of mta1 from the nurd complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
161
Chain Sequence
GEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Class I Hdacs Share a Common Mechanism of Regulation by Inositol Phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords METASTASIS-ASSOCIATED PROTEIN MTA1
total genus 43
structure length 161
sequence length 169
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bkxA02
1.10.1740.200 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4bkxA01
2DA3A 3QPLA 1EF4A 4IHVA 1ETKA 1AHDP 2OF7A 5M5XJ 4A3JJ 1U9NA 3BG5A 4W1UA 3MVPA 2FJ1A 3BT9A 1W0TA 3JRIA 4BBRJ 2H1KA 1IDZA 5EYRA 5M5WJ 2VKEA 2HQ5A 3HEFA 3Q0UA 3CCYA 4M3GA 3Q0WA 2M34A 5EZHA 2K9SA 2DMTA 3JRCA 2P81A 3A01A 3HGYA 2VPRA 1VI0A 5F27A 5FJ8J 1TC3C 1WPKA 4M3EA 2CQXA 5M3MJ 1VF9A 4AYBN 3JR9A 1F36A 3G1LA 4JX4A 2LFBA 5EEAA 2ID3A 1PUFB 1D5YA 1UG2A 3C2BA 3CDLA 1O4XA 1ZR4A 3JRHA 3ZQLA 4B3AA 5FKOA 4D5CA 3UKGA 2DA5A 2LLKA 5IP7J 2XRLA 2XSDC 4QIWN 2K9NA 4A3IJ 2GBYA 2JJ7A 3I4NJ 3PM1A 3TW7A 4A3DJ 3WHCA 2AHQA 2FQ4A 3GTPJ 2VKVA 1GV2A 3LSPA 4V2FA 1ETYA 2NVTJ 1MNMC 4DZPA 1X58A 3FIWA 4A3CJ 1E3OC 5FLVA 1QPIA 3A02A 3BR1A 5C44J 2O8KA 1LFUP 3NARA 4X1EA 1VFCA 4B1RA 2R92J 3GTGJ 1X2MA 3HOVJ 1ETXA 1JJ8C 3JRBA 1ZGWA 3ZQGA 2O9LA 3A03A 3IV5A 3VPRA 1GDTA 1WCMJ 1MBFA 1RESA 3LSJA 3HOUJ 2AO9A 4XRSG 3I4MJ 2DTZA 1FEXA 5M5YJ 3L1PA 3OSGA 2NS8A 4UUSB 5FKLA 2H8RA 3H3VK 1MBJA 1A6IA 3BR0A 2TRTA 1AKHB 4NDLA 3GTOJ 3M3YJ 4LOCA 2ECCA 4MIMA 3GTLJ 1ETOA 2LKXA 1RPWA 1ETWA 2W48A 3BG9A 2LVSA 1LFBA 1MBKA 2DJNA 2ECBA 1U8BA 1P7IA 3S2HJ 1OFCX 2K40A 3ZQIA 2ELKA 2HOAA 3BTCA 3TP3A 3JRAA 1IRZA 1NK2P 3JRDA 1TWFJ 2R5YA 1B72B 4MFDA 3IH4A 5DTDA 2XGEA 4I6ZA 5FKMA 1BW5A 4HNVA 4B4CA 4JP0A 1P7JA 1FIAA 1JKPC 1IUFA 2B63J 3O8HA 4C2MJ 2LP0A 2DA1A 2E19A 4G12A 1H8AC 1CQTA 2HOTA 4UUSA 1JTXA 1JGGA 1YRNB 5F08A 5K7HA 3LSRA 5C4JJ 2NS7A 2QF7A 2DMPA 3RZOJ 1AKHA 4C3HJ 2K9QA 3SDGA 1JKRC 2R0QC 3FISA 5EG0A 2WV1A 3TW6A 3WHBA 1R9TJ 4IHXA 3HGGA 4XK4A 1NK3P 1BJZA 2XPUA 3Q0VA 3S1MJ 4M6VA 4ABZA 2ID6A 2JN6A 1GT0C 3ZQHA 2EH3A 4S0HB 5IYCJ 2XGCA 1T33A 1F43A 2FX0A 5BNGA 2Y9YA 2KT0A 1QVUA 4Y7NJ 3O8GA 4M3BA 5F04A 1JKQC 1TWAJ 5IP6A 3ZQCA 3BQZA 1VNDA 2NVXJ 3GTQJ 3GBGA 2L0KA 2JA7J 4A3EJ 3HBLA 3HDDA 1FTZA 3E7LA 4JX6A 2EZLA 5JLXA 1QVTA 3IH3A 4UUTA 4V2GA 2G0EA 3JREA 4MLOA 1YRNA 4DYRA 1Z0XA 2EZKA 2XPVA 1MSEC 5K7ZA 4Y52J 2OPTA 5IYBJ 5IYDJ 1QRYA 1OJLA 1XG1A 1ITYA 3QPSA 3FK6A 3S1NJ 1LE8B 1Y1WJ 2QCOA 2EBIA 1IC8A 1MH4A 2MGQA 3BQYA 2DA2A 4C3JJ 3LSGA 2R7ZJ 2EQRA 5FKNA 3PO2J 2LK2A 4QTRA 1DU6A 1X2NA 5HODA 3OSFA 1BL0A 2N8GA 2HDDA 3B6AA 3HOWJ 2ZB9A 3BR5A 4FE4A 3DEWA 1XS9A 3GTJJ 1HF0A 2NVQJ 4IHYA 2JA8J 5GPAA 4BY1J 1TWHJ 3S15J 2X9DA 3MKLA 5IP9J 1UHSA 2E2IJ 2DA4A 3M4OJ 1I3QJ 2PMZN 2R5ZB 4DYQA 1TWGJ 4BBSJ 3GTKJ 1Z77A 4BY7J 3RKQA 4A3LJ 2TCTA 3A01B 1IGNA 1XC5A 4BXXJ 2M2EA 5E3LA 1K83J 4JX5A 2DA6A 1SFOJ 1IJWC 1JJ6C 5EGOA 3SJMA 3MN2A 1H88C 4DZJA 1MSFC 2Y31A 4FE7A 2CUEA 2XGDA 4CYCA 2HYJA 1WGXA 4XRSA 1APLC 1JUMA 2YU9J 2YUSA 5EF6A 2WAQN 2WB1N 4GFBA 1GVDA 2L7FP 2CJJA 2ME6A 5FLMJ 3IH2A 3S14J 2EZIA 2CRGA 4W97A 2D5VA 4C3IJ 1Q1VA 5EZGA 4JYKA 2E1OA 2IBDA 1WI3A 1U9OA 3RQIA 1B8IA 1I50J 4A3FJ 4IHWA 2HXOA 1SANA 2X48A 2E2JJ 1ENHA 1JT0A 2MSYA 1NTCA 3JRFA 4J19A 4FTHA 5J3LA 2IEKA 2KDZA 1K61A 1JUSA 3CQZJ 1HLVA 4A3GJ 2L7ZA 2R5YB 5M3FJ 1B72A 2HI3A 1WH7A 9ANTA 3RZDJ 3K7AJ 2LD5A 1JTYA 1GUUA 5IPAA 1DU0A 1I6HJ 1FJLA 4DYCA 1U78A 4AUXA 1RKWA 2XB5A 1AU7A 3NAUA 2Y0SN 2HXIA 1ZTRA 4XICA 4QSHA 1FTTA 4DW6A 3GTMJ 2Y30A 4M3DA 2JK3A 2JA6J 3BTIA 1IG7A 2LTPA 4D7NA 1ORKA 4A3BJ 1WH5A 2M0CA 5GP9A 1UMQA 5EDNA 4AC0A 5EG0B 2O7OA 3D1NI 3S1QJ 2Y2ZA 3K2AA 1MBHA 4XIDA 2L7MP 4FISA 5FKKA 3BR6A 1RETA 1OCPA 1POGA 4XRMA 3S17J 2E2HJ 2DN0A 5EGOB 3CMYA 4MFEA 3TEDA 3BR3A 4L5EA 5J1UA 5F0FA 3S1RJ 3ZQFA 3ZOBA 2DMNA 2NOGA 4CYCB 2VUMJ 3S16J 2VI6A 2Y9ZA 1MBEA 5J1RA 4FCYA 2HOSA 2I10A 1ZK8A 2L9RA 2R93J 2JMWA 1HOMA 3BTLA 2IAIA 3QQAA 2X6OA 5C4XJ 4D7MA 3TP0A 1ZKGA 5JLWA 2M8GX 3FK7A 1HDDC 4RBOA 1MBGA 1B8IB 2YS9A 1HDPA 3HOZJ 3OIOA 3F0CA 2CU7A 1JT6A 3G1OA 3HOYJ 4A69C 1Y1VJ 1A5JA 2GM4A 3LNQA 5E3NA 2LY9A 1W0UA 5E3OA 4A93J 1RR7A 1ETVA 4D5FA 1TWCJ 1BA5A 2XPWA 1G2HA 1PUFA 1FIPA 4EEFG 2MW8A 1H89C 3G1MA 1HCRA 1BW6A 2EZHA 3JRGA 4A3KJ 5F1JA 3BTJA 3HB9A 3Q3SA 3HOXJ 4A3MJ 3W6VA 3HM5A 5IOZA 2NVYJ 1JKOC 1IDYA 2RAEA 5GPCA 1IV6A 1JUPA 2CQQA 5DS9A 5J1YA 2M9HA 1ZQ3P 2GLOA 3PO3J 3H0GJ 3BG3A 1LE8A 2FD5A 1RKTA 3HKZN 2R5ZA 1OCTC 2ME0A 1MH3A 1ETQA 5E3MA 3S2DJ 2LR8A 3OOUA 4MO7A 5IOYA 1S7EA 4X6AJ 3B6CA 2DMQA 4I76A 1ZR2A 1T56A 1GV5A 2DA7A 5C3EJ 3SFIA 2XB0X 4RDUA 5K7FA 3FKIJ 2DMUA 3LOCA 4M3FA 5F0HA 2MG4A 4IEJA 4BKXA 2CUFA 5F0CA 3DCFA 2COBA 2JA5J 2JWTA 3BR2A
chains in the Genus database with same CATH superfamily
3KCCA 5CKTA 3JAMZ 4DPRA 1FYKA 3SXYA 1ZRCA 2OF7A 5M5XJ 4A3JJ 2AXTC 3KFWX 4G6QA 1U9NA 3H5AA 2Z33A 2QYOA 2H94A 3I5UA 2KIMA 3MVPA 3BT9A 3IAM2 3BZ6A 2NS0A 3G6EI 1KU7A 1DUXC 4NC7A 2H1KA 2V79A 2VKEA 4K5OA 4GCVA 2DQRA 3HEFA 1JI8A 5JI6A 3Q0WA 2M7BA 3ZR8X 2R7UA 2V6EA 2DMTA 1RUOA 3K10A 2CYYA 4ASNA 5ERIA 3HGYA 4JNDA 2DODA 2DYSH 1W5CC 2R7RA 5F27A 2P6SA 2P0WA 1TBXA 2DQ6A 1MMAA 4D9JA 1TC3C 5B1AH 2VQHA 3B34A 3PNYA 1MZBA 5TRDA 5M3MJ 3SZTA 4AYBN 3RI4A 1F36A 3CJNA 4WF2A 3T1BA 2VE9A 2Y0MA 4PFPA 1ONPA 2D2WA 1UG2A 1YE9A 1ZR4A 2CGPA 1JG9A 2A68F 2BE5F 1E0EA 1IO2A 2IXSA 3BOQA 1VQ8I 3KYDB 3UKGA 1VQMI 4XN2A 2JD0A 3J81Z 3I58A 5H2FC 1X4PA 2JRTA 2XRLA 3VYSB 4MKTA 3W2AA 2K9NA 2JJ7A 3I4NJ 4A3DJ 2CV0A 3ZMDA 2VQCA 2VKVA 4BQOA 1GV2A 2OV7A 3EUAA 2LY2A 3J7ZI 5KCMA 4UVAA 4A3CJ 1SFEA 4BHBA 4BQNA 2VJIA 4KA4A 2O8KA 3CUQB 2OZUA 2BY0A 4X1EA 5E1ZB 3SEQA 2L5QA 4ZX4A 5JO0A 1A04A 2MAPA 3U21A 5J40A 2LSOA 3JRBA 3A03A 2WY8Q 3IV5A 1LEAA 1GDTA 3W2WA 2VOOA 4Y4RA 3B2PA 4XRSG 3J80K 3RPUA 3OSGA 3OMYA 3CCSI 2NS8A 4QPOA 4UUSB 3ZRGA 3KPHA 2XQ0A 3OV8A 3PIPF 1MBJA 1A6IA 3BR0A 1EJ9A 4KT5C 2TRTA 2GIVA 4NDLA 4LOCA 2ECCA 2ZXHA 1UB9A 1QZZA 3ZMVA 4E7IA 3ULQB 3FDYA 2LKPA 4LK0F 3BG9A 1ZREA 2F4OB 3F8NA 3AAFA 2ECBA 1U8BA 3FXJA 1OFCX 2ZXIA 2BV6A 2NNNA 3SFZA 3BTCA 4CA0A 1FX7A 1K4TA 1NK2P 3I55I 4KUMA 5J8CA 3CCJI 1PYVA 5DTDA 4Q4IA 3OR2C 5FKMA 1ZN2A 3LQQA 4A5NA 2DOAA 4B48A 3PQJA 1G5AA 5CVRA 2DO7A 2HYGD 2Z2SB 1BR1A 1D0ZA 2A69F 2KP6A 4F91B 1VQKI 3IWFA 4HZFA 5DYFA 3R61A 3CCEI 5LEKA 1T0FC 2LP0A 4LLNA 3FKJA 4FT8A 1H8AC 2HGCA 1BR4A 2HOTA 1QPMA 3X2QH 1JTXA 2E7XA 3TO7A 2E60A 2Z5UA 1IV8A 3DKYA 5C4JJ 1VQ7I 2BW3A 4PJNA 1ZGJA 5LRRA 5BS6A 3JSOA 3WQRA 2DPUA 2R0QC 4MEYF 3FISA 2DT5A 1Y56A 1ZRFA 4IQJA 2B7EA 2H27A 3C7JA 3HTSB 4IHXA 1BJZA 2LF8A 2XPUA 3Q0VA 3S1MJ 4XMVA 2JN6A 3ZHXA 2CWEA 4BYYA 3JAMK 4HRIA 1USTA 2EH3A 4S0HB 4J00A 2DFHA 3FUFA 2KT0A 2HPMA 1QVUA 2GXGA 4O3MA 2VN2A 2QSGX 1B9NA 5CVUA 2LC2A 1TWAJ 4G6DA 3QYBA 1FBSA 2DYRH 5DUIA 3GUDA 1VNDA 2H09A 2DQMA 2L0KA 3S93A 3V7RA 1FTZA 3E7LA 4JX6A 4HAMA 4CCJA 2LREA 3TOBA 4BE2A 5E79C 3H35A 1FP1D 1SVOA 4IQ4A 2COMA 1U3EM 2JSCA 3BCAA 3MQ0A 3EPZA 5AIPA 3GEZA 2QZ8A 2KQRA 3CIAA 2OPTA 3FUEA 3W3CA 3LSMA 1DGWY 2QA4I 1J7KA 3DF8A 1V5EA 3DKWA 3WGHA 2PI0A 1XG1A 3QYEA 4KITB 1YO5C 2HWVA 2MA3A 3R0IA 3DPUA 5H6QA 4ENKA 2EBIA 2JVHA 3IAS2 1SQMA 2B9SA 3FXMA 4KJZA 3LSTA 2PQ8A 2MGQA 3SZPA 1S7AA 2RJIA 2R7ZJ 1V3FA 1LEBA 3FUMA 5HDKA 4AIJA 4I0BA 2X6WA 3OOPA 1LDKB 4QTRA 4RB2C 2W84A 3OSFA 3S3OA 4EM0B 4XMTA 1FMWA 2N8GA 2XAGA 2X4HA 4AIKA 1FY7A 2F4MB 2O03A 3B6AA 4AU7A 5LHHA 3CHPA 3H1CA 3KE2A 3GTJJ 3RDIA 5EV7A 2JCXA 3NWSA 3F8MA 3EBIA 5D8LB 2X9DA 4II2A 2VJ8A 4ZX3A 3MWMA 3FH7A 2K3FA 1XSXA 4ZQEA 2R7QA 2IGMA 2K5CA 1HW5A 1I3QJ 4FHTA 3L2UA 3H5NA 2PEXA 3MZHA 4FCAA 5K1YA 2VT3A 3GTKJ 4U7BA 2PMUA 1HXDA 3EDPA 2X51A 4BXFA 1T8IA 2TCTA 4S05A 1YOVB 3A01B 2VASA 1XC5A 2EB7A 3I54A 3LQRA 3OIPA 5DEQA 2V9KA 2R7OA 1ERDA 2K27A 1WFXA 5J4VA 5LEJA 3KLOA 2IS6A 2VXZA 1X1BA 3QYFA 2GA1A 3MN2A 4I98B 3V8KA 2K9MA 3QWLA 5LGNA 2CUEA 1BI2A 2VBXA 2R7SA 3G2BA 2XGDA 4CYCA 1XCVA 1Y0UA 1FSEA 4HW0A 1MGTA 1TP4A 3HC7A 3ECHA 3KP5A 4XRSA 1APLC 2JPBA 1JUMA 2OQRA 3CZLA 4ARFA 1RUNA 3PUUA 2FOWA 1GVDA 3NRVA 4B8XA 4YIRX 3CC4I 5FLMJ 4L9TA 2GXBA 1Z7UA 4AVPA 1VQ6I 4W97A 4F52A 4WCGA 2D5VA 1Y39A 2W57A 3IKTA 5CVVA 3DBRB 3CF5F 1U5TC 4Z2YA 3L00A 4OMZA 1WI3A 3NEUA 3F8CA 3QAHA 3B7UX 1U9OA 4GYIA 1K7AA 2X1EA 1I50J 2CQKA 2ZMEC 1O3TA 2HXOA 5CQGA 2X48A 4XNFA 2JRMA 1NTCA 4FTHA 3P9IA 5GAEJ 4BDYA 2KDZA 4DIQA 2JT1A 2L7ZA 4MQVA 2M3AA 2QSFX 3EQLF 4AD9A 1TNTA 4KMUX 4OOFA 4ZW8A 2QQBA 5DYMA 1P4XA 4U87A 5IPAA 4ENJA 5FGMA 1I6HJ 5FLXK 1SD6A 4UVBA 5ICFA 3T8TA 5D5XB 4AUXA 4RAZA 4ZW7A 2B0LA 1AU7A 2KRCA 3FU5A 3RASA 2Y0SN 2O3FA 2B61A 1S6LA 4YRVA 1T39A 2W4SA 2BYVE 1YJ9I 4K5LA 1CF7A 4JBAA 2IPQX 4LG0B 2JA6J 3E6CC 1BI1A 2KIQA 1FP2A 3BTIA 3M1EA 1IG7A 2E1CA 1AOYA 4D7NA 2JUCA 2ZJRF 2KFDA 1ORKA 5LRSA 3KEOA 2M0CA 4LUPA 1WJ5A 5HDNA 3UR3C 2JQ7A 1BIBA 3P5JA 2LMDA 3LA7A 2O7OA 4BE1A 4L0ZB 2YU3A 3K2AA 4XIDA 1FMVA 5FKKA 3CZEA 3PUBA 2ZJ2A 3OYKA 2Q2EA 1FT9A 3OYIA 3QJXA 1F1ZA 4YFKF 2DK8A 2EV6A 4HEA2 3HSFA 3TEDA 3BR3A 4L5EA 3D5RC 2PX9A 1W7PD 3ZQFA 3FXUA 3ZOBA 2QQ8A 5GTHC 1KQ0A 4PJMA 4ZDPA 2UXXA 3S2WA 3FTWA 3WTYC 4FQGA 2FOKA 4GDFA 1Z7LA 2HOSA 1GXQA 3VVLA 2K3PA 3KZYA 4IKFA 1BJAA 2X1CA 3FHEA 4OOEA 2Z1DA 2RVCA 3GW2A 4A0ZA 1N25A 5B66C 3DLAA 2E5NA 4JOMA 1U5TB 2EV5A 3COAC 3M8FA 3FTVA 3TKYA 3BPVA 4D7MA 4XLFA 3FK7A 1HDDC 4RBOA 1B8IB 3CO6C 1HS6A 1OYIA 4CCOA 3OIOA 2CU7A 3F8FA 1S29A 3OYDA 3FXLA 1UZCA 2L2OA 5JNLA 3ONQA 4WK8F 2FEZA 3Q9VA 3BY6A 4R8HA 1S3JA 2ESHA 1IRGA 2BXYA 3CTAA 5E3OA 1ETVA 2MBFA 1KGSA 2HTSA 4HSTA 3T8RA 2MYSA 2CUZA 2KL4A 2CG4A 2XPWA 1R23A 2VBYA 1MJ9A 2HPTA 3R0AA 1BW6A 3BROA 5D5VB 4A3KJ 5F1JA 3BTJA 5JHUA 5HLIA 4A3MJ 3W6VA 3J80Z 3HM5A 4P5OA 4KIFA 2W25A 1TW3A 1A35A 3Q5FA 1P92A 1IDYA 1BC7C 2CQQA 2R70A 3W6KB 1ZQ3P 2GTQA 2XPZA 4UHTA 4ZTFA 1FNNA 3PO3J 2QKMB 2KJBA 1J9IA 1LE8A 3HKZN 3QP6A 2STWA 4Q4EA 1Z05A 4XSZF 4MO7A 2IS1A 3QOPA 4K5NA 2DOEA 2CUJA 3BP8A 4XL9A 3B6CA 2PJRB 2DMQA 4C9YA 3R6SA 2VKDA 1MMNA 3C3WA 1GV5A 1SG7A 5K5RA 4HLYA 4WXHA 3GCMA 2F2EA 5C3EJ 1L0OC 3IRRA 3FHNA 4NC8A 5K7FA 2YPRA 3M9AA 5HNFA 2UXNA 1G4DA 4BKXA 2DBBA 1BI3A 3F6VA 3JTHA 5F0CA 2P8TA 3ML6A 1T08B 2JA5J 2XF7A 4OIOF 5BPIA 4MGRA 1ETKA 2O7GA 3H92A 3KP4A 5E18F 4FASD 3ZMTA 4ZN6A 4W1UA 2LG4A 2FJ1A 3ZMUA 4UB8C 4BBRJ 4OIQF 1IDZA 5M5WJ 1EV7A 2JVGA 2OC6A 1D0XA 3MKWB 2QVOA 1R4MB 1H9GA 4HA8A 3MZYA 3OWTA 2DW4A 2RV8A 3CMMA 3FWEA 2K86A 3FTYA 2VPRA 1VI0A 3IP4B 5FJ8J 2BVLA 4N9HA 4BQQA 5KK1A 1QA6A 2QSHX 5A2QK 2K4JA 4KIBA 3FM5A 3TMOA 2LFBA 4HNUA 5EEAA 4U0WA 2ID3A 3K70C 1H0MA 3C2BA 2WAQA 3TDUC 3VDXA 1NG6A 3JRHA 2W82A 4CHUA 4OWRB 3OYMA 1MNEA 2HVSA 2HFHA 4MEXF 3HUGB 1XSVA 2OCEA 4QIWN 5ICEA 3I64A 4A3IJ 1YQAA 2ZFWA 1W7PB 1O7FA 3TW7A 3WHCA 1JVSA 3GTPJ 3FTZA 5TJJA 1R71A 4RM2A 2W00A 3T5XA 3RQ4A 1G3TA 1G3WA 2ADUA 2HTJA 4FX4A 1X58A 1VQOI 1FYLA 1MNMC 1OISA 4XN1A 4EJUA 4CSWA 4B44A 4EJTA 2CH0A 3NARA 3P7NA 1QU3A 3OYBA 3LL7A 3C1DA 2AXLA 5FO5A 4B1RA 2FE3A 2GXAA 2F5EA 2CS3A 5HLTA 3OYJA 1ETXA 4G9YA 5L3CA 4HF0A 4YFNF 1IN8A 2EILH 1WCMJ 3CC2I 3H36A 5J47A 3CCRI 5DD4A 3LSJA 3CJQB 2VJJA 3GXOA 1FEXA 4E7LA 1XGOA 2GOMA 2WBMA 2W7NA 2PLYA 2OD5A 5FKLA 2H8RA 1FPQA 3KEDA 1XN7A 3E1SA 3CC7I 1YW9A 3DFGA 4M74A 5GADJ 3H3VK 2AS5F 1AKHB 4LIUA 4OIRF 2FSWA 4RVBA 1Z67A 1ODDA 2LKXA 2DU9A 2VQLA 4XNBA 1BOAA 4RGUA 3EUHA 2R4GA 5GAGJ 4IRHA 1R49A 1QZEA 2DJNA 5FLXZ 3BG7A 4BUPA 3DBLB 2RDPA 3TGNA 3CESA 3M1CA 3TP3A 1IRZA 4C30A 2MABA 2R5YA 4MFDA 3IH4A 5FWQA 4I6ZA 3LWFA 3N97A 2DFFA 2J5OA 4K2EA 2OTJI 3GZNB 3J7AO 1MW3A 3CHSA 1JKPC 1WVRA 1XGMA 3I0TA 3OYCA 1TQMA 2QQ9A 3O8HA 3I56I 4ZX6A 4C2MJ 2CW0F 3H9JA 2F5CA 2DA1A 2Y0SA 2WTEA 3A4CA 3AG3H 3I9V2 3AU9A 2BOLA 3FF5A 4IOCF 1JGGA 1YRNB 2EIKH 2XIGA 4U0VA 5D6EA 5K7HA 2NS7A 3ELKA 4Q48A 1AKHA 3B2XA 4YG2F 2L01A 1I1SA 5EG0A 2RC4A 1UJ8A 4EV0A 4BDZA 1VTNC 1R9TJ 1S46A 3HGGA 4J01A 3DV8A 4P9FA 1R1VA 2P4WA 2OQGA 4M6VA 4LFUA 3OYLA 5D4SA 4AR9A 1GT0C 2HPIA 3OYHA 2XAJA 4Y33A 4KNYA 4WXCA 1T33A 3FUKA 2FX0A 1FOKA 3OYFA 3DPTA 4E6KG 1REPC 5K5OA 2OCCH 3O8GA 3L2RA 3RSNA 1IXRC 3LAPA 4ESFA 4XN7A 3BQZA 2Y1DA 4BE0A 4UVCA 3S3NA 3GBGA 3KIOA 4PK4A 4BJ5C 5DCMB 3HBLA 1K4SA 5LBQA 2UV1A 2EZLA 2X6YA 1QVTA 4V2GA 2ACJA 2G0EA 3Q43A 3VYTB 3UNGC 3JREA 3CCMI 1YRNA 1MDMB 4HQMA 3CUOA 2EZKA 2XPVA 3SEZA 3N4MA 4Y52J 3BC8A 1FBQA 3AU8A 3D5LA 2ICWG 1W5TA 4UNOA 5ILVA 1ITYA 1D3YA 2R7WA 1XGNA 2XKPA 3FK6A 1OYWA 5BMZA 1D1BA 5DUKA 2XDVA 1Z9CA 2VL8A 4A2UA 1E17A 1X3UA 2FNPA 4PJJA 5IT3A 1YX5A 1E2XA 3BQYA 2CV2A 4G8XA 4BHCA 3LSGA 1NHAA 2E5ZA 2EQRA 4HX7A 4M72A 2GAUA 2DJIA 5HS8A 1JGSA 3PL8A 1ZLJA 2LK2A 4CCNA 2QM3A 2M7AA 3WTUC 3J81K 5LGUA 1WKMA 4ZQFA 3K1NA 4G94A 4IPAA 3HL2A 5HNHA 2JZYA 1J2XA 5AONA 2HNHA 1ZAOA 1F4KA 3E6DA 3CCUI 3V8LA 1R7JA 1XS9A 3KP7A 1SEUA 1NG7A 3CLQA 2QLZA 4GRIA 1TWHJ 1SMYF 1UHSA 2VT2A 3CMEI 3UCQA 1R0KA 3FU3A 3PIOF 4HF1A 3M4OJ 2R5ZB 1MMDA 1ONNA 1ULYA 3K4NA 4BBSJ 1LFPA 5JHFA 2ETHA 4NC6A 1XX5A 2KMUA 3KZZA 4BY7J 5DDGA 2KISA 2ZJQF 2R7TA 4N4NB 3CHOA 5JBIA 5HLHA 3ASNH 4CXFA 5E3LA 1K83J 1R00A 4Y6RA 3I59A 4BXUA 1MW7A 2J5PA 1JJ6C 4UXNA 5EGOA 3FTSA 4CICA 2ZO4A 2FA5A 3HOTA 1IZ1A 4BAYA 4ZW3A 2Y31A 4FE7A 4HOBA 1EH7A 2HYJA 1WI9A 3DWLE 2IA0A 1ZELA 5IT9Z 5EF6A 2W85A 2BGCA 2ZFUA 2ZBKA 2ZCWA 4HSRA 2GOXB 2CJJA 5TISC 5DCFA 2A7OA 4EATA 3REOA 4AYBA 3KP3A 3TO6A 1R6RA 2BHZA 4XM3A 4NHJA 2IT0A 5D5WB 3HZJA 4JYKA 3GF2A 3H9GA 4YIIA 5E1WA 5E1XA 2DK5A 4LJZF 2Y1EA 1R0LA 3WGGA 5L3BA 2HDCA 1B8IA 1R1TA 2A61A 4A3FJ 2M30A 3BCBA 4IHWA 3ABMH 3E3VA 4WWCA 3FU0A 1D8KA 1DP3A 1BN5A 1FOYA 4HLXA 2MSYA 4J19A 2FBHA 2HKOA 3D0SA 2JD2A 2AQFA 5M3FJ 1WH7A 4BQAA 4XNDA 5LHGA 3RZDJ 2F5DA 2X6XA 3F6OA 3K7AJ 4AM3A 3BZKA 1E3HA 1JTYA 1R36A 2MH9A 3G3ZA 3GLXA 1D5VA 2HPOA 1FJLA 4PSWA 4P96A 4RAYA 2OZ6A 2KKOA 1RKWA 2VLAA 3HPGA 3F23A 4QSHA 2A6EF 1FTTA 4DW6A 4ZH4F 1A31A 4HG2A 3L2VA 1WJCA 2CW7A 2FU4A 2JK3A 2KZGA 2XAUA 2ISYA 1P2FA 2RNJA 5ICGA 5GP9A 4X2UA 3MCZA 1STZA 2G7UA 5EDNA 3DTKA 2WY7Q 2VE8A 2E35A 5GAHJ 2Y2ZA 3I71A 4EM1A 3ZP5A 1MBHA 1J09A 1V54H 3PSIA 1IW7F 4AR1A 1OCPA 1POGA 1V5FA 2OAZA 4I99C 4XRMA 2BXZA 4XKCA 5KAFC 1HC8A 3E6MA 2EIMH 3CMYA 4GO1A 4N0BA 1A6QA 4EJVA 4QUOA 2XVCA 3R0JA 1BI0A 2DMNA 4XNAA 1T1RA 1K6YA 1M1EB 3ZHZA 3S16J 3ESWB 1O7LA 5JAZA 3CO7C 4AWXB 2DFIA 2L9RA 5E20A 2R93J 1WJEA 3ANMA 2VQGA 1SC5A 2JMWA 2UUZA 1HKSA 5JVGF 1RC9A 4KIGA 1QQIA 4KN7X 4ESJA 3IIEA 1KQ9A 3GVAA 3UEQA 1PDNC 1HOMA 4PDKA 5CVIA 2IAIA 1MJBA 4U0YA 3QP5A 3T8VA 1YJNI 4PSXA 3TP0A 1ZKGA 2M8GX 4E7KA 3U9WA 1X1CA 3CLOA 1J75A 1MBGA 1Y6IA 2BEOA 2BBYA 2YS9A 2PJRA 2Y1GA 1HDPA 3B7SA 1JT6A 2XPYA 4Y15A 1Q1HA 4A69C 1Q0LA 4LLLA 4MNUA 2GM4A 1E3PA 3EBGA 2E1NA 5HLGA 2O8XA 1J5YA 5AENA 1FC3A 3CJTB 4A93J 1VQNI 3KZIC 4XN3A 3ANNA 4RB1A 4CCMA 1Q0QA 1X19A 2CFOA 2VIXA 1IF1A 2GIZA 1V5GA 3BG6A 2EIJH 4E7SA 1K78A 2EZHA 2Y69H 2DDBA 2L4AA 1MW1A 3Q3SA 2WAEA 2C6YA 3CD6I 1P4WA 3F22A 1H9TA 3KEQA 5IOZA 1JKOC 1O57A 4K5MA 3DU5A 2QBYB 3CP8A 4HV6A 1B1BA 4RS8A 3VOEA 1IV6A 2VKHA 1LDDA 4QIRA 4GXOA 3ANLA 2A6HF 2ESNA 3ABTA 3HXLA 2EFWA 2FD5A 1RKTA 4PFOA 1OCTC 3I53A 1MH3A 2EA2A 3HOSA 3L7WA 5EEGA 3F3XA 3DXJF 1LNWA 2ZMEB 4X6AJ 1FSHA 3FH5A 3L2QA 4XOPA 1T56A 1R5ID 2X0LA 4DJAA 1OQYA 4EGYA 2V1UA 3FKIJ 4M3FA 4BJ6C 4HF2A 1HSJA 5FFXA 4U7DA 4EGZA 4C2UA 2H6CA 3HRSA 3K2ZA 2V4JC 2A07F 2JWTA 4XN4A 4OOIA 3QPLA 5CJ9A 4JK1X 4I2OA 1EF4A 4IHVA 4UB6C 1YHQI 2STTA 1FWZA 3HIFA 1J0RA 3GZ5A 5JVTA 3VSKA 1Q0HA 4XN5A 1W0TA 1UELB 2QUFA 1XPXA 2H6BA 2EPFA 5EYRA 3MFKA 2P5VA 4B43A 2HQ5A 4BH9A 1XMXA 4RSYA 2ELJA 5L3EA 3SZGA 1KONA 2VODA 4XLCA 2XC7A 3PFIA 3DBHB 3JRCA 5LD2C 1Z1DA 3CZ6A 3A01A 1ZGAA 3E5XA 4TV7A 4M9XA 1OYYA 1WJFA 1WJBA 3KP6A 4S04A 2C5ZA 1WPKA 2DT6A 4CCLA 1U6GA 1G6NA 2CQXA 4YELA 1VF9A 3JR9A 2XAFA 3F21A 2JD1A 3H3ZA 3U2RA 4JX4A 1LQ1A 2HVQA 3G4SI 4XBFA 2HVRA 1PUFB 2E34A 4A0YA 3ZI0A 2V26A 4OAZA 3ZQLA 3QU6A 3SQNA 2ZKZA 5KNLA 3OYGA 4I09A 3W6JB 4D5CA 4XLAA 5GTIC 2DA5A 3CHQA 4ZQGA 4B09A 1RRJA 4C2TA 5DM7F 2M1BA 2FMLA 3QPHA 3KX2A 3L9FA 2FBKA 1Z3YA 3MKZA 4LK1F 3PM1A 4HDUA 1JE8A 2KRHA 2EJRA 4XORA 3A2KA 4V2FA 2MLKA 2BY3A 2D1VA 4II3A 1E3OC 5FLVA 2WWYA 5IT9K 2L4MA 2VB6A 1QPIA 3BR1A 2LH9A 5C44J 1LFUP 5EEHA 2EFQA 4IZZA 2ZNYA 1WSUA 1X2MA 2H1LA 3L2CA 1ZGWA 3ZQGA 4F7ZA 3IHUA 4LG3A 2QEXI 3V7CA 3VPRA 4XN9A 5BPPA 3HSEA 1RZ4A 4KYWA 3B73A 4YEJA 2V1NA 1RESA 3AG2H 3W2VA 3B37A 1TZLA 2DTZA 2TDXA 2W24A 2W1OA 3K4KA 5M5YJ 3L1PA 4LIVA 3ZGKA 1ZH5A 2EK5A 4K5PA 3MAJA 1IRFA 3K4BA 3CF2A 2DPDA 3JCUC 2XKOA 3V7SA 2R7VA 2PMHA 1VQPI 1KZHA 3M3YJ 3KP2A 1RP3A 3HPHA 1RPWA 4QLCU 2Z9OA 1I6XA 1ETWA 1XD7A 2CMPA 2W48A 4R5TA 5BOXA 1YYVA 2GQQA 3AL0C 4UV8A 1MD0A 2LVSA 5FD5A 2RQQA 4U88A 3S2HJ 3LSIA 4UV9A 4F93B 3ZQIA 3OR1C 3JRAA 2M87A 4E70A 1TWFJ 1B72B 1PJRA 2VOPA 2XGEA 1IXCA 1BW5A 4HNVA 3MZ8A 2O5RA 1MMGA 5FD6A 4DQ2A 2O0YA 1FIAA 3WTWC 1IN7A 4FLQA 5HOOA 5DCMA 3ABKH 1B4AA 1RI7A 1TLHB 2E19A 4G12A 3DP7A 5AIQA 1MMSA 1XMKA 4L9JA 3CCLI 1Y0NA 4P55A 3LSRA 4CGZA 2QF7A 5KVRA 5J4YA 3RZOJ 4E7JA 3G73A 2QKLB 4C3HJ 3IUOA 1W1WE 2XRNA 1SVLA 2BVMA 3CP2A 2WZGA 2LY1A 2F5FA 2WV1A 4XKVA 3TW6A 2RGVA 3DTEA 3A0BC 3WHBA 2QJ1A 2WADA 3WU0A 1VQ5I 3ZN1A 2HDWA 2ID6A 4JQFA 2VONA 5JFRA 3ZQHA 3KLNA 1K79A 4CZZA 2JCYA 1OR7A 3QRFF 1KA8A 5D8KB 1F43A 3ZQQA 3F8BA 5BNGA 2Y9YA 4PGHA 1SC7A 2E71A 2OJED 3FBIB 1EKEA 1T1SA 1FOWA 1HSTA 4M3BA 1B6AA 2ELHA 4Q47A 3ZQCA 2NVXJ 4Y6SA 4ZYGA 1OCCH 1DGRM 4OINF 4EJWA 3L09A 3HDDA 3P9CA 5JLXA 4PUSA 2QWWA 3BDDA 3S3MA 3IH3A 2NAZA 3K0LA 4UUTA 3WE3A 1YIJI 4MLOA 2LRDA 2QGUA 2LBFB 2A5YB 2AQEA 2EA4A 1B9MA 1VQLI 2BZTA 1N75A 4AVZA 5IYBJ 2CQ7A 1QRYA 1OMIA 5E8IA 1TQPA 2NOJB 1UG0A 1Y8RB 4ZQTA 3S1NJ 1LE8B 3LA3A 1Y1WJ 2KHMA 3FMSA 1MH4A 2L02A 4Y17A 2V6CA 3WE2A 3FZVA 3K1PA 3I59B 2DA2A 2E1MC 3WQSB 4ZC3A 1USSA 3M8JA 3FUIA 3K4JA 3RKWA 3VODA 3GLLA 2FBIA 2K9LA 3N05A 1X2NA 1IN6A 3F9KA 1XCBA 3PUFA 1Z91A 2IVMA 5HS9A 4XQFA 4X0GA 3H0DA 1T98A 5LHIA 2PMZA 2V9VA 2ZB9A 5D4RA 3BZCA 3DEWA 2IGKA 4KT6A 1HF0A 1L3LA 1ZARA 4IHYA 4IOAF 1YITI 1YS6A 5GPAA 3VB2A 4UUVA 4KISA 5IP9J 2E2IJ 4KP7A 1OPCA 2VBZA 2DA4A 4B3XA 3B7RL 3ERMA 1TT5B 1PVEA 3ERED 1W7PA 5CPRB 1X3ZB 4IVNA 3GFIA 3MD2A 3LMMA 5EJCA 2QENA 4PZJA 4A3LJ 1IGNA 4G7HF 4CZCA 4RB0A 1WJDA 2R7XA 4JX5A 3CUQA 4QWQA 5LGTA 2DA6A 3GFMA 1XGSA 2MD0A 3GFLA 2OU2A 3GZ6A 1SFOJ 2FF4A 4XR6A 3RPUD 2KRFA 2ZC2A 2ZXWH 4ZYDA 4KFCA 1K5HA 2L9NA 1JHFA 3WQQA 3FUJA 1WGXA 3K4LA 2YU9J 2WAQN 2WB1N 4GFBA 2JTVA 4GAEA 2ME6A 3IH2A 2MAOA 3PJRA 4RM3A 1NH3A 2CRGA 4C3IJ 1Q1VA 5EZGA 3RIRA 3O2PE 2RN7A 2OUMA 3LSHA 1BIAA 2DTRA 3IWZA 5BQTA 1BM9A 1MIJA 1QNTA 1YW8A 5HDGA 3ZMZA 3RQIA 2XAQA 3AL0B 3EUKL 2L7KA 1X3WB 3V4GA 2DFEA 2E2JJ 1ENHA 2LF7A 3M7GA 5A2QZ 2ZJPF 1FBUA 1OCZH 2IEKA 5J3LA 5CVJA 1K61A 1JUSA 3CQZJ 4ZQHA 4A3GJ 2R5YB 3H5RA 4KDPA 4YIFA 2LD5A 1Z21A 1GUUA 1DU0A 4DYCA 3QPTA 1SFUA 2XF6A 1TQIA 2XB5A 2P7VB 1X1AA 4XICA 4P9UA 3FM3A 1D1CA 4PGGA 3ZQ7A 3A0HC 2FFLA 2Y30A 3WTVC 4CYDA 2ZNZA 4I7HA 2LTPA 2NRAC 3JSPA 4NB5A 1WH5A 4NQWA 3ZCOA 4G7ZF 4A12A 2K85A 2K7LA 3OIQA 5EG0B 3CZGA 4HBLA 3TBIA 4J3BA 5KHDA 1TTYA 3J7YJ 2CO5A 3RC8A 3D1NI 1S7OA 1SAXA 2HR3A 1G8XA 3S1QJ 3FHZA 2IP2A 2L7MP 2WV0A 1X3WA 2K4BA 5FRMA 1XMAA 1Y8QB 2EFNA 2DN0A 2R59A 3FBNB 3CJRB 3A1YA 4IRGA 4L18B 5F0FA 2FXAA 3C18A 3S1RJ 3E6BA 1KYZA 3I3LA 3QODA 1PP7U 1YFHA 2IS2A 4GAAA 1EH8A 1RIOH 2VI6A 1GVJA 2XAHA 5ED4A 4BEHA 2NVUB 2FMYA 1W36D 2M5WA 2ISZA 4XLPF 3NQOA 1FZPB 1ZK8A 1WZ2A 3UERA 1BBYA 1G3YA 3U1DA 1AWCA 4ZDLA 3A14A 1P4AA 4P1WA 4R5XA 3JT1A 1PP8F 3BTLA 3U9GA 2HQAA 3V8JA 3ZXSA 2LOOA 2VC0A 2XROA 2X6OA 2VPLA 5C4XJ 4B47A 1WHUA 2ZXJA 5JLWA 4XKWA 4AIHA 4KICA 3WU2C 3IC7A 4N9IA 4IX7A 1ON1A 2ZMEA 1YLFA 5B5EC 1U2WA 2HZTA 3V42A 3HOZJ 3CZKA 4ZYEA 3F0CA 2JCVA 1P9QC 1A5JA 3HOYJ 3SDBA 4GGGA 1T2KA 4M73A 2K02A 3LA2A 2LY9A 1FYMA 4CH7A 1RR7A 4XOTA 2GA2A 1TWCJ 2WA0A 3GYHX 4Y67A 1BA5A 1G2HA 5B1BH 1PUFA 3T0YA 4EEFG 4QMEA 4XMUA 1HCRA 3JRGA 2CSOA 3HHGA 2E36A 2JA2A 3HB9A 1LB2A 3HOXJ 2R3SA 3HUGA 3OYEA 2MD5A 3HJEA 4ENNA 4ESBA 4H4KC 4Y6PA 1UFMA 2Y75A 2RAEA 4XONA 1HKQA 1UHMA 4MTDA 1UAAA 2CW8A 3BG3A 3H0GJ 4LB5A 2ME0A 1SD7A 3OL4A 1ZG1A 3RCOA 1WWXA 2XF5A 4RLQA 1YW7A 1S7EA 1O3SA 1IN5A 4I76A 1IUYA 3KETA 2ZSIB 2Z99A 2M45A 2F48A 2DA7A 2P5LC 4QHPA 2RNGA 3SFIA 4RDUA 4XSXF 2DMUA 3LOCA 3CXBA 5J8FA 2X1DA 2F6CA 4EMSA 1FOXA 5DM6F 3CDHA 1IN4A 2ZSHB 1CGPA 5E17F 1ON2A 4NUBA 3S32A 2DA3A 2IS4A 3ABLH 1AHDP 4XKBA 4OMYA 3R60A 3BG5A 1XSDA 4BHPA 1DDNA 2DQLA 1KU3A 3L2WA 3WGIA 1U5TA 4A0XA 4F92B 3MEXA 3DTIA 3SHFA 3JRIA 3VSLA 4R79A 4Y13A 1OLTA 3TDZC 3Q0UA 4M3GA 3CCYA 4GYGA 5F6FA 3MKYB 2M34A 1F5TA 5JR3A 1QHHD 5EZHA 4FLSA 3BLYA 1TT0A 2K9SA 2M0MA 3AUAA 2P81A 3DLLF 3BJAA 3FX3A 2HYFA 4MS6A 3K9TA 1QBJA 2HEOA 3NWTA 5BPDA 3D5SC 1JHHA 2Y48A 4M3EA 4XLHA 1XTAA 4PVBA 3FUNA 4L9NA 2A6TA 3AG4H 3DU6A 3G1LA 4WX9A 1D5YA 4PW4A 4RCVA 1XB4A 3CDLA 1LUJB 1O4XA 4XMXA 4B3AA 3M8EA 5FKOA 1KU2A 3QOEA 3HYIA 2LLKA 3JTGA 5L3FA 4DBRA 5IP7J 4XO3A 1F9NA 2XSDC 2GBYA 4E7ZA 4E7HA 4M9ZA 3ZPLA 1SVMA 3JSZA 3AG1H 1QO0D 2AHQA 2FQ4A 1ZLKA 3QU3A 2DLLA 3FMRA 4G6TB 3LSPA 3DKXA 3RTRA 1ETYA 2FNAA 2XHKA 2NVTJ 4DZPA 3HRTA 3FIWA 2FUG2 2GWRA 1SFKA 3A02A 1MVYA 5B3SH 3Q44A 1VFCA 2Y1CA 3GTGJ 2R92J 3HOVJ 3ABUA 4I02A 1JJ8C 3IKVA 3E5QA 1GXPA 3R4KA 2O9LA 4Z6YA 3OS1A 5DV5A 4HQEA 1AA7A 1I3AA 2D45A 2NYXA 5FRNA 3RYRA 4ON0A 1MBFA 3ROUA 2E1MB 3GFJA 2M4GA 4ZZLA 2V1DA 4DOZA 2AO9A 3HOUJ 4YFXF 3FXKA 3I4MJ 2PGGA 2V1XA 4RMNA 1J59A 1ONOA 3B7TA 2DOFA 3C2GA 4L5JA 3MMYB 2G9WA 4A03A 2Q0OA 2XGXA 4M6YA 1MW0A 3RYPA 3KYLA 1CF7B 2H8WA 1A36A 4BACA 4M9SA 4EJOA 3GTOJ 1DPUA 4MIMA 4CDGA 5D6FA 1MDMA 1ETOA 2Z3YA 4HX8A 3GTLJ 5HS7A 1MW2A 4XMZA 4PCQA 3Q9SA 3TO9A 3BWGA 4XRFA 4RGSA 1R5GA 2Q8KA 5H6RA 5DD8A 5ILSA 4FETA 1DP7P 1LFBA 1MBKA 4NQWB 1P7IA 4O6JA 2K40A 2ELKA 2A3SA 3HHHA 1FLIA 2DI3A 3PFYA 1YG2A 1EH6A 2HOAA 4ZYHA 1N77A 2WB1A 3FULA 3GO5A 1TL8A 3JRDA 4N4OB 4LB6B 4L5IA 4BS9A 1S9HA 4B4CA 1HBXG 4JP0A 4MTEA 1LVAA 1P7JA 2I5UA 3SYTA 2QQAA 1IUFA 2B63J 3FUHA 1QHGA 4G7OF 1JGIA 3M07A 3JW4A 5JC1A 4MQ9F 4RLFA 4LD5A 3KEYA 1CQTA 3AKZA 2MFZA 4HV5A 2I8DA 4UUSA 2L9SA 1SMTA 4LG0A 4ZX5A 1MNDA 5F08A 2PUSA 3E5UA 4FLRA 2LBFA 2R7DA 2DMPA 4DNCA 1KQ8A 4BJTA 3WTXC 5D5UB 4LLGF 2K9QA 3SDGA 2PN6A 1JKRC 1VQ9I 1SAUA 4R7LA 1W36C 2WPGA 1U8RA 2OBPA 2IA2A 4XK4A 4D1QA 1NK3P 1DPRA 2HOEA 4A6EA 3CMAI 4ABZA 4XN0A 4IO9F 3ZN0A 1LKXA 3E97A 4ZYAA 5JMWA 5IYCJ 2XGCA 4IHSA 4L2LA 1OCRH 5IY5H 1S8NA 1U0JA 4Y7NJ 1I27A 2V9PA 5F04A 1JKQC 3EBHA 4XLNF 3EYIA 2VBWA 5IP6A 1XDUA 3RPQA 3ISPA 4ZDOA 2X85A 3GTQJ 4AYSA 3WTZA 1GHCA 1WJAA 2JA7J 3K4MA 2C82A 2HQNA 4A3EJ 1OCOH 3GWZA 3LFKA 4AIDA 4RA2A 1I5ZA 1C0WA 1I1GA 1K6OA 2UZKA 4ZW6A 1I39A 2IW5A 3WTSC 4DYRA 4RAGA 1Z0XA 3I4PA 2BW3B 4XN8A 1MSEC 1BR2A 1V4RA 4BGDA 5K7ZA 5IYDJ 1OJLA 1MJAA 2D1HA 4D0PA 3S8PA 1O3RA 1QZYA 1X3ZA 3DPLC 4A5MA 3H3UA 2KDOA 3QPSA 1W4MA 3O3KA 2L3DA 2PL5A 3PNTA 5CQEA 2QCOA 4XO4A 4DGWB 1IC8A 1RR8C 2P6TA 2DT7B 2KJCA 4C3JJ 1SD4A 4BNCA 5FKNA 1QGPA 2IGOA 4O5VA 1ZRDA 3PO2J 1DU6A 3J7AY 1ZHFA 1O3QA 3PSFA 4Y3OA 5HODA 2DDAA 1K78B 1BL0A 2NNYA 5ICCA 5K5QA 2HDDA 4UY8I 2YX7A 4XO5A 1R1UA 1R4NB 2FQ3A 2XASA 3TQNA 3HOWJ 3BR5A 2HS5A 4FE4A 2NVQJ 3H9QA 4F3QA 1PUEE 1T95A 4HNTA 2JA8J 1G3SA 1X4OA 2R7FA 4HYEA 4BY1J 3S15J 3MKLA 3K6GA 1ZG5A 1JXSA 2BY2A 1Z3XA 3CHRA 1Z6RA 2OA4A 2PMZN 1W5SA 2EFPA 5E8GA 1TWGJ 4DYQA 3CCVI 4ETSA 2PFBA 2L54A 2R72A 4LMYA 4EM2A 2LNBA 3KYCB 1Z77A 2M4KA 3OYNA 4IRIA 3RKQA 3FTXA 2JPCA 2Q1ZB 3DQVC 4BXXJ 2M2EA 2V7FA 3LAJA 2KPMA 2NXNB 1IRXA 1R5HA 1V55H 2WC2A 4AR8A 2EGHA 3WG7H 3G71I 1IJWC 4IJAA 5FB2A 4XLEA 1TW2A 2DAOA 4KN4X 4H0EA 3SJMA 1H88C 2G7HA 4DZJA 1MSFC 2FRHA 2CFXA 1ZS2A 1D8JA 4IHTA 3B02A 2YSRA 2XSJC 2YUSA 1IAWA 3ZMSA 1S5LC 2L7FP 4MHGA 3WG9A 2M8EA 3S14J 2EZIA 4HDVA 1YX3A 1ZYRF 3OS0A 1HA8A 2RREA 2WAFA 2YR2A 3BPXA 2E1OA 4M71A 3VWBA 1YS7A 2EWNA 2IBDA 4ITVA 3TL4X 2EV0A 4R5VA 1HQCA 3B3BA 2F5VA 1X1DA 3K69A 3ASOH 3PNVA 5FFZA 3VVMA 5H20A 1YIOA 1ONVA 1SANA 4F55A 1JT0A 2QVWA 4OAYA 4XMYA 4E4HA 3JRFA 1BC8C 2CV1A 2PJPA 1H19A 3HG9A 3O6BB 3CCQI 3RKXA 5FROA 3WODF 3OYAA 1HLVA 1B72A 4HPQA 2LKSA 2HI3A 4IL6C 9ANTA 1SFXA 5KAIC 3RKYA 1T6SA 4KMFA 5L3DA 3HRMA 4L9VA 4ZJZA 1Z6TA 1U78A 5F64A 1D1AA 4BEHB 4WXDA 2BHYA 3NAUA 4OU0A 3EETA 4BL0B 2HXIA 4CO8A 2KLOA 1ZTRA 2WZFA 1S72I 3ZHYA 4DBQA 4Q4ZF 2MC3A 2A5WA 3GTMJ 4M3DA 3CDIA 2OTLI 2QBYA 4L0YB 1LVKA 4I0AA 5HVQC 4IXAA 3E0JB 2CQNA 4A3BJ 3CUQC 2F4IA 4ANJA 2VC1A 1BOBA 3VEPA 1UMQA 3HRUA 1VZ0A 4AC0A 3HSRA 2P7CB 2KIFA 3K4CA 4CCKA 1LDJA 5ILUA 2RKHA 1OR7C 4NBQA 3K70D 2O6GE 2A05A 4ZZDA 4FISA 2LDUA 2MH2A 3BR6A 4HX4A 1RETA 5CLSA 3FXOA 2DXIA 4RGXA 2E2HJ 2VXDA 4RAFA 3S17J 5EGOB 1MKMA 1YTYA 4MFEA 3DEUA 4LGWA 3VFZA 3BJOA 3WTTC 2MLGA 5J1UA 1H3LA 1ACIA 3FXQA 2PG4A 4CYCB 2NOGA 6PAXA 2VUMJ 2Y9ZA 3EYYA 1MBEA 1UCRA 5J1RA 2EFOA 2XV4S 5L3GA 4FCYA 3LFUA 1XDSA 2I10A 4A6DA 3F72A 2HQRA 1T0FA 4ZTJA 2Z16A 1KU9A 4PJLA 3K1MA 4PJ0C 3A06A 3QQAA 2O61A 1YJWI 3OL3A 1EA3A 1GLNA 1OKRA 2IRFG 2EINH 1HKTA 4IF4A 3BJ6A 2XUBA 5LFAA 3TOAA 2HU9A 4NNJA 1R58A 1UHWA 4LITA 4BU2A 2KIUA 4PU2A 3FH8A 2DCEA 1IXSB 1R22A 2RQPA 2ZXGA 3FMQA 4OIPF 2IGNA 3HW2A 3G1OA 1Y1VJ 3P9KA 4R1HA 2VJ4A 3VYRB 2GZWA 3PQKA 1DQUA 2IJLA 3OS2A 1LJ9A 3GMEA 3LNQA 1T38A 4QPEA 5E3NA 1WQ2A 4V19K 2P5KA 2YX4A 1W0UA 5J6XA 3AFHA 4D5FA 1P6RA 1KYWA 3LSKA 3FXRA 2BY1A 1SD5A 1RNLA 1WRJA 1FIPA 3IL2A 5DULA 2MW8A 3FUDA 2HKXA 3G1MA 4EVIA 1H89C 3VYUB 4Q5SF 4EQQA 4RB3C 2LYCA 3RC3A 3IRQA 4AICA 5CYVA 4CUGA 3HKZA 4QPQA 3C2HA 2NVYJ 4ZW5A 2HZDA 1TNSA 5GPCA 5DLLA 1JUPA 1HW2A 2KZVA 5DS9A 5J1YA 2M9HA 5JMPA 4FX0A 3WU1B 4I01A 2GLOA 2IA1A 2JUGA 2MC4A 1N78A 1HW1A 4RGRA 2R5ZA 3FTUA 5E3MA 3S2DJ 1ETQA 2JSPA 2LR8A 3OOUA 3HTUA 5IOYA 4FLOA 1LPQA 1ZG3A 2Q2EB 2JV7A 4M6XA 2Y1FA 3ECOA 3RJPA 1ZR2A 3DEEA 2PBIA 5LLQA 2UWMA 2XB0X 4XMWA 3GX4X 4ENMA 2VJ5A 5F1RA 1YI2I 2L9VA 1GW6A 2E7WA 1VQ4I 5F0HA 2MG4A 3OY9A 1G59A 4IEJA 3FU6A 2CUFA 5TGTA 3EUHC 3DCFA 1X1PA 2COBA 3U1KA 1B59A 3BR2A 1D0YA
chains in the Genus database with same CATH topology
2DA3A 4XN4A 3QPLA 1EF4A 4DPRA 4IHVA 1ETKA 2O7GA 1AHDP 2OF7A 5M5XJ 4A3JJ 1U9NA 4ZN6A 3BG5A 4W1UA 3MVPA 2FJ1A 3BT9A 1Q0HA 4XN5A 1W0TA 3JRIA 4BBRJ 2H1KA 1IDZA 5EYRA 5M5WJ 2VKEA 4K5OA 4RSYA 2HQ5A 3HEFA 3Q0UA 3CCYA 4M3GA 3Q0WA 2M34A 4FLSA 5EZHA 2K9SA 2DMTA 3JRCA 3AUAA 2P81A 3A01A 3HGYA 4JNDA 3FTYA 2VPRA 1VI0A 5F27A 4MS6A 2DQ6A 5FJ8J 1TC3C 2C5ZA 1WPKA 4M3EA 3B34A 2CQXA 5M3MJ 3FUNA 4PVBA 1VF9A 4AYBN 3JR9A 2JD1A 1F36A 3G1LA 4JX4A 2LFBA 1ONPA 5EEAA 2ID3A 1PUFB 1D5YA 1UG2A 3C2BA 4RCVA 4PW4A 3CDLA 1O4XA 1ZR4A 3JRHA 1JG9A 3ZI0A 4XMXA 3ZQLA 4B3AA 5FKOA 4D5CA 3UKGA 2DA5A 2LLKA 3CHQA 4XN2A 2JD0A 4ZQGA 5IP7J 4XO3A 2XRLA 2XSDC 4MKTA 4QIWN 2K9NA 4A3IJ 2GBYA 2JJ7A 3I4NJ 3JSZA 3PM1A 3TW7A 4A3DJ 3WHCA 1JVSA 2AHQA 2FQ4A 3GTPJ 2VKVA 3FTZA 1GV2A 3LSPA 4V2FA 1ETYA 2NVTJ 1MNMC 4DZPA 1X58A 3FIWA 4A3CJ 1E3OC 5FLVA 1ONNA 4XN1A 1QPIA 3A02A 3BR1A 5C44J 2O8KA 1LFUP 3NARA 1MVYA 4X1EA 1VFCA 2Y1CA 3Q44A 4B1RA 2R92J 3GTGJ 4ZX4A 5JO0A 5HLTA 2MAPA 1X2MA 3HOVJ 1ETXA 1JJ8C 3JRBA 1ZGWA 3ZQGA 2O9LA 3A03A 3IV5A 3VPRA 4XN9A 5BPPA 1GDTA 1WCMJ 1MBFA 1RESA 3LSJA 3B2PA 3HOUJ 2AO9A 2PGGA 4XRSG 3I4MJ 3B37A 2DTZA 1FEXA 5M5YJ 3L1PA 3OSGA 1ONOA 3B7TA 2NS8A 4UUSB 4K5PA 5FKLA 2H8RA 3KEDA 4A03A 2XQ0A 3H3VK 1MW0A 1MBJA 1A6IA 3BR0A 2TRTA 1AKHB 4NDLA 3GTOJ 3M3YJ 4LOCA 2ECCA 4MIMA 3GTLJ 1ETOA 1MW2A 1RP3A 4RVBA 4XMZA 2LKXA 1RPWA 1ETWA 4R5TA 2W48A 4XNBA 3BG9A 2LVSA 1LFBA 1MBKA 2DJNA 2ECBA 1U8BA 1P7IA 3S2HJ 1OFCX 2K40A 3ZQIA 2ELKA 3FULA 2HOAA 3BTCA 3TP3A 3JRAA 1IRZA 1NK2P 3JRDA 1TWFJ 2R5YA 1B72B 4MFDA 3IH4A 5DTDA 2XGEA 4I6ZA 4Q4IA 5FKMA 5FWQA 1BW5A 4HNVA 4B4CA 1G5AA 4JP0A 1MW3A 1P7JA 3CHSA 1FIAA 1JKPC 4FLQA 1IUFA 2B63J 3O8HA 5DYFA 3FUHA 4ZX6A 4C2MJ 1JGIA 2LP0A 5JC1A 2DA1A 2E19A 4G12A 1H8AC 1CQTA 2HOTA 4UUSA 3AU9A 1JTXA 4ZX5A 1JGGA 1YRNB 5F08A 2PUSA 5K7HA 3LSRA 5C4JJ 2NS7A 2QF7A 4FLRA 2DMPA 3RZOJ 1AKHA 3B2XA 4C3HJ 2K9QA 3SDGA 1JKRC 3WQRA 4R7LA 2R0QC 3FISA 2WPGA 2WZGA 5EG0A 2WV1A 3TW6A 3WHBA 1R9TJ 2QJ1A 1S46A 4IHXA 3HGGA 4XK4A 1NK3P 1BJZA 2XPUA 3Q0VA 3S1MJ 4M6VA 4XMVA 4ABZA 2ID6A 2JN6A 1GT0C 3ZHXA 4AR9A 3ZQHA 2JCYA 2EH3A 4S0HB 5IYCJ 2XGCA 1OR7A 1T33A 4L2LA 5JMWA 3FUKA 1F43A 2FX0A 5BNGA 2Y9YA 3FUFA 2KT0A 1QVUA 4Y7NJ 1T1SA 3O8GA 4M3BA 5F04A 1JKQC 3EBHA 1TWAJ 5IP6A 4XN7A 3ZQCA 3BQZA 1VNDA 2NVXJ 3GTQJ 2Y1DA 4Y6SA 2DQMA 4AYSA 3GBGA 2L0KA 2JA7J 2C82A 4A3EJ 3HBLA 3HDDA 1FTZA 3E7LA 4JX6A 2EZLA 5JLXA 1QVTA 3IH3A 4UUTA 4ZW6A 4V2GA 3Q43A 2G0EA 3JREA 4MLOA 1YRNA 4DYRA 1Z0XA 2EZKA 2XPVA 4XN8A 3CIAA 1MSEC 5K7ZA 4Y52J 2OPTA 3FUEA 3AU8A 5IYBJ 5IYDJ 1QRYA 1OJLA 1X3ZA 1XG1A 1ITYA 3QPSA 3FK6A 3S1NJ 4ZQTA 2PL5A 1LE8B 1Y1WJ 3R0IA 2QCOA 2EBIA 1SQMA 4XO4A 1IC8A 1MH4A 2MGQA 2RJIA 3BQYA 2DA2A 4C3JJ 3LSGA 2R7ZJ 3WQSB 2EQRA 5FKNA 3FUMA 3FUIA 3PO2J 2LK2A 4QTRA 1DU6A 1X2NA 5HODA 3OSFA 4XMTA 1BL0A 4ZQFA 2N8GA 2HDDA 5HNHA 3B6AA 4XO5A 3HOWJ 2ZB9A 3BR5A 4FE4A 3CHPA 3DEWA 1XS9A 3GTJJ 1HF0A 2NVQJ 5EV7A 4IHYA 2JA8J 2JCXA 5GPAA 3EBIA 4BY1J 1TWHJ 3S15J 2X9DA 3MKLA 5IP9J 1UHSA 2E2IJ 2VJ8A 3FH7A 1R0KA 4KP7A 3FU3A 3CHRA 4ZQEA 2DA4A 3M4OJ 3UCQA 1I3QJ 2PMZN 2R5ZB 4DYQA 1TWGJ 3B7RL 4BBSJ 4FCAA 2R72A 3GTKJ 1Z77A 4BY7J 3CHOA 3RKQA 4A3LJ 3FTXA 5JBIA 2TCTA 3A01B 1IGNA 1XC5A 4BXXJ 2M2EA 4CXFA 5E3LA 1K83J 4AR8A 4JX5A 2EGHA 4Y6RA 2DA6A 1SFOJ 1IJWC 1JJ6C 5EGOA 3FTSA 3SJMA 3MN2A 1H88C 4DZJA 4ZW3A 1MSFC 2Y31A 1K5HA 4FE7A 2CUEA 1ZS2A 2XGDA 4CYCA 2HYJA 3FUJA 3WQQA 1WGXA 4XRSA 1APLC 3CZLA 1JUMA 2YU9J 4ARFA 2YUSA 5EF6A 2WAQN 2WB1N 4GFBA 4GAEA 3PUUA 1GVDA 2L7FP 2CJJA 2ME6A 5FLMJ 3IH2A 3S14J 2MAOA 2EZIA 2A7OA 2CRGA 4W97A 2D5VA 4C3IJ 1Q1VA 5EZGA 4JYKA 2E1OA 2IBDA 1WI3A 2Y1EA 1R0LA 4R5VA 3B7UX 1U9OA 3B3BA 3RQIA 1B8IA 1I50J 4A3FJ 4IHWA 2HXOA 3VVMA 3FU0A 1SANA 2X48A 2E2JJ 1ENHA 1JT0A 2QVWA 2MSYA 1NTCA 3JRFA 4J19A 4FTHA 5J3LA 2IEKA 1H19A 2JD2A 2KDZA 1K61A 1JUSA 3CQZJ 1HLVA 4ZQHA 4A3GJ 2L7ZA 2R5YB 5M3FJ 1B72A 2HI3A 1WH7A 9ANTA 4XNDA 3RZDJ 3K7AJ 4OOFA 2LD5A 4ZW8A 1JTYA 1GUUA 5IPAA 1DU0A 1I6HJ 2HPOA 1FJLA 4DYCA 1U78A 4AUXA 1RKWA 2XB5A 4ZW7A 1AU7A 3FU5A 3NAUA 3RASA 2VLAA 2Y0SN 2HXIA 3ZHYA 1ZTRA 4XICA 4QSHA 2B61A 2WZFA 1FTTA 4DW6A 4K5LA 3GTMJ 2FFLA 2Y30A 4M3DA 2JK3A 2JA6J 3BTIA 1IG7A 2LTPA 4D7NA 1ORKA 4A3BJ 1WH5A 4NQWA 2M0CA 5GP9A 4LUPA 4X2UA 1UMQA 5EDNA 4AC0A 5EG0B 3CZGA 4J3BA 2O7OA 3RC8A 3D1NI 3S1QJ 2Y2ZA 3K2AA 1MBHA 4XIDA 2L7MP 4FISA 5FKKA 3BR6A 1X3WA 3CZEA 1RETA 4AR1A 1OCPA 1POGA 4XRMA 3S17J 2E2HJ 3QJXA 2DN0A 5EGOB 3CMYA 2R59A 4MFEA 3TEDA 3BR3A 4QUOA 4L5EA 1H3LA 5J1UA 5F0FA 3S1RJ 3ZQFA 3ZOBA 2DMNA 2NOGA 4CYCB 1T1RA 4XNAA 3ZHZA 2VUMJ 4GAAA 3S16J 2VI6A 2Y9ZA 3FTWA 1MBEA 5J1RA 5JAZA 4FCYA 2HOSA 2I10A 1ZK8A 2L9RA 2R93J 3VVLA 3UERA 3ANMA 1SC5A 2JMWA 3FHEA 4OOEA 3A14A 3IIEA 4R5XA 3UEQA 3JT1A 1HOMA 3BTLA 2IAIA 3QQAA 3A06A 3FTVA 2X6OA 3T8VA 5C4XJ 4D7MA 3TP0A 1ZKGA 5JLWA 2M8GX 3FK7A 1HDDC 3U9WA 4RBOA 1MBGA 1B8IB 1HS6A 4PU2A 3FH8A 2YS9A 2Y1GA 3CZKA 1HDPA 3HOZJ 2ZXGA 3OIOA 3F0CA 3B7SA 2CU7A 2JCVA 1JT6A 2XPYA 3G1OA 3HOYJ 4A69C 1Y1VJ 1A5JA 1Q0LA 5JNLA 4ZX3A 2GM4A 3LNQA 3EBGA 4QPEA 5E3NA 2LY9A 5AENA 1W0UA 5E3OA 4A93J 1RR7A 1ETVA 4D5FA 3ANNA 1TWCJ 1Q0QA 4Y67A 1BA5A 2XPWA 1G2HA 1PUFA 1FIPA 3T0YA 4EEFG 5DULA 2MW8A 4QMEA 3FUDA 1H89C 3G1MA 4XMUA 1HCRA 2HPTA 1BW6A 2EZHA 3JRGA 1MW1A 4A3KJ 5F1JA 3BTJA 3HB9A 3Q3SA 3HOXJ 4A3MJ 3W6VA 3RC3A 4AICA 3HM5A 5IOZA 2NVYJ 4ZW5A 1JKOC 4K5MA 4Y6PA 1IDYA 2RAEA 5GPCA 1IV6A 1JUPA 2CQQA 4QIRA 5DLLA 2R70A 5DS9A 5J1YA 2M9HA 1ZQ3P 2GTQA 2XPZA 2GLOA 5JMPA 3ANLA 3PO3J 3H0GJ 3BG3A 1LE8A 2FD5A 1RKTA 3HKZN 2R5ZA 1OCTC 3FTUA 4Q4EA 2ME0A 1MH3A 1ETQA 5E3MA 3S2DJ 2LR8A 3OOUA 4MO7A 5IOYA 4FLOA 4K5NA 1S7EA 4X6AJ 3B6CA 3FH5A 2DMQA 4I76A 2JV7A 2Y1FA 1ZR2A 1T56A 1GV5A 1SG7A 2DA7A 4QHPA 5C3EJ 3SFIA 4XMWA 2XB0X 4RDUA 5K7FA 3FKIJ 2DMUA 3LOCA 4M3FA 1GW6A 5HNFA 5F0HA 2MG4A 3FU6A 4IEJA 4BKXA 2CUFA 5F0CA 3DCFA 2COBA 2JA5J 2JWTA 3BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA3 A;  3QPL A;  1EF4 A;  4IHV A;  1ETK A;  1AHD P;  2OF7 A;  5M5X J;  4A3J J;  1U9N A;  3BG5 A;  4W1U A;  3MVP A;  2FJ1 A;  3BT9 A;  1W0T A;  3JRI A;  4BBR J;  2H1K A;  1IDZ A;  5EYR A;  5M5W J;  2VKE A;  2HQ5 A;  3HEF A;  3Q0U A;  3CCY A;  4M3G A;  3Q0W A;  2M34 A;  5EZH A;  2K9S A;  2DMT A;  3JRC A;  2P81 A;  3A01 A;  3HGY A;  2VPR A;  1VI0 A;  5F27 A;  5FJ8 J;  1TC3 C;  1WPK A;  4M3E A;  2CQX A;  5M3M J;  1VF9 A;  4AYB N;  3JR9 A;  1F36 A;  3G1L A;  4JX4 A;  2LFB A;  5EEA A;  2ID3 A;  1PUF B;  1D5Y A;  1UG2 A;  3C2B A;  3CDL A;  1O4X A;  1ZR4 A;  3JRH A;  3ZQL A;  4B3A A;  5FKO A;  4D5C A;  3UKG A;  2DA5 A;  2LLK A;  5IP7 J;  2XRL A;  2XSD C;  4QIW N;  2K9N A;  4A3I J;  2GBY A;  2JJ7 A;  3I4N J;  3PM1 A;  3TW7 A;  4A3D J;  3WHC A;  2AHQ A;  2FQ4 A;  3GTP J;  2VKV A;  1GV2 A;  3LSP A;  4V2F A;  1ETY A;  2NVT J;  1MNM C;  4DZP A;  1X58 A;  3FIW A;  4A3C J;  1E3O C;  5FLV A;  1QPI A;  3A02 A;  3BR1 A;  5C44 J;  2O8K A;  1LFU P;  3NAR A;  4X1E A;  1VFC A;  4B1R A;  2R92 J;  3GTG J;  1X2M A;  3HOV J;  1ETX A;  1JJ8 C;  3JRB A;  1ZGW A;  3ZQG A;  2O9L A;  3A03 A;  3IV5 A;  3VPR A;  1GDT A;  1WCM J;  1MBF A;  1RES A;  3LSJ A;  3HOU J;  2AO9 A;  4XRS G;  3I4M J;  2DTZ A;  1FEX A;  5M5Y J;  3L1P A;  3OSG A;  2NS8 A;  4UUS B;  5FKL A;  2H8R A;  3H3V K;  1MBJ A;  1A6I A;  3BR0 A;  2TRT A;  1AKH B;  4NDL A;  3GTO J;  3M3Y J;  4LOC A;  2ECC A;  4MIM A;  3GTL J;  1ETO A;  2LKX A;  1RPW A;  1ETW A;  2W48 A;  3BG9 A;  2LVS A;  1LFB A;  1MBK A;  2DJN A;  2ECB A;  1U8B A;  1P7I A;  3S2H J;  1OFC X;  2K40 A;  3ZQI A;  2ELK A;  2HOA A;  3BTC A;  3TP3 A;  3JRA A;  1IRZ A;  1NK2 P;  3JRD A;  1TWF J;  2R5Y A;  1B72 B;  4MFD A;  3IH4 A;  5DTD A;  2XGE A;  4I6Z A;  5FKM A;  1BW5 A;  4HNV A;  4B4C A;  4JP0 A;  1P7J A;  1FIA A;  1JKP C;  1IUF A;  2B63 J;  3O8H A;  4C2M J;  2LP0 A;  2DA1 A;  2E19 A;  4G12 A;  1H8A C;  1CQT A;  2HOT A;  4UUS A;  1JTX A;  1JGG A;  1YRN B;  5F08 A;  5K7H A;  3LSR A;  5C4J J;  2NS7 A;  2QF7 A;  2DMP A;  3RZO J;  1AKH A;  4C3H J;  2K9Q A;  3SDG A;  1JKR C;  2R0Q C;  3FIS A;  5EG0 A;  2WV1 A;  3TW6 A;  3WHB A;  1R9T J;  4IHX A;  3HGG A;  4XK4 A;  1NK3 P;  1BJZ A;  2XPU A;  3Q0V A;  3S1M J;  4M6V A;  4ABZ A;  2ID6 A;  2JN6 A;  1GT0 C;  3ZQH A;  2EH3 A;  4S0H B;  5IYC J;  2XGC A;  1T33 A;  1F43 A;  2FX0 A;  5BNG A;  2Y9Y A;  2KT0 A;  1QVU A;  4Y7N J;  3O8G A;  4M3B A;  5F04 A;  1JKQ C;  1TWA J;  5IP6 A;  3ZQC A;  3BQZ A;  1VND A;  2NVX J;  3GTQ J;  3GBG A;  2L0K A;  2JA7 J;  4A3E J;  3HBL A;  3HDD A;  1FTZ A;  3E7L A;  4JX6 A;  2EZL A;  5JLX A;  1QVT A;  3IH3 A;  4UUT A;  4V2G A;  2G0E A;  3JRE A;  4MLO A;  1YRN A;  4DYR A;  1Z0X A;  2EZK A;  2XPV A;  1MSE C;  5K7Z A;  4Y52 J;  2OPT A;  5IYB J;  5IYD J;  1QRY A;  1OJL A;  1XG1 A;  1ITY A;  3QPS A;  3FK6 A;  3S1N J;  1LE8 B;  1Y1W J;  2QCO A;  2EBI A;  1IC8 A;  1MH4 A;  2MGQ A;  3BQY A;  2DA2 A;  4C3J J;  3LSG A;  2R7Z J;  2EQR A;  5FKN A;  3PO2 J;  2LK2 A;  4QTR A;  1DU6 A;  1X2N A;  5HOD A;  3OSF A;  1BL0 A;  2N8G A;  2HDD A;  3B6A A;  3HOW J;  2ZB9 A;  3BR5 A;  4FE4 A;  3DEW A;  1XS9 A;  3GTJ J;  1HF0 A;  2NVQ J;  4IHY A;  2JA8 J;  5GPA A;  4BY1 J;  1TWH J;  3S15 J;  2X9D A;  3MKL A;  5IP9 J;  1UHS A;  2E2I J;  2DA4 A;  3M4O J;  1I3Q J;  2PMZ N;  2R5Z B;  4DYQ A;  1TWG J;  4BBS J;  3GTK J;  1Z77 A;  4BY7 J;  3RKQ A;  4A3L J;  2TCT A;  3A01 B;  1IGN A;  1XC5 A;  4BXX J;  2M2E A;  5E3L A;  1K83 J;  4JX5 A;  2DA6 A;  1SFO J;  1IJW C;  1JJ6 C;  5EGO A;  3SJM A;  3MN2 A;  1H88 C;  4DZJ A;  1MSF C;  2Y31 A;  4FE7 A;  2CUE A;  2XGD A;  4CYC A;  2HYJ A;  1WGX A;  4XRS A;  1APL C;  1JUM A;  2YU9 J;  2YUS A;  5EF6 A;  2WAQ N;  2WB1 N;  4GFB A;  1GVD A;  2L7F P;  2CJJ A;  2ME6 A;  5FLM J;  3IH2 A;  3S14 J;  2EZI A;  2CRG A;  4W97 A;  2D5V A;  4C3I J;  1Q1V A;  5EZG A;  4JYK A;  2E1O A;  2IBD A;  1WI3 A;  1U9O A;  3RQI A;  1B8I A;  1I50 J;  4A3F J;  4IHW A;  2HXO A;  1SAN A;  2X48 A;  2E2J J;  1ENH A;  1JT0 A;  2MSY A;  1NTC A;  3JRF A;  4J19 A;  4FTH A;  5J3L A;  2IEK A;  2KDZ A;  1K61 A;  1JUS A;  3CQZ J;  1HLV A;  4A3G J;  2L7Z A;  2R5Y B;  5M3F J;  1B72 A;  2HI3 A;  1WH7 A;  9ANT A;  3RZD J;  3K7A J;  2LD5 A;  1JTY A;  1GUU A;  5IPA A;  1DU0 A;  1I6H J;  1FJL A;  4DYC A;  1U78 A;  4AUX A;  1RKW A;  2XB5 A;  1AU7 A;  3NAU A;  2Y0S N;  2HXI A;  1ZTR A;  4XIC A;  4QSH A;  1FTT A;  4DW6 A;  3GTM J;  2Y30 A;  4M3D A;  2JK3 A;  2JA6 J;  3BTI A;  1IG7 A;  2LTP A;  4D7N A;  1ORK A;  4A3B J;  1WH5 A;  2M0C A;  5GP9 A;  1UMQ A;  5EDN A;  4AC0 A;  5EG0 B;  2O7O A;  3D1N I;  3S1Q J;  2Y2Z A;  3K2A A;  1MBH A;  4XID A;  2L7M P;  4FIS A;  5FKK A;  3BR6 A;  1RET A;  1OCP A;  1POG A;  4XRM A;  3S17 J;  2E2H J;  2DN0 A;  5EGO B;  3CMY A;  4MFE A;  3TED A;  3BR3 A;  4L5E A;  5J1U A;  5F0F A;  3S1R J;  3ZQF A;  3ZOB A;  2DMN A;  2NOG A;  4CYC B;  2VUM J;  3S16 J;  2VI6 A;  2Y9Z A;  1MBE A;  5J1R A;  4FCY A;  2HOS A;  2I10 A;  1ZK8 A;  2L9R A;  2R93 J;  2JMW A;  1HOM A;  3BTL A;  2IAI A;  3QQA A;  2X6O A;  5C4X J;  4D7M A;  3TP0 A;  1ZKG A;  5JLW A;  2M8G X;  3FK7 A;  1HDD C;  4RBO A;  1MBG A;  1B8I B;  2YS9 A;  1HDP A;  3HOZ J;  3OIO A;  3F0C A;  2CU7 A;  1JT6 A;  3G1O A;  3HOY J;  4A69 C;  1Y1V J;  1A5J A;  2GM4 A;  3LNQ A;  5E3N A;  2LY9 A;  1W0U A;  5E3O A;  4A93 J;  1RR7 A;  1ETV A;  4D5F A;  1TWC J;  1BA5 A;  2XPW A;  1G2H A;  1PUF A;  1FIP A;  4EEF G;  2MW8 A;  1H89 C;  3G1M A;  1HCR A;  1BW6 A;  2EZH A;  3JRG A;  4A3K J;  5F1J A;  3BTJ A;  3HB9 A;  3Q3S A;  3HOX J;  4A3M J;  3W6V A;  3HM5 A;  5IOZ A;  2NVY J;  1JKO C;  1IDY A;  2RAE A;  5GPC A;  1IV6 A;  1JUP A;  2CQQ A;  5DS9 A;  5J1Y A;  2M9H A;  1ZQ3 P;  2GLO A;  3PO3 J;  3H0G J;  3BG3 A;  1LE8 A;  2FD5 A;  1RKT A;  3HKZ N;  2R5Z A;  1OCT C;  2ME0 A;  1MH3 A;  1ETQ A;  5E3M A;  3S2D J;  2LR8 A;  3OOU A;  4MO7 A;  5IOY A;  1S7E A;  4X6A J;  3B6C A;  2DMQ A;  4I76 A;  1ZR2 A;  1T56 A;  1GV5 A;  2DA7 A;  5C3E J;  3SFI A;  2XB0 X;  4RDU A;  5K7F A;  3FKI J;  2DMU A;  3LOC A;  4M3F A;  5F0H A;  2MG4 A;  4IEJ A;  4BKX A;  2CUF A;  5F0C A;  3DCF A;  2COB A;  2JA5 J;  2JWT A;  3BR2 A; 
#chains in the Genus database with same CATH topology
 3KCC A;  5CKT A;  3JAM Z;  4DPR A;  1FYK A;  3SXY A;  1ZRC A;  2OF7 A;  5M5X J;  4A3J J;  2AXT C;  3KFW X;  4G6Q A;  1U9N A;  3H5A A;  2Z33 A;  2QYO A;  2H94 A;  3I5U A;  2KIM A;  3MVP A;  3BT9 A;  3IAM 2;  3BZ6 A;  2NS0 A;  3G6E I;  1KU7 A;  1DUX C;  4NC7 A;  2H1K A;  2V79 A;  2VKE A;  4K5O A;  4GCV A;  2DQR A;  3HEF A;  1JI8 A;  5JI6 A;  3Q0W A;  2M7B A;  3ZR8 X;  2R7U A;  2V6E A;  2DMT A;  1RUO A;  3K10 A;  2CYY A;  4ASN A;  5ERI A;  3HGY A;  4JND A;  2DOD A;  2DYS H;  1W5C C;  2R7R A;  5F27 A;  2P6S A;  2P0W A;  1TBX A;  2DQ6 A;  1MMA A;  4D9J A;  1TC3 C;  5B1A H;  2VQH A;  3B34 A;  3PNY A;  1MZB A;  5TRD A;  5M3M J;  3SZT A;  4AYB N;  3RI4 A;  1F36 A;  3CJN A;  4WF2 A;  3T1B A;  2VE9 A;  2Y0M A;  4PFP A;  1ONP A;  2D2W A;  1UG2 A;  1YE9 A;  1ZR4 A;  2CGP A;  1JG9 A;  2A68 F;  2BE5 F;  1E0E A;  1IO2 A;  2IXS A;  3BOQ A;  1VQ8 I;  3KYD B;  3UKG A;  1VQM I;  4XN2 A;  2JD0 A;  3J81 Z;  3I58 A;  5H2F C;  1X4P A;  2JRT A;  2XRL A;  3VYS B;  4MKT A;  3W2A A;  2K9N A;  2JJ7 A;  3I4N J;  4A3D J;  2CV0 A;  3ZMD A;  2VQC A;  2VKV A;  4BQO A;  1GV2 A;  2OV7 A;  3EUA A;  2LY2 A;  3J7Z I;  5KCM A;  4UVA A;  4A3C J;  1SFE A;  4BHB A;  4BQN A;  2VJI A;  4KA4 A;  2O8K A;  3CUQ B;  2OZU A;  2BY0 A;  4X1E A;  5E1Z B;  3SEQ A;  2L5Q A;  4ZX4 A;  5JO0 A;  1A04 A;  2MAP A;  3U21 A;  5J40 A;  2LSO A;  3JRB A;  3A03 A;  2WY8 Q;  3IV5 A;  1LEA A;  1GDT A;  3W2W A;  2VOO A;  4Y4R A;  3B2P A;  4XRS G;  3J80 K;  3RPU A;  3OSG A;  3OMY A;  3CCS I;  2NS8 A;  4QPO A;  4UUS B;  3ZRG A;  3KPH A;  2XQ0 A;  3OV8 A;  3PIP F;  1MBJ A;  1A6I A;  3BR0 A;  1EJ9 A;  4KT5 C;  2TRT A;  2GIV A;  4NDL A;  4LOC A;  2ECC A;  2ZXH A;  1UB9 A;  1QZZ A;  3ZMV A;  4E7I A;  3ULQ B;  3FDY A;  2LKP A;  4LK0 F;  3BG9 A;  1ZRE A;  2F4O B;  3F8N A;  3AAF A;  2ECB A;  1U8B A;  3FXJ A;  1OFC X;  2ZXI A;  2BV6 A;  2NNN A;  3SFZ A;  3BTC A;  4CA0 A;  1FX7 A;  1K4T A;  1NK2 P;  3I55 I;  4KUM A;  5J8C A;  3CCJ I;  1PYV A;  5DTD A;  4Q4I A;  3OR2 C;  5FKM A;  1ZN2 A;  3LQQ A;  4A5N A;  2DOA A;  4B48 A;  3PQJ A;  1G5A A;  5CVR A;  2DO7 A;  2HYG D;  2Z2S B;  1BR1 A;  1D0Z A;  2A69 F;  2KP6 A;  4F91 B;  1VQK I;  3IWF A;  4HZF A;  5DYF A;  3R61 A;  3CCE I;  5LEK A;  1T0F C;  2LP0 A;  4LLN A;  3FKJ A;  4FT8 A;  1H8A C;  2HGC A;  1BR4 A;  2HOT A;  1QPM A;  3X2Q H;  1JTX A;  2E7X A;  3TO7 A;  2E60 A;  2Z5U A;  1IV8 A;  3DKY A;  5C4J J;  1VQ7 I;  2BW3 A;  4PJN A;  1ZGJ A;  5LRR A;  5BS6 A;  3JSO A;  3WQR A;  2DPU A;  2R0Q C;  4MEY F;  3FIS A;  2DT5 A;  1Y56 A;  1ZRF A;  4IQJ A;  2B7E A;  2H27 A;  3C7J A;  3HTS B;  4IHX A;  1BJZ A;  2LF8 A;  2XPU A;  3Q0V A;  3S1M J;  4XMV A;  2JN6 A;  3ZHX A;  2CWE A;  4BYY A;  3JAM K;  4HRI A;  1UST A;  2EH3 A;  4S0H B;  4J00 A;  2DFH A;  3FUF A;  2KT0 A;  2HPM A;  1QVU A;  2GXG A;  4O3M A;  2VN2 A;  2QSG X;  1B9N A;  5CVU A;  2LC2 A;  1TWA J;  4G6D A;  3QYB A;  1FBS A;  2DYR H;  5DUI A;  3GUD A;  1VND A;  2H09 A;  2DQM A;  2L0K A;  3S93 A;  3V7R A;  1FTZ A;  3E7L A;  4JX6 A;  4HAM A;  4CCJ A;  2LRE A;  3TOB A;  4BE2 A;  5E79 C;  3H35 A;  1FP1 D;  1SVO A;  4IQ4 A;  2COM A;  1U3E M;  2JSC A;  3BCA A;  3MQ0 A;  3EPZ A;  5AIP A;  3GEZ A;  2QZ8 A;  2KQR A;  3CIA A;  2OPT A;  3FUE A;  3W3C A;  3LSM A;  1DGW Y;  2QA4 I;  1J7K A;  3DF8 A;  1V5E A;  3DKW A;  3WGH A;  2PI0 A;  1XG1 A;  3QYE A;  4KIT B;  1YO5 C;  2HWV A;  2MA3 A;  3R0I A;  3DPU A;  5H6Q A;  4ENK A;  2EBI A;  2JVH A;  3IAS 2;  1SQM A;  2B9S A;  3FXM A;  4KJZ A;  3LST A;  2PQ8 A;  2MGQ A;  3SZP A;  1S7A A;  2RJI A;  2R7Z J;  1V3F A;  1LEB A;  3FUM A;  5HDK A;  4AIJ A;  4I0B A;  2X6W A;  3OOP A;  1LDK B;  4QTR A;  4RB2 C;  2W84 A;  3OSF A;  3S3O A;  4EM0 B;  4XMT A;  1FMW A;  2N8G A;  2XAG A;  2X4H A;  4AIK A;  1FY7 A;  2F4M B;  2O03 A;  3B6A A;  4AU7 A;  5LHH A;  3CHP A;  3H1C A;  3KE2 A;  3GTJ J;  3RDI A;  5EV7 A;  2JCX A;  3NWS A;  3F8M A;  3EBI A;  5D8L B;  2X9D A;  4II2 A;  2VJ8 A;  4ZX3 A;  3MWM A;  3FH7 A;  2K3F A;  1XSX A;  4ZQE A;  2R7Q A;  2IGM A;  2K5C A;  1HW5 A;  1I3Q J;  4FHT A;  3L2U A;  3H5N A;  2PEX A;  3MZH A;  4FCA A;  5K1Y A;  2VT3 A;  3GTK J;  4U7B A;  2PMU A;  1HXD A;  3EDP A;  2X51 A;  4BXF A;  1T8I A;  2TCT A;  4S05 A;  1YOV B;  3A01 B;  2VAS A;  1XC5 A;  2EB7 A;  3I54 A;  3LQR A;  3OIP A;  5DEQ A;  2V9K A;  2R7O A;  1ERD A;  2K27 A;  1WFX A;  5J4V A;  5LEJ A;  3KLO A;  2IS6 A;  2VXZ A;  1X1B A;  3QYF A;  2GA1 A;  3MN2 A;  4I98 B;  3V8K A;  2K9M A;  3QWL A;  5LGN A;  2CUE A;  1BI2 A;  2VBX A;  2R7S A;  3G2B A;  2XGD A;  4CYC A;  1XCV A;  1Y0U A;  1FSE A;  4HW0 A;  1MGT A;  1TP4 A;  3HC7 A;  3ECH A;  3KP5 A;  4XRS A;  1APL C;  2JPB A;  1JUM A;  2OQR A;  3CZL A;  4ARF A;  1RUN A;  3PUU A;  2FOW A;  1GVD A;  3NRV A;  4B8X A;  4YIR X;  3CC4 I;  5FLM J;  4L9T A;  2GXB A;  1Z7U A;  4AVP A;  1VQ6 I;  4W97 A;  4F52 A;  4WCG A;  2D5V A;  1Y39 A;  2W57 A;  3IKT A;  5CVV A;  3DBR B;  3CF5 F;  1U5T C;  4Z2Y A;  3L00 A;  4OMZ A;  1WI3 A;  3NEU A;  3F8C A;  3QAH A;  3B7U X;  1U9O A;  4GYI A;  1K7A A;  2X1E A;  1I50 J;  2CQK A;  2ZME C;  1O3T A;  2HXO A;  5CQG A;  2X48 A;  4XNF A;  2JRM A;  1NTC A;  4FTH A;  3P9I A;  5GAE J;  4BDY A;  2KDZ A;  4DIQ A;  2JT1 A;  2L7Z A;  4MQV A;  2M3A A;  2QSF X;  3EQL F;  4AD9 A;  1TNT A;  4KMU X;  4OOF A;  4ZW8 A;  2QQB A;  5DYM A;  1P4X A;  4U87 A;  5IPA A;  4ENJ A;  5FGM A;  1I6H J;  5FLX K;  1SD6 A;  4UVB A;  5ICF A;  3T8T A;  5D5X B;  4AUX A;  4RAZ A;  4ZW7 A;  2B0L A;  1AU7 A;  2KRC A;  3FU5 A;  3RAS A;  2Y0S N;  2O3F A;  2B61 A;  1S6L A;  4YRV A;  1T39 A;  2W4S A;  2BYV E;  1YJ9 I;  4K5L A;  1CF7 A;  4JBA A;  2IPQ X;  4LG0 B;  2JA6 J;  3E6C C;  1BI1 A;  2KIQ A;  1FP2 A;  3BTI A;  3M1E A;  1IG7 A;  2E1C A;  1AOY A;  4D7N A;  2JUC A;  2ZJR F;  2KFD A;  1ORK A;  5LRS A;  3KEO A;  2M0C A;  4LUP A;  1WJ5 A;  5HDN A;  3UR3 C;  2JQ7 A;  1BIB A;  3P5J A;  2LMD A;  3LA7 A;  2O7O A;  4BE1 A;  4L0Z B;  2YU3 A;  3K2A A;  4XID A;  1FMV A;  5FKK A;  3CZE A;  3PUB A;  2ZJ2 A;  3OYK A;  2Q2E A;  1FT9 A;  3OYI A;  3QJX A;  1F1Z A;  4YFK F;  2DK8 A;  2EV6 A;  4HEA 2;  3HSF A;  3TED A;  3BR3 A;  4L5E A;  3D5R C;  2PX9 A;  1W7P D;  3ZQF A;  3FXU A;  3ZOB A;  2QQ8 A;  5GTH C;  1KQ0 A;  4PJM A;  4ZDP A;  2UXX A;  3S2W A;  3FTW A;  3WTY C;  4FQG A;  2FOK A;  4GDF A;  1Z7L A;  2HOS A;  1GXQ A;  3VVL A;  2K3P A;  3KZY A;  4IKF A;  1BJA A;  2X1C A;  3FHE A;  4OOE A;  2Z1D A;  2RVC A;  3GW2 A;  4A0Z A;  1N25 A;  5B66 C;  3DLA A;  2E5N A;  4JOM A;  1U5T B;  2EV5 A;  3COA C;  3M8F A;  3FTV A;  3TKY A;  3BPV A;  4D7M A;  4XLF A;  3FK7 A;  1HDD C;  4RBO A;  1B8I B;  3CO6 C;  1HS6 A;  1OYI A;  4CCO A;  3OIO A;  2CU7 A;  3F8F A;  1S29 A;  3OYD A;  3FXL A;  1UZC A;  2L2O A;  5JNL A;  3ONQ A;  4WK8 F;  2FEZ A;  3Q9V A;  3BY6 A;  4R8H A;  1S3J A;  2ESH A;  1IRG A;  2BXY A;  3CTA A;  5E3O A;  1ETV A;  2MBF A;  1KGS A;  2HTS A;  4HST A;  3T8R A;  2MYS A;  2CUZ A;  2KL4 A;  2CG4 A;  2XPW A;  1R23 A;  2VBY A;  1MJ9 A;  2HPT A;  3R0A A;  1BW6 A;  3BRO A;  5D5V B;  4A3K J;  5F1J A;  3BTJ A;  5JHU A;  5HLI A;  4A3M J;  3W6V A;  3J80 Z;  3HM5 A;  4P5O A;  4KIF A;  2W25 A;  1TW3 A;  1A35 A;  3Q5F A;  1P92 A;  1IDY A;  1BC7 C;  2CQQ A;  2R70 A;  3W6K B;  1ZQ3 P;  2GTQ A;  2XPZ A;  4UHT A;  4ZTF A;  1FNN A;  3PO3 J;  2QKM B;  2KJB A;  1J9I A;  1LE8 A;  3HKZ N;  3QP6 A;  2STW A;  4Q4E A;  1Z05 A;  4XSZ F;  4MO7 A;  2IS1 A;  3QOP A;  4K5N A;  2DOE A;  2CUJ A;  3BP8 A;  4XL9 A;  3B6C A;  2PJR B;  2DMQ A;  4C9Y A;  3R6S A;  2VKD A;  1MMN A;  3C3W A;  1GV5 A;  1SG7 A;  5K5R A;  4HLY A;  4WXH A;  3GCM A;  2F2E A;  5C3E J;  1L0O C;  3IRR A;  3FHN A;  4NC8 A;  5K7F A;  2YPR A;  3M9A A;  5HNF A;  2UXN A;  1G4D A;  4BKX A;  2DBB A;  1BI3 A;  3F6V A;  3JTH A;  5F0C A;  2P8T A;  3ML6 A;  1T08 B;  2JA5 J;  2XF7 A;  4OIO F;  5BPI A;  4MGR A;  1ETK A;  2O7G A;  3H92 A;  3KP4 A;  5E18 F;  4FAS D;  3ZMT A;  4ZN6 A;  4W1U A;  2LG4 A;  2FJ1 A;  3ZMU A;  4UB8 C;  4BBR J;  4OIQ F;  1IDZ A;  5M5W J;  1EV7 A;  2JVG A;  2OC6 A;  1D0X A;  3MKW B;  2QVO A;  1R4M B;  1H9G A;  4HA8 A;  3MZY A;  3OWT A;  2DW4 A;  2RV8 A;  3CMM A;  3FWE A;  2K86 A;  3FTY A;  2VPR A;  1VI0 A;  3IP4 B;  5FJ8 J;  2BVL A;  4N9H A;  4BQQ A;  5KK1 A;  1QA6 A;  2QSH X;  5A2Q K;  2K4J A;  4KIB A;  3FM5 A;  3TMO A;  2LFB A;  4HNU A;  5EEA A;  4U0W A;  2ID3 A;  3K70 C;  1H0M A;  3C2B A;  2WAQ A;  3TDU C;  3VDX A;  1NG6 A;  3JRH A;  2W82 A;  4CHU A;  4OWR B;  3OYM A;  1MNE A;  2HVS A;  2HFH A;  4MEX F;  3HUG B;  1XSV A;  2OCE A;  4QIW N;  5ICE A;  3I64 A;  4A3I J;  1YQA A;  2ZFW A;  1W7P B;  1O7F A;  3TW7 A;  3WHC A;  1JVS A;  3GTP J;  3FTZ A;  5TJJ A;  1R71 A;  4RM2 A;  2W00 A;  3T5X A;  3RQ4 A;  1G3T A;  1G3W A;  2ADU A;  2HTJ A;  4FX4 A;  1X58 A;  1VQO I;  1FYL A;  1MNM C;  1OIS A;  4XN1 A;  4EJU A;  4CSW A;  4B44 A;  4EJT A;  2CH0 A;  3NAR A;  3P7N A;  1QU3 A;  3OYB A;  3LL7 A;  3C1D A;  2AXL A;  5FO5 A;  4B1R A;  2FE3 A;  2GXA A;  2F5E A;  2CS3 A;  5HLT A;  3OYJ A;  1ETX A;  4G9Y A;  5L3C A;  4HF0 A;  4YFN F;  1IN8 A;  2EIL H;  1WCM J;  3CC2 I;  3H36 A;  5J47 A;  3CCR I;  5DD4 A;  3LSJ A;  3CJQ B;  2VJJ A;  3GXO A;  1FEX A;  4E7L A;  1XGO A;  2GOM A;  2WBM A;  2W7N A;  2PLY A;  2OD5 A;  5FKL A;  2H8R A;  1FPQ A;  3KED A;  1XN7 A;  3E1S A;  3CC7 I;  1YW9 A;  3DFG A;  4M74 A;  5GAD J;  3H3V K;  2AS5 F;  1AKH B;  4LIU A;  4OIR F;  2FSW A;  4RVB A;  1Z67 A;  1ODD A;  2LKX A;  2DU9 A;  2VQL A;  4XNB A;  1BOA A;  4RGU A;  3EUH A;  2R4G A;  5GAG J;  4IRH A;  1R49 A;  1QZE A;  2DJN A;  5FLX Z;  3BG7 A;  4BUP A;  3DBL B;  2RDP A;  3TGN A;  3CES A;  3M1C A;  3TP3 A;  1IRZ A;  4C30 A;  2MAB A;  2R5Y A;  4MFD A;  3IH4 A;  5FWQ A;  4I6Z A;  3LWF A;  3N97 A;  2DFF A;  2J5O A;  4K2E A;  2OTJ I;  3GZN B;  3J7A O;  1MW3 A;  3CHS A;  1JKP C;  1WVR A;  1XGM A;  3I0T A;  3OYC A;  1TQM A;  2QQ9 A;  3O8H A;  3I56 I;  4ZX6 A;  4C2M J;  2CW0 F;  3H9J A;  2F5C A;  2DA1 A;  2Y0S A;  2WTE A;  3A4C A;  3AG3 H;  3I9V 2;  3AU9 A;  2BOL A;  3FF5 A;  4IOC F;  1JGG A;  1YRN B;  2EIK H;  2XIG A;  4U0V A;  5D6E A;  5K7H A;  2NS7 A;  3ELK A;  4Q48 A;  1AKH A;  3B2X A;  4YG2 F;  2L01 A;  1I1S A;  5EG0 A;  2RC4 A;  1UJ8 A;  4EV0 A;  4BDZ A;  1VTN C;  1R9T J;  1S46 A;  3HGG A;  4J01 A;  3DV8 A;  4P9F A;  1R1V A;  2P4W A;  2OQG A;  4M6V A;  4LFU A;  3OYL A;  5D4S A;  4AR9 A;  1GT0 C;  2HPI A;  3OYH A;  2XAJ A;  4Y33 A;  4KNY A;  4WXC A;  1T33 A;  3FUK A;  2FX0 A;  1FOK A;  3OYF A;  3DPT A;  4E6K G;  1REP C;  5K5O A;  2OCC H;  3O8G A;  3L2R A;  3RSN A;  1IXR C;  3LAP A;  4ESF A;  4XN7 A;  3BQZ A;  2Y1D A;  4BE0 A;  4UVC A;  3S3N A;  3GBG A;  3KIO A;  4PK4 A;  4BJ5 C;  5DCM B;  3HBL A;  1K4S A;  5LBQ A;  2UV1 A;  2EZL A;  2X6Y A;  1QVT A;  4V2G A;  2ACJ A;  2G0E A;  3Q43 A;  3VYT B;  3UNG C;  3JRE A;  3CCM I;  1YRN A;  1MDM B;  4HQM A;  3CUO A;  2EZK A;  2XPV A;  3SEZ A;  3N4M A;  4Y52 J;  3BC8 A;  1FBQ A;  3AU8 A;  3D5L A;  2ICW G;  1W5T A;  4UNO A;  5ILV A;  1ITY A;  1D3Y A;  2R7W A;  1XGN A;  2XKP A;  3FK6 A;  1OYW A;  5BMZ A;  1D1B A;  5DUK A;  2XDV A;  1Z9C A;  2VL8 A;  4A2U A;  1E17 A;  1X3U A;  2FNP A;  4PJJ A;  5IT3 A;  1YX5 A;  1E2X A;  3BQY A;  2CV2 A;  4G8X A;  4BHC A;  3LSG A;  1NHA A;  2E5Z A;  2EQR A;  4HX7 A;  4M72 A;  2GAU A;  2DJI A;  5HS8 A;  1JGS A;  3PL8 A;  1ZLJ A;  2LK2 A;  4CCN A;  2QM3 A;  2M7A A;  3WTU C;  3J81 K;  5LGU A;  1WKM A;  4ZQF A;  3K1N A;  4G94 A;  4IPA A;  3HL2 A;  5HNH A;  2JZY A;  1J2X A;  5AON A;  2HNH A;  1ZAO A;  1F4K A;  3E6D A;  3CCU I;  3V8L A;  1R7J A;  1XS9 A;  3KP7 A;  1SEU A;  1NG7 A;  3CLQ A;  2QLZ A;  4GRI A;  1TWH J;  1SMY F;  1UHS A;  2VT2 A;  3CME I;  3UCQ A;  1R0K A;  3FU3 A;  3PIO F;  4HF1 A;  3M4O J;  2R5Z B;  1MMD A;  1ONN A;  1ULY A;  3K4N A;  4BBS J;  1LFP A;  5JHF A;  2ETH A;  4NC6 A;  1XX5 A;  2KMU A;  3KZZ A;  4BY7 J;  5DDG A;  2KIS A;  2ZJQ F;  2R7T A;  4N4N B;  3CHO A;  5JBI A;  5HLH A;  3ASN H;  4CXF A;  5E3L A;  1K83 J;  1R00 A;  4Y6R A;  3I59 A;  4BXU A;  1MW7 A;  2J5P A;  1JJ6 C;  4UXN A;  5EGO A;  3FTS A;  4CIC A;  2ZO4 A;  2FA5 A;  3HOT A;  1IZ1 A;  4BAY A;  4ZW3 A;  2Y31 A;  4FE7 A;  4HOB A;  1EH7 A;  2HYJ A;  1WI9 A;  3DWL E;  2IA0 A;  1ZEL A;  5IT9 Z;  5EF6 A;  2W85 A;  2BGC A;  2ZFU A;  2ZBK A;  2ZCW A;  4HSR A;  2GOX B;  2CJJ A;  5TIS C;  5DCF A;  2A7O A;  4EAT A;  3REO A;  4AYB A;  3KP3 A;  3TO6 A;  1R6R A;  2BHZ A;  4XM3 A;  4NHJ A;  2IT0 A;  5D5W B;  3HZJ A;  4JYK A;  3GF2 A;  3H9G A;  4YII A;  5E1W A;  5E1X A;  2DK5 A;  4LJZ F;  2Y1E A;  1R0L A;  3WGG A;  5L3B A;  2HDC A;  1B8I A;  1R1T A;  2A61 A;  4A3F J;  2M30 A;  3BCB A;  4IHW A;  3ABM H;  3E3V A;  4WWC A;  3FU0 A;  1D8K A;  1DP3 A;  1BN5 A;  1FOY A;  4HLX A;  2MSY A;  4J19 A;  2FBH A;  2HKO A;  3D0S A;  2JD2 A;  2AQF A;  5M3F J;  1WH7 A;  4BQA A;  4XND A;  5LHG A;  3RZD J;  2F5D A;  2X6X A;  3F6O A;  3K7A J;  4AM3 A;  3BZK A;  1E3H A;  1JTY A;  1R36 A;  2MH9 A;  3G3Z A;  3GLX A;  1D5V A;  2HPO A;  1FJL A;  4PSW A;  4P96 A;  4RAY A;  2OZ6 A;  2KKO A;  1RKW A;  2VLA A;  3HPG A;  3F23 A;  4QSH A;  2A6E F;  1FTT A;  4DW6 A;  4ZH4 F;  1A31 A;  4HG2 A;  3L2V A;  1WJC A;  2CW7 A;  2FU4 A;  2JK3 A;  2KZG A;  2XAU A;  2ISY A;  1P2F A;  2RNJ A;  5ICG A;  5GP9 A;  4X2U A;  3MCZ A;  1STZ A;  2G7U A;  5EDN A;  3DTK A;  2WY7 Q;  2VE8 A;  2E35 A;  5GAH J;  2Y2Z A;  3I71 A;  4EM1 A;  3ZP5 A;  1MBH A;  1J09 A;  1V54 H;  3PSI A;  1IW7 F;  4AR1 A;  1OCP A;  1POG A;  1V5F A;  2OAZ A;  4I99 C;  4XRM A;  2BXZ A;  4XKC A;  5KAF C;  1HC8 A;  3E6M A;  2EIM H;  3CMY A;  4GO1 A;  4N0B A;  1A6Q A;  4EJV A;  4QUO A;  2XVC A;  3R0J A;  1BI0 A;  2DMN A;  4XNA A;  1T1R A;  1K6Y A;  1M1E B;  3ZHZ A;  3S16 J;  3ESW B;  1O7L A;  5JAZ A;  3CO7 C;  4AWX B;  2DFI A;  2L9R A;  5E20 A;  2R93 J;  1WJE A;  3ANM A;  2VQG A;  1SC5 A;  2JMW A;  2UUZ A;  1HKS A;  5JVG F;  1RC9 A;  4KIG A;  1QQI A;  4KN7 X;  4ESJ A;  3IIE A;  1KQ9 A;  3GVA A;  3UEQ A;  1PDN C;  1HOM A;  4PDK A;  5CVI A;  2IAI A;  1MJB A;  4U0Y A;  3QP5 A;  3T8V A;  1YJN I;  4PSX A;  3TP0 A;  1ZKG A;  2M8G X;  4E7K A;  3U9W A;  1X1C A;  3CLO A;  1J75 A;  1MBG A;  1Y6I A;  2BEO A;  2BBY A;  2YS9 A;  2PJR A;  2Y1G A;  1HDP A;  3B7S A;  1JT6 A;  2XPY A;  4Y15 A;  1Q1H A;  4A69 C;  1Q0L A;  4LLL A;  4MNU A;  2GM4 A;  1E3P A;  3EBG A;  2E1N A;  5HLG A;  2O8X A;  1J5Y A;  5AEN A;  1FC3 A;  3CJT B;  4A93 J;  1VQN I;  3KZI C;  4XN3 A;  3ANN A;  4RB1 A;  4CCM A;  1Q0Q A;  1X19 A;  2CFO A;  2VIX A;  1IF1 A;  2GIZ A;  1V5G A;  3BG6 A;  2EIJ H;  4E7S A;  1K78 A;  2EZH A;  2Y69 H;  2DDB A;  2L4A A;  1MW1 A;  3Q3S A;  2WAE A;  2C6Y A;  3CD6 I;  1P4W A;  3F22 A;  1H9T A;  3KEQ A;  5IOZ A;  1JKO C;  1O57 A;  4K5M A;  3DU5 A;  2QBY B;  3CP8 A;  4HV6 A;  1B1B A;  4RS8 A;  3VOE A;  1IV6 A;  2VKH A;  1LDD A;  4QIR A;  4GXO A;  3ANL A;  2A6H F;  2ESN A;  3ABT A;  3HXL A;  2EFW A;  2FD5 A;  1RKT A;  4PFO A;  1OCT C;  3I53 A;  1MH3 A;  2EA2 A;  3HOS A;  3L7W A;  5EEG A;  3F3X A;  3DXJ F;  1LNW A;  2ZME B;  4X6A J;  1FSH A;  3FH5 A;  3L2Q A;  4XOP A;  1T56 A;  1R5I D;  2X0L A;  4DJA A;  1OQY A;  4EGY A;  2V1U A;  3FKI J;  4M3F A;  4BJ6 C;  4HF2 A;  1HSJ A;  5FFX A;  4U7D A;  4EGZ A;  4C2U A;  2H6C A;  3HRS A;  3K2Z A;  2V4J C;  2A07 F;  2JWT A;  4XN4 A;  4OOI A;  3QPL A;  5CJ9 A;  4JK1 X;  4I2O A;  1EF4 A;  4IHV A;  4UB6 C;  1YHQ I;  2STT A;  1FWZ A;  3HIF A;  1J0R A;  3GZ5 A;  5JVT A;  3VSK A;  1Q0H A;  4XN5 A;  1W0T A;  1UEL B;  2QUF A;  1XPX A;  2H6B A;  2EPF A;  5EYR A;  3MFK A;  2P5V A;  4B43 A;  2HQ5 A;  4BH9 A;  1XMX A;  4RSY A;  2ELJ A;  5L3E A;  3SZG A;  1KON A;  2VOD A;  4XLC A;  2XC7 A;  3PFI A;  3DBH B;  3JRC A;  5LD2 C;  1Z1D A;  3CZ6 A;  3A01 A;  1ZGA A;  3E5X A;  4TV7 A;  4M9X A;  1OYY A;  1WJF A;  1WJB A;  3KP6 A;  4S04 A;  2C5Z A;  1WPK A;  2DT6 A;  4CCL A;  1U6G A;  1G6N A;  2CQX A;  4YEL A;  1VF9 A;  3JR9 A;  2XAF A;  3F21 A;  2JD1 A;  3H3Z A;  3U2R A;  4JX4 A;  1LQ1 A;  2HVQ A;  3G4S I;  4XBF A;  2HVR A;  1PUF B;  2E34 A;  4A0Y A;  3ZI0 A;  2V26 A;  4OAZ A;  3ZQL A;  3QU6 A;  3SQN A;  2ZKZ A;  5KNL A;  3OYG A;  4I09 A;  3W6J B;  4D5C A;  4XLA A;  5GTI C;  2DA5 A;  3CHQ A;  4ZQG A;  4B09 A;  1RRJ A;  4C2T A;  5DM7 F;  2M1B A;  2FML A;  3QPH A;  3KX2 A;  3L9F A;  2FBK A;  1Z3Y A;  3MKZ A;  4LK1 F;  3PM1 A;  4HDU A;  1JE8 A;  2KRH A;  2EJR A;  4XOR A;  3A2K A;  4V2F A;  2MLK A;  2BY3 A;  2D1V A;  4II3 A;  1E3O C;  5FLV A;  2WWY A;  5IT9 K;  2L4M A;  2VB6 A;  1QPI A;  3BR1 A;  2LH9 A;  5C44 J;  1LFU P;  5EEH A;  2EFQ A;  4IZZ A;  2ZNY A;  1WSU A;  1X2M A;  2H1L A;  3L2C A;  1ZGW A;  3ZQG A;  4F7Z A;  3IHU A;  4LG3 A;  2QEX I;  3V7C A;  3VPR A;  4XN9 A;  5BPP A;  3HSE A;  1RZ4 A;  4KYW A;  3B73 A;  4YEJ A;  2V1N A;  1RES A;  3AG2 H;  3W2V A;  3B37 A;  1TZL A;  2DTZ A;  2TDX A;  2W24 A;  2W1O A;  3K4K A;  5M5Y J;  3L1P A;  4LIV A;  3ZGK A;  1ZH5 A;  2EK5 A;  4K5P A;  3MAJ A;  1IRF A;  3K4B A;  3CF2 A;  2DPD A;  3JCU C;  2XKO A;  3V7S A;  2R7V A;  2PMH A;  1VQP I;  1KZH A;  3M3Y J;  3KP2 A;  1RP3 A;  3HPH A;  1RPW A;  4QLC U;  2Z9O A;  1I6X A;  1ETW A;  1XD7 A;  2CMP A;  2W48 A;  4R5T A;  5BOX A;  1YYV A;  2GQQ A;  3AL0 C;  4UV8 A;  1MD0 A;  2LVS A;  5FD5 A;  2RQQ A;  4U88 A;  3S2H J;  3LSI A;  4UV9 A;  4F93 B;  3ZQI A;  3OR1 C;  3JRA A;  2M87 A;  4E70 A;  1TWF J;  1B72 B;  1PJR A;  2VOP A;  2XGE A;  1IXC A;  1BW5 A;  4HNV A;  3MZ8 A;  2O5R A;  1MMG A;  5FD6 A;  4DQ2 A;  2O0Y A;  1FIA A;  3WTW C;  1IN7 A;  4FLQ A;  5HOO A;  5DCM A;  3ABK H;  1B4A A;  1RI7 A;  1TLH B;  2E19 A;  4G12 A;  3DP7 A;  5AIQ A;  1MMS A;  1XMK A;  4L9J A;  3CCL I;  1Y0N A;  4P55 A;  3LSR A;  4CGZ A;  2QF7 A;  5KVR A;  5J4Y A;  3RZO J;  4E7J A;  3G73 A;  2QKL B;  4C3H J;  3IUO A;  1W1W E;  2XRN A;  1SVL A;  2BVM A;  3CP2 A;  2WZG A;  2LY1 A;  2F5F A;  2WV1 A;  4XKV A;  3TW6 A;  2RGV A;  3DTE A;  3A0B C;  3WHB A;  2QJ1 A;  2WAD A;  3WU0 A;  1VQ5 I;  3ZN1 A;  2HDW A;  2ID6 A;  4JQF A;  2VON A;  5JFR A;  3ZQH A;  3KLN A;  1K79 A;  4CZZ A;  2JCY A;  1OR7 A;  3QRF F;  1KA8 A;  5D8K B;  1F43 A;  3ZQQ A;  3F8B A;  5BNG A;  2Y9Y A;  4PGH A;  1SC7 A;  2E71 A;  2OJE D;  3FBI B;  1EKE A;  1T1S A;  1FOW A;  1HST A;  4M3B A;  1B6A A;  2ELH A;  4Q47 A;  3ZQC A;  2NVX J;  4Y6S A;  4ZYG A;  1OCC H;  1DGR M;  4OIN F;  4EJW A;  3L09 A;  3HDD A;  3P9C A;  5JLX A;  4PUS A;  2QWW A;  3BDD A;  3S3M A;  3IH3 A;  2NAZ A;  3K0L A;  4UUT A;  3WE3 A;  1YIJ I;  4MLO A;  2LRD A;  2QGU A;  2LBF B;  2A5Y B;  2AQE A;  2EA4 A;  1B9M A;  1VQL I;  2BZT A;  1N75 A;  4AVZ A;  5IYB J;  2CQ7 A;  1QRY A;  1OMI A;  5E8I A;  1TQP A;  2NOJ B;  1UG0 A;  1Y8R B;  4ZQT A;  3S1N J;  1LE8 B;  3LA3 A;  1Y1W J;  2KHM A;  3FMS A;  1MH4 A;  2L02 A;  4Y17 A;  2V6C A;  3WE2 A;  3FZV A;  3K1P A;  3I59 B;  2DA2 A;  2E1M C;  3WQS B;  4ZC3 A;  1USS A;  3M8J A;  3FUI A;  3K4J A;  3RKW A;  3VOD A;  3GLL A;  2FBI A;  2K9L A;  3N05 A;  1X2N A;  1IN6 A;  3F9K A;  1XCB A;  3PUF A;  1Z91 A;  2IVM A;  5HS9 A;  4XQF A;  4X0G A;  3H0D A;  1T98 A;  5LHI A;  2PMZ A;  2V9V A;  2ZB9 A;  5D4R A;  3BZC A;  3DEW A;  2IGK A;  4KT6 A;  1HF0 A;  1L3L A;  1ZAR A;  4IHY A;  4IOA F;  1YIT I;  1YS6 A;  5GPA A;  3VB2 A;  4UUV A;  4KIS A;  5IP9 J;  2E2I J;  4KP7 A;  1OPC A;  2VBZ A;  2DA4 A;  4B3X A;  3B7R L;  3ERM A;  1TT5 B;  1PVE A;  3ERE D;  1W7P A;  5CPR B;  1X3Z B;  4IVN A;  3GFI A;  3MD2 A;  3LMM A;  5EJC A;  2QEN A;  4PZJ A;  4A3L J;  1IGN A;  4G7H F;  4CZC A;  4RB0 A;  1WJD A;  2R7X A;  4JX5 A;  3CUQ A;  4QWQ A;  5LGT A;  2DA6 A;  3GFM A;  1XGS A;  2MD0 A;  3GFL A;  2OU2 A;  3GZ6 A;  1SFO J;  2FF4 A;  4XR6 A;  3RPU D;  2KRF A;  2ZC2 A;  2ZXW H;  4ZYD A;  4KFC A;  1K5H A;  2L9N A;  1JHF A;  3WQQ A;  3FUJ A;  1WGX A;  3K4L A;  2YU9 J;  2WAQ N;  2WB1 N;  4GFB A;  2JTV A;  4GAE A;  2ME6 A;  3IH2 A;  2MAO A;  3PJR A;  4RM3 A;  1NH3 A;  2CRG A;  4C3I J;  1Q1V A;  5EZG A;  3RIR A;  3O2P E;  2RN7 A;  2OUM A;  3LSH A;  1BIA A;  2DTR A;  3IWZ A;  5BQT A;  1BM9 A;  1MIJ A;  1QNT A;  1YW8 A;  5HDG A;  3ZMZ A;  3RQI A;  2XAQ A;  3AL0 B;  3EUK L;  2L7K A;  1X3W B;  3V4G A;  2DFE A;  2E2J J;  1ENH A;  2LF7 A;  3M7G A;  5A2Q Z;  2ZJP F;  1FBU A;  1OCZ H;  2IEK A;  5J3L A;  5CVJ A;  1K61 A;  1JUS A;  3CQZ J;  4ZQH A;  4A3G J;  2R5Y B;  3H5R A;  4KDP A;  4YIF A;  2LD5 A;  1Z21 A;  1GUU A;  1DU0 A;  4DYC A;  3QPT A;  1SFU A;  2XF6 A;  1TQI A;  2XB5 A;  2P7V B;  1X1A A;  4XIC A;  4P9U A;  3FM3 A;  1D1C A;  4PGG A;  3ZQ7 A;  3A0H C;  2FFL A;  2Y30 A;  3WTV C;  4CYD A;  2ZNZ A;  4I7H A;  2LTP A;  2NRA C;  3JSP A;  4NB5 A;  1WH5 A;  4NQW A;  3ZCO A;  4G7Z F;  4A12 A;  2K85 A;  2K7L A;  3OIQ A;  5EG0 B;  3CZG A;  4HBL A;  3TBI A;  4J3B A;  5KHD A;  1TTY A;  3J7Y J;  2CO5 A;  3RC8 A;  3D1N I;  1S7O A;  1SAX A;  2HR3 A;  1G8X A;  3S1Q J;  3FHZ A;  2IP2 A;  2L7M P;  2WV0 A;  1X3W A;  2K4B A;  5FRM A;  1XMA A;  1Y8Q B;  2EFN A;  2DN0 A;  2R59 A;  3FBN B;  3CJR B;  3A1Y A;  4IRG A;  4L18 B;  5F0F A;  2FXA A;  3C18 A;  3S1R J;  3E6B A;  1KYZ A;  3I3L A;  3QOD A;  1PP7 U;  1YFH A;  2IS2 A;  4GAA A;  1EH8 A;  1RIO H;  2VI6 A;  1GVJ A;  2XAH A;  5ED4 A;  4BEH A;  2NVU B;  2FMY A;  1W36 D;  2M5W A;  2ISZ A;  4XLP F;  3NQO A;  1FZP B;  1ZK8 A;  1WZ2 A;  3UER A;  1BBY A;  1G3Y A;  3U1D A;  1AWC A;  4ZDL A;  3A14 A;  1P4A A;  4P1W A;  4R5X A;  3JT1 A;  1PP8 F;  3BTL A;  3U9G A;  2HQA A;  3V8J A;  3ZXS A;  2LOO A;  2VC0 A;  2XRO A;  2X6O A;  2VPL A;  5C4X J;  4B47 A;  1WHU A;  2ZXJ A;  5JLW A;  4XKW A;  4AIH A;  4KIC A;  3WU2 C;  3IC7 A;  4N9I A;  4IX7 A;  1ON1 A;  2ZME A;  1YLF A;  5B5E C;  1U2W A;  2HZT A;  3V42 A;  3HOZ J;  3CZK A;  4ZYE A;  3F0C A;  2JCV A;  1P9Q C;  1A5J A;  3HOY J;  3SDB A;  4GGG A;  1T2K A;  4M73 A;  2K02 A;  3LA2 A;  2LY9 A;  1FYM A;  4CH7 A;  1RR7 A;  4XOT A;  2GA2 A;  1TWC J;  2WA0 A;  3GYH X;  4Y67 A;  1BA5 A;  1G2H A;  5B1B H;  1PUF A;  3T0Y A;  4EEF G;  4QME A;  4XMU A;  1HCR A;  3JRG A;  2CSO A;  3HHG A;  2E36 A;  2JA2 A;  3HB9 A;  1LB2 A;  3HOX J;  2R3S A;  3HUG A;  3OYE A;  2MD5 A;  3HJE A;  4ENN A;  4ESB A;  4H4K C;  4Y6P A;  1UFM A;  2Y75 A;  2RAE A;  4XON A;  1HKQ A;  1UHM A;  4MTD A;  1UAA A;  2CW8 A;  3BG3 A;  3H0G J;  4LB5 A;  2ME0 A;  1SD7 A;  3OL4 A;  1ZG1 A;  3RCO A;  1WWX A;  2XF5 A;  4RLQ A;  1YW7 A;  1S7E A;  1O3S A;  1IN5 A;  4I76 A;  1IUY A;  3KET A;  2ZSI B;  2Z99 A;  2M45 A;  2F48 A;  2DA7 A;  2P5L C;  4QHP A;  2RNG A;  3SFI A;  4RDU A;  4XSX F;  2DMU A;  3LOC A;  3CXB A;  5J8F A;  2X1D A;  2F6C A;  4EMS A;  1FOX A;  5DM6 F;  3CDH A;  1IN4 A;  2ZSH B;  1CGP A;  5E17 F;  1ON2 A;  4NUB A;  3S32 A;  2DA3 A;  2IS4 A;  3ABL H;  1AHD P;  4XKB A;  4OMY A;  3R60 A;  3BG5 A;  1XSD A;  4BHP A;  1DDN A;  2DQL A;  1KU3 A;  3L2W A;  3WGI A;  1U5T A;  4A0X A;  4F92 B;  3MEX A;  3DTI A;  3SHF A;  3JRI A;  3VSL A;  4R79 A;  4Y13 A;  1OLT A;  3TDZ C;  3Q0U A;  4M3G A;  3CCY A;  4GYG A;  5F6F A;  3MKY B;  2M34 A;  1F5T A;  5JR3 A;  1QHH D;  5EZH A;  4FLS A;  3BLY A;  1TT0 A;  2K9S A;  2M0M A;  3AUA A;  2P81 A;  3DLL F;  3BJA A;  3FX3 A;  2HYF A;  4MS6 A;  3K9T A;  1QBJ A;  2HEO A;  3NWT A;  5BPD A;  3D5S C;  1JHH A;  2Y48 A;  4M3E A;  4XLH A;  1XTA A;  4PVB A;  3FUN A;  4L9N A;  2A6T A;  3AG4 H;  3DU6 A;  3G1L A;  4WX9 A;  1D5Y A;  4PW4 A;  4RCV A;  1XB4 A;  3CDL A;  1LUJ B;  1O4X A;  4XMX A;  4B3A A;  3M8E A;  5FKO A;  1KU2 A;  3QOE A;  3HYI A;  2LLK A;  3JTG A;  5L3F A;  4DBR A;  5IP7 J;  4XO3 A;  1F9N A;  2XSD C;  2GBY A;  4E7Z A;  4E7H A;  4M9Z A;  3ZPL A;  1SVM A;  3JSZ A;  3AG1 H;  1QO0 D;  2AHQ A;  2FQ4 A;  1ZLK A;  3QU3 A;  2DLL A;  3FMR A;  4G6T B;  3LSP A;  3DKX A;  3RTR A;  1ETY A;  2FNA A;  2XHK A;  2NVT J;  4DZP A;  3HRT A;  3FIW A;  2FUG 2;  2GWR A;  1SFK A;  3A02 A;  1MVY A;  5B3S H;  3Q44 A;  1VFC A;  2Y1C A;  3GTG J;  2R92 J;  3HOV J;  3ABU A;  4I02 A;  1JJ8 C;  3IKV A;  3E5Q A;  1GXP A;  3R4K A;  2O9L A;  4Z6Y A;  3OS1 A;  5DV5 A;  4HQE A;  1AA7 A;  1I3A A;  2D45 A;  2NYX A;  5FRN A;  3RYR A;  4ON0 A;  1MBF A;  3ROU A;  2E1M B;  3GFJ A;  2M4G A;  4ZZL A;  2V1D A;  4DOZ A;  2AO9 A;  3HOU J;  4YFX F;  3FXK A;  3I4M J;  2PGG A;  2V1X A;  4RMN A;  1J59 A;  1ONO A;  3B7T A;  2DOF A;  3C2G A;  4L5J A;  3MMY B;  2G9W A;  4A03 A;  2Q0O A;  2XGX A;  4M6Y A;  1MW0 A;  3RYP A;  3KYL A;  1CF7 B;  2H8W A;  1A36 A;  4BAC A;  4M9S A;  4EJO A;  3GTO J;  1DPU A;  4MIM A;  4CDG A;  5D6F A;  1MDM A;  1ETO A;  2Z3Y A;  4HX8 A;  3GTL J;  5HS7 A;  1MW2 A;  4XMZ A;  4PCQ A;  3Q9S A;  3TO9 A;  3BWG A;  4XRF A;  4RGS A;  1R5G A;  2Q8K A;  5H6R A;  5DD8 A;  5ILS A;  4FET A;  1DP7 P;  1LFB A;  1MBK A;  4NQW B;  1P7I A;  4O6J A;  2K40 A;  2ELK A;  2A3S A;  3HHH A;  1FLI A;  2DI3 A;  3PFY A;  1YG2 A;  1EH6 A;  2HOA A;  4ZYH A;  1N77 A;  2WB1 A;  3FUL A;  3GO5 A;  1TL8 A;  3JRD A;  4N4O B;  4LB6 B;  4L5I A;  4BS9 A;  1S9H A;  4B4C A;  1HBX G;  4JP0 A;  4MTE A;  1LVA A;  1P7J A;  2I5U A;  3SYT A;  2QQA A;  1IUF A;  2B63 J;  3FUH A;  1QHG A;  4G7O F;  1JGI A;  3M07 A;  3JW4 A;  5JC1 A;  4MQ9 F;  4RLF A;  4LD5 A;  3KEY A;  1CQT A;  3AKZ A;  2MFZ A;  4HV5 A;  2I8D A;  4UUS A;  2L9S A;  1SMT A;  4LG0 A;  4ZX5 A;  1MND A;  5F08 A;  2PUS A;  3E5U A;  4FLR A;  2LBF A;  2R7D A;  2DMP A;  4DNC A;  1KQ8 A;  4BJT A;  3WTX C;  5D5U B;  4LLG F;  2K9Q A;  3SDG A;  2PN6 A;  1JKR C;  1VQ9 I;  1SAU A;  4R7L A;  1W36 C;  2WPG A;  1U8R A;  2OBP A;  2IA2 A;  4XK4 A;  4D1Q A;  1NK3 P;  1DPR A;  2HOE A;  4A6E A;  3CMA I;  4ABZ A;  4XN0 A;  4IO9 F;  3ZN0 A;  1LKX A;  3E97 A;  4ZYA A;  5JMW A;  5IYC J;  2XGC A;  4IHS A;  4L2L A;  1OCR H;  5IY5 H;  1S8N A;  1U0J A;  4Y7N J;  1I27 A;  2V9P A;  5F04 A;  1JKQ C;  3EBH A;  4XLN F;  3EYI A;  2VBW A;  5IP6 A;  1XDU A;  3RPQ A;  3ISP A;  4ZDO A;  2X85 A;  3GTQ J;  4AYS A;  3WTZ A;  1GHC A;  1WJA A;  2JA7 J;  3K4M A;  2C82 A;  2HQN A;  4A3E J;  1OCO H;  3GWZ A;  3LFK A;  4AID A;  4RA2 A;  1I5Z A;  1C0W A;  1I1G A;  1K6O A;  2UZK A;  4ZW6 A;  1I39 A;  2IW5 A;  3WTS C;  4DYR A;  4RAG A;  1Z0X A;  3I4P A;  2BW3 B;  4XN8 A;  1MSE C;  1BR2 A;  1V4R A;  4BGD A;  5K7Z A;  5IYD J;  1OJL A;  1MJA A;  2D1H A;  4D0P A;  3S8P A;  1O3R A;  1QZY A;  1X3Z A;  3DPL C;  4A5M A;  3H3U A;  2KDO A;  3QPS A;  1W4M A;  3O3K A;  2L3D A;  2PL5 A;  3PNT A;  5CQE A;  2QCO A;  4XO4 A;  4DGW B;  1IC8 A;  1RR8 C;  2P6T A;  2DT7 B;  2KJC A;  4C3J J;  1SD4 A;  4BNC A;  5FKN A;  1QGP A;  2IGO A;  4O5V A;  1ZRD A;  3PO2 J;  1DU6 A;  3J7A Y;  1ZHF A;  1O3Q A;  3PSF A;  4Y3O A;  5HOD A;  2DDA A;  1K78 B;  1BL0 A;  2NNY A;  5ICC A;  5K5Q A;  2HDD A;  4UY8 I;  2YX7 A;  4XO5 A;  1R1U A;  1R4N B;  2FQ3 A;  2XAS A;  3TQN A;  3HOW J;  3BR5 A;  2HS5 A;  4FE4 A;  2NVQ J;  3H9Q A;  4F3Q A;  1PUE E;  1T95 A;  4HNT A;  2JA8 J;  1G3S A;  1X4O A;  2R7F A;  4HYE A;  4BY1 J;  3S15 J;  3MKL A;  3K6G A;  1ZG5 A;  1JXS A;  2BY2 A;  1Z3X A;  3CHR A;  1Z6R A;  2OA4 A;  2PMZ N;  1W5S A;  2EFP A;  5E8G A;  1TWG J;  4DYQ A;  3CCV I;  4ETS A;  2PFB A;  2L54 A;  2R72 A;  4LMY A;  4EM2 A;  2LNB A;  3KYC B;  1Z77 A;  2M4K A;  3OYN A;  4IRI A;  3RKQ A;  3FTX A;  2JPC A;  2Q1Z B;  3DQV C;  4BXX J;  2M2E A;  2V7F A;  3LAJ A;  2KPM A;  2NXN B;  1IRX A;  1R5H A;  1V55 H;  2WC2 A;  4AR8 A;  2EGH A;  3WG7 H;  3G71 I;  1IJW C;  4IJA A;  5FB2 A;  4XLE A;  1TW2 A;  2DAO A;  4KN4 X;  4H0E A;  3SJM A;  1H88 C;  2G7H A;  4DZJ A;  1MSF C;  2FRH A;  2CFX A;  1ZS2 A;  1D8J A;  4IHT A;  3B02 A;  2YSR A;  2XSJ C;  2YUS A;  1IAW A;  3ZMS A;  1S5L C;  2L7F P;  4MHG A;  3WG9 A;  2M8E A;  3S14 J;  2EZI A;  4HDV A;  1YX3 A;  1ZYR F;  3OS0 A;  1HA8 A;  2RRE A;  2WAF A;  2YR2 A;  3BPX A;  2E1O A;  4M71 A;  3VWB A;  1YS7 A;  2EWN A;  2IBD A;  4ITV A;  3TL4 X;  2EV0 A;  4R5V A;  1HQC A;  3B3B A;  2F5V A;  1X1D A;  3K69 A;  3ASO H;  3PNV A;  5FFZ A;  3VVM A;  5H20 A;  1YIO A;  1ONV A;  1SAN A;  4F55 A;  1JT0 A;  2QVW A;  4OAY A;  4XMY A;  4E4H A;  3JRF A;  1BC8 C;  2CV1 A;  2PJP A;  1H19 A;  3HG9 A;  3O6B B;  3CCQ I;  3RKX A;  5FRO A;  3WOD F;  3OYA A;  1HLV A;  1B72 A;  4HPQ A;  2LKS A;  2HI3 A;  4IL6 C;  9ANT A;  1SFX A;  5KAI C;  3RKY A;  1T6S A;  4KMF A;  5L3D A;  3HRM A;  4L9V A;  4ZJZ A;  1Z6T A;  1U78 A;  5F64 A;  1D1A A;  4BEH B;  4WXD A;  2BHY A;  3NAU A;  4OU0 A;  3EET A;  4BL0 B;  2HXI A;  4CO8 A;  2KLO A;  1ZTR A;  2WZF A;  1S72 I;  3ZHY A;  4DBQ A;  4Q4Z F;  2MC3 A;  2A5W A;  3GTM J;  4M3D A;  3CDI A;  2OTL I;  2QBY A;  4L0Y B;  1LVK A;  4I0A A;  5HVQ C;  4IXA A;  3E0J B;  2CQN A;  4A3B J;  3CUQ C;  2F4I A;  4ANJ A;  2VC1 A;  1BOB A;  3VEP A;  1UMQ A;  3HRU A;  1VZ0 A;  4AC0 A;  3HSR A;  2P7C B;  2KIF A;  3K4C A;  4CCK A;  1LDJ A;  5ILU A;  2RKH A;  1OR7 C;  4NBQ A;  3K70 D;  2O6G E;  2A05 A;  4ZZD A;  4FIS A;  2LDU A;  2MH2 A;  3BR6 A;  4HX4 A;  1RET A;  5CLS A;  3FXO A;  2DXI A;  4RGX A;  2E2H J;  2VXD A;  4RAF A;  3S17 J;  5EGO B;  1MKM A;  1YTY A;  4MFE A;  3DEU A;  4LGW A;  3VFZ A;  3BJO A;  3WTT C;  2MLG A;  5J1U A;  1H3L A;  1ACI A;  3FXQ A;  2PG4 A;  4CYC B;  2NOG A;  6PAX A;  2VUM J;  2Y9Z A;  3EYY A;  1MBE A;  1UCR A;  5J1R A;  2EFO A;  2XV4 S;  5L3G A;  4FCY A;  3LFU A;  1XDS A;  2I10 A;  4A6D A;  3F72 A;  2HQR A;  1T0F A;  4ZTJ A;  2Z16 A;  1KU9 A;  4PJL A;  3K1M A;  4PJ0 C;  3A06 A;  3QQA A;  2O61 A;  1YJW I;  3OL3 A;  1EA3 A;  1GLN A;  1OKR A;  2IRF G;  2EIN H;  1HKT A;  4IF4 A;  3BJ6 A;  2XUB A;  5LFA A;  3TOA A;  2HU9 A;  4NNJ A;  1R58 A;  1UHW A;  4LIT A;  4BU2 A;  2KIU A;  4PU2 A;  3FH8 A;  2DCE A;  1IXS B;  1R22 A;  2RQP A;  2ZXG A;  3FMQ A;  4OIP F;  2IGN A;  3HW2 A;  3G1O A;  1Y1V J;  3P9K A;  4R1H A;  2VJ4 A;  3VYR B;  2GZW A;  3PQK A;  1DQU A;  2IJL A;  3OS2 A;  1LJ9 A;  3GME A;  3LNQ A;  1T38 A;  4QPE A;  5E3N A;  1WQ2 A;  4V19 K;  2P5K A;  2YX4 A;  1W0U A;  5J6X A;  3AFH A;  4D5F A;  1P6R A;  1KYW A;  3LSK A;  3FXR A;  2BY1 A;  1SD5 A;  1RNL A;  1WRJ A;  1FIP A;  3IL2 A;  5DUL A;  2MW8 A;  3FUD A;  2HKX A;  3G1M A;  4EVI A;  1H89 C;  3VYU B;  4Q5S F;  4EQQ A;  4RB3 C;  2LYC A;  3RC3 A;  3IRQ A;  4AIC A;  5CYV A;  4CUG A;  3HKZ A;  4QPQ A;  3C2H A;  2NVY J;  4ZW5 A;  2HZD A;  1TNS A;  5GPC A;  5DLL A;  1JUP A;  1HW2 A;  2KZV A;  5DS9 A;  5J1Y A;  2M9H A;  5JMP A;  4FX0 A;  3WU1 B;  4I01 A;  2GLO A;  2IA1 A;  2JUG A;  2MC4 A;  1N78 A;  1HW1 A;  4RGR A;  2R5Z A;  3FTU A;  5E3M A;  3S2D J;  1ETQ A;  2JSP A;  2LR8 A;  3OOU A;  3HTU A;  5IOY A;  4FLO A;  1LPQ A;  1ZG3 A;  2Q2E B;  2JV7 A;  4M6X A;  2Y1F A;  3ECO A;  3RJP A;  1ZR2 A;  3DEE A;  2PBI A;  5LLQ A;  2UWM A;  2XB0 X;  4XMW A;  3GX4 X;  4ENM A;  2VJ5 A;  5F1R A;  1YI2 I;  2L9V A;  1GW6 A;  2E7W A;  1VQ4 I;  5F0H A;  2MG4 A;  3OY9 A;  1G59 A;  4IEJ A;  3FU6 A;  2CUF A;  5TGT A;  3EUH C;  3DCF A;  1X1P A;  2COB A;  3U1K A;  1B59 A;  3BR2 A;  1D0Y A; 
#chains in the Genus database with same CATH homology
 2DA3 A;  4XN4 A;  3QPL A;  1EF4 A;  4DPR A;  4IHV A;  1ETK A;  2O7G A;  1AHD P;  2OF7 A;  5M5X J;  4A3J J;  1U9N A;  4ZN6 A;  3BG5 A;  4W1U A;  3MVP A;  2FJ1 A;  3BT9 A;  1Q0H A;  4XN5 A;  1W0T A;  3JRI A;  4BBR J;  2H1K A;  1IDZ A;  5EYR A;  5M5W J;  2VKE A;  4K5O A;  4RSY A;  2HQ5 A;  3HEF A;  3Q0U A;  3CCY A;  4M3G A;  3Q0W A;  2M34 A;  4FLS A;  5EZH A;  2K9S A;  2DMT A;  3JRC A;  3AUA A;  2P81 A;  3A01 A;  3HGY A;  4JND A;  3FTY A;  2VPR A;  1VI0 A;  5F27 A;  4MS6 A;  2DQ6 A;  5FJ8 J;  1TC3 C;  2C5Z A;  1WPK A;  4M3E A;  3B34 A;  2CQX A;  5M3M J;  3FUN A;  4PVB A;  1VF9 A;  4AYB N;  3JR9 A;  2JD1 A;  1F36 A;  3G1L A;  4JX4 A;  2LFB A;  1ONP A;  5EEA A;  2ID3 A;  1PUF B;  1D5Y A;  1UG2 A;  3C2B A;  4RCV A;  4PW4 A;  3CDL A;  1O4X A;  1ZR4 A;  3JRH A;  1JG9 A;  3ZI0 A;  4XMX A;  3ZQL A;  4B3A A;  5FKO A;  4D5C A;  3UKG A;  2DA5 A;  2LLK A;  3CHQ A;  4XN2 A;  2JD0 A;  4ZQG A;  5IP7 J;  4XO3 A;  2XRL A;  2XSD C;  4MKT A;  4QIW N;  2K9N A;  4A3I J;  2GBY A;  2JJ7 A;  3I4N J;  3JSZ A;  3PM1 A;  3TW7 A;  4A3D J;  3WHC A;  1JVS A;  2AHQ A;  2FQ4 A;  3GTP J;  2VKV A;  3FTZ A;  1GV2 A;  3LSP A;  4V2F A;  1ETY A;  2NVT J;  1MNM C;  4DZP A;  1X58 A;  3FIW A;  4A3C J;  1E3O C;  5FLV A;  1ONN A;  4XN1 A;  1QPI A;  3A02 A;  3BR1 A;  5C44 J;  2O8K A;  1LFU P;  3NAR A;  1MVY A;  4X1E A;  1VFC A;  2Y1C A;  3Q44 A;  4B1R A;  2R92 J;  3GTG J;  4ZX4 A;  5JO0 A;  5HLT A;  2MAP A;  1X2M A;  3HOV J;  1ETX A;  1JJ8 C;  3JRB A;  1ZGW A;  3ZQG A;  2O9L A;  3A03 A;  3IV5 A;  3VPR A;  4XN9 A;  5BPP A;  1GDT A;  1WCM J;  1MBF A;  1RES A;  3LSJ A;  3B2P A;  3HOU J;  2AO9 A;  2PGG A;  4XRS G;  3I4M J;  3B37 A;  2DTZ A;  1FEX A;  5M5Y J;  3L1P A;  3OSG A;  1ONO A;  3B7T A;  2NS8 A;  4UUS B;  4K5P A;  5FKL A;  2H8R A;  3KED A;  4A03 A;  2XQ0 A;  3H3V K;  1MW0 A;  1MBJ A;  1A6I A;  3BR0 A;  2TRT A;  1AKH B;  4NDL A;  3GTO J;  3M3Y J;  4LOC A;  2ECC A;  4MIM A;  3GTL J;  1ETO A;  1MW2 A;  1RP3 A;  4RVB A;  4XMZ A;  2LKX A;  1RPW A;  1ETW A;  4R5T A;  2W48 A;  4XNB A;  3BG9 A;  2LVS A;  1LFB A;  1MBK A;  2DJN A;  2ECB A;  1U8B A;  1P7I A;  3S2H J;  1OFC X;  2K40 A;  3ZQI A;  2ELK A;  3FUL A;  2HOA A;  3BTC A;  3TP3 A;  3JRA A;  1IRZ A;  1NK2 P;  3JRD A;  1TWF J;  2R5Y A;  1B72 B;  4MFD A;  3IH4 A;  5DTD A;  2XGE A;  4I6Z A;  4Q4I A;  5FKM A;  5FWQ A;  1BW5 A;  4HNV A;  4B4C A;  1G5A A;  4JP0 A;  1MW3 A;  1P7J A;  3CHS A;  1FIA A;  1JKP C;  4FLQ A;  1IUF A;  2B63 J;  3O8H A;  5DYF A;  3FUH A;  4ZX6 A;  4C2M J;  1JGI A;  2LP0 A;  5JC1 A;  2DA1 A;  2E19 A;  4G12 A;  1H8A C;  1CQT A;  2HOT A;  4UUS A;  3AU9 A;  1JTX A;  4ZX5 A;  1JGG A;  1YRN B;  5F08 A;  2PUS A;  5K7H A;  3LSR A;  5C4J J;  2NS7 A;  2QF7 A;  4FLR A;  2DMP A;  3RZO J;  1AKH A;  3B2X A;  4C3H J;  2K9Q A;  3SDG A;  1JKR C;  3WQR A;  4R7L A;  2R0Q C;  3FIS A;  2WPG A;  2WZG A;  5EG0 A;  2WV1 A;  3TW6 A;  3WHB A;  1R9T J;  2QJ1 A;  1S46 A;  4IHX A;  3HGG A;  4XK4 A;  1NK3 P;  1BJZ A;  2XPU A;  3Q0V A;  3S1M J;  4M6V A;  4XMV A;  4ABZ A;  2ID6 A;  2JN6 A;  1GT0 C;  3ZHX A;  4AR9 A;  3ZQH A;  2JCY A;  2EH3 A;  4S0H B;  5IYC J;  2XGC A;  1OR7 A;  1T33 A;  4L2L A;  5JMW A;  3FUK A;  1F43 A;  2FX0 A;  5BNG A;  2Y9Y A;  3FUF A;  2KT0 A;  1QVU A;  4Y7N J;  1T1S A;  3O8G A;  4M3B A;  5F04 A;  1JKQ C;  3EBH A;  1TWA J;  5IP6 A;  4XN7 A;  3ZQC A;  3BQZ A;  1VND A;  2NVX J;  3GTQ J;  2Y1D A;  4Y6S A;  2DQM A;  4AYS A;  3GBG A;  2L0K A;  2JA7 J;  2C82 A;  4A3E J;  3HBL A;  3HDD A;  1FTZ A;  3E7L A;  4JX6 A;  2EZL A;  5JLX A;  1QVT A;  3IH3 A;  4UUT A;  4ZW6 A;  4V2G A;  3Q43 A;  2G0E A;  3JRE A;  4MLO A;  1YRN A;  4DYR A;  1Z0X A;  2EZK A;  2XPV A;  4XN8 A;  3CIA A;  1MSE C;  5K7Z A;  4Y52 J;  2OPT A;  3FUE A;  3AU8 A;  5IYB J;  5IYD J;  1QRY A;  1OJL A;  1X3Z A;  1XG1 A;  1ITY A;  3QPS A;  3FK6 A;  3S1N J;  4ZQT A;  2PL5 A;  1LE8 B;  1Y1W J;  3R0I A;  2QCO A;  2EBI A;  1SQM A;  4XO4 A;  1IC8 A;  1MH4 A;  2MGQ A;  2RJI A;  3BQY A;  2DA2 A;  4C3J J;  3LSG A;  2R7Z J;  3WQS B;  2EQR A;  5FKN A;  3FUM A;  3FUI A;  3PO2 J;  2LK2 A;  4QTR A;  1DU6 A;  1X2N A;  5HOD A;  3OSF A;  4XMT A;  1BL0 A;  4ZQF A;  2N8G A;  2HDD A;  5HNH A;  3B6A A;  4XO5 A;  3HOW J;  2ZB9 A;  3BR5 A;  4FE4 A;  3CHP A;  3DEW A;  1XS9 A;  3GTJ J;  1HF0 A;  2NVQ J;  5EV7 A;  4IHY A;  2JA8 J;  2JCX A;  5GPA A;  3EBI A;  4BY1 J;  1TWH J;  3S15 J;  2X9D A;  3MKL A;  5IP9 J;  1UHS A;  2E2I J;  2VJ8 A;  3FH7 A;  1R0K A;  4KP7 A;  3FU3 A;  3CHR A;  4ZQE A;  2DA4 A;  3M4O J;  3UCQ A;  1I3Q J;  2PMZ N;  2R5Z B;  4DYQ A;  1TWG J;  3B7R L;  4BBS J;  4FCA A;  2R72 A;  3GTK J;  1Z77 A;  4BY7 J;  3CHO A;  3RKQ A;  4A3L J;  3FTX A;  5JBI A;  2TCT A;  3A01 B;  1IGN A;  1XC5 A;  4BXX J;  2M2E A;  4CXF A;  5E3L A;  1K83 J;  4AR8 A;  4JX5 A;  2EGH A;  4Y6R A;  2DA6 A;  1SFO J;  1IJW C;  1JJ6 C;  5EGO A;  3FTS A;  3SJM A;  3MN2 A;  1H88 C;  4DZJ A;  4ZW3 A;  1MSF C;  2Y31 A;  1K5H A;  4FE7 A;  2CUE A;  1ZS2 A;  2XGD A;  4CYC A;  2HYJ A;  3FUJ A;  3WQQ A;  1WGX A;  4XRS A;  1APL C;  3CZL A;  1JUM A;  2YU9 J;  4ARF A;  2YUS A;  5EF6 A;  2WAQ N;  2WB1 N;  4GFB A;  4GAE A;  3PUU A;  1GVD A;  2L7F P;  2CJJ A;  2ME6 A;  5FLM J;  3IH2 A;  3S14 J;  2MAO A;  2EZI A;  2A7O A;  2CRG A;  4W97 A;  2D5V A;  4C3I J;  1Q1V A;  5EZG A;  4JYK A;  2E1O A;  2IBD A;  1WI3 A;  2Y1E A;  1R0L A;  4R5V A;  3B7U X;  1U9O A;  3B3B A;  3RQI A;  1B8I A;  1I50 J;  4A3F J;  4IHW A;  2HXO A;  3VVM A;  3FU0 A;  1SAN A;  2X48 A;  2E2J J;  1ENH A;  1JT0 A;  2QVW A;  2MSY A;  1NTC A;  3JRF A;  4J19 A;  4FTH A;  5J3L A;  2IEK A;  1H19 A;  2JD2 A;  2KDZ A;  1K61 A;  1JUS A;  3CQZ J;  1HLV A;  4ZQH A;  4A3G J;  2L7Z A;  2R5Y B;  5M3F J;  1B72 A;  2HI3 A;  1WH7 A;  9ANT A;  4XND A;  3RZD J;  3K7A J;  4OOF A;  2LD5 A;  4ZW8 A;  1JTY A;  1GUU A;  5IPA A;  1DU0 A;  1I6H J;  2HPO A;  1FJL A;  4DYC A;  1U78 A;  4AUX A;  1RKW A;  2XB5 A;  4ZW7 A;  1AU7 A;  3FU5 A;  3NAU A;  3RAS A;  2VLA A;  2Y0S N;  2HXI A;  3ZHY A;  1ZTR A;  4XIC A;  4QSH A;  2B61 A;  2WZF A;  1FTT A;  4DW6 A;  4K5L A;  3GTM J;  2FFL A;  2Y30 A;  4M3D A;  2JK3 A;  2JA6 J;  3BTI A;  1IG7 A;  2LTP A;  4D7N A;  1ORK A;  4A3B J;  1WH5 A;  4NQW A;  2M0C A;  5GP9 A;  4LUP A;  4X2U A;  1UMQ A;  5EDN A;  4AC0 A;  5EG0 B;  3CZG A;  4J3B A;  2O7O A;  3RC8 A;  3D1N I;  3S1Q J;  2Y2Z A;  3K2A A;  1MBH A;  4XID A;  2L7M P;  4FIS A;  5FKK A;  3BR6 A;  1X3W A;  3CZE A;  1RET A;  4AR1 A;  1OCP A;  1POG A;  4XRM A;  3S17 J;  2E2H J;  3QJX A;  2DN0 A;  5EGO B;  3CMY A;  2R59 A;  4MFE A;  3TED A;  3BR3 A;  4QUO A;  4L5E A;  1H3L A;  5J1U A;  5F0F A;  3S1R J;  3ZQF A;  3ZOB A;  2DMN A;  2NOG A;  4CYC B;  1T1R A;  4XNA A;  3ZHZ A;  2VUM J;  4GAA A;  3S16 J;  2VI6 A;  2Y9Z A;  3FTW A;  1MBE A;  5J1R A;  5JAZ A;  4FCY A;  2HOS A;  2I10 A;  1ZK8 A;  2L9R A;  2R93 J;  3VVL A;  3UER A;  3ANM A;  1SC5 A;  2JMW A;  3FHE A;  4OOE A;  3A14 A;  3IIE A;  4R5X A;  3UEQ A;  3JT1 A;  1HOM A;  3BTL A;  2IAI A;  3QQA A;  3A06 A;  3FTV A;  2X6O A;  3T8V A;  5C4X J;  4D7M A;  3TP0 A;  1ZKG A;  5JLW A;  2M8G X;  3FK7 A;  1HDD C;  3U9W A;  4RBO A;  1MBG A;  1B8I B;  1HS6 A;  4PU2 A;  3FH8 A;  2YS9 A;  2Y1G A;  3CZK A;  1HDP A;  3HOZ J;  2ZXG A;  3OIO A;  3F0C A;  3B7S A;  2CU7 A;  2JCV A;  1JT6 A;  2XPY A;  3G1O A;  3HOY J;  4A69 C;  1Y1V J;  1A5J A;  1Q0L A;  5JNL A;  4ZX3 A;  2GM4 A;  3LNQ A;  3EBG A;  4QPE A;  5E3N A;  2LY9 A;  5AEN A;  1W0U A;  5E3O A;  4A93 J;  1RR7 A;  1ETV A;  4D5F A;  3ANN A;  1TWC J;  1Q0Q A;  4Y67 A;  1BA5 A;  2XPW A;  1G2H A;  1PUF A;  1FIP A;  3T0Y A;  4EEF G;  5DUL A;  2MW8 A;  4QME A;  3FUD A;  1H89 C;  3G1M A;  4XMU A;  1HCR A;  2HPT A;  1BW6 A;  2EZH A;  3JRG A;  1MW1 A;  4A3K J;  5F1J A;  3BTJ A;  3HB9 A;  3Q3S A;  3HOX J;  4A3M J;  3W6V A;  3RC3 A;  4AIC A;  3HM5 A;  5IOZ A;  2NVY J;  4ZW5 A;  1JKO C;  4K5M A;  4Y6P A;  1IDY A;  2RAE A;  5GPC A;  1IV6 A;  1JUP A;  2CQQ A;  4QIR A;  5DLL A;  2R70 A;  5DS9 A;  5J1Y A;  2M9H A;  1ZQ3 P;  2GTQ A;  2XPZ A;  2GLO A;  5JMP A;  3ANL A;  3PO3 J;  3H0G J;  3BG3 A;  1LE8 A;  2FD5 A;  1RKT A;  3HKZ N;  2R5Z A;  1OCT C;  3FTU A;  4Q4E A;  2ME0 A;  1MH3 A;  1ETQ A;  5E3M A;  3S2D J;  2LR8 A;  3OOU A;  4MO7 A;  5IOY A;  4FLO A;  4K5N A;  1S7E A;  4X6A J;  3B6C A;  3FH5 A;  2DMQ A;  4I76 A;  2JV7 A;  2Y1F A;  1ZR2 A;  1T56 A;  1GV5 A;  1SG7 A;  2DA7 A;  4QHP A;  5C3E J;  3SFI A;  4XMW A;  2XB0 X;  4RDU A;  5K7F A;  3FKI J;  2DMU A;  3LOC A;  4M3F A;  1GW6 A;  5HNF A;  5F0H A;  2MG4 A;  3FU6 A;  4IEJ A;  4BKX A;  2CUF A;  5F0C A;  3DCF A;  2COB A;  2JA5 J;  2JWT A;  3BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...