4ZQGA

Crystal structure of the moraxella catarrhalis dox-p reductoisomerase in complex with nadh, fosmidomycin and magnesium
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
total genus 154
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqgA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqgA01
1BXGB 4MJLA 1K6JA 2NV6A 2NTJA 3GGPA 1G0OA 1HLPA 4XJSA 5GZ6A 4WCFB 5KVCA 5K0ZA 4BGUA 4GWGA 5HS4A 3PJDA 4AFNA 4B3JA 1RJWA 4XWYA 3GH3A 2OFPA 1RYDA 4W7IA 3PJGA 1TI7A 2GF2A 2HAEA 1MW1A 4I5DA 2CF6A 1BHSA 3PIIA 4HY3A 4MVJM 1K0UA 2FY8A 5JC1A 3CPSA 3CZMA 4BHTA 1LNQA 1PL8A 1BXGA 1WMBA 2DPGA 3U3XA 4LMPA 4BVAA 5IJZA 1PQWA 4PLPA 2PFGA 2XXBA 1J4AA 1Q0LA 1ENPA 2FPPA 4CV3A 5CG2A 2PWZA 4GX0A 4LK3A 3ZCXA 5TSDA 5IZCC 1UXHA 1LLDA 2CDBA 4AJNA 4GSLA 3CKYA 3KYCB 3O26A 4WCFC 4ND3A 4M89A 5HRUA 1NPYA 2DKNA 2V6MA 4CMKA 2JFFA 4C4OA 4NFYA 3OH8A 2AQKA 1J0XO 4GPD1 1E1KA 3HDQA 2X9NA 3ADPA 3H3FA 4X54A 1I32A 1VKOA 4HNGA 4YWJA 4PZDA 4IMPA 3MWDB 2PZJA 1DOHA 4CLXA 3PJEA 3I4CA 6ADHA 3ETDA 1DAPA 3PYLA 5BSGA 3MTGA 3PQFA 4GSKA 3KYCA 2Q1SA 1GZ4A 4ROSA 4R41A 2C82A 4D45A 3DZJA 4J16A 1H6DA 4J90A 2D4AA 3JQ9A 3TNLA 3I9LA 2FPGA 1PU2A 4RVUA 4BO5A 4OQZA 5I7FA 3W4IA 3NGLA 2DTXA 3RQSA 4LN1A 3INGA 1IYZA 4XB2A 1EFLA 1T2EA 3H5NA 2FZEA 3LT2A 1LXCA 1KOLA 2QX7A 1XYGA 5CEJA 1DDOA 3IC5A 3RJ9A 5THKA 4XR4A 4JXKA 4U5QA 2O7GA 2C2YA 3EDMA 1YE3A 3MWEB 5DN9A 5CEFA 3OJOA 2PV7A 4DL9A 4BO1A 2J3HA 1VL8A 4OSPA 5L7YA 4J4TA 3BIOA 4RQUA 5JW6A 4FSHA 4W7HA 5KOIA 3I6IA 4YJFB 1YB4A 1LLCA 4FS3A 5HS6A 4DXHA 3JD1A 2Y1FA 2B35A 1LA2A 1Q7BA 2DBRA 2HSDA 2PLAA 3WGHA 5KIAA 1F8GA 4O1MA 3BMQB 3LC1O 4NNJA 4TZTA 2WYWA 2OL4A 4GX5A 3U9LA 4BKOA 2JD1A 3PHLA 4YT4A 1D7OA 4UVHA 3UAGA 1E3JA 3FCOA 1EMDA 2CVOA 2NU8A 4BV8A 4UEOA 4KOAA 4AJLA 4QUKA 1GYQA 1EQUA 1OOEA 4YJFA 4ZJUA 1B8UA 3VH3A 3VH2A 4ALKA 5EQFA 3U0BA 1WNTA 2EERA 4F46A 2BELA 5LDGA 4K6FA 1C3VA 4UUPA 4WEOA 3PQDA 2DBQA 1EUDA 2LDBA 1YQGA 3C7CB 1HXHA 1GDHA 4YQZA 3WX0A 3WYCA 1KERA 4E2XA 4B7UA 3BMQA 3PPIA 5G0UA 4I9NA 4MVJE 3OJFA 4YJHB 3TRIA 1R4MB 4E5KA 5C37A 2JAPA 4BKUA 3DMTC 4I5EA 4LW8A 4DIFA 2VNAA 3BMCB 3KVOA 1EE2A 1LUAA 1YOVB 2YDXA 3G0OA 5A5EA 4TRJA 3E8XA 5T8KA 1RM4A 5JAIA 1IZ0A 3L6EA 2V6GA 2D59A 2D3TA 3A4VA 2X58A 4DIBA 1KEWA 5A1TA 2NNLD 4OSOA 5JYDA 1KVTA 3QW2A 3AI2A 4PZCA 1GQQA 2RHCA 3FWZA 1YWGO 4JJIA 1UDBA 4OXNA 4Q3DA 2ZJ1A 3Q9UA 4ZQEA 5ENDA 2IYOA 1E1NA 1E3WB 3F47A 3KSZO 3CZLA 3PGXA 1WLYA 1WZIA 3JD3A 4WLUA 5BT9A 3OJ0A 4N54A 4BO0A 4BMVA 3QY9A 1BW9A 3IMFA 1NAHA 1CJCA 1PWZA 2Q1WA 3LYLA 1P1JA 3BHJA 3IJRA 3DO5A 2OORA 4CMIA 3ITKA 5F3RA 5AXAA 1HWYA 1YQDA 4FIZA 4Q3BA 4B8ZA 4D7AA 1R12A 1TVEA 4BMNA 3JQAD 3BMNB 3DBLB 1PL6A 3GUYA 4J7CA 5A04A 1R0SA 3RROA 3FN4A 1ZW1A 2NTNA 3EMKA 4EJMA 4BS9A 3JQ7B 2D8AA 3OA0A 4EUEA 1E3WA 4OYRA 1PJ2A 3ZNOA 1ZKMA 4KUGA 4E31A 3GHYA 2B5WA 1YBMA 5A9SA 3WTCA 1ZFNA 3VPXA 2O3QA 2QZZA 3WGQA 4CXFA 3GDFA 1PR3A 1J49A 2Y67A 3KOUA 3BMNA 3ADOA 3V2UA 1NQ5A 1BVRA 3V1UA 2OGUA 3ORFA 4A27A 2GLXA 2X4GA 5HBRA 2O4CA 4GMFA 4EUFA 4INAA 1LI4A 4AICA 2EKLA 2X5OA 3AOEA 3QVOA 1S46A 1SB8A 3DONA 3JYNA 2AG5A 4QQRA 5JCJD 3DAPA 3K92A 1SZJG 3WIDA 1Y5RA 3PK0A 4RPKA 4Z9YA 4EJ0A 2I9PA 5F1PA 1H6BA 3NT4A 1CQJA 2R00A 1ZH8A 3FF4A 4IGFA 2NSDA 1P31A 2VQ3A 2ZCVA 4Y8VA 2JCYA 1JTVA 4JBIA 3DHYA 3H6KA 3E48A 3WFJA 3SLKA 4RVHA 3AM5A 1KVUA 2ET6A 2P4QA 3DZHA 3QJ5A 2ILTA 3TFQA 4M8SA 4D43A 2B4RO 1E77A 4YEDA 4J0FA 3ZNNA 1EVIA 2FR1A 3VVBA 1QSGA 1ONNA 4EGFA 1GL3A 4E12A 5I8WA 4UUNA 2X0NA 3VPSA 2FMUA 1QLHA 3DBHB 3RCBA 2D5CA 2EKQA 3UERA 3JQAB 3ZH2A 3T4XA 2GZ3A 1QRRA 3GN2A 4OHUA 3MJSA 4TWRA 5EJ2A 1EUZA 4IJKA 4RPGA 3WR5A 2UAGA 3VAZA 5L7WA 3NDRA 4XGKA 1U3VA 3RD5A 2OHXA 4JROA 4YDRA 7ADHA 1WDKA 1RM3A 2D2IA 3HE3A 3GVHA 3QP9A 5TLSA 2RIRA 4LSMA 4AJIA 4BKQA 1DSSG 1AE1A 3FPLA 2CF5A 3HN7A 1A9ZA 2HMTA 2XF8A 4WNCA 5FI3A 3GPDG 1KYQA 2BI8A 1LDMA 2J5QA 2EP7A 4MIOA 2VWHA 1BMDA 1YB5A 5EPOA 2WDZA 4QXMA 3GC6A 4I9UA 2VRCA 3RUIA 3K30A 2OBYA 4CLOA 1B2LA 4NI5A 2DTDA 3HADA 1WZEA 4JGBA 3QE3A 2RAFA 3ZWPA 4K6CA 4BNJA 3BAZA 4RVDA 4O0LA 3LF2A 3NT5A 3K2EA 4I1IA 3IL2A 2JFGA 3GN1A 2WD7B 4ZVVA 3QWIA 3AOGA 3WGOA 4MKXA 1BSVA 5F5NA 4BO4A 3EUWA 4II3A 5JAZA 1LC0A 2QQ5A 3E6AA 4M86A 3WBBA 1Y8QB 3WGZA 4KTTE 3ZWOA 1ULUA 5IG2A 4YJGB 1UDAA 1PX0A 2AE2A 3R0IA 2YW9A 3G1UA 1GTMA 2WE7A 2FR8A 1A27A 4TQGA 3H8VA 3DTYA 2AHRA 1U2DA 1EFKA 1C0PA 4BGEA 4E6PA 1YJ8A 5L95A 2VYNA 1ONOA 1YB1A 5JAQA 4DYDA 1P9LA 1ADGA 1IOLA 3I9JA 5DCYA 4LRSB 3JYLA 4A73A 2EW8A 3S1LA 4LVUA 1W8DA 3OFSA 4JNKA 5I7EA 1E7MA 1K6XA 2X7HA 4D0SA 1ISFA 2X1HA 4YJGA 1TB4A 3FNEA 1XU9A 4U6SA 3TFOA 3SBOA 1U5AA 1JKJA 3BTVA 1Y9EA 3RSHA 3QLJA 1IUKA 5I9MA 4NU5A 1EBUA 1V3TA 4KQWA 1ZCJA 3QWAA 4OMUA 3H9JA 2DBZA 4L4XA 4YT8A 5C7IO 4WOJA 1IPFA 4J2HA 4DUPA 4YAGA 5AQ1A 4TKLA 4A5OA 4PLGA 1PJLA 2JAHA 3HUDA 1Y9AA 3ULKA 5JCXA 1PS0A 4IDCA 4JCOA 4IDBA 3RUFA 1LRJA 1XSEA 2R6JA 3BTUA 3HNPA 5JDIA 3CINA 1LLQA 2PKQO 3MJ4A 4IGEA 3K31A 3OSUA 2NUAA 5ES3A 1I3NA 3OIFA 4R3NA 4DMMA 4DVJA 4ONEA 1WW8A 3NGXA 3HJAA 1Z6ZA 1XDWA 4ESOA 4Y9DA 3G1TA 3BTSA 3TL2A 2DVMA 4XYGA 4NQWA 5A02A 4JP2A 2GN8A 1E7RA 2NU9A 3IOYA 3D5TA 3TQHA 2RH8A 5DP1A 3EAGA 1SAYA 2NU7A 2E49A 2Q1TA 4YJDA 3W1VA 1S6YA 4BL5A 4BO2A 2A92A 4LRTB 1WMAA 3CZEA 4PLCA 5IAAA 4IS3A 2X23A 5DCWA 3W4JA 3TF5A 2P9GA 3E5RA 4J4BA 4MP6A 3W8DA 3RUEA 1PL7A 1X0XA 2GERA 4WCDA 2WYUA 4WECA 3NDJA 4ZRMA 2J8ZA 3C7DB 4CV1A 1I01A 2AQIA 5DNAA 4RLSA 1UZMA 1KVRA 3WLFA 2VT2A 4RPLA 4BO3A 5CPFA 4CR6A 2AEFA 1GCUA 4FGWA 3DDNA 4IIVA 4Z3KA 1OC4A 2ZYDA 3DOOA 4Y67A 2Q45A 2ZYGA 4FFRA 3TZHA 1DJQA 3V1TC 4D46A 1Y6JA 4WLNA 4II2A 4BMSA 3ANLA 1ID1A 3LT1A 4GX2A 1UXJA 4UAGA 3VOSA 5CDTA 1GCOA 3MJCA 4GWKA 3PZBA 1UJMA 4YR9A 3ROPA 1Y8RB 4FFMA 4TVBA 2IZZA 4CM3A 3C8MA 1DIHA 7MDHA 5CAEA 3ZHXA 5U1PA 4GAEA 1F14A 2O4UX 4Q9NA 4R1TA 3ZHZA 3Q3CA 1GFSA 5A3VA 4Z6KA 4B3IA 2FRDA 4NK4A 2P5UA 1VI2A 3HDHA 1MC4A 4L76A 1C0KA 3U4IA 1PGOA 1QORA 2NVUA 3SJ7A 5IDXA 2DUUA 2EF1A 3OA2A 4OQYA 2X86A 2YYYA 2X5JO 3ON5A 4GBJA 1Z82A 1Z73A 4H7PA 4IDGA 1Y8RA 3ZWVA 4WLFA 4RCVA 1DIAA 4RGBA 2O23A 3AM4A 2B69A 4CLEA 3JQFA 3NDIA 4M54A 1VJTA 2OXIA 4HWKA 2JHFA 3FBGA 3HHPA 4XQCA 4NFSA 2CY0A 3ZWWA 4IINA 4MVJH 5B4VA 5G0SA 4EUHA 4FDAA 2ZTMA 4UVDA 1G6KA 4PG4A 3RC2A 4D41A 3TOXA 4BNGA 3O8QB 2TMGA 5DULA 1PR9A 1TT5B 2YJZA 2IYPA 1E1LA 5TJ9A 1HSOA 3F5SA 5L4LA 4CM1A 1I36A 2HUNA 3UICA 4A10A 2IXAA 1ADBA 2VZ9A 3SLGA 1JQBA 3FSRA 2EKPA 2NACA 4LVCA 3WWYA 3DWFA 5DF1A 5H82A 4CODB 3S55A 3WTBA 1ZSYA 3ZZNA 3E5MA 3U5TA 5K6AC 2GNAA 2RHRA 1HDYA 4DPMA 3GEGA 4GI2A 4CLRA 1TT5A 2JHGA 1ISGA 1HTBA 4YAEA 3RKUA 5TIIA 4J7XA 5AOVA 3DXFA 1KS9A 1EK6A 1I3MA 1TLTA 2YY7A 4Z0HO 9LDBA 1C0IA 3C1AA 4IZHA 3PIDA 1HDOA 1N5DA 1RM5A 4R54A 1T2AA 4K1LA 1PJQA 1XU7A 4BNLA 2P68A 4NBTA 1UZLA 3MEQA 3NKLA 3PJFA 5BSFA 4W9NC 2AQHA 3UCQA 1ZK4A 5KNLA 1H0KA 1NQOA 3H9GA 3TZKA 4IZIA 3FTPA 3LDHA 4KMSA 2E48A 1EE9A 4XRGA 4JBGA 4BQPA 3CUKA 4HFRA 3GZ4A 3QVWA 4KWHA 3QIVA 1CERA 4PRLA 2Q1UA 5DBGA 2PH3A 5TRTA 1SC5A 5KVQA 4KWIA 3HQ4O 3IAHA 3ICPA 5ICMA 5CFZA 1GQYA 4PRKA 1KIFA 4D42A 1VM6A 3HZZA 3AFNA 2DPHA 2WWRA 5I7VA 2I5PO 4OGWA 1NFRA 3HN2A 1NVGA 5JLAA 1EUCA 5L40A 1M6HA 1SB9A 4Y6RA 2NQTA 3NTOA 4NFHA 4J2OA 4O5OA 3RUDA 1MFZA 3HFSA 1N9GB 2Q4EA 4NBUA 3B6ZA 2GPTA 4JN6B 1P1FA 4M1QA 2BFMA 4R9SA 4DQVA 1PGNA 4XGIA 4R01A 3NX4A 4ALMA 1IHXA 2HKIA 4NDNE 3ENNA 6LDHA 1MC5A 3KRTA 4J4HA 4IDDA 3AI3A 3ZWMA 3PYXA 2SCUA 5EQDA 1NVTA 1T2FA 2FZWA 1LX6A 3WYBA 3OIGA 1A4IA 2Y0EA 3ABIA 2FPIA 5ER9A 1ENYA 4CMHA 1HE4A 4KQXA 5IZCA 4YAJA 3EVTA 1PZHA 4E2ZA 1N9GA 3E9NA 3CZGA 3CIFA 3VPHA 5L3ZA 2BD0A 1K89A 4WCFA 4L0QA 4PIVA 3CZKA 3KUXA 1FDTA 1ZJZA 1G1AA 1NVMB 1QXSA 3GNTA 4DC1A 3R3JA 3ZU2A 3UW3A 1Q7GA 2CVQA 4CMJA 3IP3A 2LDXA 1P44A 2IXBA 3UF0A 1DPGA 1A7AA 3RBZA 1B0AA 1WDLA 4MIEA 1OAAA 4FLQA 4XA8A 3Q0EA 1A7KA 4J6FA 1NWHA 3E1KA 1LSJA 1T4BA 1SNYA 5JMWA 3RWBA 2EGHA 1OMOA 3PDUA 1R0KA 1UUFA 4S1VA 3GY0A 1NFQA 3VZQA 4CUZA 1XEAA 4QT0A 4RO0A 3IKVA 4ZU3A 1O94A 4FPXA 3RFVA 3QV1A 1V9LA 4GL4A 3BYZA 1B3RA 2H6EA 1JW9B 5TX7A 1HDZA 2CDAA 3UXYA 3ZWAA 4IQ0A 1O95A 3L6OO 3QWFA 1NXQA 4JX8A 4D0RA 3HB5X 2Y66A 1KEPA 2EP5A 4AJ2A 4U7WA 3KYDB 5G0WA 2FOIA 3IDSA 4F45A 3SXPA 3PHIA 4RPJA 3RUHA 2ZJ0A 3TZQA 1YONA 1E7WA 1PGPA 3C1TA 4B7CA 1BRMA 2DUWA 3INRA 4OXYA 4U0JA 3KEQA 4F6LA 1BTOA 1VJ1A 1YJQA 5G4KB 3UCFA 2HMWA 4Q3CA 1EVYA 2IODA 2ZIZA 1BWSA 4DIOA 1QYDA 4H3VA 1VC2A 3RFTA 4JJGA 4B4UA 3WQSB 1FF9A 2HMVA 3EHEA 2ZK7A 1B15A 3KYDA 1WDMA 1ZSVA 1P45A 4NZ9A 1GV1A 3JQ9C 4OL9A 2NADA 5T64A 4AJJA 1V3UA 3COSA 2RH4A 1FDWA 5G4LA 1XR3A 1CRWG 1SC6A 1O8CA 3U62A 1N7HA 3D64A 5JDCC 1C0LA 4YRAA 4BO8A 1KC3A 5DT9A 3M2TA 5B4UA 1IE3A 4R1SA 1L7DA 1GUZA 3EW7A 5IDYA 5F21A 5TGDA 4HUJA 1H94A 4CQMD 1ZEJA 3PLRA 1DC6A 3MCVA 3WMWA 4CM8A 1NQAO 1I24A 3JQBA 2V6BA 1MGOA 4EEZA 1JAYA 2X0IA 2EEZA 3AUSA 1MB4A 3RC1A 4CR7A 4YPOA 3RU7A 4DGSA 1ZZEA 2VYVD 4XZ3A 4YRBA 4I9HA 1FDVA 2QW8A 2VHWA 3ANMA 2C0CA 4P4LA 3FRJA 2C59A 3DMTA 2AMFA 4TMFA 2NQ8A 3L77A 2G76A 3A9WA 4IS2A 5GY7A 1H6CA 3OF2A 4A03A 1T2DA 4FN4A 1YL7A 3H9EO 2JCVA 5KJ1A 3A06A 3QRWA 3LT0A 4BNYA 4XQ9A 3TSCA 4FOSA 1T26A 2VHXA 1X1TA 2FHSA 1MX3A 4FC7A 5DBIA 5EERA 1QYVA 4FGSA 4IXWA 2X9GA 3LSYA 1I3LA 3FWNA 3EK2A 4BNNA 3O4RA 3DBVO 4FR5A 4J9VA 3Q6IA 4WUVA 4AYSA 2GN4A 4TSKA 1B14A 1W4ZA 1YVEI 4Z9XA 2Q2QA 3OJEA 3DZFA 4FFLA 4YXFA 2C5AA 4BNXA 3AWDA 1LQUA 3H9QA 4YJHA 1R4MA 4I5GA 4LUPA 3RBVA 4R5HA 3BMCA 1YOVA 1EEHA 2PK3A 1H93A 1H2BA 2GD1O 2VN8A 2WM3A 1U8FO 1Q1NA 4CMEC 1DFIA 4MP8A 4MINA 1JAXA 2VOJA 2Y99A 1VL6A 4YQYA 3WOHA 3WXBA 3ZWCA 1LSUA 1QP8A 2EV9A 4R1NA 4D44A 1E5QA 4WK6A 2HQ1A 2B5VA 5CDUA 1X7HA 1P33A 3GLQA 4CUKA 4D3DA 3RAJA 5B37A 3BHIA 1I33A 3WJAA 2O3RA 1PJ4A 4HKTA 4YT5A 4DTIA 3WBFA 1XWFA 4CQMB 3DBRB 2C20A 3G17A 2NVWA 4BQRA 1MW3A 2O3UA 4OOFA 1GY8A 2NWQA 4J1NA 4M49A 1FMCA 1LRLA 4NJOA 2Q2WA 4YRDA 5COAA 3OICA 1ZK2A 2H5LA 5TQVA 2UUPA 2BKAA 1R66A 1DFHA 3DBLA 1GYPA 3ROQA 3ZNPA 1U9JA 4ZN6A 1EBFA 3TOZA 2C29D 2G0TA 2R2GA 4FJ0A 1QMGA 3P2YA 5IDQA 1P3DA 4I08A 3JQ7A 3HDYA 1E7YA 4LMRA 4XCVA 3RFXA 2RBEA 1K6IA 2QIOA 3WWZA 4LCJA 2I3AA 3F46A 4CM7A 3F4BA 5KWEA 1DXYA 1ORRA 4R9RA 3OHSX 1MW2A 2BH9A 1E6WA 1KY4A 3D4NA 3I5MA 3F6YA 1O9BA 4MP3A 4UEJA 4HFJA 2POQX 1YDWA 2HJSA 2GDZA 2YHIB 4B4WA 1U4SA 4OO3A 5AXBA 5U4QA 2PKRA 1OBFO 1RM0A 1V6AA 5JNLA 1DJNA 3F5QA 3BTOA 1GEGA 4DLAA 3PWSA 2YUTA 4DLBA 4FJ2A 3AOEC 4FW8A 1QYWA 5A9TA 3K5PA 5I8ZA 3OBBA 2NM0A 4W82A 2FSSA 2QHXA 3DFZA 1K5HA 1JA9A 4TROA 4CM9D 4FLSA 2BFOA 4O59O 1RP3A 1NAIA 2V6FA 4NBWA 3IUPA 3GGOA 4HFMA 3P2OA 1AGNA 2P4HX 1LEHA 3C85A 1ZSNA 2O7QA 1R15A 3CZRA 3OECA 2AE1A 5TNXA 3VH1A 3FHLA 1DHRA 4XEHA 3ZNQA 4E2WA 2DFDA 2H1SA 5KJEA 3WB9A 4PG8A 1HETA 3DBHA 1AN9A 3QVXA 1Z75A 4QECA 3JQAA 1UAGA 2GYYA 3D3WB 3EGOA 4R1UA 4ZGWA 5AYVA 1HSZA 2WTBA 3GF4A 4BB6A 3DQPA 3ZV6A 2ZB8A 5A06A 1A5ZA 2Z5LA 4W99A 5TJHA 1DO8A 4BGIA 2BI7A 5EINA 4ZICA 1NASA 2IZ0A 5KKCA 4Q3AA 3LC7O 1O6ZA 1NPTO 5JFOA 4ILKA 1N1GA 3PGJA 4J43A 1ISJA 4RJTA 2PY6A 2BFPA 2JD2A 3UEQA 4JIGA 1R16A 3C7AA 1I0ZA 3RI3A 3I4FA 4RV9A 5TF4A 4GH5A 4NK5A 2C2XA 4R3WA 4S3MA 5G0TA 2WSBA 1U1IA 4WE3A 1IPEA 4YAKA 4ZA2A 5EMHA 4RLHA 3K8ZA 1QKIA 2V7PA 4RORA 2WJPA 4L8VA 3PWKA 3ZV4A 3BZUA 3PP8A 3F1LA 3EYWA 5JCJA 1WWKA 4BIIA 1CEQA 2C07A 4KDEA 2BGMA 3UFXA 3BMOB 3E82A 3ZW9A 1EVJA 1NM5A 2W8ZA 4GVXA 3WG9A 3WQQA 1BDBA 2PD6A 1G0NA 2WD7A 3TWOA 1S7CA 2DFVA 4Q39A 5DDIP 3HSKA 4GGOA 1GYRA 2CNBA 4R5MA 3I9NA 4C7JA 1Y8QA 1KY5A 3WDSA 4UUOA 2AXQA 4O6VA 2Y1GA 1PEDA 4IDEA 1LDEA 5F1OA 1ZK3A 4CM4B 1P74A 3GZNB 3K6JA 3U4CA 3B1FA 3BMOA 3T4EA 5DP2A 1K2WA 5EL0A 2ZTVA 3GNQA 4J7UA 2QRLA 3NV9A 3GMSA 2PA3A 4CMBA 1E3LA 1A71A 3ZWBA 2FN7A 2UV8A 1PJTA 5A3JA 4DMLA 1ENOA 4NMHA 5B4TA 4CM9A 4MVJG 3U49A 3DHEA 1HDCA 1I2CA 1UP4A 1P1KA 3L07A 4NH4A 2O3TA 1I2BA 1T25A 1QV7A 2P9EA 3LLSA 2W2LD 4CM4A 5GZ1A 1YO6A 3K2BA 4L74A 2IEDA 2DC1A 4HADA 4U6QA 3X2EA 5CDGA 1VLLA 3GK3A 4N7RA 4BNMA 5EN4A 4E4YA 4PVDA 5IZ4A 4YT2A 1GZ6A 3UOGA 2Z95A 4ND1A 1NR7A 1VE9A 2Z1MA 3QQPA 3HB4X 3ZV5A 4D3SA 1WP4A 3N7UA 3NTRA 3PHJA 1GPJA 5IN4A 1JG9A 1VSVA 1DC4A 4FD3A 4PLZA 5J23A 3VPFA 3ZDFA 3A28A 1ISIA 3ITDA 4QX6A 4BNKA 2E4AA 1RPNA 1TT7A 3ZGYA 3SVTA 3RASA 1DRUA 3UKOA 4N5NA 4CL8A 4XX0A 4RQTA 1X15A 2JL1A 4J0EA 1N7GA 4XJTA 1UXGA 5JDIC 2PGLA 5KVSA 3R1IA 1T1SA 3K73O 5C3MA 5ENVA 4E13A 3GVXA 1LDNA 3N74A 2W4QA 2HU2A 3DAGA 1I2ZA 1E0DA 1UAYA 1HRDA 3A14A 1AXEA 5LDHA 3KB6A 4CM6A 5CPBA 3JQGB 4I8XA 3BA1A 3ZWYA 3UN1A 4EEXA 3OM9A 2O2SA 3DMYA 1HZZA 3L6DA 1F06A 2CVZA 1CDOA 3B1KA 4ZHSA 3D4PA 5DCUA 3CTMA 2VT3A 2E82A 2FSVA 5FWNA 1OFGA 2QYSA 4WGGA 3OQ1A 1YQXA 4GKBA 2ZATA 1W6UA 1NBOA 3D0OA 1Q0HA 3M2PA 3S8MA 1H3LA 3IUSA 4F3YA 3F1KA 1ML3A 2VNSA 1GD1O 1OC2A 3B1JA 1LBEA 1XELA 1HE3A 1E1MA 1VRWA 3NT2A 5CHEA 1FK8A 1PTJA 4J91A 4OXKA 1JVBA 4I5FA 3JQGA 4EJ6A 4RVGA 3TN7A 5THQA 4HV4A 1UXIA 3VH4A 1YH3A 4KZPA 5JE8A 2YZ7A 3Q1LA 1QR6A 4NG5A 4XDYA 2Y1EA 2F1KA 3DZBA 1AXGA 3PYMA 1SBYA 5JXWA 1PZFA 4CLDA 3LVFO 3RUCA 2O3SA 4QFDA 5JSFA 5T5QA 4DA9A 2P5YA 1Y5MA 1HLDA 3DR3A 1DIBA 4J49A 1X7GA 1Z7BA 1R37A 2JCXA 2DBVO 1BDMA 2C7GA 3LU1A 4CMGA 5BNIA 2DTEA 1NTOA 3ASVA 3IP1A 3IS3A 5CP8A 4DC0A 1P77A 3L4BC 3NEPX 4GX1A 3L0DA 4WKGA 3KTDA 3LC2O 5AXDA 1F12A 3FPCA 1C1DB 5K6AA 3FD8A 4WOKA 2D1YA 4BUCA 1B26A 3R3SA 4Q3EA 4UUMA 1GAEO 4RZIA 2Q99A 1Q0QA 3GDGA 4NU6A 3WFIA 4E0BA 3E9QA 5B12A 3K9QO 2HRZA 2EG9A 4BNZA 4PLYA 1SPXA 2J6IA 2WE8A 2YFHA 1HEUA 1A9YA 4C7KA 1MA0A 3O8QA 3FI9A 4CL3A 1OR7A 1J5PA 2OP1A 1GQ2A 4MDHA 3GR6A 3H3JA 2VUUA 4TRNA 4XR9A 3EZLA 4R4JA 5TC4A 1E3EA 2X0JA 4JP3A 1QYCA 1PJBA 3I3OA 5B1YA 2I6TA 4WNIA 2YQ4A 2Y0DA 1H5QA 1XA0A 4MOWA 1NP3A 3KETA 2UYYA 3F9IA 2V65A 3M1LA 3PDJA 4EZBA 1SO8A 1HYHA 3KXDA 1ZEMA 1RYEA 1UP7A 1LDGA 2O3JA 4KTVE 1ULSA 4CMCA 4YTEA 2EW2A 1NYTA 3H2ZA 2Q49A 3MZ0A 4YB8A 1I8TA 3E9MA 4Y6SA 3AU9A 1DAOA 5C7OO 1BXZA 4EI2A 4E5MA 1LDBA 3S2IA 3ROKA 3MOGA 4L75A 1H6AA 4M55A 2B4QA 1JVSA 3V2HA 2VZ0A 5HWSA 2MAOA 1NHWA 3JQDA 3G3EA 3I9KA 4ZQBA 4BNWA 2BHLA 5AVOA 1EVZA 1P1HA 2VHZA 3ZN2A 4E30A 4J1TA 1A72A 3NYWA 1SEPA 4L73A 3VZRA 1U3UA 2XAAA 4Z3DA 3FNGA 3GOHA 1M76A 3C3XA 4KUHA 4MO2A 5GMOA 5KKAA 3S2FA 3ZV3A 5KJCA 2HK8A 5ITVA 3CEAA 3FBTA 3NRCA 3KZVA 1T2CA 2E37A 2J5RA 4QO7A 3WSVA 4AJ4A 4BGVA 1JU9A 1SOVA 2Q50A 4CV0A 3U4DA 5IDWA 1N1EA 4GQAA 2WEKA 1ADCA 4IBOA 1VSUA 4Y6PA 1DC3A 3KM0A 5A5FA 2Y0CA 1HF3A 4PGFA 3VZSA 3VDRA 3W6ZA 2TMDA 3D4OA 4XYEA 4D79A 4B4OA 2OMEA 2PGDA 2NU6A 4TKMA 1U3WA 2HCTA 3VKUA 1O0SA 2QRKA 3TPCA 3B70A 2WMDA 4AJHA 1VL0A 2GZ2A 3ONFA 2GN6A 2YHUA 4WJZA 4B7XA 5COQA 3ZWNA 2C7VA 1JN0A 1MW0A 2G17A 1N92A 2OZPA 3DOCA 1E3SA 3E03A 1EK5A 3GA0A 4DBVO 3HFGA 3NTQA 4ALIA 3INTA 3G49A 4O63O 4ND2A 3C24A 3NAQA 1PSDA 4UVIA 3VHRA 2DT5A 3GVPA 1KVSA 2GCGA 3QA9A 4BNVA 4R51A 1O5IA 2EJWA 4URFA 4ALLA 4E3ZA 4GGPA 2QYTA 4BNIA 5A03A 5C7LO 2FR0A 3FNFA 3IIEA 3GDOA 3EVNA 5FF9A 3Q2KA 4DLLA 2G82A 2AEJA 2PH5A 4FOOA 4RVSA 2PR2A 1LC3A 4NBRA 3WGGA 2B4TO 1KVQA 2B36A 5FYDA 3LT4A 1M66A 1X14A 2O7SA 2GUGA 3DZGA 4P4GA 3EC7A 1FDUA 2ZQYA 4YA6A 4QEDA 5JYEA 3AY3A 3I1JA 2ZB4A 4E33A 3A1NA 2EWMA 2JJYA 1I10A 3QVSA 5ICSA 3R6DA 2MAPA 4LSWA 1LJ8A 2WPGA 1KC1A 4IIUA 3SC4A 2G5CA 2D5AA 2AQ8A 3OEWA 3TL3A 5ILOA 2XXJA 2HRBA 4FC6A 5BNTA 3NJ4A 4JJFA 4AJPA 3TZ6A 3JD4A 4XB1A 9LDTA 1XCBA 2BGLA 3LF1A 3V2GA 2JD0A 4XIJA 5BNFA 2I76A 4Z9FA 1D3AA 5I9LA 4WLOA 3AUUA 3S2EA 5DZSA 4DREA 3KEOA 3DHNA 1U4OA 3VDQA 2A9FA 1I30A 2J5KA 5JMPA 3AM3A 4CLHA 1V35A 1HZJA 3AJRA 1IB6A 1SEVA 3WJ7A 5A05A 1U7HA 1XKQA 1X0VA 3KO8A 4ZQFA 1MG0A 1P1IA 4P8RA 3EZYA 2E6UX 4CV2A 2I99A 2IDZA 3GMDA 1ZK0A 5DOZA 1DRWA 1L1FA 3AU8A 3OIDA 5JDCA 3Q9NA 4NJMB 5CDYA 3WLEA 1UP6A 4MPDA 1F17A 1H9BA 1P0CA 3VPGA 2QZ9A 1DC5A 4HX5A 5BR7A 1E7QA 2HK9A 4G81A 5LC1A 2P2SA 2AW5A 1JKIA 5G4KA 3GAFA 1CQIA 3I9MA 1XLTA 1ISHA 8LDHA 4UULA 1GU7A 5ER6A 3HDJA 3LLVA 3UCXA 3V5NA 2VZ8A 3P5SA 1LU9A 4P4NA 3HWRA 3ZU4A 3QWBA 4KP7A 3VKVA 2X6TA 3CXRA 3ROMA 1D1SA 4NJMA 3ZHYA 1Z7EA 4W6ZA 4PN3A 5MDHA 2QG4A 3FR7A 1BXKA 1I3KA 1LTHR 2UUOA 4DQXA 1ZJYA 3PZRA 3T0YA 4H16A 1ZBQA 1Z45A 4WPGA 4F6CA 2HMUA 1ONPA 4CJXA 5A9RA 4ND5A 2ZYAA 3L4SO 4FLRA 5T6BA 1V3VA 1PJCA 2J3JA 3WSWA 3PRJA 4QFCA 3WGYA 3DTTA 1YKFA 1KEVA 4R69A 3I52A 3ZI0A 1Y1PA 2J3IA 4OJNA 2CSUA 3JYPA 4J1SA 1JKFA 2P91A 3SEFA 4IQGA 4DBZA 2GGSA 1MVYA 1CF2O 1ZXLA 3GVCA 3UGKA 3JQBC 2HMSA 4IUYA 3ENKA 3VC7A 2GSDA 3F4LA 8ADHA 2OUIA 3LK7A 3AW9A 1D4FA 1DEHA 3GAZA 1LSSA 4YACA 4B4VA 4CMEA 1XQ6A 4A0SA 5HA5A 4PVCA 4E5PA 1ISMA 3W4KA 1G5AA 1BW9B 2WD8A 3KSDO 5KJFA 1E6EA 2VHVA 4NPCA 4CMIB 4Q3NA 1E5LA 2IRWA 1PJ3A 2G1UA 1O89A 4EW6A 5HTOA 1T4DA 2X8LA 2VCYA 1HE2A 1IULA 1DFGA 1ENZA 3H4VA 4JLWA 3JYQA 1YL5A 3RU9A 3DOJA 4R68A 2PD3A 4UREA 4FFOA 2B0JA 3MJVA 5CEEA 5I9NA 3CMCO 3L9XA 3RIHA 5T8KC 2FWMX 4W4TA 2EHDA 5G0VA 5A4DA 1TXGA 2OO5A 1D1TA 4G5HA 4NIMA 4ND4A 3WS7A 4ID9A 3PEFA 4GLOA 2A4KA 5A9SB 3SJUA 4NHEA 3OQBA 3GQVA 2YV3A 4XD2A 3SX2A 1PGJA 3KSUA 4G65A 5KCZA 1SMKA 1R0LA 1W73A 2PGJA 2YQ5A 5JO0A 4YCAA 2Q3EA 3ONDA 1U5CA 1PQUA 2ZB7A 3PWZA 4B79A 1KEUA 4WEQA 2VHYA 4HP8A 2VRCD 1X7DA 4OKIA 4ZQGA 2B37A 2VWPA 4E2YA 5IXYA 1QYXA 2GASA 3JCZA 4P22A 2YFQA 3D1LA 1MFPA 3GHHA 4OIMA 5KVVA 3FR8A 3GFGA 4RF2A 1GPDG 4FBGA 1E92A 4MKZA 3DBRA 3I9OA 5COBA 4CQMA 4EYEA 5BQFA 1HE5A 3KHUA 2Y93A 3M6IA 3DFUA 1H2HA 1B8VA 1V8BA 5GZ3A 2GO1A 3H65A 2I67A 2VYVA 1B7GO 3NUGA 4MVJP 5JY6A 2ZKLA 1Y81A 3ZU3A 4MVJD 1EZ4A 1UH5A 4FCCA 3UUWA 1P0FA 1DLIA 3FNHA 5EESA 2IZ1A 1E3IA 3W8FA 4UVEA 5L53A 1V0JA 1QG6A 3O38A 2AG8A 3OQ6A 4YVFA 4AG3A 2NVBA 5DOVA 1MG5A 1XIVA 4FFPA 1YXMA 4IDFA 5L4NA 1ZIDA 3GRPA 2AA3A 2DQ4A 3QVTA 2VYND 3BHMA 1YRLA 5JAMA 1GUYA 2BF7A 1U2GA 1B16A 2PZMA 3ETGA 2Y1DA 1GV0A 2Y05A 3DZIA 1NX6A 4IY1A 1NQTA 1HL3A 3GNSA 4GLLA 2GN9A 2I3GA 2R00C 5KJ6A 5TT1A 4DPKA 4ALNA 2DU8A 2BRUA 3D3EA 1DHTA 1YBVA 2YHIA 2O2YA 3U4HA 3GG2A 1R6DA 4XGNA 2CDCA 4PLVA 4ZQHA 2VTEA 1F0YA 4CQLB 5L51A 1NPDA 1GR0A 3OP4A 1J6UA 3WMXA 3DEYX 1VPDA 4YBZA 5LCXA 2VUSA 4BB5A 4E5NA 2ZTUA 3OMLA 4YYZA 1GZ3A 2O48X 1C14A 2H9IA 3N58A 4FJ1A 4BKPA 4CLOB 4KDFA 4OKNA 3H7AA 3QWHA 5JBIA 2W2KB 5DBFA 1M67A 4TZKA 2W98A 5L7TA 3D7LA 4BOYA 4LCEA 3K96A 3I83A 4RL6A 3WICA 3CE6A 5K9ZA 2PZKA 5TT0A 4BNTA 3DAFA 1JWBB 4UEKA 5FI5A 1ZO8A 1WPQA 1MV8A 4CQLA 1FJHA 4HXYA 1BG6A 1HYEA 2Q2VA 5FFFA 3D3WA 1DIGA 3FTNA 1L7EA 5FEUA 4HNHA 1PWXA 3Q2IA 1ZMTA 1AHIA 1R4NB 3W6UA 3P19A 5ITWA 1ARZA 4NQZA 2C54A 2W2KA 4MKRA 1DLJA 2CMDA 3WYEA 1RWBA 2YV1A 3CMMA 5IF3A 2PD4A 4AJ1A 4J3FA 3ICCA 3W8EA 3ANNA 4RPHA 3PXXA 4HFNA 2D0IA 4Z0TA 1YGYA 4BKRA 4KUEA 4OH1A 5G2OA 1PIWA 3O03A 2W90A 3AI1A 3ZHBA 1M2WA 4MVJA 3UH1A 4CMAA 3IJPA 1XGKA 3OJLA 5F1KA 4AJEA 4WASA 4OAQA 1KBZA 2ZCUA 1R4NA 2Y1CA 1W0CA 1NR1A 2BMAA 1WVGA 5F5LA 1ZK1A 2GZ1A 5TS3A 4YAIA 2Z1NA 5L4SA 4MVJI 1U7TA 3PQEA 1VJ0A 3SC6A 1CIVA 2UDPA 2VWQA 4L9RA 3PTZA 1BVUA 1BGVA 1GEEA 1DBVO 3WNVA 4BO6A 2VTDA 2PZLA 3WGTA 1TEHA 2VOEA 1RKXA 2CUKA 3H5RA 2DAPA 5KTKA 2BFAA 4PLWA 2HO5A 4AJKA 2PNFA 3TJRA 4MIYA 4PLTA 1UZNA 2VRBA 3WNQA 4IDAA 4PFJA 4AVYA 1U3TA 3GT0A 3ONEA 4PG7A 1B3BA 3VZPA 3ZWXA 2OBNA 3AFMA 2AEMA 2Y1OA 4H15A 3GVIA 4J1QA 4N5MA 4A2CA 1IL0A 2X9VA 4IJVA 4PZEA 4XKJA 3MTJA 5IFLA 2H63A 4M87A 1EQ2A 1YL6A 2B83A 5H81A 3RVDA 3I6QA 1FDSA 2C5EA 3GZNA 1E7SA 5ILGA 3CH6A 2YDYA 1M75A 2ZTLA 3AY7A 2X0RA 3PI7A 1LLUA 3JQEA 4PG5A 3ZW8A 2QRJA 4EITA 2JFHA 1FXSA 3GG9A 1CWUA 3JTMA 1P1RA 5JS6A 3JQ8B 3PFWO 1Z74A 5JPIA 4E5YA 4CR8A 1NWCA 1D8AA 4R16A 1NHGA 3BXXA 4EDFA 3KBOA 2RCYA 1N2SA 4HBGA 1HDRA 3I23A 1PS8A 2IE0A 3NJ8A 3DL2A 3MJEA 3PHGA 3WQRA 4L4RA 1PQPA 3MJTA 4U8GA 3B20A 3AY6A 4PLFA 3PVZA 4RZHA 3T7CA 3UCEA 1PZGA 4RDHA 4L4SA 3WIEA 4PCVA 2XPCA 1PJSA 3DB2A 3JQ8A 4QSMA 3KLMX 1KETA 3GRKA 5IXSA 4RF5A 1AUPA 3CSDA 2JKVA 2EGGA 1X13A 2Q46A 1YBAA 1PS9A 4IM7A 4BNFA 4RF3A 1ZNQO 4TVOA 3IQDB 4DWVA 3GEMA 1U8XX 1IHYA 3IKTA 3F3SA 2HDHA 3E18A 4RDIA 4D3FA 1K3TA 1H9AA 4ZRNA 3S2GA 4IXTA 3PHHA 2A94A 4GVLA 4RF4A 3RC7A 1N8KA 2BLLA 4XYBA 4CPDA 4DPLA 3JSAA 3JYOA 1I5RA 4BO9A 3RJ5A 4FLOA 1YDEA 3O9ZA 3JV7A 4Y98A 3JD2A 4CUJA 2P9CA 2PTGA 4B3HA 2IEBA 4WLVA 4JBHA 4PG6A 1HKUA 1TA4A 4ALJA 3U09A 1QV6A 4UVGA 2NVUB 1F8FA 2OP0A 4AJOA 1SOWA 1Y7TA 4MVJF 4FQ8A 1Q2XA 1XHLA 1DRVA 1UXKA 3P7MA 2FP4A 4G2NA 1XG5A 3H5AA 4XIYA 2NTVA 3DZKA 4TRMA 1X1EA 1YS4A 2DM6A 1T24A 3PLNA 3L4BA 5C5IA 1JGIA 5HM8A 1NNUA 1MP0A 2W2LA 4QTZA 5T57A 2CFCA 2HK7A 3OEYA 5JC8A 2HJRA 4QO8A 3Q11A 3T7EA 4DYVA 4IQ8A 4GKVA 4IJUA 4PLHA 1B8PA 1C1XB 2GR9A 1GADO 4CM5A 4K9DA 2I65A 5CG1A 2PKQP 1LDYA 1JDJA 4ZD6A 3DC2A 3AUTA 3KV3O 3EY4A 3OETA 1HYGA 1OI7A 3QHAA 4JK3A 3RBXA 3ZU5A 4OOEA 1M6WA 5AXCA 5I7SA 4BO7A 3GEDA 3UHAA 4LISA 4TRRA 3JQ6A 4FFNA 4ITUA 3GGGA 4K28A 4P38A 3RKRA 5BSEA 2I66A 4CLRB 3JQFC 2EXXA 1JLLA 1HDXA 3KYBA 3MOIA 2ZQZA 4IPTA 4NBVA 1C1XA 4DQUA 1LRKA 4RVFA 1C1DA 2X22A 4IJWA 1MXHA 1DIRA 1OZAA 1EDZA 4W9NA 3WGIA 2F00A 5BSHA 4NR0A 3LZ6A 5MGBA 4B8WA 3C1OA 2YV2A 4A26A 1U28A 4OM8A 3M1AA 3UVEA 3X2FA 1HDGO 1LQTA 1UR5A 3KLPX 4XRRA 3D5QA 4K26A 4A7PA 4BNUA 4GMGA 1E6UA 4E21A 1ZUD1 5JO9A 3GFBA 1MLDA 5H83A 1GUFA 1XQ1A 2WYVA 1AHHA 3ETEA 4AL4A 1IY8A 3JD0A 4N5LA 4U0KA 1LSOA 2CZCA 3JQCA 3H2SA 4JQCA 1CETA 5ADHA 2A35A 3L9WA 1EDOA 3LQFA 2VWGA 4XQGA 2UVDA 1SCUA 1WAMA 3TZCA 1ZS2A 2BGKA 3AK4A 4E32A 4XYMA 3V1YA 3H9UA 2J3KA 4IMRA 1NFFA 1QLJA 1HT0A 2EJVA 2O50A 3G79A 1DB3A 3RUAA 1MXFA 3HG7A 2Q4BA 1ZVMA 5CDSA 4BNHA 4FB5A 3V8BA 2DLDA 1VKNA 4CM8B 2ZB3A 1UDCA 4DRYA 5T67A 2Y68A 2OOSA 4Z0PA 5JY1A 5L9AA 1IZ9A 1T1RA 4XYLA 3GPIA 2CD9A 1A4UA 5IN5A 3STHA 4LGVA 3VVCA 3RC9A 1PGQA 4EBFA 4N18A 4J9UE 3QSGA 1ADFA 1CYDA 3VTFA 4BV9A 1PZEA 1Q7CA 4XQEA 1JWAB 4WLEA 2GRAA 3ST7A 5U9CA 5EIOA 5L45A 1WXDA 3ASUA 1ZMOA 2XOXA 3AUAA 1ZXBA 2NLOA 1MUUA 2EIHA 2X5KO 3PFFA 2VUTA 4XDZA 3TDKA 3GUCA 2HLPA 3VTZA
chains in the Genus database with same CATH superfamily
3W3AD 3HEAA 5TS2A 5JZVA 1ZUHA 4YNBA 2H4JA 5H9WA 3P0RA 2V0NA 1X8LA 5GZ6A 2A67A 4TLBA 2OVFA 4TTIA 5AIBA 3NBZC 4BGUA 3FVQA 3HTXA 3I34X 3PJDA 1IOWA 4B3JA 3ZGNA 4XWYA 5E38A 3HBMA 3GH3A 3Q3JB 1GPAA 4P3NA 4W7IA 3VDXA 1K0FA 5K05A 3MUFA 3DFIA 1KA9H 3FTDA 2ZIFA 1BHSA 3WADA 1LTQA 3I64A 4QDOA 3VR2A 2RSLA 2FY8A 1L4YA 4NEHB 4BHTA 2JLZA 4QGBA 1VXOA 3ZE8A 4Q3OA 1WMBA 1V8FA 1HDIA 3U3XA 4E1AA 1P1CA 4CKBA 2FPOA 1NMZA 2UXBB 1PQWA 4PLPA 1S7GA 2VK1A 1RLMA 1J4AA 1EU1A 1QU3A 2FPPA 4ETNA 1LFDB 4DUZB 4C0XA 4GQBA 5FOTA 1EFPA 2GPSA 3VC2A 3S5JA 5IZCC 5BMOA 4HH4A 1EHCA 2PL5A 1LLDA 2FLVA 2QT1A 1JILA 2VPTA 2BBOA 3P4YA 4R2KA 3CKYA 3RGWS 2MDTA 2Z2KA 5I7OA 5GAJA 5JZMA 2QGFA 4ZW7A 3O26A 2HF9A 1L6RA 3AILA 4M89A 1NPYA 5J63A 2DKNA 4CMKA 2YYSA 1RTKA 1FFEA 2HBQA 3V97A 4NFYA 3RRMA 1TM5E 2AQKA 1E1KA 4S12A 2FPGB 2H0AA 3BSYA 1YDFA 3C6XA 2B82A 5KYYB 2IBSA 1U3CA 3OZFA 3YASA 1GG9A 4I14A 1K4MA 3ADPA 1ZNYA 2ZBRA 3H3FA 3HJHA 3LQYA 4HNGA 1L9XA 2FUNB 4FYWA 4X45A 1AGYA 4MRVA 4RTSA 4PZDA 1GDTA 4IMPA 1Q1BA 4PHGA 4R71A 4ZTZB 3GGSA 1D6MA 3JWEA 4MGEA 4CLXA 1DAPA 2HIHA 3AETB 3L7IA 3PYLA 4GSKA 3KYCA 4XM1A 4CEJB 2RBGA 4ROSA 4RTKA 1M1NB 1QQ5A 2D1QA 1SHZA 2Z2XA 4R0NA 2WICA 2WU1A 3DZJA 3R5FA 4FW9A 2OGSA 5C51B 3K7EA 1NW7A 4TQ9A 4KMMA 3JQ9A 1VFNA 1PU2A 4RVUA 4F9TA 3TBKA 1XI2A 4D92A 2VF5X 3W4IA 1TYZA 4C30A 1EIWA 3GWGA 1Z8NA 3QU9A 2ZE5A 4IJQA 4PYRA 1O94C 3RW9A 2YHSA 1SVNA 3JAKB 3S7ZA 5IF9A 3PNVA 5BMVA 2QN8A 5FAXA 3EOAI 3A3PA 1WLSA 1Y1QA 3LT2A 4RE5A 2NO7A 4YGYA 2GXQA 4AQ7A 2QX7A 2IF2A 2XH8A 2J33A 1XYGA 3TKAA 1OKKA 3D5EA 1W4CA 4HS9A 5THKA 4IG4A 1YNSA 4P3PA 4NP6A 4DNQA 3Q43A 4XR4A 2WOOA 3OG9A 3FCCA 4O5AA 2C2YA 1PYGA 1DKMA 4U2KA 1F7VA 4HH1A 4IIJB 4PZ9A 4ZPJA 3MWEB 1Y4ZA 3EQ9A 5CA1B 3IBFA 1KZ1A 3LPLA 3OJOA 3T6KA 4ASUA 1C7IA 2J3HA 2PSFA 3RTAA 2GYWA 3PQ2A 1ZX1A 3NV7A 5EVCA 2V7QD 3F5FA 4HAXA 1C3OA 2UUAB 3QKUA 4J4TA 5LQCA 5HP4A 2WJVA 4YAFA 3BGVA 2Z09A 1GRCA 1SVWA 2SKCA 1T3TA 3ZD7A 5KI6A 4XMUA 5F5XA 4OUKX 1VCMA 4DXHA 5KYXB 2O2JA 1SIOA 2HA4A 2OCIA 5I48A 2Y1FA 1L8LA 2IA5A 2CV0A 1XDUA 3PX3A 1CR4A 4FHDA 1CJUC 1G9XA 3SI7A 4HVTA 1F8GA 4O1MA 1N6IA 3LC1O 4FGJA 1XTZA 1J5EB 3BN3A 5KNCH 4MLDA 4GX5A 5E4YA 1Z4MA 1FX1A 5DNEA 4UAUA 2ZR8A 4AUMA 3PHLA 4QU9A 1E3JA 2XTZA 3EXEA 3KB2A 3S2SA 5KUTA 2GPBA 1PG0A 2CUZA 4UEOA 4ZJUA 2G9QA 4QUKA 1OOEA 2QLMA 4AO6A 1H1LB 2HH9A 2W8BB 3KQOA 1UKEA 3VH3A 3VH2A 2OO7A 5JSHA 2EERA 1RP1A 1W85A 2AR0A 3DJYA 5AW9A 4R7GA 3VSBA 5A3SA 1QFZA 1JS1X 2R11A 2LDBA 4HATA 2RAUA 3C7CB 2WUEA 1U8CB 2GARA 4JLJA 3AJAA 5LB2A 1M5TA 1WVIA 1P4RA 4B7UA 3BMQA 3PPIA 1MCZA 4YAOA 3R7WA 2QVYX 2FUKA 1JSXA 3K1JA 4MVJE 3LDGA 5C37A 1WULS 2A78A 1JTFA 1POWA 5H5JA 1YFKA 4BKUA 4CN8A 4I5EA 5DHTA 1ORVA 5B58C 4DIFA 1EGVB 3D3QA 3EQ7A 1ZOIA 4DLKA 4L22A 2RHHA 3UMCA 2Q9BA 1E32A 4MI3A 4QELA 2R6HA 2IZ6A 3AV3A 1IN8A 1BH6A 4XEUA 4YMGA 1BX3A 2J1LA 3HB9A 4JCCA 5JAIA 1IZ0A 1VCNA 3L6EA 2D59A 2D3TA 1FNDA 1I51A 2VJMA 1G2PA 1C30B 1UC4B 2VYQA 3ED1A 4G85A 4O2BA 3LQQA 4C21A 1JZTA 1Z18A 4PR0A 2K7FA 2CJWA 1E2BA 4TS3A 2EC5A 2ECQA 3EWSA 3NCTA 2RHCA 4GXRA 5ALQA 2ZM5A 2O1XA 4NF2A 2JDID 1NVUQ 3WBKA 4JQSA 3JSXA 1E3WB 3SYNA 1CEEA 3CZLA 2O2CA 1L3CA 1CIJA 3OJ0A 1QE5A 4GPBA 2GDJA 2WIGA 2BZ0A 2ZZKA 3LYLA 4LJ8A 3C14C 4LF4B 1BH2A 1KP2A 3I1IA 2OORA 2LZ0A 3KZKA 3F2VA 3LQ1A 2R6R1 2EW1A 4Q3BA 4CW7A 1NYRA 1SXJC 5D6NA 3AHGA 4BMNA 3MXOA 3QPVA 4IMIB 5K3FA 4BRWA 4J7CA 4HGRA 1JPUA 4LOIA 1DU4A 2DFTA 5FLXA 1CY0A 4UEWA 3RROA 1ZIOA 1P7CA 3EMKA 5CR9A 4ENSA 4EMUA 1NJ5A 4CIDA 2CLKB 2FK7A 3PC7A 1VPEA 3OA0A 2OHOA 4RK4A 4OYRA 4H77A 3ZNOA 2WP0A 2V1UA 2V7QA 3U9SA 1KR2A 3G7SA 4GM1A 1PWYE 2UU9B 3WGNA 3WO0A 2O3QA 2QY9A 2QZZA 1JBEA 1MJ5A 3TBFA 3T9BA 2GCPA 3OZDA 1BN6A 3DE2X 2JJQA 3BMNA 3V2UA 1NQ5A 1FIUA 1PCXA 4M60A 1GW6A 4B3XA 4NTZA 3K1TA 2BDTA 2ZG6A 1QGUA 5H02A 3G85A 1TC2A 1X6VA 2CE7A 5KOJB 1C4WA 5I9BA 3RYTC 4RYLA 4D5GA 1Z5ZA 4NSNA 1J2RA 3BRWA 2QL5A 4RJIA 5HPYB 1PKXA 3DONA 3SR0A 2AG5A 2IYWA 3G2PA 4WI1A 2QN1A 1WW2A 3DAPA 3EH2A 3WIDA 5TMPA 5LZ4A 4RPKA 4C4YA 4KH1A 5C4MA 5F1PA 5A3QA 3FSJX 3MFYA 1EFVA 4F1KA 3CHOA 3FF4A 3QVJA 4IGFA 1DGQA 2BFDB 1LW6E 1P31A 3N8HA 1TQ6A 2ZCVA 4IF6A 3LHDA 4A9AA 4I8IA 5TQ0A 3IAM6 1E2KA 3CVUA 3WFJA 1HEIA 1Y4SA 4DR5B 4HN9A 3R6WA 3MCTA 1W49A 2AS0A 3ZQKA 4N3GA 2WUWE 1RKVA 2M6KA 1CBUA 3LIPA 2AUNA 3A9UA 2F17A 4IIJF 5K0NA 5CA1F 3TFQA 1O97D 5T4EA 3SICE 4GQIA 4KODA 1BN7A 2AJDA 2VSXA 2C9MA 4M8SA 3WYAA 4B83A 5BV0A 4YEDA 3SBXA 3FTEA 3ZNNA 1JG3A 4MWDA 3I0ZA 5KWJA 1QSGA 1V16A 1ONNA 4KR0A 4AY6A 4GDFA 3WL4A 3EIFA 5JUWA 2GBGA 2H48A 2OILA 2RB4A 1QLHA 3Q7SA 5H80A 2YUIA 3B7GA 5AJZA 4OHZA 3T7DA 3X1WA 3HUTA 1I0IA 2W2XA 3JQAB 3GLHB 3K2IA 4PANA 1PQ4A 3ZH2A 4TWRA 3NLLA 5FUVA 5HKBA 3GPCA 5JZBA 1EUZA 1HTWA 4XMXA 4LWPA 3BRQA 2A8YA 4TLAA 1Z08A 2ZB2A 1C9KA 3IUNA 3N2ZB 4XGKA 4B7ZA 4EKDA 2JDIA 1WDKA 4KI0A 4Z7OB 1G18A 7ABPA 2A1UA 1Z83A 4PAWA 3EH1A 4LWZA 1KEEA 2RKOA 4KGDA 3ER9A 2VQEB 1P19A 1JAIA 2GEKA 1TFRA 3TK1A 4BKQA 4WKOA 1AE1A 1R7RA 3FPLA 1QIHA 2CF5A 4QBKA 1KSJA 3V4RA 2QNBA 4E1BA 5A7HA 1KXJA 1K92A 1VJRA 4H7IA 3O8NA 4R40A 2ZRMA 3N28A 2A7QA 1TK3A 3E61A 3HBJA 4G4GA 3LCVB 2BI8A 2J5QA 2D1SA 4FHGA 2EP7A 4LOJA 1T10A 4K5MA 1RFGE 1RZUA 2H2IA 3GC6A 4HXEB 4I9UA 3PBKA 2H2WA 4Y1FA 2O6HA 5K4AA 3RUIA 4PNEA 3L4EA 1B2LA 3R44A 4A23A 4CLOA 2FN3A 2GF0A 1M1YB 1XVAA 1NSTA 2RHDA 4IOMA 1F3OA 1ZUIA 3QNMA 4K86A 4XJXA 3K8QA 1G5QA 1N6KA 1E3DA 2ZT8A 4I1IA 3WRXA 4Z86A 1WHSB 1M7BA 2X1MA 4JOCA 2J9GA 2PH7A 4BP1A 4ZVVA 2C42A 4RADA 3CJTA 3P2IA 3QWIA 4KLRA 3WMGA 1TTQB 3BE6A 1NF8A 3P32A 4OXIA 1PQYA 4O1IA 4RH0A 3S5UA 4KBFA 5F5NA 2VPZA 1E4VA 2XDWA 3KKZA 4P9NA 2OA0A 1LC0A 2JGIA 2P0YA 5BV7A 2HTFA 3TG2A 1ULUA 2MJLA 2QRMA 3C48A 2DWQA 1ONBA 2IT1A 5SICE 3ZQ6A 4D0GA 2YW9A 1JKJB 1ZMXA 4EFLA 3W2GA 1UKCA 2QTWB 2D2XA 5CCDA 2D6FA 3CLUC 3DTYA 3KQNA 4ZW8A 3F7OA 1JIJA 1C0PA 3EAFA 4BGEA 1YJ8A 5LMNB 2VYNA 1YB1A 4TTPA 5JAQA 4DYDA 1JA0A 1DUIA 5HFNA 1SC4A 4F7DA 5DCYA 5LWQA 1VRVA 5KDLA 5CA0A 2VAWA 1SD5A 5BN5B 3QVVA 4BXOA 4TV9B 3L8CA 2I4TA 4BTVA 3IQEA 4UU1A 2X7HA 4N3NA 3CKKA 1HO3A 3IQZA 1C7EA 2G4LA 4HAYA 1H5UA 4YJGA 3SIWA 4Y7CA 5HQ3A 3KTAB 5BURA 1J06A 2PU5A 3Q7IA 3BTVA 5KSYA 4DPRA 3K72B 3P96A 4Y0AA 4AYTA 4KQWA 4ZX5A 4US0R 2QA5A 3HK2A 1FYDA 2NPOA 1BKDR 3QWAA 1KMHA 2NUAB 2RARA 3H9JA 5AI4A 4XX1A 4F6RB 2XOKD 4L4XA 3TLBA 1Q1AA 2C2MA 3FSGD 3ZZTA 4ADSG 4YT8A 3JAMA 1GTSA 3CZCA 2I1LA 5C7IO 5B2EA 5EZYB 1IPFA 4BQSA 1PVVA 3HU5A 4FGZA 3NR2A 4LTMA 3ZK8A 1NF3A 2NU9B 1GG2A 4WL0A 1MDFA 1A8UA 5E6UA 3KZXA 1D4AA 5JCXA 4AR9A 2PFKA 2XDQB 4KYIB 2VCHA 4DJJA 4EEKA 5HQTA 1PJAA 3A6PC 4LDJA 1GGVA 5ALEA 3ZHVA 1RE1A 2ECPA 5FBRB 1FDOA 1XSEA 2R7AA 3MQ4A 4M1EA 2F8LA 2HMAA 2YX1A 3AG5A 3RC3A 1WCYA 3CINA 3EXHC 4NICA 1LLQA 5JDIA 2PKQO 3MJ4A 1S5PA 1NVWQ 1E2PA 2QGNA 1DQRA 2XQFA 5CYFA 4W9RA 5ES3A 3OE5A 1I3NA 3OIFA 4R3NA 3RIYA 2HCBA 4J3JA 3QKWA 4OA5A 5DCLA 4DMMA 1XDWA 3TPZA 4ZREA 3FU0A 1X8XA 3T8YA 1SUAA 2ISCA 4EY6A 2O5EA 2CUTA 3G1TA 4X8MA 2HLDD 4Y9SA 3PGLA 3V1KA 2JFYA 3MJFA 4QTUB 1XAHA 4IQ4A 1YIOA 2B2XA 4YCDA 2BGIA 3RDPA 1PFGA 4FZ3A 2WFLA 1UCFA 1XTKA 2FEMA 1SAYA 1TMGE 2NU7A 4ARSA 3FUXA 2I9KA 2VDUE 2B9EA 5CNIA 1EWYA 3GCDA 2VJYA 1XL0A 2C8VA 2O2DA 2BT4A 2QTZA 1YCDA 3E9YA 3EA4A 1OX4A 2JGLA 1EHIA 2X23A 3W4JA 5JI2E 4LBWA 3K4QA 3E5RA 3ROZA 1F5SA 1PL7A 2FMIA 3QX3A 5JJLA 3NDJA 5FUWA 3ZWDA 2J8ZA 1WBBA 3C7DB 4CV1A 2AQIA 2H29A 1WJGA 1G21B 3OLWA 2PO5A 1GTG1 3MINB 1Y1RA 2Q5QA 3THOA 3CRRA 1BX0A 3EC2A 1G2IA 1NZFA 5EJ5A 4RPLA 3IUBA 5CXSA 5CPFA 4NATA 4CR6A 4IKOA 3VTZA 4JJ7A 4FGWA 4CG1A 1QU2A 1M1UA 4JUAA 4B0OA 3ZVLA 1OC4A 3CHPA 2DR0A 2IEIA 4PBTA 2I22A 2CBGA 3DE0X 3OCVA 3NANA 3PVCA 4FYXA 4XDHA 4ZRDA 2ZYGA 5C34B 3UV3A 1DJQA 1JR4A 2E4VA 4D46A 5JAOA 2VC2B 3T61A 2QTMA 4NV3A 3TL6A 2H11A 2I2FA 4GX2A 1XTRA 1GXSB 3MJCA 4GWKA 5CB4B 5EV7A 2NO1A 5FQOA 4YRZA 3ROPA 2QL9A 4IIEA 4YMIA 3KQLA 3C8MA 3DD5A 2BGTA 3M49A 4HYYA 4W5QA 2I7DA 1KJWA 4L02A 4M9XA 3OD5A 1J22A 4GAEA 1JQEA 1F14A 1HLGA 1LPPA 2O4UX 2PUHA 2UZIR 3K9NA 4Q9NA 5GGYA 4BVGA 1KMIY 3AT1A 3Q3CA 2QN2A 1GFSA 2ZIUB 4ZCIA 3K0HA 1L7MA 2FSVC 3DOUA 1P9WA 4NK4A 2P5UA 2P2CA 4JT9A 5F98A 3EFOB 2JFXA 4L76A 1C0KA 3I39X 5BXQC 1P8AA 1QORA 1XZQA 2VBFA 4G07A 5E3JA 3TUIC 4KG7A 3ZG6A 2YJ5A 2I8LA 4HVLA 5IDXA 2XB4A 4OQYA 3MOSA 5EHNA 3TAXA 3UUEA 1BD4A 1P80A 3C43A 1EYZA 3NORA 4H0CA 1N6RA 1T0PA 3D81A 3OMXA 5EP1A 1YCGA 4WLFA 2P0AA 2Q9CA 2IIQA 2POCA 3UO8B 4W9MC 4RGBA 2JGNA 4KMRA 1YJAA 2PS0A 1AK1A 1R50A 3EFEA 3F9RA 3LY8A 3MGAA 4XMTA 3OF5A 4IEIA 4CT0A 4HLUC 5BSMA 1W4BA 2HOQA 4HMOA 3Q3GE 5FWXB 2AMYA 1IAQA 5EWJB 1X94A 2HCFA 3U7QA 2L19A 3R6GA 4M1OA 2QTBA 4NFSA 3BF7A 4IINA 4LC0A 4EUHA 5JQGF 1G6KA 4JI6B 3KKPA 5FXMA 3TOXA 3O8QB 3PUXA 1HSOA 1KKLA 1U7ZA 3CUWA 3L7KA 4XJVA 3AUFA 4LMAA 5L4LA 1SK8A 3U4QA 1I36A 2HUNA 2QGZA 2ZRGA 4TV9F 1ID8A 1E5VA 2HXSA 5JJ5A 1E6MA 3WZLA 2RG7A 2NOAA 4GMHA 4LVCA 3DWFA 3SQLA 1O96A 2CC2A 5H82A 2C4TA 4CODB 4ER3A 2BSQA 3ZZNA 2W71A 4ZYZA 2IHNA 1DZIA 2O0HA 2BR5A 3GJ5A 2EZUA 4TVKA 4WFJA 3E5MA 3TVTA 3U5TA 4B31A 1GVNB 3HI4A 4O4LA 3F73A 2XKBA 2GTHA 4F06A 4MJXA 3TBHA 1TT5A 1C4KA 1MF7A 1T0HB 2A9OA 2GLTA 4NDAA 3DXXA 3B37A 1N7IA 3CNLA 3DMHA 1P0IA 4LOHA 1I3MA 1JIXA 5EZYF 1XTUA 2A3NA 2WF6A 3P1JA 1OBCA 1Z5VA 3ZD6A 2ZBVA 1QQTA 4IV0A 5FCDA 2DH6A 4IZHA 3Q5DA 1RI2A 3PIDA 4BCCA 4M1MA 1N5DA 3DEAA 2AFHA 3TGWA 4PSAA 2P4SA 3KLOA 4OYYA 4UOQA 4EZEA 4X20A 3BIWA 1REQA 1XU7A 4DKXA 2VQ6A 3OX2A 3UWSA 3LP5A 2ADFA 2DZDA 3FOWA 4I4IA 2D5BA 5BSFA 4X3CA 5D2CA 2WNHA 3CLRC 1BIFA 3UCQA 1KMMA 1ZK4A 4O3FA 3S29A 1OFUX 3DT8A 3CWCA 1M2VA 1BCSA 2YNMD 4W5WA 3WB1A 1O94D 3Q8LA 3LDHA 5IPFA 3M4NA 5IVDA 3GUZA 4KMSA 3W5HA 2RD2A 1FP4A 4KJXA 2VSFA 4ZT4A 3IBGA 1EE9A 4ZMBA 1NVXQ 3A8TA 1QHXA 2BOVA 1KDRA 4BLPA 1YBHA 1N3YA 3B2PA 1T0UA 5IKXA 4ZT7A 1EP3B 1CV2A 1XVVA 2OV8A 2Q1UA 3T5GA 2PH3A 1QDEA 4YIKA 2X76A 5ICMA 1SC5A 1CJTC 1JX6A 3O5AA 5CFZA 1R5BA 1KDYA 1GQYA 1G8PA 2GZMA 3A1VA 2GWRA 1VM6A 2OM6A 3QKIA 4I6GA 4JJEA 5IXJA 2HEGA 2DPHA 3NFRA 3OD1A 4MKGA 1W75A 4ZI7A 3QBEA 3GD7A 3I9FA 1XWWA 1NFRA 4EQ6A 4D9GA 3PUHA 1EUCA 2HB6A 2JJ2D 1SB9A 1FP2A 5B55A 1Y1SA 1TDJA 3MTBA 4NY1A 2FPIB 3HKDA 1RWKA 4J2OA 4LBYA 4ED9A 1Q77A 5ITZA 4KMOA 4O5OA 3IXLA 2N47A 4E5UA 4LBVA 3HFSA 1N9GB 2EX1A 4TWJA 3L41A 1WKCA 2XF2A 4QUEA 1O03A 1JFTA 4NAUA 1P1FA 4R9SA 3W06A 4DQVA 4JAVC 3FULA 4D4GA 4R01A 5IU6A 1IHXA 1CUGA 2P79A 2HKIA 2NUPA 3N39C 3NIWA 3OUUA 2QM8A 1MC5A 4NDNE 1SVIA 3KRTA 2ZIWB 4UNQA 3ZWMA 3RAPR 1X7XA 1TQDA 2QLJA 1NVTA 1T2FA 4MGZR 3HVUA 2FMHA 4P7GA 3OIGA 3LYUA 2PU7A 4EY4A 2Y0EA 5CB4F 5CCBA 3T7AA 2OZVA 2ZGVA 3TPFA 5ALIA 4BFXA 1JR3E 3F71A 4QYXA 2IU0A 2QB5A 5IZCA 4N7MA 3EVTA 4XN2A 2VJBA 4DY6A 3G0IA 1XZNA 3HCFA 3CZGA 2DY1A 5KTPA 2G6BA 1LB1B 2F64A 3QF4B 4X5OA 5LBUA 4C88A 3O4JA 5F52A 4PIVA 4ZVPA 3K8YA 2VDWB 3LP8A 3MRVA 3BDIA 1DBSA 4QTTB 4OHMA 4DC1A 3VFDA 3NM5A 1E4OA 821PA 1FC0A 4CMJA 5K99A 1N5JA 1PJ8A 2P11A 3KDPA 3UF0A 5KREA 3AESB 3TCNA 4M7OA 1G19A 3RBZA 4FBMA 4EA6A 4Q1CA 5CLFA 1GKLA 3R0JA 3B2QA 2E5LB 2OESA 3BD7A 2NUTB 2JGRA 4J6FA 4RGYA 4GYYA 3I42A 1X1CA 1JZSA 1JLRA 2EGHA 1BKSB 1QWOA 1OMOA 2O2ZA 1K8YB 2ERYA 2QD1A 4BVKA 4CUZA 4EX7A 3GY0A 1NFQA 3VZQA 2YJ6A 1PW5A 3OQMA 1QP7A 4O29A 4XUCA 1G6Q1 2ZBQA 3DV2A 1C3JA 4RO0A 4LHZA 2R6AA 1O94A 2Q4RA 1S01A 3QV1A 4D6PA 1NQWA 4GL4A 3BORA 3ER6A 4MRRA 1MZPA 4B46A 1JW9B 3B52X 1HDZA 3E2MA 2GN1A 3GI1A 5TX7A 1WXIA 1SXJD 3UXYA 1BHJA 3AZOA 3B82A 3N2EA 5AM4A 2VKTA 5HE8A 3BL6A 3RS3A 4I3GA 3CFYA 4TM8A 3SSAA 4B3FX 4Q7JB 1K6EA 1UFOA 1WV0A 3DC7A 3KYDB 4AJ2A 4CNQA 2NZWA 2ZDHA 1TO2E 4AJ9A 3U3JA 3H42B 3PHIA 1VFPA 3OZSA 3OQHA 1GNSA 1E7WA 2FZVA 2ETXA 1THMA 1RRKA 2QS9A 4QG3A 1D9ZA 1GVHA 3LXUX 5AHKA 1Y7LA 3AETA 4LF8B 1BTOA 1YJQA 2HC9A 2Z83A 2XWBF 4CEJA 1K6MA 4X61A 1M83A 1D2HA 3UJ9A 1E89A 1R0ZA 2R4UA 2H85A 4MNTA 4ER7A 4Q21A 1TCAA 4NOKA 4B4UA 4BMDA 2UVQA 1FF9A 4D4KA 2OHHA 5DVZA 4D81A 2PUTA 4JT4A 1JG4A 2OAEA 4TLMB 3HDTA 4UBNA 3RUPA 2UXDB 2HJ9A 3BB3A 1ZIPA 4PAGA 4KK3A 1M7GA 3L93A 4FE7A 3R8CA 3WLOA 4N03A 2Q3FA 5PGMA 3COSA 4YY3B 1FDWA 2X7JA 2GHIA 2ZBGA 4Q4DA 3KZOA 4QTXA 4F96A 5MGNA 1X1DA 1Y6FA 1SC6A 3V7UA 1EM6A 1N7HA 1XMJA 1C0LA 2G67A 3LPNA 3ND9A 5ALYA 1K3UB 5DT9A 3GLHE 3EW7A 3IEKA 4G1CA 3RABA 1OV6A 2HV9A 3FB1A 2P1DA 4L5BA 4HUJA 4LQDA 1H94A 4UJ3A 3TIVA 4CQMD 4IJ6A 2BEUA 4LVNA 2HJHA 4HO1X 4TXMA 5BR8B 4CTMA 1MGOA 4NMMA 4MA4A 2X0IA 2EEZA 2ZWVA 4I1OA 2R97A 3H83A 2IK8A 5EEHA 5EGSA 4CR7A 2IPNA 4MS1B 1M1ZA 2AOXA 4I9HA 4MWCA 3AHHA 4KNVA 5DFAA 1TC1A 4D9NA 4Z4GA 5LU8A 4L6IA 4KLAA 5CVJA 1WF6A 4NCJA 4QVKA 1L7NA 1SC9A 3VNVA 1FYEA 4DR4B 5DB4A 1A8PA 2OHVA 4YP0A 3OF2A 4A03A 3GH1A 5BW5A 2D1FA 1V1MB 2IHBA 3ONVA 2ZIEA 1WXFA 2F3QA 3DVLA 4FN4A 3L6BA 3V3TA 5KJ1A 3C15C 3D6FA 3TR5A 4LZJA 4F2PA 4MDYA 3QU4A 2GH1A 2XYGA 1FQJA 4XQ9A 1YAHA 5A02A 3O82A 2XRZA 4FOSA 1T26A 1Z0JA 1X1TA 2NAFA 2VHXA 4FC7A 1M1YE 1QR2A 5EERA 4FGSA 4IXWA 1H1LA 1F48A 1YR2A 1RFLA 5J2UA 3CTPA 2GZHA 2BTOA 1U7DA 2V4ZA 2ZM6B 4XFDA 3SE0A 4J9VA 2ODEA 3BCHA 4K9NA 4WUVA 2GN4A 3CU5A 1B14A 1W4ZA 1B0PA 1M0TA 3D6NB 2PO7A 3K4HA 3OO1A 4JL5A 4WERA 1IEXA 4C2BA 2WQZA 4FFLA 2C5AA 1AQIA 1LQUA 5AENA 3AWDA 3GX1A 3H9QA 3RRZA 4A6PA 4B4DA 4EKIA 3OCWA 4OUDA 4FHCA 5KEIA 3EBGA 4LUPA 1W35A 3MQFA 2I4LA 2HWUA 4R5HA 5B36A 3EMDA 3KXPA 4FINA 5BYJA 1R5NA 1H93A 1R0BA 2IZ5A 4FCVA 4I50B 4G23A 1CUZA 1VLVA 3EQ2A 2OY0A 5K0JA 4NCNA 1V3QE 4LXYA 2RGYA 3IT1A 4MP8A 1ZGZA 2VOJA 2ZYRA 1VL6A 3REFA 1N2OA 4ZU6X 1MDBA 1W94A 1QP8A 1L4NA 4OGFA 4R1NA 3PPVA 4D44A 3FUCA 1JJFA 4UPVA 2HQ1A 4WK6A 4ZT2A 5A71A 3RU2A 5CDUA 2E4WA 1P33A 3JU3A 1D7AA 4CUKA 1ZR2A 3JZFA 4W8OA 2GD2A 5CH8A 5EMLA 2X6RA 1M8FA 3BHIA 3ZX4A 4DJAA 5BYAA 4HKTA 1PJ4A 3FH0A 4H31A 3KOXA 2XUGA 3WBFA 1NUPA 1QV9A 1XWFA 4AWXA 2VAXA 1GTZA 3G17A 1IZ7A 2NVWA 3IIMA 3C3CA 1JI0A 3OQJA 1MW3A 2H59A 5DASA 1FFYA 3HP7A 1GY8A 1SXHA 4M49A 4EVRA 3ZCUA 5KQGA 4DR1B 3ZGVA 4QM6A 4CLRA 4G4SP 2H5LA 2IHJA 2BKAA 1K4KA 1DFHA 3LCCA 1RW4A 2WINI 5AESA 1XEWX 1Q1EA 4L8LA 3CLUD 3CRQA 3DMNA 1DKOA 1V6SA 1J0EA 5K8CA 5SV2A 4LKOA 3P2YA 4QJ4A 1YZHA 4I08A 1H2FA 1VRCA 2HHCA 3KJXA 1E7YA 3PS9A 4ZHQA 4EW3A 3O83A 1EX7A 3A6JA 2QIOA 1S8OA 3W5CA 1D0VA 2I3AA 4LCJA 4MGKR 3GOQA 3M6WA 3T06B 5KWEA 3EXIA 4RZ3A 1D2EA 2PMDA 4RZSA 1P75A 1Y3AA 3O31A 5GWXA 3SVLA 1R9GA 3PF9A 5EP4A 1JG1A 2DHEA 1MW2A 4YCSA 3WL3A 2VCEA 1UQRA 1R6UA 3NHAA 3RYHA 3KXLA 1G5RA 5KOJA 4JMLA 4LTDA 2B94A 1YDWA 4JH0A 1QRUA 1C41A 2EWVA 2ZYSA 4QIHA 4B4WA 1U4SA 3OZUA 1PL0A 5AXBA 3SEAA 4DM7A 1DJNA 4GXNA 3FF1A 5LBIA 5JECA 3DFFA 5IJAA 1I4OA 2ZROA 1DX9A 1WTAA 4LJAA 4DXAA 1B1AA 2R65A 3LDFA 1MX9A 4RY9A 3OBBA 5KKNB 4MITA 1LLFA 2NM0A 4KPYA 2OR3A 2WSYB 2GMWA 4ZCPA 1NLYA 1Y3BE 2JFWA 2JVIA 1K5HA 3DFZA 4NE7A 4FNGA 4TROA 3W3AH 4BY9E 2XVZA 1EXDA 4QHPA 4PO3X 2BFOA 1W5AA 4W1QA 4HXFB 3IDFA 3MAGA 4O59O 1OWNA 1XYVA 3IUPA 2VPWA 4KWEA 4ZVLA 2P4HX 2PT9A 3IJEB 3EGIA 3C85A 3EZ2A 3H8SA 5L8VA 1G21E 2BFNA 2O7QA 1QIDA 1R15A 3CZRA 2RHLA 2I54A 5IK2A 5K20A 3VH1A 5DGHA 3M0EA 3ZJTA 3FHLA 1S2MA 2WKQA 3LS2A 3MD9A 1T8UA 5DEOA 1V5WA 1NUAA 2H1SA 2I55A 3I6YA 4JENA 5FIUA 1YHYA 2OOKA 4HRAA 5DYGA 2H3EA 2QV0A 1WE2A 5HHTA 3IMEA 3CNOA 3JQAA 4XSHA 1OIXA 1HSZA 4NOMA 4B7AA 3H1EA 3AM1A 3GF4A 2CCJA 1YI0A 2P77A 5B6PA 2O8FA 2KI5A 2QVXX 3MGGA 8ATCA 5BSRA 3QEOA 1AZWA 3GCZA 4U1RA 1ZD8A 4IH4A 4PSCA 3HR7A 2AWNA 2J67A 2XRMA 3L04A 3W1WA 1M2NA 3HUFA 5B3KA 1Y3HA 4ZICA 1NASA 1N2JA 2Y3IA 1XKLA 4DHWA 1PO7A 4DEYA 2HZ7A 4YAUA 1A9QA 3EZGA 3UFXB 4EVIA 1MHTA 1XNRB 1ISJA 3IP6A 1QWSA 2PY6A 2ZRNA 1DINA 3CUTA 3GELA 2V9CA 3HYLA 3NYQA 4BUZA 4DT1A 3MMNA 3R8FA 4RV9A 5TF4A 4JOSA 4H1VA 4QSHA 5BMVB 3AFIA 3KZ1E 4JZYA 3PC3A 3AVOA 5DYYA 3ET4A 4S3MA 1OBVA 3U16A 3HP4A 1ECLA 5HZKA 2IGTA 2IYZA 4I1SA 1IPEA 2PL1A 5LA6F 5LFAA 1UOOA 2BH2A 4RLHA 1TM2A 2V7PA 4LYDA 3CRZA 2WJPA 4L8VA 1YI1A 4RA9A 1RPTA 2BISA 3BZUA 1VSTA 3C87A 3KUKA 3F1LA 3V8PA 2NSJA 5E2BA 4BIIA 2J0QA 2J7PD 2YS6A 4KDEA 4B4KA 3C41J 4I50F 3RS0A 5LLSA 3F96A 4DAEA 4GVXA 1PI3A 3FLEA 3KWMA 3WG9A 1JFRA 4YRPA 1J0DA 4EZIA 4MUBA 2TSYB 5D3MB 1S7CA 3DS8A 4HYQA 4NRDA 3TWOA 4C3VA 2CLFB 4GGOA 2CUNA 2NXWA 1YR8A 2IEGA 2WIAA 4G25A 1YR6A 1GYRA 5H1YA 4AXXA 4AG5A 3GJ3A 4DKJA 4QREA 3IRUA 1S2IA 3PEUA 3TD9A 4ZCSA 2CHFA 1KAGA 3WDSA 4UUOA 4M8NE 2DYKA 1L1QA 3K0CA 2Y1GA 9ATCA 5K8JB 2Y9PB 3LAWA 1ZK3A 3GZNB 3K6JA 3H1TA 1IEWA 4BLQA 4XN9A 1XZ8A 2F59A 3PNLA 3RTGA 5HZHA 1K2WA 2PUGA 5BR4A 2QXYA 4Z99A 1EP2B 3E4CA 3X1MA 3ME5A 4MS4B 1ZD1A 3MT9A 1HV8A 2MSNA 1A71A 1L5VA 2VZEA 1I2MA 2CN1A 3ZWBA 4CKXA 2XI4A 2UV8A 5AKLA 5A3JA 2WRZA 3ZXUB 5LMZA 1A2QA 4QATA 4C0LA 5B4TA 3EXHA 3HM9A 3KPJA 1OZHA 5AKJA 3HXOA 5I7RA 1QRSA 2WW8A 1UP4A 4AS2A 2ASVA 2HPZA 3SIPA 1ORTA 5K7SA 2G4VA 1QGAA 1UC5B 1W581 3GEEA 1OHHD 3F6EX 1T25A 1YHNA 3KTAA 3N0XA 4KB5A 2P9EA 4MROA 2D0PB 3EBIA 2W2LD 3DL4A 3GW8A 2ZFUA 3K2BA 4JJ8A 4N7JA 4PN7A 3OQIA 1C8BA 4RKFA 4MAAA 4OBEA 4QICA 4JLVA 5IAKA 1C4OA 2VPXA 2PSDA 4L0DA 4FIDA 3AVXA 5JD3A 3W5IA 1TRKA 4D97A 4ZIRB 4KO1S 1QOQB 3AW8A 2Z95A 1CK4A 3HB4X 4A8JB 1VL1A 4UE2A 3GLIB 1WP4A 3N7UA 3I5UA 3PHJA 1CHDA 2F55A 2O8BB 2XDQA 3NOVA 5BSVA 3ZIDA 4D26A 2JBWA 3R9XA 3VPFA 2DHCA 1I1QB 3ZDFA 4JXZA 3L40A 3CONA 3O3MB 1ZHFA 4QX6A 2PLFA 4LSGA 4TYMA 4YK7A 2O52A 4W5RA 2RH5A 1EGHA 3EZNA 3GGDA 3SVTA 4TZ6A 3A2LA 4I5IA 1OIVA 4JI8B 4JI0B 5EUMA 1E9FA 3N8GA 2UXCB 1G8AA 1Z6GA 1ZCAA 4N5NA 4PSUA 2TMYA 4KW7A 1FSFA 2ZYWX 2JL1A 1T6NA 3DD1A 4TX1A 1Q0RA 2Z6UA 4QA9A 5KVSA 3DTNA 3MAAC 3RE1A 3K73O 3CLRD 4B81A 2GFHA 2P6RA 3N74A 1PEAA 4I4CA 2PCLA 3ZTWA 1E0DA 1L4GA 2ROQA 4GFDA 4RZUA 2G63A 4U9UA 1AXEA 1Z37A 3L82B 2CT8A 5BNZA 4CM6A 3H1PA 5CXXA 3L8DA 4G41A 2J7PA 3GO4A 2IY7A 4I8XA 1JHQA 2HU5A 3ZVKA 1BQEA 1DKPA 4BPRA 2H2GA 3WI7A 2X8JA 3G1WA 2OWEA 5HUQA 1F06A 4AO7A 1N78A 4NBSA 1CDOA 2MIIA 2ZJ3A 3D4PA 4LXIA 1W2HA 3CTMA 1EA7A 5FWNA 2FSVA 1S2OA 1MRZA 4XARA 4WGGA 2QYSA 5KQRA 3ZV7A 2ARKA 2JA2A 1NT2A 1Y34E 1G21A 1NBOA 2ZATA 3IVXA 4PXAA 2ZYHA 1C9EA 4PGMA 3MINA 3PGA1 5E95A 4B75A 1HUQA 3H0KA 3O73A 1N4AA 1ML3A 2VNSA 3QYJA 1W88A 3EVBA 5DNDA 1XELA 1GWNA 4QUHA 2QSYA 5CHEA 4J91A 1OGIA 4OXKA 1KFKB 2GESA 3KALA 1CUSA 2P4EA 4CNBA 4MX8A 4ZI3A 1CY4A 3JYHA 1U2ZA 3MYYA 1J97A 2QUBA 3H99A 4FKBA 4HLUA 4HV4A 2ZTSA 4LF5B 3X1KA 4FU0A 4Z51A 5JE8A 1QR6A 2GAFA 3O2JA 5J40A 2Y1EA 3EYAA 2Q5HA 3HZHA 3Q8WA 3X1JA 1IONA 3UH0A 4A2WA 3AF5A 3PD1A 3W9UA 2XYVA 4JS0A 3RH0A 1SBYA 3VPAA 5JXWA 3K2QA 1SFRA 3BJMA 1JIKA 1IBCA 2GTPA 4UPDA 3RUCA 2O3SA 4II7A 1LJLA 3TZBA 5LVAA 2ASEA 5JSFA 4DA9A 1XRMA 2JAWA 2NXNA 3WWPA 1Y5MA 4ND7A 3U6KA 2PJRA 1M9NA 4M0LA 4M2LA 4EHHA 3PEWA 2DBVO 3M82A 2IV2X 3WYNA 4PXYA 3IS3A 1FX0A 4R6WA 5ALKA 2FSGA 3C3YA 1DTEA 1P7YA 4PQEA 1ZM7A 2XTAA 4L51A 2VJAA 5F23A 4WKGA 5HDBB 3QFRA 3MG9A 2Q0XA 3MGBA 5AXDA 1Z8FA 4UDXX 1V26A 2IY8A 1K2VN 3KPUA 4FFBA 1J0AA 1GTL1 2BR3A 1VL5A 4HDAA 3BEOA 4BUCA 1B26A 3I0NA 3UOAB 2WWTA 4UUMA 4MPJA 5JZSA 1Z2CA 1GAEO 3SS9X 2OGZA 5EIBC 2PZBA 3WFIA 5EWJA 5ESWA 3SSOA 4D0RA 3AJ9A 4FEYA 1I4EB 4F5EA 5B12A 1JQAA 2BHNA 3STUA 2VHTA 2WT4A 4H0FA 4PLYA 3NEYA 1II8B 2WE8A 3QXXA 4MRMB 2ZEJA 3R7BA 3UUGA 1H4TA 4QM7A 3O8QA 3D0KA 3V46A 1CX9B 3ILSA 3ZVNA 1J5PA 2OP1A 4I2VA 1GQ2A 3T1YB 4ZVRA 2XB8A 3COJA 3MF4A 2WG0A 4R4JA 4RJLA 1E3EA 1QLWA 1U31A 3I6BA 5TC4A 2FVYA 1O2DA 2FRXA 3RQIA 2OD9A 5B1YA 1TYDE 4WNIA 2YQ4A 3IKLA 5FA5A 4LHXA 4Z4QA 1H5QA 1CNFA 2DY0A 5FBHA 5L3SB 1P5FA