4ZQGA

Crystal structure of the moraxella catarrhalis dox-p reductoisomerase in complex with nadh, fosmidomycin and magnesium
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
b'LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
total genus 154
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqgA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqgA01
5BT9A 1MLDA 4ZA2A 4BMSA 4EJMA 4CLEA 1AHIA 2EF1A 3BTUA 4JN6B 3IIEA 2PKQO 1R4NA 3B6ZA 3NDRA 1VJTA 4CM8B 3K2BA 3F6YA 3GUYA 3AM5A 4IPTA 4EI2A 3P7MA 1FK8A 2NVBA 5B4TA 1ZO8A 1S7CA 2ZQYA 5EQDA 2XF8A 2DFDA 3TZCA 4NU6A 1UXHA 2X0NA 3FBTA 3GZ4A 4TZTA 5T8KC 2NU7A 1EFLA 2POQX 4NK5A 3I9LA 4XYBA 3AI2A 4R5MA 1G1AA 4B4VA 5DBIA 3SLKA 3F47A 5TRTA 3GY0A 3WB9A 1E7QA 1NAHA 5HA5A 4ZQBA 1V9LA 4YACA 4DIBA 5BNFA 3E9NA 3OF2A 4J91A 2NADA 3ZWCA 1ISGA 1E6WA 2HMSA 3FTPA 3D3WA 3IOYA 4CR8A 5U9CA 3HG7A 4BNHA 2Q1TA 5JC1A 3HJAA 3CPSA 2I65A 2RHCA 1Z6ZA 4ILKA 5AVOA 1KIFA 2F1KA 1SEPA 3RKUA 1LC0A 4E5YA 5K0ZA 4XX0A 3RC1A 1ISFA 3P2OA 3JCZA 3MJEA 4EW6A 3DQPA 5CDUA 2V6BA 3I52A 4HFJA 2QRLA 1ZKMA 3NDJA 3RUAA 1ZSNA 2J3IA 3JQDA 4YJGB 2WM3A 3O26A 1FF9A 2YYYA 3NUGA 3DC2A 4ZICA 2E4AA 4J9UE 1X7GA 2JHFA 4WCFB 1WW8A 2UUPA 4RF3A 4BS9A 4R4JA 4XJTA 1PQWA 2FSVA 3T4EA 1RJWA 5ER9A 3IJPA 1O89A 3C7AA 1GL3A 3O38A 4MVJI 3G0OA 1MW1A 4PLZA 4C7KA 3MOGA 4YJFA 3VH3A 2PKRA 2VQ3A 4RF5A 2GLXA 4U6QA 3CSDA 1UP7A 2YFHA 3S2GA 5A3VA 2CDBA 5JMPA 1YBMA 3FWZA 1A7KA 2OBNA 3FI9A 2DTEA 1MVYA 3BTVA 3GA0A 1P1RA 2AA3A 3SXPA 3BTOA 3FBGA 3IS3A 5COAA 4E2XA 4IDAA 3ONDA 4FB5A 2ZB8A 1CIVA 3QV1A 2ZTLA 3GT0A 2VRBA 3DMTC 3I4CA 5I7FA 1TXGA 4E32A 3RUFA 4XGNA 4Y9DA 5JCJD 2JD2A 3D5TA 4LVCA 2PD6A 1BTOA 2B83A 5IZCC 4IXWA 5FEUA 1EZ4A 3EVTA 2FR0A 3KUXA 4RPLA 3TF5A 3PGXA 5A9RA 3L77A 2O7GA 1FMCA 3O4RA 1KETA 2UYYA 3ORFA 2YUTA 5AXCA 3STHA 4CM9D 1E6UA 1E5QA 2HK8A 1H93A 4YCAA 1CF2O 1HYGA 1NASA 1PJTA 3Q11A 4YJGA 3WNQA 4D42A 3LQFA 3CMMA 4OXKA 1OAAA 3JQAD 3VDQA 2EIHA 2YDYA 3ETGA 2PV7A 5IAAA 4WCFA 2FRDA 5JAQA 3IQDB 4OIMA 3PWZA 4IZIA 1GYRA 4B4OA 1D7OA 3DOOA 1IY8A 1PS8A 3DAGA 3V1UA 4EITA 3FWNA 3H6KA 1HF3A 4IIUA 2MAPA 3GVCA 5IJZA 2FY8A 1GUYA 4FFOA 3WICA 1TT7A 2B4TO 4ALMA 1ZSVA 4I1IA 3ROMA 1WWKA 4R3WA 3ZNOA 5GY7A 3GGOA 4CLRA 3NRCA 2G17A 4XKJA 1ENZA 3NT4A 3C1OA 2FMUA 4M1QA 3DFUA 4IDDA 3I9MA 4Y6PA 4D3SA 1XWFA 4GH5A 1VSUA 4WUVA 5G0VA 3WR5A 3ZW9A 4CODB 1GFSA 1W73A 3TL3A 1E1KA 3P2YA 3CXRA 4PZEA 3ZHXA 3W6ZA 1I01A 1JWBB 1ZUD1 3PYLA 1OC2A 3AOEC 3HSKA 1SC5A 1OI7A 4P4NA 4WLOA 5F1KA 5A06A 1QV7A 3MZ0A 5A9TA 3DHNA 3NTQA 4BQPA 2UUOA 4IM7A 4H7PA 3BHJA 2BH9A 3ANLA 3R1IA 1V8BA 5IXYA 1PJ3A 5EL0A 1T1RA 2DBRA 4D44A 1Y8QA 3H7AA 4NBWA 1XHLA 4ZVVA 4FGWA 4PCVA 3WTCA 2NUAA 3ZWMA 1EUCA 1JN0A 1ZXLA 4PG4A 4ND5A 2E82A 1VPDA 4CQMD 4CQMB 4PLCA 3VPGA 4A03A 2X1HA 1OR7A 2YV3A 4LMPA 1HWYA 1GZ4A 1LEHA 4WLFA 1E7YA 1EVIA 4AJNA 3WTBA 3I9KA 1AHHA 2X5OA 4R01A 3WYEA 2JCYA 2B37A 5JCXA 4IJUA 4NHEA 4UVIA 5AQ1A 4HKTA 4OQYA 1D4FA 4NQZA 2Y1CA 1EMDA 2H1SA 3GN1A 2BI8A 3OJ0A 3L9WA 4XR9A 5TLSA 2OMEA 3F5QA 1W0CA 1T4DA 2CNBA 1I2CA 3JQEA 5A9SB 1R6DA 5TIIA 1YBAA 5FF9A 4K6CA 5H83A 4AFNA 2G82A 1I30A 1Q0HA 1BG6A 1UP4A 3EUWA 4MVJA 4IGEA 1NFRA 3PGJA 1G0OA 5CPFA 2O3TA 2I9PA 3JYOA 5BR7A 2ZB3A 3HDHA 2JCVA 4GLLA 2JAPA 1KS9A 2FR1A 1PJSA 3E5MA 4BNKA 5JAMA 3JYNA 1N7GA 3PVZA 3ENKA 4AJPA 2JJYA 1H9AA 3GN2A 5ITWA 2Y66A 1QYWA 3BXXA 1LSOA 3GNSA 1QMGA 3WLEA 4QEDA 3GF4A 3JQ7B 4BQRA 5KVSA 3UFXA 3GOHA 3KXDA 1LDBA 4TKMA 4H3VA 2Q50A 1QYXA 2C7VA 3WYBA 2YQ4A 4K9DA 2Q3EA 3BMQB 1FJHA 1JG9A 1R15A 4NH4A 1U5AA 4YAJA 3S2IA 4AJ2A 4FGSA 2Y67A 4TVOA 2IXBA 1PJQA 4FC6A 2WD7B 4GSLA 1YB1A 4AJLA 4YVFA 1NAIA 1UAGA 4CUJA 4PLWA 4MKZA 2JL1A 2AE1A 3LLSA 3EAGA 1CQIA 3P5SA 1MG0A 3U4DA 1N8KA 3V2HA 1HE4A 4QFCA 3VAZA 3H5AA 3GVHA 1Z74A 3PI7A 2GR9A 1I3MA 1DIHA 1I0ZA 3RBXA 2NVWA 4AVYA 3ETEA 2CZCA 2NU8A 4DL9A 1B14A 4EGFA 5JYDA 1ZJZA 4GLOA 4QX6A 3FN4A 2RIRA 1Z82A 1GEGA 3BA1A 5KVCA 4YT5A 1UDAA 5U4QA 4PLFA 4YQYA 4J9VA 3HQ4O 4I9NA 1M75A 2CVQA 4BNFA 4AICA 2I6TA 2VZ0A 3M2TA 4CUKA 3V1YA 2EKPA 1F0YA 2WSBA 5B4UA 3EYWA 4GX1A 3UCXA 3CINA 1ONPA 5JSFA 3JQ7A 4OH1A 5DZSA 3S2EA 1QYCA 3KSDO 4JJGA 4WEQA 1P45A 3H8VA 2OBYA 5T8KA 1RPNA 5KNLA 3OEYA 4DQXA 1U4OA 3F3SA 3OBBA 1IZ9A 2NTNA 3SJ7A 1TLTA 1NR1A 2R6JA 3RROA 3VKVA 4CLXA 2HMVA 1WP4A 4KUHA 2C20A 1ZIDA 3LSYA 2PKQP 1RYDA 1FXSA 4NI5A 1EEHA 3GZNB 1VLLA 9LDTA 2BHLA 2CSUA 1PGQA 2VT3A 4OHUA 1X13A 1VJ0A 2WD7A 3TPCA 2FP4A 4Z3KA 2GNAA 1FDSA 3ASUA 1T2CA 4MKXA 2LDBA 3W8FA 1R0LA 1XIVA 3LZ6A 5HS6A 1N9GA 4NBVA 3MJCA 3F1LA 2W90A 4OJNA 4LSWA 4NBTA 3KZVA 3LC2O 5U1PA 4BNMA 2X5KO 3G3EA 2GPTA 1LQUA 1NXQA 1PS0A 2X0JA 2X9NA 1EK6A 4BNIA 4OOEA 1JVBA 3AOGA 1HDZA 4CL8A 1TT5B 3CZMA 2J3JA 5DOZA 1RKXA 4XQEA 4L75A 4KWHA 4NU5A 1H2HA 1H94A 2EW2A 4L73A 2O23A 2EERA 1X7DA 5FWNA 4PGFA 3RJ5A 2P68A 4IJVA 1RM4A 4CMBA 1YO6A 5DF1A 3KLMX 3KRTA 4R1TA 1I8TA 4HFNA 4I8XA 4UREA 4RVUA 1B15A 4R9RA 1H5QA 3GH3A 5GZ6A 2P5YA 3ZDFA 3JYPA 4KWIA 2VOJA 1ZS2A 4DPMA 1DRWA 1DB3A 4B3HA 1AXEA 1JLLA 1YONA 2A35A 3OJOA 2ZJ0A 1QORA 4JJFA 1K89A 4E5KA 1NVTA 3A06A 2O2SA 5KJCA 4MO2A 1O94A 3PIIA 3DZFA 5JBIA 1DOHA 2NSDA 1Y9EA 2ZYDA 3CZRA 1O8CA 4XZ3A 3GZNA 1NFFA 1LLUA 1V3VA 4PLVA 2SCUA 1T25A 5KVQA 4EZBA 3KYDB 4IGFA 1KVQA 3E18A 5L40A 2WWRA 4Q3BA 2YZ7A 3U4CA 1SO8A 4E2ZA 4EYEA 2IDZA 3UHAA 4DVJA 3C85A 1CYDA 4BMVA 4TRNA 5TC4A 1I10A 1KYQA 1Z75A 5EERA 3L6EA 3ZV5A 1YL7A 2WPGA 1KOLA 1TT5A 3W4KA 4BHTA 4UULA 2NU6A 3I9JA 4GPD1 5TJHA 5AYVA 4OQZA 4OL9A 2AG8A 3PDUA 2VZ9A 2C5EA 3ZU5A 3PXXA 1XGKA 2RAFA 5AXBA 5TF4A 1H6BA 2EJWA 4CMIB 1HDCA 4RVDA 2GCGA 4OAQA 4WK6A 5F5NA 4GX5A 4D0SA 2X9GA 3KYBA 1PL7A 3LU1A 1LDNA 2NVUB 3ETDA 3RUDA 1E7WA 3ZN2A 3JD1A 3QRWA 1AUPA 4BL5A 2VRCD 1HZZA 2CMDA 1YJQA 2DT5A 3FNHA 2CDAA 4KTTE 3SX2A 3Q1LA 1UDCA 1ZK3A 4FC7A 2VYNA 1O0SA 1DO8A 3SLGA 1PIWA 1NQ5A 1YGYA 1ZCJA 4U6SA 2ET6A 3V2UA 4JIGA 4DQUA 5H82A 1U4SA 3RAJA 2X0RA 2YHIA 3LC7O 4HX5A 2PFGA 1QSGA 3UERA 1EE9A 4AJOA 3H5NA 4AYSA 2I5PO 2CY0A 4OYRA 3GAZA 1R12A 4D7AA 3QVSA 3A14A 5IDWA 4NMHA 3GRKA 3FNEA 2EEZA 1QKIA 4M8SA 2V65A 4DQVA 1HE5A 3AOEA 3DMYA 2OP0A 2O3JA 3L4BA 5EJ2A 5CEEA 1IB6A 2BFAA 2IRWA 2VT2A 3WSWA 2UAGA 3DBRB 4QTZA 4E12A 3H2SA 3K5PA 3GHYA 1GTMA 1HDGO 3PRJA 1R0SA 2CD9A 5JY1A 1LDYA 2OO5A 4N5NA 3AFNA 2Q1WA 1Y6JA 3E48A 2B36A 4RV9A 3Q9NA 3BMNA 1C1DB 2I66A 1UXKA 3QHAA 4IQGA 3U5TA 3TOXA 4EUHA 1U3TA 2H9IA 4CR6A 1HDOA 1PX0A 1YVEI 1AE1A 4FFRA 3WGHA 1QP8A 2F00A 4YT8A 4PLGA 2VHXA 4J4BA 3V2GA 1H0KA 5ENDA 3WDSA 4F45A 2OOSA 3M1AA 4W9NA 1PJBA 2NVUA 3WFJA 3RUIA 4LN1A 1UZLA 3JQ8B 1LQTA 1GYPA 2QZ9A 2FZWA 1HDYA 4B4WA 3WJ7A 4NIMA 2I67A 5ADHA 1L7DA 1Z45A 2P9EA 1BVUA 1P1KA 2CVZA 3NTOA 3EW7A 3DBHB 4WE3A 5CG1A 1UAYA 2Y1FA 2PWZA 3ZHBA 1TVEA 2HSDA 4FS3A 1P1HA 2DTXA 3BZUA 1LUAA 1KVSA 3S55A 1SB8A 3H9UA 4MVJG 1DDOA 1JKIA 1TI7A 2BGKA 2NQ8A 3AWDA 4XRRA 4CJXA 4BB6A 1NM5A 2Y1GA 1SEVA 4LW8A 1KEUA 1ZJYA 2ZTMA 2Q2VA 1DFGA 4B7UA 3GR6A 4BNXA 3HB5X 1DIAA 4FJ2A 4FLQA 4BGEA 3JD0A 3KETA 4XA8A 1WAMA 3PWKA 3R6DA 1BDMA 2D1YA 3AW9A 3RI3A 1MP0A 4QQRA 3KHUA 4LGVA 1GZ6A 2I3AA 4DRYA 3HN7A 1A4UA 4MPDA 5FYDA 4YRAA 3PK0A 1H9BA 1Q0LA 5TT0A 4DUPA 3TFOA 4RJTA 2IZ1A 3PHJA 4F6LA 4I5DA 4IIVA 4IJWA 3RSHA 1GUFA 1P74A 2IODA 4LCJA 3RUHA 1ZXBA 4CM1A 3ZHYA 1Z73A 4YQZA 4EEXA 2AQKA 4OXYA 4KUEA 3EZLA 1UH5A 1ZK4A 1DAOA 1DHTA 4FJ0A 5BSFA 1LDMA 1W4ZA 3PJEA 4F46A 1CERA 4IINA 1Y9AA 4OMUA 5THQA 2OP1A 3ZWWA 1NX6A 4MOWA 4FOOA 5A5FA 4BNLA 5G0UA 5B37A 3TZ6A 5C7IO 4FW8A 2O4UX 2VHWA 3RUCA 3ANNA 2ZCVA 3K8ZA 4Y6SA 5A1TA 3DFZA 5JLAA 4XB1A 4Z9YA 1SBYA 4BNJA 3DBHA 1V35A 3S2FA 1EDOA 3FF4A 4ZJUA 4GGOA 4RPKA 4M86A 3DL2A 3NT2A 2X58A 3INGA 3QY9A 1B2LA 2Q4BA 1JQBA 3RBZA 4DYDA 2VNAA 2FPIA 4RVGA 2HMUA 4Q9NA 3KSZO 3NEPX 3EMKA 3ANMA 2EXXA 1GQYA 1JVSA 1RWBA 4YAIA 2NU9A 3UF0A 3QVTA 2FN7A 4GI2A 4GQAA 4RDIA 4CR7A 1UP6A 1T2AA 4PRKA 1YQGA 4Z6KA 4BO6A 5TQVA 3HUDA 1ENYA 1UUFA 4I5FA 3KYCB 3HDQA 4A27A 2NACA 3GMSA 4DYVA 4PN3A 1T1SA 5JC8A 1MUUA 2EHDA 2MAOA 1YDEA 3K9QO 1HL3A 5JFOA 2IEDA 2QW8A 2W2LA 1T24A 1NBOA 3DONA 3ZWAA 1IPFA 1P0CA 3HE3A 4A2CA 4GX2A 4PLPA 1JDJA 4PRLA 1Q7BA 1J6UA 2WJPA 3WS7A 4DC1A 5JY6A 1JKJA 4MDHA 2JFGA 1PZEA 2DBVO 4Q39A 4OSPA 4NFSA 1SZJG 2Y05A 5JMWA 5CHEA 2Y0EA 5BSGA 3HN2A 1T4BA 5TX7A 3KSUA 2P5UA 3JQ9A 3QSGA 3DWFA 3WGQA 3PHHA 2YV2A 3KVOA 2IE0A 3TL2A 1YOVA 4LISA 4XYLA 1E3WA 3UCQA 4PG5A 2D3TA 1WDKA 4BOYA 3HNPA 3WWYA 4OKNA 3DZIA 4R41A 3RD5A 3NTRA 4CLOB 3KV3O 3W1VA 1ZEJA 4NPCA 3QWBA 4OGWA 4J7CA 1M76A 3DOJA 3C8MA 1WXDA 5IDXA 3QP9A 1RM5A 2Y0CA 1BWSA 3C3XA 3FNFA 3QVOA 4CM8A 4K1LA 3L4SO 2E49A 2H5LA 3OIGA 3ZZNA 2AXQA 3GPDG 3ROQA 4IDFA 2Z95A 3QA9A 4FFPA 5CDSA 4YJHB 4BKPA 2IZ0A 3MJTA 1NHGA 3BMCB 2H6EA 4AG3A 5KIAA 2X0IA 1MV8A 4Y67A 2OXIA 1WMBA 4XQCA 4UVDA 5KKAA 1GQQA 1NR7A 4JLWA 2ZYAA 2TMDA 3WGYA 3EVNA 5EMHA 1Y8RB 4R9SA 1DC3A 4YA6A 4D45A 1O95A 2PY6A 5ICSA 1NTOA 3EC7A 3ZHZA 3E82A 3JQFC 5DCYA 1X7HA 3VVBA 4WLEA 1ZK1A 3HWRA 4BO8A 4IXTA 4AJ1A 4E4YA 5C7LO 4ZQGA 4DMMA 1R4MB 2RH4A 3ZGYA 2YFQA 2W4QA 2X86A 5L95A 1X0VA 4XWYA 3UN1A 4W82A 1KEVA 4DTIA 4WJZA 1F06A 2JKVA 3F46A 4X54A 3LYLA 1L1FA 5DCUA 1T26A 3IJRA 3UGKA 3MWDB 5LC1A 3WYCA 3IKTA 1DFIA 4ALKA 4CLOA 4TRJA 1RP3A 2IYPA 4GMFA 4XR4A 3JQAB 1P9LA 1ZK0A 4R1UA 4NJOA 1LU9A 2OL4A 3N74A 4RF2A 3BIOA 4DIFA 1RYEA 1E1NA 2D8AA 2HUNA 4M55A 3V5NA 1GYQA 4RPJA 2HJSA 2YQ5A 3I23A 1P1FA 4E33A 1ZW1A 4K26A 4PLHA 3PPIA 2B4QA 3L0DA 1GCOA 4YJHA 2BMAA 3EZYA 4XD2A 4Z0HO 5FI3A 3GAFA 2GGSA 1M66A 3VPXA 3WMWA 1XYGA 4XDYA 3CZGA 1U2GA 1VJ1A 4IDEA 5L4LA 2PGDA 5AXAA 5C5IA 1R66A 4Q3NA 4DBVO 3QW2A 5TS3A 3ZCXA 1SB9A 4P22A 2VHZA 4RLSA 2GERA 2Z1NA 4NBRA 1SMKA 5JCJA 2VCYA 2C29D 3RJ9A 1LBEA 4YAGA 2VWHA 1NQOA 1WVGA 2Q99A 1EBFA 1F14A 2AMFA 3PWSA 1NPDA 4CM9A 3ROKA 1VL6A 3E03A 4ALJA 4FDAA 1U9JA 2BRUA 1C0IA 1E3JA 2AQHA 5G4LA 1PJ4A 1GAEO 5DCWA 1U2DA 3JQAA 5EQFA 2YY7A 2B0JA 3OJLA 1U8FO 4XDZA 3JQBC 3X2FA 3O9ZA 4D0RA 5G0SA 2ZJ1A 1R0KA 4KTVE 4FLSA 2XXJA 5BSEA 3ZI0A 4J4TA 1Y81A 3GVIA 4BO3A 1IL0A 4W7IA 3IP3A 3DXFA 3JD4A 4D3FA 2BLLA 3U09A 3GVPA 4BMNA 4CQLB 2DVMA 4ALLA 5IN4A 3UXYA 3ONEA 5LDHA 5KTKA 4UUPA 3PFWO 3LDHA 3MWEB 4ZU3A 2EP5A 1OMOA 2Q49A 4E31A 1Y5RA 1JTVA 1PWXA 1A9YA 1P1JA 1OZAA 4OSOA 1V6AA 1CEQA 3FR7A 4CMEA 3UICA 2ZB4A 3DHYA 3GEDA 1DHRA 6LDHA 5B12A 3ADOA 3KO8A 1M6HA 2EW8A 4LRTB 4XJSA 3ZU2A 3F1KA 2R00A 1P1IA 4P38A 3PJDA 2O3QA 1MFZA 3K6JA 3KB6A 3OP4A 3IDSA 1PEDA 3MTGA 3GK3A 4W7HA 3CZEA 1KVTA 3G79A 3TRIA 4J16A 5DP1A 3CMCO 1D3AA 3OQ1A 1ZBQA 1I3KA 4JCOA 2PH5A 4ZN6A 1LRKA 3I4FA 2DLDA 3QVWA 5A03A 1YS4A 3OFSA 4XYEA 4CQMA 2HKIA 1N1EA 3VC7A 3DB2A 4MIOA 4BO1A 1ONNA 1M6WA 3LVFO 4O5OA 2DAPA 2Q46A 4CMGA 3G1UA 1C0PA 2UV8A 1E77A 3D4NA 4RDHA 1I3NA 4CMHA 1Z7BA 2QQ5A 4GAEA 1ZZEA 4FCCA 4CXFA 3NAQA 2NQTA 1XG5A 1WPQA 1W8DA 4UUOA 9LDBA 2VWQA 3A9WA 3PHGA 4TRRA 3SC4A 1UZNA 4J0FA 2DUWA 2X6TA 1FDUA 1PTJA 3VZRA 1K2WA 2EKQA 2PR2A 1TA4A 5A9SA 3I5MA 4J2OA 4ZRMA 4I5GA 2IYOA 3T4XA 4AL4A 3UCFA 1GV0A 1VE9A 1VSVA 1C3VA 4DLBA 5KJFA 4BKOA 3OMLA 4E5MA 3O8QB 3RBVA 1E3LA 3M2PA 4J1SA 3GQVA 4RZIA 3I83A 5GMOA 4KOAA 3GDOA 4Z0PA 3W8EA 2HO5A 3AK4A 1DJNA 3FSRA 4PG7A 4R1NA 1MW3A 1NQAO 3CEAA 3SC6A 5THKA 3G49A 4CM4B 3IUPA 3RC7A 2Y0DA 1ID1A 5HWSA 2QRKA 4NZ9A 2CFCA 3H2ZA 3FTNA 3RU9A 4WEOA 4TQGA 1AN9A 2JCXA 3UEQA 4QXMA 1LLQA 2QRJA 1PS9A 4J7UA 4FBGA 1LC3A 2HMTA 3CZLA 5EINA 1N7HA 1E6EA 1B8VA 3INRA 2DUUA 1J0XO 1ZMOA 2BKAA 4R69A 3KLPX 3HB4X 1XLTA 5HS4A 1ADGA 2R2GA 3MJ4A 5JO9A 5BQFA 3BMQA 1LDGA 1XKQA 5L53A 1KC1A 2B69A 3TZKA 1I24A 3OJFA 3GUCA 3G1TA 4NJMB 1K0UA 2VHVA 2W2KB 3PHIA 4BGIA 1B8UA 1DRVA 4J3FA 3VPFA 3K92A 3PJFA 5AOVA 1V3UA 2PZLA 1BXZA 3CKYA 1WZEA 3KBOA 1GV1A 1PZHA 4EJ0A 1V3TA 2RHRA 5TSDA 5JXWA 2VTDA 2J3KA 2LDXA 5TNXA 3PZBA 4G65A 3LF2A 4KMSA 3NT5A 4K6FA 1Y7TA 5IXSA 4B79A 2AQ8A 2O7SA 3F4LA 3T0YA 2DBZA 3O8QA 4OKIA 4TSKA 4AJKA 3GNQA 1IHXA 3VZSA 2IXAA 5A02A 1JWAB 5IDQA 2VOEA 4RORA 3I1JA 1HETA 4Z3DA 4A5OA 1ZVMA 1AGNA 3QWFA 1XQ6A 3WGTA 4CM4A 1PGPA 4R68A 4YRDA 4BKUA 4E0BA 3PP8A 1M2WA 3HZZA 1ISIA 3UUWA 1VL8A 4N18A 1F17A 4NNJA 4E3ZA 3FR8A 5L7WA 1GD1O 4Y6RA 2NWQA 5C3MA 2BFPA 1J5PA 3F9IA 4M49A 3OIFA 3VTFA 1EQ2A 5B4VA 4FIZA 4MVJE 2X9VA 1VKOA 5DBFA 4R3NA 2JFHA 4J49A 3RQSA 4YWJA 2O3RA 1J49A 2P2SA 1LJ8A 2PH3A 3DZJA 4GL4A 1A7AA 3GLQA 4BGVA 3UW3A 5JAZA 1H6CA 2C0CA 5CDYA 1HDXA 3DMTA 3JQFA 4J2HA 3VPSA 4A7PA 1HSZA 1HYEA 2WYWA 4ALNA 1GUZA 3LC1O 4LSMA 5F5LA 4HP8A 5IZCA 1Q1NA 1A5ZA 3AFMA 4BNWA 3LF1A 4NR0A 2A94A 1N92A 4S1VA 4BO5A 4TRMA 7ADHA 5L51A 2VUSA 1UXIA 4U7WA 4WASA 4LCEA 4EUEA 1BDBA 4B7CA 4BUCA 3BYZA 5DDIP 1P77A 4HADA 1Y1PA 5A04A 1FDWA 2J5KA 1WZIA 3WG9A 3KEOA 2CUKA 3ZH2A 2BELA 2B4RO 2X8LA 3H9GA 4XEHA 3JTMA 4GKVA 1ULUA 3TSCA 4H15A 2I3GA 4Z9XA 4B4UA 3E6AA 3PJGA 1DIBA 3NGXA 2VYVD 4OO3A 4EJ6A 3FCOA 4IMPA 5G2OA 1PWZA 2D59A 1LXCA 1Y5MA 2J6IA 2A4KA 5JDCC 2WEKA 4BKQA 3VDRA 3FPCA 4N5LA 5CFZA 3RC9A 1K3TA 2EV9A 1E3IA 4PG6A 3IAHA 4Q3EA 3T7CA 4Z0TA 5AXDA 4BNTA 1LLDA 4YDRA 2EGHA 1CJCA 4CV3A 2D0IA 5JO0A 1PL6A 3K96A 4FLOA 4YB8A 3RASA 1EUDA 3KYDA 4C4OA 3EGOA 1WLYA 3DHEA 2GSDA 3EDMA 4BO7A 3GNTA 1U7HA 3ZU3A 3BAZA 3D0OA 3E9QA 1A9ZA 1XA0A 2PD3A 1SOWA 1SCUA 2O4CA 4R1SA 4TKLA 3I6IA 3W4JA 1U3WA 3I9OA 2QYTA 2PZMA 3CTMA 2GZ1A 2HRZA 2V6MA 1NYTA 2HLPA 1NFQA 3TFQA 3TDKA 1GPDG 4JXKA 5FFFA 3A28A 1KY4A 2AW5A 2W98A 4CUZA 1PZGA 3MJSA 1WMAA 3ICPA 4J4HA 4W4TA 3VH4A 3CH6A 5T57A 4L76A 3JQBA 1RM0A 4RLHA 4CMIA 1B26A 3D5QA 5T5QA 4QSMA 4CV1A 4MJLA 3OECA 5CDTA 2FOIA 4BB5A 3NGLA 3FPLA 1KEWA 2E37A 4ZQEA 2YV1A 4HNHA 3HDJA 1NPTO 4FPXA 1Q7CA 2VRCA 1A72A 1ZFNA 3DEYX 2O3SA 3W8DA 5CEJA 1VL0A 4FD3A 1P0FA 4J6FA 4CM7A 4CV2A 1BGVA 5KJ1A 3AJRA 5JS6A 3W6UA 3G17A 1PGOA 1GQ2A 3SJUA 4YYZA 1MXHA 3ITDA 3NKLA 4HBGA 2JD0A 1YB5A 4MINA 3WQRA 3DBLB 3WFIA 3PQDA 2GF2A 1N1GA 1B16A 4UVEA 3AI1A 3P19A 3VHRA 1CETA 4ID9A 1DIGA 4IQ8A 3ONFA 3GFBA 3S8MA 3I6QA 3DBRA 4BNZA 5DN9A 3ZWBA 1CRWG 1IHYA 4ESOA 2BFMA 2GN8A 4JK3A 1I2ZA 1TB4A 2QHXA 3ZWYA 1C1DA 1X14A 2D5AA 3HFGA 4B3JA 1OFGA 3ULKA 2B5WA 4I9HA 2NLOA 1LSJA 1XDWA 4HY3A 3GEGA 4MKRA 1DLIA 3UH1A 4ZHSA 4XYGA 4UEJA 4XGIA 1MC4A 2CVOA 1OC4A 1LNQA 3NX4A 3GEMA 2QZZA 3ZW8A 8ADHA 1UDBA 4LVUA 1Q2XA 1ADBA 4L4XA 4A0SA 2X5JO 4I08A 3DDNA 4L4SA 3AUTA 3JQ8A 4JJIA 5K6AC 2V6FA 3O03A 1BSVA 1P44A 5EESA 4Q3DA 1HRDA 4J1NA 4O1MA 1QG6A 1Q7GA 4FLRA 3H4VA 4FN4A 5A05A 4IDBA 5EIOA 2G1UA 3E9MA 4PZCA 1ZEMA 1BRMA 2A9FA 3CUKA 4YBZA 4B8ZA 3D3WB 4LUPA 1QXSA 1P33A 4IDCA 3DBLA 5CP8A 3UCEA 1UJMA 5K9ZA 4E2WA 1DLJA 4YR9A 4R5HA 2EGGA 4WOKA 1JU9A 4WCDA 1NQTA 4YAKA 3F5SA 1HDRA 3WBBA 4UEKA 4XCVA 4IBOA 3ZWVA 2XXBA 1KY5A 3WGOA 1F12A 4PVCA 2VHYA 2DPHA 1HT0A 4RCVA 4AJHA 5T64A 2BI7A 1R16A 3U4HA 3VKUA 3T7EA 2IZZA 1SAYA 2OGUA 2WMDA 1QRRA 3TZQA 1VRWA 4GX0A 3WIDA 4CLHA 5I7EA 5IG2A 2C59A 5HBRA 4E30A 3RWBA 4FSHA 3IUSA 4DA9A 5JDIC 3E8XA 3ICCA 4BO2A 4CMKA 2JFFA 2C54A 4YJFB 1VKNA 4MP6A 1ADCA 4BNVA 4W99A 4D79A 1H6AA 3QWAA 5DOVA 1NVMB 4AJJA 4L8VA 1FDTA 4GGPA 4R16A 1YB4A 1PR3A 3BMOB 3PLNA 1YJ8A 3DZBA 3WMXA 4ONEA 2GO1A 4QO7A 4XQ9A 2Q2WA 4LRSB 4QUKA 3C24A 4J43A 2C5AA 4CPDA 5HTOA 3UOGA 1G5AA 1T2EA 1LRLA 4MVJH 1OOEA 1PQPA 2EP7A 2DQ4A 3LT2A 2J5RA 1HLPA 4KUGA 1DC6A 4XB2A 2HDHA 2YJZA 5G0WA 1O6ZA 3QQPA 2GN6A 2PZKA 4E21A 4N7RA 2OZPA 4DGSA 1HZJA 3KM0A 3RFVA 1EBUA 3VZPA 4N5MA 3IKVA 4B3IA 4WNCA 1MX3A 3KTDA 4CM3A 3NJ8A 1LI4A 1ZSYA 4D46A 5CPBA 4DMLA 3MJVA 1K5HA 2FZEA 1JAYA 3QIVA 3SBOA 1HYHA 1HEUA 1SC6A 1XU9A 4RVFA 4UUNA 3K2EA 3KYCA 5HRUA 1F8FA 3QJ5A 2Q1SA 5TT1A 1ISHA 3OH8A 4IMRA 4PFJA 3U62A 2XOXA 4OXNA 2W8ZA 4NG5A 4BNYA 1NHWA 2QG4A 2AG5A 2HAEA 4RL6A 4HFMA 2BGLA 3ZNQA 5F1PA 2OFPA 2X23A 2JD1A 2ZK7A 1DSSG 1JAXA 3U9LA 3BHIA 3GG2A 1GU7A 3JD2A 4JBGA 4TVBA 4BNUA 3LLVA 3A1NA 4PZDA 1RM3A 4U0KA 1PJLA 3BMOA 3RFXA 3TN7A 1X1TA 3TOZA 4BO0A 3AY3A 3NJ4A 4EDFA 5JPIA 4CLRB 3RUEA 5I9MA 1U1IA 3GPIA 3B1KA 1DBVO 2Q1UA 4YEDA 3VZQA 4J7XA 4URFA 1EVZA 4WNIA 2DPGA 2PA3A 5IN5A 2H63A 3U4IA 1MW0A 1BVRA 2VTEA 3W4IA 1E7MA 4IZHA 1BMDA 1ONOA 4F6CA 3Q9UA 4AJIA 4I5EA 5LDGA 3TQHA 2AEMA 1L7EA 2GN4A 4DPLA 1QR6A 4ND2A 3X2EA 3ZV4A 4HFRA 5CDGA 1XEAA 2P9GA 5B1YA 2VZ8A 1T2FA 1IOLA 1JKFA 5CAEA 4BKRA 3ON5A 1Y8QB 4RQTA 4UUMA 5BNTA 4ND4A 4BNNA 1GY8A 3QWIA 3UVEA 3WQQA 1LX6A 3DOCA 4TROA 3BMCA 5ER6A 5H81A 4ALIA 3OM9A 2ZATA 1EVYA 4ITUA 3OJEA 5I8WA 1KVUA 1H3LA 2O50A 5JDCA 3TJRA 1Y8RA 2V7PA 4E5PA 2VUTA 3OHSX 3ZV3A 4D41A 1HSOA 4BVAA 4YPOA 2GZ3A 2PGJA 4RZHA 5G4KB 3JQCA 2Y1EA 4IUYA 1K6IA 2G76A 1E3EA 2VUUA 3DZGA 2GYYA 4BGUA 3WSVA 4UVGA 1R4MA 1A27A 5IDYA 5KVVA 1H2BA 3SEFA 3ZWXA 1IE3A 1WDMA 1BXGB 4KZPA 4R51A 2PGLA 5JE8A 4MVJP 3WXBA 2Z1MA 3ZU4A 4IS2A 3ZWNA 2ZYGA 1EQUA 4MVJF 4MVJD 2Y68A 3N7UA 1IULA 3IL2A 3TZHA 2DFVA 2O48X 4FOSA 5EPOA 1JA9A 4F3YA 4QECA 4DWVA 3L4BC 4HWKA 1A71A 4EUFA 2B35A 1XQ1A 1YRLA 1LTHR 4PG8A 1C0KA 4O0LA 4KP7A 5J23A 1ZH8A 1UR5A 1U8XX 4BIIA 2FSSA 1GR0A 4WLUA 4GSKA 1H6DA 3CIFA 4WPGA 2HK9A 3FD8A 3OICA 1X0XA 4YAEA 2HJRA 4L74A 2GDZA 1D1TA 3PDJA 4JGBA 5EN4A 4MP3A 1E1MA 1ML3A 2GN9A 5DULA 3M6IA 4NBUA 2FWMX 4XGKA 3LK7A 4XIYA 4S3MA 3PQFA 1MG5A 2YHUA 1HLDA 3R3SA 2BF7A 1O5IA 3C1TA 4LK3A 2P91A 4W9NC 3H9JA 1B7GO 2J5QA 2Q45A 5DBGA 1YL6A 1IYZA 5G4KA 2DC1A 2NV6A 3QE3A 1NPYA 1X1EA 3L9XA 4M87A 2D2IA 4BO4A 3JD3A 5ES3A 1NWCA 3V1TC 2HMWA 2WYVA 3JQ6A 5C7OO 3D64A 5ILOA 3S1LA 2NNLD 1BXGA 1ENPA 3EHEA 3JSAA 3COSA 1IUKA 4EEZA 1SNYA 2AQIA 5A4DA 5L9AA 1PJCA 3I9NA 1I33A 3ZWPA 3HADA 3JQGB 3OA2A 2RH8A 3JV7A 5ENVA 4A10A 4DC0A 1K6XA 3OIDA 2X4GA 5G0TA 2WE8A 4FR5A 3VPHA 4H16A 3PQEA 4ROSA 3PZRA 1PR9A 5BSHA 2WD8A 2OORA 4MIEA 1LSSA 5I9LA 1GCUA 4G81A 2E6UX 3ZNPA 1EUZA 1U7TA 4CQLA 5KJ6A 3AM3A 2ZTUA 1D1SA 1B3RA 1EFKA 1GEEA 2HK7A 3GGGA 3Q3CA 5KKCA 4RVSA 4WOJA 3JYQA 3OETA 1DRUA 1GDHA 1PSDA 3D3EA 4GVXA 5CG2A 1V0JA 4ZGWA 3RVDA 1O9BA 4GBJA 2Y1OA 5K6AA 3LT4A 1DXYA 1HXHA 4TZKA 1ISMA 1C14A 4FFLA 2FHSA 2WYUA 3GDGA 4CMJA 2EKLA 1YWGO 2NTVA 1EE2A 1TEHA 4J1QA 5GZ3A 5ICMA 5COBA 3OQ6A 3B20A 1YE3A 2EG9A 4JX8A 1WDLA 2V6GA 4IDGA 1B8PA 1MFPA 2D5CA 1I2BA 3OEWA 3C7DB 4DREA 4OOFA 2JHGA 4YXFA 3B1JA 4J0EA 4INAA 5FI5A 4N54A 2Y1DA 1C1XB 4QT0A 5KWEA 3MCVA 1N9GB 2NTJA 2I99A 3EY4A 3QWHA 1IPEA 1WNTA 2UDPA 3ZWOA 3H65A 3WOHA 1SOVA 3HHPA 4DIOA 1OBFO 3INTA 4GWKA 1PGNA 2CDCA 3AUSA 1ADFA 2HU2A 3JQGA 3NV9A 1YDWA 4PVDA 1DIRA 4HUJA 3OA0A 4O59O 4WGGA 5I8ZA 1B3BA 1NVGA 2HQ1A 2QIOA 5TGDA 1ORRA 4CLDA 2QX7A 3DAPA 1R37A 3KOUA 1FDVA 4NK4A 4R54A 3E5RA 3ZV6A 2HCTA 3R0IA 1GADO 3QLJA 1CQJA 3DTYA 4P8RA 1X15A 1PZFA 1P31A 3OQBA 3B1FA 2G0TA 1BHSA 5JDIA 3EK2A 4NQWA 4K28A 4U5QA 2ZB7A 1NP3A 1HE2A 1ULSA 4RQUA 5COQA 1J4AA 3A4VA 5JAIA 5DNAA 4ZRNA 3R3JA 3WGGA 4JQCA 3DTTA 2DBQA 4QO8A 1CWUA 3BHMA 3DZHA 3FNGA 2AEFA 3K31A 2JAHA 1MXFA 1YXMA 4JBHA 5L3ZA 2P4QA 1EDZA 3RU7A 5F1OA 4IJKA 1MW2A 1UZMA 3NYWA 5GZ1A 3JQ9C 2B5VA 2VWPA 4L4RA 1DJQA 4IQ0A 3PTZA 3D4PA 4B8WA 3ENNA 1EK5A 3PYMA 4JBIA 1C1XA 3AU9A 1VC2A 3IMFA 3M1LA 5F3RA 3AI3A 4CL3A 2X7HA 5L4NA 3H3JA 2QYSA 2YW9A 3LT1A 4FJ1A 3DAFA 1PQUA 2ZIZA 3GC6A 3AU8A 5L45A 3CZKA 2O7QA 4KDEA 1D8AA 1QV6A 3WWZA 1MB4A 4ZD6A 1N2SA 1KBZA 3Q6IA 4EBFA 5A3JA 3H9QA 4NFYA 2J3HA 2P4HX 3H5RA 4NDNE 1JW9B 2DTDA 3WNVA 2DU8A 4FQ8A 5I7VA 4D43A 1S46A 2O2YA 8LDHA 4GVLA 5LCXA 2PNFA 4HXYA 4NJMA 4DBZA 3H3FA 3IC5A 2W2KA 5A5EA 1E7RA 3MOIA 1I3LA 3PYXA 2G5CA 2RBEA 3FRJA 5F21A 4AJEA 3TNLA 3AY7A 2EWMA 3WX0A 1U5CA 3L6OO 4A73A 2VYND 3JYLA 1BW9B 2J8ZA 5CEFA 2Q2QA 2XPCA 3RFTA 1LSUA 4L0QA 3PFFA 4YRBA 3ASVA 2YHIB 4PIVA 4KDFA 3DZKA 4GWGA 4YJDA 3WQSB 2GRAA 3K73O 3VVCA 4G5HA 3U3XA 2Q4EA 3ROPA 1W6UA 4YT2A 1XCBA 3GHHA 4IS3A 4L9RA 4BV9A 3AUAA 3ZNNA 2FR8A 3N58A 3RIHA 4E2YA 1T2DA 5TJ9A 1XSEA 4RPHA 4CV0A 1QLJA 1PGJA 4W6ZA 1QYVA 1DFHA 2ZTVA 1UXGA 1YL5A 4TWRA 2Z5LA 5JNLA 5KCZA 4D3DA 2AHRA 1I32A 3QVXA 4P4LA 3Q0EA 4Y98A 1UXJA 4CMAA 5I9NA 4WCFC 3GFGA 3BMNB 3BTSA 1YH3A 4GKBA 4UEOA 4M89A 2FPGA 3TWOA 4XQGA 3WBFA 1HKUA 1C0LA 4BNGA 5L4SA 5MDHA 3WGIA 3CE6A 3KEQA 3MTJA 3RC2A 3RKRA 4ND1A 4BO9A 5JYEA 1Z7EA 4FFMA 4TMFA 2OHXA 5DP2A 4CM6A 1DC5A 5T6BA 2HRBA 1ARZA 1LRJA 5C37A 5HM8A 3F4BA 1A4IA 4DLAA 4IY1A 2CF6A 2BD0A 2D4AA 3Q2KA 1E7SA 3AM4A 1KERA 4FFNA 4NFHA 3E1KA 1BW9A 1U3UA 1QYDA 1YQXA 3PIDA 5I7SA 5ITVA 2GZ2A 4YTEA 2CF5A 1DAPA 4AJ4A 1CDOA 3IP1A 3UAGA 4Z9FA 5IZ4A 4E5NA 1ZMTA 3ADPA 1B0AA 3D7LA 2PTGA 1U28A 2YDXA 2PZJA 4WLNA 3DO5A 5KOIA 3ST7A 1K6JA 2C2YA 4M54A 1JGIA 1HTBA 4XIJA 4U0JA 2TMGA 4WLVA 3D4OA 1IZ0A 4JP2A 2DM6A 3PEFA 3LT0A 4Q3CA 1I5RA 4P4GA 4YT4A 2Y93A 4Q3AA 2VWGA 2PLAA 3H9EO 4CMCA 1E92A 3L6DA 3DR3A 1DEHA 1XU7A 1P3DA 2EJVA 2VYVA 3FHLA 4DLLA 3Q2IA 2O3UA 4JP3A 2C07A 3VH2A 3WLFA 4J90A 3WJAA 1XR3A 1LA2A 3GRPA 3U49A 1ZNQO 2P9CA 2C2XA 1KVRA 1S6YA 1I36A 1MGOA 4E6PA 1VI2A 4II3A 3GGPA 3HDYA 4UAGA 3V8BA 5BNIA 2ZQZA 2PK3A 1SPXA 1G6KA 5IFLA 1ISJA 1YQDA 1VM6A 2UVDA 2OUIA 3C1AA 4O6VA 1E3SA 5ILGA 1MC5A 1G0NA 5T67A 1PL8A 4CMEC 4O63O 1MA0A 3VH1A 5JW6A 2GUGA 2GASA 2ZCUA 3DBVO 3VTZA 1GPJA 2VNSA 2XAAA 3NDIA 4QFDA 3WGZA 4BV8A 2R00C 4RO0A 1PU2A 1U3VA 4RF4A 1KC3A 1NNUA 2IEBA 2ILTA 4II2A 2DKNA 1HE3A 4GMGA 1BXKA 1F8GA 1ZK2A 3ABIA 1YBVA 3K30A 4CM5A 4E13A 4HV4A 4J1TA 4PLYA 4U8GA 4WKGA 4JNKA 1R4NB 1EVJA 2X22A 4MIYA 4MVJM 4MP8A 3ITKA 4XYMA 3I3OA 4DPKA 4ND3A 5IF3A 5MGBA 1GZ3A 3L07A 3WIEA 2A92A 2WE7A 4G2NA 2BGMA 2NM0A 4JROA 4RPGA 2I76A 1E0DA 3VOSA 1QLHA 2PD4A 1N5DA 5DT9A 4PLTA 4UVHA 3HFSA 3RCBA 7MDHA 3AY6A 1XELA 3B70A 4OM8A 1NWHA 3GDFA 3OSUA 4RGBA 1DC4A 2WDZA 2W2LD 5KJEA 1PJ2A 3PLRA 1DPGA 4WECA 1KEPA 4Y8VA 4ZQFA 3AUUA 1LDEA 1LLCA 2BFOA 1ENOA 2RCYA 2C82A 4ZQHA 3UKOA 2FPPA 1Q0QA 1YKFA 3GG9A 4B7XA 3MEQA 3GVXA 4I9UA 4LMRA 4RVHA 2ZKLA 2GD1O 1AXGA 3PHLA 2WTBA 4A26A 4C7JA 4XRGA 5L7YA 5L7TA 3C7CB 3SVTA 4KQXA 2VN8A 1YOVB 6ADHA 4DXHA 3U0BA 1E3WB 1E1LA 1M67A 2AE2A 2AEJA 3GMDA 2Y99A 3D1LA 2C7GA 2E48A 4KQWA 1E5LA 4HNGA
chains in the Genus database with same CATH superfamily
4LQLA 5C7YA 4BP9A 1GT91 1MLDA 1NXWA 2Z04A 3DPSA 4MQ4A 3VO1A 4C3ZA 4CLEA 3X44A 5AW5A 1OSNA 2PKQO 1I13A 2NYRA 2XB9A 4CM8B 5BWMA 5KQMA 5IJXA 3GRFA 1BDIA 5B7QA 3IQIX 1FK8A 1LD3A 4I1YA 1ZM3A 1T8YA 2NVBA 5B4TA 4B3TB 1ZO8A 3FW1A 1HC7A 4D9MA 2DFDA 1MEEA 1ECJA 2X6QA 5T4BA 2X0NA 1J97A 1WY5A 3FBTA 3GZ4A 1OWMA 4TZTA 2POQX 3DZ8A 3I9LA 2BZGA 5K1ZA 5IEJA 4R5MA 1MKYA 1OCEA 1CUHA 1P6UA 1YIOA 3HC7A 5LB4A 2QOEA 2GCPA 2BTOA 3KTAB 2VBFA 5TB5A 3ZXIA 1XX6A 3CZ4A 3IUJA 3ZWCA 3RAPR 2AZMA 2LIVA 1ISGA 1E3TA 1E6WA 1VIAA 2R70A 1PFUA 1TYBE 2ACKA 2YWDA 3D3WA 3ELDA 3IOYA 1YRQA 2Q0HA 3BCUA 3LDAA 2PX5A 1N2IA 1L5QA 3Q5DA 1XCJA 2Q1TA 3HJAA 4O4JA 5T3UA 2NQ2C 5AVVA 3CPSA 4F06A 2DLCX 1A5SB 4MQ5A 1F6DA 1KIFA 1EWTA 3GARA 1SEPA 3RKUA 2ZTHA 4E5YA 2DPLA 4I3GA 2YASA 4XX0A 4UARA 2Q9AA 5EEGA 3P2OA 4NNOA 1N75A 5DW3A 3B3AA 4MWCA 3DQPA 2ZXGA 1ZAKA 2V6BA 1FRNA 4TTTS 5FBQB 3V1KA 4EHKA 4QDOA 1ZKMA 4H27A 5D7BA 4UM9B 1EXNA 1ZSNA 4I6JA 2J3IA 3NJRA 2GLTA 1FFSA 1Y6RA 5G1NA 3SYMA 4XW2A 3O26A 3U16A 3KR1A 3A3NA 3IBTA 1FF9A 4U7TB 5DEIA 5BWLA 3U44A 2E4AA 5TEVA 2JHFA 3EA0A 1GZVA 2UUPA 4KHZA 3RWOA 1P8AA 2JHPA 3VX3A 2FSVA 1I7LA 5ER9A 3IJPA 4BVHA 1GL3A 4IDHA 1JIJA 1KQGA 1NMSA 1MW1A 4C7KA 1DKUA 3F3YA 2VK2A 3AY0A 3GJ7A 5CB6A 1QE5A 2PXHA 1ECBA 1RAEA 1SGWA 3OU2A 4Q37A 2XCSB 1JVNA 2GLXA 3PKZA 4U6QA 5EQTA 2CL5A 2YFHA 3JZFA 2FSHA 4HDMA 5LZ9A 3E81A 2FZLA 3F74A 1A7KA 5BSKA 1JJBA 2DTEA 3BTVA 5DSTA 1FXWF 1XMOB 1JSCA 2C58A 3WVNA 1ZH2A 1O94C 3F3KA 4P4UA 1FCJA 2LBPA 4URYR 1OI3A 2ZBVA 2Z58A 4G4SP 3FBGA 1NJ8A 2LV8A 3HXQA 1T36B 1RYHA 5CFOA 3ZGZA 4O8ZA 5GV8A 1L1QA 2PBLA 3PCXA 3TKLA 3AI7A 3DFFA 2N0SA 3DT6A 1KEEA 1N7JA 2EFYA 2HDNB 3E1GA 3G5UA 1GKKA 1KYWA 1BOFA 4HNAA 3D5TA 4C5BA 5JCJD 2PD6A 3IQGX 3OSZA 1W44A 1VIYA 2GFQA 5EMNA 3A4YA 5IZCC 4IXWA 3ZTYA 5K01A 2P6OA 4B2IA 1C7ZA 4ZHQA 1NVDA 3PT9A 4K46A 2O6LA 4KXLA 1JH9A 4UTPA 3L8GA 2O7GA 1FMCA 1JXAA 1RKUA 3OCXA 5TPZA 3V33A 3PI6A 4LKRA 1E6UA 3RFFA 2CXSA 3W5HA 5IBPA 2QBYA 2HK8A 4H1VA 1M8JA 1SZCA 3OO0A 4HRAA 1BX1A 4BCDA 1U3DA 4YJGA 1U8YA 3CSSA 3GD5A 3VYTB 2GLUA 2TRSB 3HI4A 1OAAA 3JQAD 4IEEA 2QTAA 5AHKA 3MLAA 3UHFA 3J81A 3VDQA 2R97A 2XCIA 3T12A 3VR3A 5G1OA 3W34A 4WCFA 1SD2A 1YTUA 4JQYA 3P0EA 3BA6A 4QUGA 3UT0A 3TRDA 4EJSB 4IZIA 4IHKA 1SXHA 3SX4A 1D7OA 2W83A 4Q9DA 5FIUA 3DCIA 2NUTB 5JSYA 3AIIA 4C6TA 3ORSA 5CLFA 3FWNA 3SY8A 1W48A 2FEWB 3BREA 4CG3A 1HZZC 2XQIA 5J2UA 1EU1A 3UJ7A 1J99A 1OWLA 3ONNA 1XF9A 2OE2A 1TT7A 3GOQA 4IH4A 4URVR 2N3ZA 1JHOA 4ALMA 5T4EA 4KQ2A 1MX5A 3ENZA 2Z56A 2NXEA 2O57A 2OHFA 3LYUA 4I1IA 4YONB 3ROMA 1YDGA 5AFSA 2JFXA 4R5TA 3ZVKA 4C7MA 3OEEA 2JBHA 1FYEA 1Z4IA 5KOJA 1ENZA 4FXPA 3C1OA 2ZRAA 3VSCA 4XO3A 3O94A 1SH7A 2BM0A 3CRW1 3LUHA 3NAMA 2ZCJA 3QU4A 2GESA 1ODJA 3FJYA 1GQOA 4IW3B 3C6YA 3RSLA 4D3SA 1XWFA 4NEGA 3HNRA 4WUVA 4OGGA 1VG0B 3RIYA 4RJKA 3P2YA 5F33A 4XJVA 3BF7A 3AGPA 4KAFA 4DLVA 1IIBA 4PYMA 6GPBA 4K6KA 3HSKA 1SC5A 4P4NA 2XNJA 1QV7A 3MZ0A 2Q7XA 3DHNA 1VYHA 3DE1X 3F6SA 3LLUA 4MUHA 3OY2A 3PUUA 4NCNA 4BQPA 4HS9A 4QPEA 1FTYA 5CXXA 3TM4A 3CLSC 2C3UA 1PJ3A 3TXXA 1T34A 3AVQA 3K20A 4LZOA 5DNVA 5EUQB 5KYTA 3NBKA 4CDRA 4DCCA 4D44A 4DRZA 3H7AA 1TYAE 3V80A 4L2LA 1WR8A 4ZT5A 1EUCA 1ZXLA 1K8XB 1VPDA 2Y3IA 4S1TA 1PG5A 1OBOA 2XVAA 2FN3A 3B9PA 3GP8A 5HQ3B 1OR7A 4YXWD 4OQ4A 4ZANA 4YHHB 2ZU0C 3IHKA 4AJNA 1H2EA 4BE4A 5F4ZA 1YJ5A 4GOXA 3D43A 3Q3JB 2XOEA 3JAKB 1PT6A 3EYAA 1NE7A 3VPDA 1D4FA 1QZZA 2BCGY 4QUIA 4WI1A 2PEZA 4L3OA 1EX6A 3TEFA 3GELA 4U02A 4F8YA 3EGEA 5KYWB 4F5WA 4PF1A 4AD8A 1GNPA 4KO4S 5IUJC 1M34E 3L9WA 2H8GA 2R5WA 4XR9A 2BDUA 2AWOA 2OMEA 2PKCA 1LH0A 1Y1RA 1DRKA 3NONA 3FLBA 5D1HA 3JQEA 3IEMA 2BTEA 4HX9A 5A9SB 1R6DA 3NVKI 3K1AA 4GDMA 2P30A 3QK7A 1FZTA 1AUOA 2G82A 2VJYA 1Q0HA 2C5ZA 1D2NA 3GAAA 3PENA 1JJVA 3EUWA 4G1MB 1NFRA 2HA5A 2J9ZB 4BRWA 2I9PA 3PC8A 2R3SA 2BW0A 2AMVA 2HRQA 5K0BA 2JCVA 1IXSB 4GLLA 3SKVA 1WPGA 2JAPA 1KS9A 4F72A 1PJSA 4NE9A 3RRFA 1IBRA 4DMHA 1MN6A 1FRQA 2W6JA 4YCLA 3RSZA 5J9FA 221PA 4QBIA 4DG8A 4AJPA 2FAXA 1XVLA 2JJYA 3AZOA 5JZOA 1NVFA 1FY2A 3GN2A 4QJ5A 4EX6A 3DS8A 1LSOA 2CCKA 3K8YA 1W9HA 4J0JA 1UBKS 3O4FA 5CT6A 4H0FA 2O0JA 2ZRFA 2C94A 3HGMA 4QWMA 4MYCA 4Z4EA 2DFPA 3JQRA 4R1PA 3Q72A 4TKMA 3QKSB 4H3VA 3N59A 1G59A 1LI7A 3WYBA 2ECQA 4FDVA 2ZIFA 2Q3EA 1M0SA 4HDNB 2CXRA 4DFDA 2Q28A 5TF0A 3WK6A 1FJHA 2AS0A 1PV2A 1YHYA 4DJTA 1R15A 2PFSA 1YJCA 2NO4A 2V7QD 3KWJA 3L4KA 3VHLB 1T5LA 4AY2A 5BN1A 5BO5A 2RJ3A 4BUJA 2ZBUA 1G5HA 5J2TB 2IPLA 2Y67A 1YVDA 1GN9A 2CHGA 4GSLA 2WD7B 4P93A 1YB1A 1B73A 2FP4B 5CM9C 4AJLA 3Q1KA 4CYMA 5E6SA 1VL2A 4UDXX 1W36C 1NLUA 2Z57A 4P08A 2AE1A 3LLSA 4PY2A 2GVDC 1BAPA 2ZVQX 3LPCA 3CZ9A 1CQIA 5LM3A 1MG0A 1IUPA 1N8KA 1WZNA 2ZRMA 3FOAA 3LS2A 4KAAA 4EY5A 1Z74A 2Z8YA 3CSUA 3U7HB 2JBWA 2CBXA 2NVWA 3ETEA 1T4MA 3T3HA 2KHZA 2NU8A 4WNYA 4TGLA 4B3CA 5JYDA 4X9XA 3FN4A 4U00A 3IRVA 1RAAA 1GEGA 4FMCF 1HM5A 4K5LA 4YT5A 1UDAA 3AZPA 3V97A 1VFPA 4X2UA 4G0ZA 4J9VA 1U0RA 3HQ4O 5FI0B 5LXTF 2D0OB 2I6TA 2VZ0A 6REQB 3T6KA 3CB4A 3M6FA 4ID3A 1QDEA 1T1JA 4IIDA 3RAEC 2VRNA 1H2FA 3CINA 3SS7X 1KZGB 3JQ7A 4YMIA 3TTYA 1QIIA 1BJRE 5CFNA 1JQ3A 1TC2A 4G0QA 4BVJA 3BBPA 2JLAA 1V4VA 4GPIB 1IDN1 1RPNA 5T8KA 3IOBA 4G5RA 3R5TA 1N8TA 1YJXA 3JY6A 2EARA 3RROA 3VKVA 1BN6A 5IFKA 4AZSA 5JYCA 4CLXA 2HMVA 4KUHA 3PX7A 1M72A 2C20A 2G83A 1OWOA 3LWZA 1ZMXA 3FNQA 1G8HA 4AYWA 5AW9A 1Y3FE 4ML3A 1AQYA 5ADVA 3SQXA 3BGDA 4C78A 3PG5A 3WGJA 3H97A 1PWHA 4U2DA 4F2WA 3VPBA 4ZXFA 5GJCA 1KI6A 2E55A 3AESA 3N28A 4WESB 3ASUA 3NBMA 3U31A 1R0LA 3LZ6A 1SXJB 1Z36A 1G20A 1NTRA 2O0LA 1P0QA 5IYZB 1T10A 1XZDA 4YJKA 4EG7A 4OJNA 4LSWA 4MVCA 2PL9A 3KZVA 3LC2O 1DQZA 1QO9A 1E62A 1EUYA 4OK5A 1PS0A 3LX8A 1K8YB 1EK6A 4OOEA 1TT5B 4QUHA 2PKXA 1WUJS 5LUBA 4FT2A 2JW5A 1W5FA 2ZE5A 4WZBE 1H2HA 4HWGA 2EW2A 4L73A 1KQNA 1E2LA 1FSSA 2O23A 1X1BA 2BP7B 1X7DA 1YZQA 1TD9A 5K0CA 4UBJA 4WERA 4FB4A 5HDQA 3CB2A 4G5GA 4PBRA 4UREA 4TL9A 2VJMB 1OFUA 1H5QA 2GXSA 2HIGA 2R751 4ZYYA 5HVNA 2WF6A 3O2SB 2WHXA 2H4ZA 5HGJA 1QB7A 4M1KA 1DMRA 2H3EA 5AOBA 2QYHA 3DKVA 1AXEA 2GM4A 4D4LA 1JLLA 2R7KA 3R20A 4GXQA 4WZ6A 2GRJA 3JVVA 2ZJ0A 1QORA 1WXQA 3UWSA 4E5KA 2RHLA 2QRGA 2X7XA 1WKVA 1NVTA 1ZP6A 2I29A 4YJ2B 4Q19A 3T7DA 4M98A 4AP6A 3D6HA 5K7SA 2HW8A 3G85A 2B6NA 2OD9A 1W47A 2GKSA 3R0XA 3SJZA 2QLMA 3ZBPA 3QPBA 1Y9EA 3WHPA 5IANA 2FPUA 3CZRA 2D6FA 4QIHA 1EIZA 1NNI1 3GZNA 5C1IA 2NPFA 4ZZIA 4S24A 1DZ3A 2REBA 3C3WA 1V3VA 3COZA 1J56A 3IIMA 5E7IA 5FBWB 4OQPA 1MW8X 1T25A 3H0EA 1E2QA 2GXUA 1MVOA 1EVQA 5EV7A 1FEZA 2YZ7A 4MLCA 3T8YA 2GK6A 4L5YA 1U0LA 1JHDA 4COKA 1SCUB 4Q93A 4JL6A 2QZSA 2J9FB 2BHTA 1CYDA 1KAHA 2AN4A 2FSUA 2R7LA 3MUFA 5EXDA 3MBKA 1UQUA 1GN8A 1R0XA 2I33A 2AJDA 3L6EA 1YL7A 2WPGA 2BMFA 4XIGS 4KIWA 5BV0A 5HZMA 5ALOA 4NBSA 3W4KA 4BHTA 3K0SA 3I9JA 3N5KA 3QOXA 4GPD1 3DD1A 3K1ZA 3CR3C 1QFMA 1UIMA 3PDUA 2VZ9A 1C7QA 1K75A 1M1YE 2C5EA 2XD9A 3DGFC 3N2NA 5HNFA 5HF9A 4QUJA 5I7AA 4QQNA 3O3NB 4LXQA 2RAFA 4G5XA 5AXBA 5TF4A 4ZX4A 2BDEA 3O75A 1I6WA 3EXIB 2GCGA 1RAIA 3VC3A 4ER7A 2O8FA 1M10A 3BDAA 3CUEF 4GX5A 1ADJA 4YS6A 1RAFA 4LJ9A 4ZYXA 3SZUA 3DEFA 5BVHA 2CJWA 3ETDA 3N2GA 2AD5A 3SI7A 2ZPUA 3EQZA 4HD8A 4J3BA 3ZN2A 1U2GC 2XMPA 4MS3B 2EF0A 3L7MA 1Y9DA 2CMDA 2PGAA 1ESDA 1YJQA 3MWLA 3RIXA 4FYMA 2QVLA 1OYWA 4HB3A 4KTTE 3SX2A 1HFWA 1UDCA 4RWEA 3ZCUA 5FR1A 2ZM6B 4G85A 1ZCJA 3L18A 2EZ8A 1EKXA 2W22A 4WA8A 4DQUA 5K0GA 4OGLA 2I78A 1ETHA 1WL8A 3ENQA 4YRIA 2V98A 3H87A 1RLIA 5T4FA 3IEPA 2PUSA 2FHPA 2P4EA 4AJOA 4RY9A 1MNAA 1UKEA 5JIBA 3HKBB 4AWBA 3MA0A 1ZVVA 4Y3UA 3S0JA 3UEOA 4D7AA 3A14A 1J9ZA 1RP1A 1FJ2A 1MJGA 2V65A 3DMYA 2XECA 3ICEA 2ZFUA 4MUXA 4ZAGA 3GH1A 3JASB 3E2PA 3AP3A 2VT2A 2W48A 2UAGA 1UJ6A 1XXLA 4P82A 1R8JA 2DULA 3H2SA 4YV0A 3ITEA 1QGUA 1PJAA 1XRNA 2CD9A 1JJFA 2VKQA 3PRJA 2PWAA 2OO5A 3UWMA 1IDOA 4N5NA 1M0EA 3NUZA 2Q1WA 3E48A 3UH0A 1GFZA 2J0EA 2A6PA 2I66A 3D7RA 4S0XA 5ECGC 1GFIA 3TS1A 5KNDH 4IQGA 3U5TA 1X7ZB 1U3TA 2QVCA 2J9YB 3TE6A 821PA 2H9IA 4WZAA 2IEYA 3RTAA 2C4VA 3MAGA 2QQ0A 3FZEA 1CYEA 1L2TA 1XZAA 3FNIA 5BR8B 4RXMA 4C0XA 5D86A 2ZW9A 3ROEA 1QP8A 2F00A 1KDRA 1CU1A 2RMKA 4PLGA 3WAKA 4D9HA 4DCPA 5BSVA 2JPDA 2QPTA 3WDSA 5C8YB 5DU2A 4HNVA 5FPPA 4MUAA 1IWPB 1KI9A 5CFRA 1GOTA 4HH4A 3KNZA 3JQ8B 2CXTA 3LH5A 3PITA 4L27A 4TSFA 2B1IA 3UC9A 3G8AA 5BRAA 4MMXB 1WQ1R 5CFQA 5ADHA 1UC9A 4JBWA 5DSXA 2PFKA 3LP6A 5ED0A 2O8DA 1Z6GA 3ID6C 1BVUA 4CNQA 5A6SA 1P1KA 2WZDA 3CEJA 2Y92A 5ETJA 1T6YA 4ND8A 2P0EA 3RRBA 4YRJA 4F2DA 4PSUA 1ILWA 1CPYA 3H7IA 1O97D 2D1RA 2G09A 2HHJA 3OFVA 4WE3A 1SQ0A 5I4IA 3ZHBA 3AF6A 3A4LA 4MCHA 3S55A 1QUFA 1ZGZA 3KR2A 3Q9LA 4KLAA 2P9ZA 4L16A 4NQRA 1UBJS 3W1WA 7AT1A 2KQUA 3H9UA 3N0RA 1DDOA 1HEIA 2NQ8A 2WF7A 4BB6A 1NM5A 4LW8A 2WT8A 2Q2VA 3HXKA 4I1SA 2A2ZA 2CNNA 3TNJA 1XXHA 4B7UA 4BNXA 3R74A 4PYLA 1YRWA 5FBKA 4DA0A 1DIAA 1JBKA 2Y9MB 3K8OE 1GXSB 2NYVA 4F3KA 4LHSA 5I7SA 1TUBA 1Y7PA 1JUDA 3WYAA 3KZXA 2ZTSA 3PB3A 1DC7A 1MP0A 2CFOA 4QQRA 3KHUA 4LGVA 3BL8A 4DRYA 3BSWA 1KP9A 3EARA 5TPWB 2OC9A 1BRTA 1VCNA 5AD1A 2CUZA 1CJUC 4LVOA 4BRSA 4TLAA 2HYIC 4DUPA 3TFOA 4RJTA 3FFTA 3BN3A 4OQMA 2WKRA 3W8NA 3PHJA 3II6X 2VSNA 1IQUA 1YZGA 3RSHA 3ICQB 2IODA 1CZLA 3RUHA 2ODQA 1YZYA 3PT5A 3IJEB 1TU4A 4KQKA 1FVFA 4OBWA 2OENG 1JEJA 3I73A 2IHZA 4RZ2A 4WIAA 1JJAA 3K6KA 3IIIA 4OXYA 4EEXA 5H59A 2ZSEA 1UH5A 2G36A 4FJ0A 1VSBA 5DYTA 5IBRA 5FUQA 1XMPA 4ZYZA 2QTCA 2A0KA 3RQIA 4F46A 2J6BA 1Y9AA 4LYJA 2IS1A 2RI0A 4OMUA 4DSUA 3ZWWA 1UJ4A 5JS2A 1S2GA 1X3ZA 4L9AA 4B8YA 4WINA 5CD9A 2ZZNA 4F93B 2IHJA 3G2IA 4RJ2A 3FY4A 2OD7A 4JUAA 4KH0A 2ZT5A 3IXLA 4JL8A 5G0UA 3TRJA 1NJ1A 4YJ3B 5DKFA 5TMBA 4IKEA 2WKSA 1EWYA 4IO1A 3TLGA 2W11A 5JLAA 4R2HA 4Z9YA 4YDHB 2Q3BA 4D4IA 4HYEA 3ANXA 1V35A 3NASA 2OWEA 4TTSA 3LG2A 3SZMA 2HWKA 4P4TA 3V8MA 2B8NA 3CKLA 5CA1A 1LWNA 5FH9A 1B2LA 1GNVA 5AVXA 1FMLA 3BRWA 3EVCA 2VDNB 2VK1A 4DYDA 3VR2A 1YU6A 3KB2A 2XGOA 4RVGA 3HU1A 1KZ9A 4Q4HB 1R6AA 3N2IA 3O1JC 1GAQA 3SQDA 4BBZA 2CK3A 2A5GA 4JI1B 1Z62A 3ZK9A 4IIXA 2WVAA 4ARSA 1RWBA 1JHPA 3DO6A 5FTKA 2P9YA 3UF0A 3QVTA 1Q3HA 3P26A 4M8KA 4NRDA 4GQAA 3ZS9A 3L6RA 3IB3A 1XD2A 4PRKA 1W49A 2HT6A 4DLTA 4BO6A 1XTRA 3HUDA 1ENYA 1Q7EA 1T1SA 1M5TA 2EL9A 5C5DA 1OXKB 1LV8A 1MUUA 1SU4A 5DWVA 4AB1A 1HL3A 3A0UA 2A1IA 3OM1A 4M37A 3T4PA 4FZJA 2EFCB 2MWMA 1NBOA 1UC4B 1KZHA 1IHDA 3PRYA 4GX2A 1QHYA 2GS9A 1NW9B 4F91B 1HLGA 1Q7BA 3L7OA 4KREA 4LXHA 3WS7A 5A5VA 3W7VA 1VBMA 1WBJB 1GO2A 1W581 2V7TA 3C39A 3OPYA 2JFGA 1AK2A 2Z09A 3MCAA 4OSPA 2OG1A 2Y05A 2Y0EA 3HBNA 3HN2A 4KFSA 2QR5A 5TX7A 4ZZ1A 1TMGE 1X7XB 2PHZA 2ZBGA 4R8LA 4RSMA 3FTEA 2M32A 2Z9BA 3PHHA 3VTKA 3OKAA 4FE4A 4MZDA 5JEEA 4RTNA 5DM60 3ONVA 2OWDA 3FE2A 1XDDA 4LISA 3UB3A 3IMEA 4L8FA 4AY5A 1L4MA 4XYLA 3GLFA 1SQMA 2D3TA 2OO3A 3K94A 3S27A 4NCHA 2P9BA 4ESVA 1ABEA 2G9ZA 3PQ8A 1MX9A 1QQ7A 4AF6A 3LQRA 3QI2A 4CIBA 3KV3O 3FWYA 4C9BA 3EIEA 2QUHA 2ZSUA 1L1EA 4D74A 2VK8A 1WB5A 1Z0JA 1GUDA 2P6UA 3QP9A 3KLOA 4IH1A 2I4TA 4TT3D 2QUJA 2BYTA 4ZPJA 4JY7A 5FV4A 2I4OA 3T3NA 1C9NA 3EAFA 4FS8A 1E1DA 2GILA 3OTWA 4HRVA 2ZJBA 4LXTA 4ENSA 3EQ6A 5H3HA 3GJRA 3X1XA 5KX5B 3U5ZB 1YACA 2B4YA 2D06A 3X1DA 2PSJA 4IDFA 1X39A 4HT3B 4HNGA 2A1TR 4YRNA 4QELA 1S7GA 3USES 5AMXA 4ZT4A 3L02A 1GFWA 1NHGA 3MJTA 1DU4A 3BMCB 2H6EA 4PN7A 3Q43A 5KIAA 1VMDA 2OTCA 1MV8A 2IITA 1MR3F 4PO1A 5EG5A 3PKIA 1ZUNA 4FNMA 4B2LA 5EJ4A 1KFCB 2OXIA 1CVRA 1NR7A 4JLWA 1JB9A 4PC6A 3P9ZA 5E2BA 1JAZA 1GA1A 1P2VA 2PRSA 2ZYIA 5EMHA 4JLBA 4M0CA 5KWVA 4DR1B 2XRMA 4G23A 1NBAA 4D45A 5TE9A 1NTOA 1P4AA 3EC7A 3E82A 3JQFC 4W8OA 4YRQA 5LP6C 3PPVA 3UJ6A 5ES4B 4JI8B 4WLEA 3HWRA 4X1IB 1UMDB 4BO8A 5JXHA 4MK4A 4AJ1A 3HJNA 4MDYA 5D7NA 1R4MB 1HG0A 1E0JA 1SN7A 1U11A 2X86A 1YVUA 2X42A 3BRSA 3WO0A 2CSXA 2H4FA 4W82A 2AC2A 2W58A 2XCTB 1KH3A 3WLIA 3E4CA 2OV6A 4X1OA 2JKVA 4DMGA 4X54A 2O2IA 2WUDA 4XSHA 5DM70 3H1TA 1GQRA 4QOSA 2C7PA 4AP9A 1ZD9A 3P45A 1BMFD 3KJHA 4RKQA 3WYCA 2E5WA 2RI6A 4OQQA 3W06A 3GZJA 4GMFA 2BEJA 3GFRA 3LPAA 1ZK0A 3SQOA 3V2IA 2Q07A 2GEUA 2L42A 2OCYC 3PDCA 3BIOA 2E18A 2CLIB 2IYWA 3GT3A 2WWWA 4B35A 4DIFA 2WIJA 1E1NA 3L01A 3PXAA 1KJ8A 1GYQA 4RPJA 4OHZA 2PMEA 3V8PA 4CN8A 1P1FA 4CT4B 4UTXA 1VKRA 2NZ2A 2CHQA 1PR1A 2ODBA 4L9SA 5EE3A 4PLHA 4WH0A 1TZJA 3EUEA 3DF7A 4FMPA 4ZW3A 3VNAA 3J80A 1GCOA 4YJHA 2ZYSA 1RYMA 3HY4A 2BMAA 3EZYA 4UNPA 5JEDA 3JATA 3ZD6A 2E4VA 3FVVA 3GAFA 1DT3A 3VA7A 3QGMA 1TO1E 1KZ7B 4N8EA 2P9TA 1K4MA 1XYGA 3W6OA 1NUAA 3CJRA 3A26A 4FVTA 2HQSA 1E63A 3I12A 2CL7X 5CVUA 4IDEA 5E8RA 4M7RA 4BVGA 4Q24A 1F51E 4OHFA 4BMDA 3JSZA 3A3YA 3ESBA 4P7JA 4EA9A 1EFVB 1R66A 3IUNA 3L1UA 4QYXA 1RLMA 2PMWB 2ZRJA 1IN6A 3KQVA 4DBVO 1Z47A 3UY4A 4UHBA 3MD9A 4C3UA 2G6TA 4RLSA 3DF9A 2GERA 2WJHA 3VU8A 2E5LB 3TGWA 4HMQA 1CUEA 2ZBEA 3R24A 3ZVLA 4C3VA 1VZ3A 3TMYA 3IURA 5JCJA 3JVIA 1ULAA 1OZ0A 3FYUC 1LBEA 3ZKWB 4JU9A 5LQCA 2DWUA 1QRDA 4LZNA 5FKJA 1QAQA 2KW5A 2UKDA 2XE7A 1NQOA 4JL5A 4UKDA 1EBFA 1PR4A 5CNMA 1VP9A 1PSWA 3E03A 4MKFA 1U9JA 2BRUA 3G23A 4JJAA 3P4XA 4WD3A 4Y7DA 3LPDA 1PJ4A 3TJZA 1GAEO 4C4XA 2QYOA 3ILVA 3JQAA 5EQFA 4ZVOA 4O1HA 3X2FA 4K9LA 4U9HS 1KXJA 4D0RA 5REQB 4US0R 4WFIA 2Q3DA 4AKHA 5F4BA 2BFBB 1E69A 1U2RA 1K6EA 5BSEA 2XXJA 5JS8A 3K5WA 1G8YA 4J4TA 4R71A 4OTZA 3Q8MA 3IP3A 4Q02A 3E35A 1AQUA 2BLLA 2CJPA 3IHWA 4BMNA 4D25A 2DVMA 1PYGA 5ESXA 3ONEA 5KTKA 4IICA 5ALGA 5E3JA 4BLVA 5F7JA 3N39C 4EI9A 3DAYA 4QTUB 4C1BA 1Y1LA 3FAZA 4AX8A 3BWVA 1DX6A 3CVOA 4ZMSA 3F3MA 1EPUA 2AJCA 1MB9A 1OR8A 4WOPA 4PXYA 1FSZA 5G3YA 1CUUA 1QG4A 1K63A 2GJ8A 3QUCA 4DLPA 1LPMA 1Y3IA 5GVSA 2JGJA 4QRHA 1VLHA 4RHEA 3FX2A 3DHYA 1G38A 3PGKA 2P2CA 2AL7A 3GEDA 3I5UA 2WM8A 3RLFA 3KU4A 3NHKA 4M53A 4MQMA 4GL2A 3ADOA 2FUEA 5E0KB 3N0XA 5L3SB 3F1KA 3FKJA 1P1IA 1KP2A 1T0HB 2GEKA 1Z07A 4P38A 5AKXA 3FOEC 2AOVA 5G3ZA 4CDNA 4G07A 3EH1A 4XASA 5T41A 2BJWA 1M2EA 1QK3A 2H1OA 4KQJA 3TZEA 1FLAA 3CZEA 1L5OA 4PQYA 1OAOC 1XKLA 4O4LA 1JHVA 2O05A 1ESZA 3IPLA 4RD0A 3U3DA 2PYIA 1AV6A 5DP1A 3ESYA 4GR4A 2B82A 4ER0A 3CMCO 4KPUA 4V0MA 1VMEA 1D3AA 2EATA 4MI1A 1AF7A 3EEYA 4KWCA 2C3PA 4UPEA 1YUMA 2FQQA 5EJMA 1YS4A 1W9MA 2YR0A 3H2BA 3TNYA 3OFSA 2YWBA 3DB2A 3KVRA 2WSSD 3LVFO 2ERXA 4FDUA 3TVDA 4X92A 4YXWA 4DF3A 3IODA 2XW6A 3ZI7A 1ZS9A 2E3JA 4GBED 4CMGA 4YPVA 5BV2P 3I1FA 4ZEXA 4HTFB 1E77A 4OEHA 1Z7BA 1OX4B 1XAGA 1VKHA 2NSLA 2UVPB 4CXFA 3NAQA 4FCCA 3U9WA 3ASZA 4F11A 3AVTA 4ETMA 3GEPA 2P79A 2VTBB 1W8DA 4ZFNA 4RAQA 3SC4A 1OA1A 4JBNA 4Q16A 3TYXA 1U2TA 4V0NA 3UKDA 5A5GA 5C1OA 1FDUA 4ZCQA 1R2QA 3VZRA 1N5OX 1PFYA 2PR2A 3SK0A 3T52A 4UHFA 5C1BA 1PI3A 1DXHA 4ZRMA 1GQFA 4E70A 3HYSA 4TKVA 5AIAA 3HVJA 3P20A 3QG1A 4DZTA 2PZBA 3E0XA 2WJ3A 1LF5A 1EXWA 1SBHA 1VSVA 4C6HA 5KJFA 4OLFA 1V26A 2OGSA 4IZOA 2WIDA 3O8QB 4Q00A 3RBVA 4JJ7A 4Q4LA 1CHNA 3BKXA 1EX9A 4NH0A 2Y8EA 1SCQA 5TQ2A 3GQVA 4RZIA 5LBIA 1RZVA 1VB3A 5GMOA 3W8EA 2HO5A 2DHCA 3EWNA 1N2ZA 3MS4A 1K7FB 1J07A 2OCBA 3K35A 4LG1A 3KPWA 1MMFB 2XUZA 3HXPA 3SC6A 2V7UA 2Y77A 1V1RA 4ZYUA 3IUPA 3RC7A 4D6PA 1ID1A 1EK2A 2XLBA 4MS1A 2QRKA 1O6FA 4QPZA 2A7OA 1HMPA 4US2R 5JQWA 4ATNA 4QXMA 3UEQA 3FA2A 4HC4A 5F2OA 4P2BA 1XD9A 5EINA 4KPEC 4BFYA 5K0EA 1E6EA 2EFDB 2R8YA 1B8VA 3INRA 2DUUA 3KAPA 3M3HA 4TM7A 3KLPX 3VOBA 3HB4X 5JARA 1ADGA 1UM9B 4HXFB 4J0KA 3L0BA 4JC4A 2FW9A 4P86A 1P2SA 4ZCLA 5BQFA 1LDGA 3OUUA 1XKQA 5L53A 1YVPA 2ZBFA 3EZ7A 2JJ8A 3UJDA 3GUCA 2V7QA 1K0UA 4BGIA 4BXOA 4L78A 1LBHA 1LPNA 3D0QA 3P9CA 1EXMA 2QAGA 1GAJA 4J3FA 3TLJA 4RS3A 3PJFA 3A6EA 1A2BA 5ALMA 1E0AA 1PNOA 2WOJA 2K7ZA 1WZEA 4OA8A 3Q10A 4TX1A 1RIIA 3W5SA 4FNOA 5TSDA 2JIMA 5JXWA 1YC5A 4MQFA 4BIMA 1SOAA 3LCRA 4YUAA 1J09A 2LDXA 1U9YA 3BL5A 3PZBA 4N9QA 5TNXA 4UCFA 3LF2A 1Y3CE 3WNZA 1II8B 4EUKA 3EBIA 1Y7TA 3A6GA 2RGNC 4F4FA 4CIAA 2O7SA 1U6JA 1RYNA 4TV8B 1OXMA 3QSYA 1ZM2A 4ZOAA 5AW8A 1B93A 2DBZA 4PC1A 4HDOB 1NU6A 5J3JA 2AZTA 4AJKA 1Z5ZA 1OA0A 3L5KA 1W94A 3UB2A 4ZJPA 1C9KA 3GNQA 3LBHA 2JFWA 2CYCA 5A02A 1BDJA 2D2EA 2WTMA 2ZYRA 3KOZA 3BEDA 4LGCA 4ZT6A 4A5OA 1FJGB 3RS7A 5A4MS 3L04A 4RKYA 1Y82A 3IAXA 4Z51A 1G98A 2XR1A 2QUZA 2ZKIA 3ND7A 4MPRA 3WGTA 4HUTA 5AVUA 4FR2A 4BKUA 3FOFC 1UMBA 2HADA 1OPXA 1Y8ZA 4V02A 1BQ3A 4K03A 1BKYA 1LX7A 2MT9A 1KBOA 4EVSA 2OBXA 2DSTA 3UUWA 3S29A 2FPGB 4Y6RA 1A1SA 4JHLA 3U40A 2PMDA 5F9HA 2RFLA 5IAJA 1G8PA 1SCBA 1RWKA 4M49A 1SCNE 3Q8XB 3VTFA 3SVLA 2ZSKA 5FO1A 4URZR 2XTAA 1URPA 4BLOA 1TEZA 2ID4A 4WDQA 1E79D 2X9VA 2QD2A 3KJIA 2B98A 4IG4A 1CDDA 5AKHA 4YWJA 5CA0A 1YBFA 2PH3A 4PXAA 2FQXA 2I34A 4HAXA 4C6SA 5DHUA 1N5LA 1TQ4A 1JHZA 4R0VA 4AMGA 6Q21A 2UZAA 2XRFA 4J2HA 3VPSA 5C46F 2ZXEA 2HWWA 3H05A 2IWRA 4B43A 5L3VA 3FYTA 1Z8NA 1IZ8A 4LSMA 1VXRA 3VZDA 5A4KA 1FNMA 5AUNB 4RESA 3KAKA 5IZCA 2XBLA 1M2GA 2R4QA 2I62A 1KKLA 2C1EA 4P3OA 2ZRQA 3AFMA 4TYWA 3KKKA 2A94A 5L51A 3O93A 7ADHA 1UBOS 4FHFA 5DYYA 4MR9A 1UXIA 2FETA 4UBLA 3VU1A 3BX1A 1B0UA 1A9RA 3PQ4A 4MRVA 1B8NA 1P77A 1RBYA 2ZUBA 3D8TA 4UFNA 3DA8A 1JEQA 1FTGA 2BFDB 2WU3A 4UD6A 1DEAA 3HRKA 2C2OA 1UOPA 1Y1PA 4C0JA 1ZD8A 1FDWA 5IKPA 3RV3A 1H9CA 1USIA 4URWR 1DI0A 1NJ5A 3IA2A 3LO5A 4M99A 3RYFA 2F9MA 3W5CA 3FU0A 1E3MA 2P9QA 2GN0A 2WJGA 3VR4H 3JTMA 4HLDA 1ULUA 3EGXB 2R11A 4FFBA 4NFLA 4BP3A 1C2YA 3THYA 3E6AA 1DIBA 1U2ZA 1RP7A 2QX4A 2VYVD 3NGXA 2HSZA 4JJEA 4OMCA 5B7GA 1G8MA 1RCFA 4BVFA 4I3FA 4EBBA 1DQYA 1W0KD 2J6IA 4UBNA 2A4KA 1A1VA 5JDCC 3WA7A 3KZOA 2P7IA 3P97A 1V6CA 4XARA 4RTJA 3GQBB 4N5LA 4PXSA 1Y1SA 2JANA 4QDZA 3E0QA 3MM4A 3U2QA 5HM6A 2FP3A 1SXPA 1N3YA 3T7CA 1FFCA 2QKYA 1FP1D 4XSVA 1LLDA 2XDQB 3KTOA 4YDRA 3ZDQA 2FEPA 1A9TA 3KUKA 1SC4A 2I4MA 4XSGA 4A8JA 2UXCB 2R8ZA 3ICVA 4A0GA 3H83A 1EUDA 1T3LA 1UF9A 3KYDA 4ZALA 1BXRA 4BBJA 2RAUA 3EDMA 1YRHA 1U7HA 1T5IA 2ADOA 2QQGA 3UT5B 2PD3A 4R1SA 4FYKA 4IIGA 1TKBA 4TKLA 1PZNA 4LAFA 5H9VA 3SSMA 1U3WA 3I9OA 2VQFB 1MCZA 4M9QA 2PZMA 2XMGA 3CTMA 4QGGA 3WGMA 4Y2TA 2H16A 1NFQA 4PPYA 5SV2A 3EODA 1KY4A 1T13A 3DLTA 3SZGA 2W98A 4CUZA 4HNRA 5CB4B 2AI3A 3IILA 3HKEA 1WMAA 3MJSA 1XQVA 3ICPA 4ZK2A 5ALNA 3O84A 3ILYA 1I51A 2J3MA 1RM0A 2MSNA 2ZANA 3JQBA 4ZVLA 4BTVA 5JZVA 4YI5A 2CCGA 3TW6A 2V58A 3PPYA 5T5QA 5LSAA 1R8XA 4CV1A 1OXBB 3C3EA 4JITA 3Q15C 2FOIA 4QA9A 1H19A 2J6HA 1QOPB 1GLVA 1P0PA 3FPLA 4ENPA 2FZ5A 4TTQA 1N2BA 4QTTB 3I09A 4ZW7A 1WTAA 4HNHA 3TIGA 3BXGA 3ZWQA 3HDJA 5C18A 1NPTO 5FUVA 1CUVA 3K0HA 1EHCA 1IUNA 2F1OA 2RHGB 1YOBA 4PC2A 3BJIC 4Q7EA 4URUR 4FD3A 3JWJA 3BHNA 4CM7A 5DNEA 1PX2A 5IEBA 5KJ1A 3D0RA 3AJRA 1IG3A 2MOKA 3QVLA 3N6VA 1J2RA 1S4QA 3G17A 4AQYB 3OCZA 1GGMA 1AKRA 3RSGA 3MVEA 1OT3A 5SY4A 2JEYA 1YB5A 4TOIA 3LQYA 2PL3A 5IM4F 3DBLB 5IJ9B 4PAWA 4HUQA 3H4TA 5F3WB 4JJ8A 2Q4RA 1VPWA 1W30A 1JZQA 1N1GA 1B16A 2XB2A 5ALSA 3M3DA 5BUQA 1QF6A 3VHRA 2H65A 3L1KA 3V32A 1ISRA 4IQ8A 3ZTWA 4O2AA 1F48A 1VKZA 2DG2A 3C3BA 3EEBA 3GFBA 3MRSA 3ONFA 3Q7PA 4HPWA 2WQ6A 3QPAA 2C9DA 3BBLA 4S0ZA 4WFQA 3DBRA 2ODEA 3TAXA 4DIMA 3RVRA 1NJSA 1I0LA 4I50A 2VC2B 3NHLA 5HG0A 5CVTA 2D4HA 1HX7A 1IHYA 4MV8A 1ORTA 2VF2A 1ESCA 3P0IA 4KVAA 1D2RA 1TB4A 4K7JA 3WMGA 1DE0A 3ZWYA 5I7RA 1EDEA 2PWBA 4LJSA 1PDOA 3UJCA 2P9HA 2BFFB 1XDWA 3GEGA 1I4LD 5BSMA 1KK2A 1NW5A 5CR9A 3GBSA 3T7TA 3EFOA 1ZONA 4RHFA 4TSRA 1V8PA 4DARA 4EHAA 2WF8A 3L2OB 3HBJA 1OC4A 3B1YA 3RFCA 1CR2A 4P54A 4D4JA 1UZAA 2QZZA 3UENA 3ZW8A 1UDBA 3RGGA 4Q7JB 5TS2A 2ZITA 1ADBA 1PT5A 4GMHA 4C43A 2RHJA 3PHBE 2X5JO 1QH1B 3T9FA 3FUHA 1T29A 3EVAA 3FHOA 4D5GA 3CLHA