4ZQGA

Crystal structure of the moraxella catarrhalis dox-p reductoisomerase in complex with nadh, fosmidomycin and magnesium
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
total genus 154
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqgA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqgA01
1P33A 4NBWA 4RDHA 5G0TA 4E5KA 4PRLA 3ZU5A 4BO6A 3AK4A 3QWAA 1KC1A 5KNLA 1XQ1A 3DZKA 3HNPA 3W4JA 3NT5A 4QSMA 2X0IA 2Q1WA 2ZYGA 1E1LA 4CMCA 1ARZA 3EMKA 3UHAA 5HBRA 4L76A 2VHZA 1GYRA 3E6AA 4RL6A 2CVZA 1T1RA 3JQFC 3AY3A 5BSFA 1LSOA 3VDQA 1WLYA 2QRLA 2CVOA 3T0YA 3INTA 4EZBA 2H9IA 1K6XA 4CMAA 3HN7A 3BMCB 3H65A 1DIAA 1HZZA 2Y1CA 3DAFA 3BMNB 5JAZA 1H2HA 1LUAA 1Y7TA 2HAEA 2JCYA 3QWBA 1Y8QB 1HTBA 5COBA 4U8GA 2B4RO 2YDYA 4E3ZA 3DBRA 3TZKA 4MVJP 4AJNA 4QUKA 3C3XA 4OMUA 4ESOA 4OSPA 1VL6A 1J6UA 5K9ZA 1WXDA 2B5WA 3HJAA 5FI3A 2VN8A 4XRGA 5ICSA 3HDHA 4ONEA 2Q2WA 4MDHA 1X13A 5I7SA 1HXHA 1NVGA 3SLKA 3JQAB 4UAGA 4DPMA 1M67A 3HDJA 1VE9A 3ENKA 4PIVA 3E03A 2YHUA 4RPLA 3NAQA 1B2LA 3C24A 1LSUA 4K9DA 4Q3CA 3EVNA 4QQRA 3WX0A 1E3EA 3SBOA 3B20A 4A0SA 2VWPA 4B8WA 2PD4A 3W6ZA 2E49A 3PJDA 4Z0TA 1MX3A 1JKIA 2D0IA 4ZQHA 3GRPA 3WMWA 4Z9YA 4YAGA 4PG7A 5IFLA 3TZ6A 3KYCA 4B4OA 4BO5A 1GTMA 4CL8A 1PZEA 2YQ4A 3CUKA 1XR3A 4OL9A 3ZWXA 2VRCA 1WDKA 4CQMD 3VVCA 1XHLA 2UDPA 1RKXA 1B7GO 3VAZA 3EYWA 1KY4A 3D4NA 3GHYA 4R1SA 2FHSA 3OJFA 4BO0A 3A06A 5ICMA 4D45A 1WW8A 3PYMA 4IJVA 4BGVA 2JAHA 1EMDA 2GERA 4CMBA 3I4CA 2GPTA 3F1LA 1PS8A 2DAPA 2VRCD 4DPLA 3DZFA 1I0ZA 4XDYA 5BR7A 3U5TA 5MGBA 3F46A 4OOEA 1F8FA 3KLMX 1UAGA 4GAEA 2O4CA 2XPCA 2A94A 2ZTUA 4WOJA 3SVTA 3AUSA 1Q7BA 5F3RA 5EERA 2UUPA 1YONA 3OMLA 5IDXA 1FK8A 2Y1FA 3RFVA 1YDWA 4BIIA 3FSRA 3RU7A 4J91A 5CFZA 1TA4A 3H5NA 1NFRA 2V6MA 3MTJA 4TVBA 1B3RA 2HK9A 3S1LA 3AI3A 2EGGA 1KYQA 1ONNA 4NFYA 4IJUA 4Q9NA 1CDOA 1DHTA 4FFLA 4NK5A 4I9HA 3S2IA 1NM5A 3SXPA 4XQCA 4WNIA 3BTOA 5JYEA 4J2HA 1PGNA 5JC1A 2GN9A 2I65A 3GRKA 1DRWA 2X9GA 4EI2A 3IQDB 4MIEA 1YDEA 2TMDA 3ANNA 1ZFNA 2P9GA 1LI4A 4J2OA 3DZGA 3WICA 2QG4A 4TWRA 3S55A 1R12A 1A4UA 4I9UA 5KJEA 3LZ6A 3RSHA 3L4SO 4O59O 2E6UX 1G1AA 2NACA 1BVRA 2J3HA 1GQQA 3AWDA 3FNGA 3A28A 4R01A 1LTHR 2AQHA 1V9LA 3GLQA 3L6OO 3NTRA 1VRWA 1WPQA 2CDCA 3PWSA 4G65A 5DCYA 4ALNA 4BL5A 3ULKA 3E18A 2IYPA 4IJKA 3ROKA 1J4AA 1LLDA 1C1XA 5JDCC 1SC5A 4A26A 3Q9NA 4O0LA 3WBFA 1CJCA 3F4BA 3MJEA 3K9QO 3W1VA 2NQ8A 5JAQA 1UDBA 2X0RA 4R54A 1E3WA 2NTJA 4YAIA 3ONEA 3PLRA 2BMAA 2RHCA 2SCUA 2YV1A 3UF0A 1F06A 1SOWA 2AEJA 3JQCA 4IDDA 3T7CA 4E5YA 4BO4A 8LDHA 1EVIA 5CDYA 1EE9A 1AXGA 1XSEA 3FBTA 1MW2A 1ZK2A 4R9RA 4XYGA 2GZ2A 3F5SA 4ZJUA 2ZQYA 5IN4A 3U4IA 1R15A 2G17A 4Y9DA 4IQ8A 2IZ1A 1EFLA 3ZV3A 3DBVO 4J0FA 1FDSA 5KIAA 3JD2A 1FDTA 2GNAA 5JYDA 3DBLB 2AG8A 3ASUA 2BI8A 5F1OA 2DTEA 1A27A 1S46A 4B4VA 4CMIB 5L7WA 5DOVA 2P91A 3DDNA 1U3WA 2FMUA 1YS4A 1DAOA 1FDVA 2HJRA 4IY1A 4U7WA 1PJTA 4FFPA 4NNJA 4WCFC 4KUGA 3OA0A 3NJ4A 3V1UA 3ASVA 4IIVA 3T4XA 3A14A 3DTTA 1NXQA 1WDMA 2FPGA 3RCBA 3JYQA 1EUZA 1HDRA 1WVGA 1Z75A 1GR0A 3WDSA 2YV2A 1NVMB 1RP3A 3N74A 3EVTA 4YR9A 2FZEA 1YXMA 1R0LA 4F45A 4LN1A 5IZCA 4YJFB 4NU5A 3JQ8A 1NFQA 2CDBA 3F1KA 4Z3DA 4AFNA 3GC6A 3U4CA 4RO0A 3OIFA 4Y67A 3C8MA 3GHHA 1D1TA 4LSMA 1E77A 3ZWCA 1UUFA 2CF5A 1MVYA 3LVFO 4CLDA 3PVZA 4DVJA 5L4SA 3Q9UA 3K8ZA 1WZIA 4GI2A 1X7GA 2Z1MA 5JLAA 4NU6A 1OR7A 3ZWPA 1PS9A 1YJQA 1E1KA 3IKTA 3R3SA 1IE3A 4N5NA 1PR3A 1KETA 2JL1A 3LYLA 3RC2A 5IAAA 2D5CA 2WTBA 2H6EA 3RBZA 1NPTO 2WSBA 4ALJA 1JQBA 1JW9B 1OOEA 3ROQA 3OETA 3AJRA 5I8ZA 3GDOA 1C14A 4E30A 5ILOA 3JQ6A 2Q2QA 4RCVA 3GNSA 3PHLA 3GEDA 2RH4A 4H3VA 4OHUA 5BNIA 4PN3A 2ZYAA 4E2WA 3B1KA 2DBRA 3PK0A 3TL3A 2HKIA 3LSYA 4E5MA 1A72A 4QFCA 4WPGA 4NPCA 1DEHA 2WWRA 5L4NA 3NGXA 3RUAA 5JAMA 1CEQA 1NWHA 3GVCA 3C7AA 1MP0A 1YQXA 4NBTA 1K5HA 4IQ0A 3BMCA 4IMRA 3B1JA 5C3MA 4WECA 1I2CA 3KVOA 2NADA 2J5KA 1P77A 1P1KA 1BXKA 3HG7A 2X6TA 4LGVA 1Y8QA 3DZHA 2A4KA 3WGZA 1MV8A 2H63A 4JXKA 2X8LA 1AXEA 3U62A 5AQ1A 2JKVA 2BHLA 1HT0A 4K26A 2Y93A 2PFGA 3H4VA 1OI7A 3PHJA 4CM4B 4GGOA 5A9SB 3MOIA 3HUDA 4KUEA 2O2SA 1BXZA 2EJWA 3JQAA 4IXWA 4FB5A 3EUWA 1Y8RB 4LUPA 1B16A 3RWBA 4PLGA 1GZ4A 1ZXLA 3QWFA 3KHUA 3GPDG 1VJ1A 2RIRA 2I6TA 1YL7A 3GDFA 4NIMA 3DZJA 1EZ4A 2Y1OA 3Q2IA 4OJNA 4W82A 3JQAD 4R5MA 3ZH2A 1JWAB 3PP8A 3VH4A 2FP4A 4MIOA 3K5PA 1S6YA 4RV9A 4IMPA 1QYDA 4PGFA 4BGIA 1GAEO 3NRCA 3PZBA 3KSUA 4XYEA 4DMMA 1MGOA 1LNQA 4BUCA 3CPSA 1VSUA 3AFMA 5EPOA 4CMJA 2R2GA 1E3LA 2R00C 4J3FA 4CV1A 2Y05A 5C7OO 4EJMA 3U4HA 1ZCJA 4JBGA 1SOVA 1B8PA 4XR9A 1MW0A 5LCXA 1MLDA 2O23A 4PLWA 4PG5A 2VYVD 4IDEA 1YOVB 5KVVA 4XEHA 2X4GA 3KO8A 4PVCA 1K89A 3DWFA 1E7WA 4J4BA 5BSGA 1UP4A 1E7YA 1EK6A 1X0VA 4YT5A 1EBUA 1NP3A 3E1KA 4RGBA 5F1PA 4OM8A 4YRBA 2OHXA 5A04A 4UEKA 2JD1A 3JQBC 4OIMA 3ICPA 2BI7A 2PZMA 1Q0LA 1J5PA 2JCXA 4RVFA 3GK3A 1MC5A 4AJHA 1B14A 4EEXA 3LQFA 4B4WA 4RORA 2CFCA 4IBOA 2EWMA 3PQDA 3QLJA 1YGYA 3ENNA 1QYVA 4JJGA 4NQZA 4PLVA 2EW2A 2C29D 2Q99A 3OA2A 4FOSA 4EJ0A 1C0PA 3SC6A 3QV1A 4XQGA 5L4LA 1JVBA 2Q4BA 3ETGA 1PS0A 2Y0EA 1K6IA 3M1LA 5EINA 4IPTA 4CQMB 3D3WB 1NR1A 1R37A 5JO9A 3DL2A 5BNTA 1X14A 3DONA 1ISMA 2JD2A 1KVUA 3KZVA 5I9NA 1NQOA 4RPJA 4CM5A 4MOWA 1B8VA 3L77A 2AEFA 1TI7A 4BV9A 4HXYA 3AU9A 3JYNA 3D3EA 4PLHA 4MVJF 3N7UA 3ZHZA 1QKIA 4TKLA 4CR7A 5I9MA 1GADO 1HYHA 1I3MA 4PCVA 2Z95A 3MWEB 5FI5A 4N5LA 5IDQA 4Z0HO 2ZIZA 2H1SA 1Y9AA 2PKQO 3H5AA 1JN0A 4L8VA 4KP7A 3ETDA 2I3AA 3FNFA 2H5LA 2PNFA 3LC1O 1KVSA 4G81A 1I32A 4DIFA 1DIGA 2QZ9A 4O6VA 4BNJA 3C1AA 1HDZA 4IUYA 3UKOA 4CMEA 5JO0A 3KYBA 5TX7A 1YB5A 3HDYA 4IGEA 3RASA 1YH3A 4U5QA 2XXBA 3WGHA 2W98A 3H2SA 4XB2A 1TVEA 5FEUA 3WQSB 4FLRA 3A1NA 3RQSA 1PZGA 3I9JA 3P2OA 4D7AA 4AL4A 2O3UA 1BDBA 2V7PA 4FC6A 3AM5A 4B4UA 5G2OA 4YJHB 1R16A 1SMKA 4U6SA 1Y9EA 4D43A 1Z73A 3MCVA 5B4TA 1EVYA 2PK3A 1V3VA 4ALIA 2J5RA 3DMYA 1JAXA 1DC3A 5THKA 5JMPA 1MXFA 1BW9B 3OH8A 4Q3EA 4E13A 2PR2A 4E33A 5B4UA 1NQAO 3CIFA 3DBLA 5CG2A 3WBBA 1VPDA 3IP1A 1HETA 3PGXA 1GEEA 2ZB7A 5JNLA 4CMIA 3PDUA 4U6QA 5AVOA 5GZ6A 3OJ0A 1VJTA 3UERA 1RYEA 2GRAA 5JBIA 5JDIA 5CEFA 4ZRNA 1DJQA 4OXNA 4ZQGA 1GL3A 4JBIA 3GVIA 3TZHA 2VTEA 4DL9A 1LLCA 1Z7EA 2I9PA 2VYNA 4L73A 2ZB3A 3CZMA 2ZTVA 2D3TA 2VHXA 3CZEA 2J3JA 2RH8A 5KJ6A 4INAA 1T1SA 4XQEA 1FDWA 2LDXA 5GMOA 1MW3A 4YCAA 3NTQA 2EKPA 4ID9A 1UAYA 5B1YA 4CMKA 4IDCA 4B3IA 2VYND 2DKNA 1PWXA 2NV6A 3WMXA 4G2NA 3R0IA 1BDMA 1LSSA 1G5AA 2O50A 3Q3CA 6LDHA 4LK3A 4KTVE 2AQIA 2IRWA 3ZU3A 5ITVA 3HZZA 4E2XA 1PL6A 4YT2A 1Y5MA 4IQGA 5G4LA 9LDTA 4R3WA 3AUTA 1BRMA 1U28A 3CMMA 1N1GA 3ZCXA 4YB8A 2EKLA 3GAFA 5ENDA 4Z9FA 1P74A 1SO8A 3D64A 1PZHA 3TFOA 1LC3A 5CEEA 3TPCA 3WSVA 5HA5A 1SC6A 6ADHA 4D0RA 1BSVA 3QJ5A 1OFGA 4JJIA 3K96A 1ZIDA 2AQ8A 2O3TA 3GFBA 1IB6A 1XCBA 4NJOA 3I9NA 5TQVA 2R6JA 5U1PA 1WMAA 4DQUA 2B4QA 1XU9A 2C7VA 4UVGA 5T67A 4GVLA 4QECA 4FCCA 5IXYA 2PGLA 5A3VA 5COAA 5T8KA 3SEFA 1E3SA 1G0NA 1P9LA 3NT4A 3OJEA 1NQ5A 4XYBA 3RROA 3V5NA 3DOOA 1KVQA 4YAJA 3E9NA 3DEYX 3RC9A 2HLPA 4AJIA 3JYOA 4BNIA 5IDWA 4LRSB 4R1TA 3HFSA 4PLTA 3VVBA 4EYEA 4K1LA 1HE3A 1I3LA 3DB2A 2B83A 4IIUA 1BTOA 2P9EA 4CLEA 5THQA 1BHSA 4MJLA 3FNEA 4GX5A 4NBVA 3CH6A 4FC7A 1JAYA 3D4OA 3FWZA 3TNLA 2JFFA 4CM4A 1NHWA 2LDBA 4IZIA 5A9SA 2VRBA 2C59A 2HK8A 1ISGA 4D46A 1Z82A 2BKAA 3KRTA 1YB1A 3VTZA 1XDWA 5KJFA 4CV0A 1Y8RA 3I9LA 4BMNA 4FLSA 4J1QA 1L1FA 3ZV5A 2YDXA 2VHVA 4GKBA 1YL5A 4XGNA 4IZHA 2DFVA 1A9ZA 5TIIA 4LW8A 4Q39A 1UH5A 3P5SA 4E6PA 1ZSYA 2Y1DA 4FFMA 1I3KA 3GVPA 3NUGA 2VWHA 4PZEA 1UP6A 4QXMA 5G4KB 4MP8A 4PG8A 2HMTA 1CQJA 3F4LA 3UVEA 3WGGA 4BNYA 2WMDA 2OO5A 3V8BA 4D42A 4DIBA 3GQVA 5JFOA 2I3GA 5T64A 4NR0A 3DTYA 1VKNA 1OBFO 4I8XA 3PEFA 7ADHA 1M75A 1O95A 1QR6A 2VUSA 2XOXA 4FW8A 5K0ZA 1EDOA 4PFJA 4L74A 5IZ4A 3DBHB 1YOVA 3CMCO 2DBQA 2VNAA 2ZATA 3E82A 4ZD6A 2O7GA 5A4DA 2D1YA 1VKOA 2WD7B 4FQ8A 3PZRA 2VT2A 4AJLA 1MFZA 3PFFA 4FJ1A 2GSDA 3OJOA 3DOJA 5C7IO 5FWNA 2PY6A 1LJ8A 5EIOA 2C2YA 4MIYA 3WNVA 4DC1A 4YT8A 4GMFA 4RPHA 4OH1A 3V2UA 2YUTA 4OQYA 1UXGA 1VI2A 2OOSA 1O89A 3L6DA 1H6CA 3K31A 1LX6A 3HB4X 5AXDA 4ZQFA 3UUWA 4C4OA 1BXGB 3FTPA 4YRAA 3V2HA 4RVSA 4RVDA 1X7DA 5IZCC 1KERA 2VWQA 5BT9A 1B8UA 4FIZA 4CL3A 1EE2A 4DLLA 2IODA 1CF2O 1SEVA 3H9EO 1NQTA 1DB3A 3ZNOA 3INGA 1N9GB 1C1DA 3VC7A 3M1AA 5KVCA 4QEDA 4J7XA 3H9UA 2FZWA 4AJEA 5HRUA 2JAPA 4CMHA 1LA2A 3D3WA 2D4AA 4CQMA 5A1TA 3BHIA 1AE1A 4DWVA 1GD1O 3PXXA 2GGSA 5AXCA 1QYXA 4A7PA 3ZI0A 3KSZO 3WFIA 1XGKA 3V2GA 4ITUA 2J8ZA 4J9UE 1KEWA 2YHIB 5JMWA 3VOSA 3W4IA 5CDTA 2HCTA 1WMBA 5GZ3A 1LDMA 3LDHA 4CV2A 4MP6A 2DLDA 4ND2A 1CYDA 4YDRA 3INRA 2UYYA 1UDCA 2HO5A 3LLSA 2CD9A 4WEOA 1DIHA 4RF5A 3BAZA 4TRJA 4NHEA 3RD5A 4OAQA 4YVFA 3IJRA 4E0BA 2EIHA 2HDHA 3UCXA 1GZ3A 4EBFA 2AG5A 4KQXA 2P4HX 4FLOA 1MG5A 3H9QA 4GVXA 5L53A 4OXKA 4FGSA 3SX2A 4Y6RA 3RUDA 2NSDA 3FNHA 1JU9A 4BNMA 2RBEA 5LDHA 2I76A 1M6HA 1G6KA 1S7CA 3WOHA 1N7GA 2QIOA 3DR3A 1EFKA 3ZHYA 5CPFA 2D8AA 2JHFA 3BXXA 2WYWA 1NWCA 4L4RA 4TZTA 4BNHA 3UXYA 2B5VA 2HJSA 1A4IA 3AOEA 4YJHA 4DGSA 4DQVA 4WOKA 4FOOA 4YJDA 1FDUA 1LSJA 3E48A 4TROA 1YBVA 3ZNPA 3WG9A 1ADBA 4CJXA 2Y1EA 1JWBB 5I7VA 4UUMA 4A10A 3NEPX 4DLAA 1BW9A 2G82A 4HFNA 1E7SA 1TT5B 5DCWA 1I2ZA 3NKLA 3WQRA 4R3NA 2EKQA 3ANMA 1HRDA 1SBYA 3PYXA 4NJMB 5KWEA 1Q7GA 1V0JA 3WIEA 2AQKA 1YL6A 1ISJA 4M55A 1IYZA 4W99A 2WDZA 3MJSA 2HRZA 4WLFA 4HWKA 1E6WA 4WUVA 5HS6A 1ZZEA 1M6WA 3GEMA 5JSFA 1PJ4A 3RFTA 4HP8A 3WB9A 2NTVA 3G79A 2VOJA 5ES3A 3VZPA 3OECA 5L9AA 3TWOA 4GSLA 1T2AA 3ZWBA 1H93A 1LU9A 1V8BA 1YB4A 1OMOA 4ND5A 1LDNA 1O0SA 1WDLA 4J4TA 4MKZA 2BGKA 4D3FA 3IOYA 1T26A 1TXGA 5ER9A 1PTJA 1JG9A 3JD3A 1Z6ZA 2JHGA 3HSKA 3WS7A 3GFGA 4BNXA 2A92A 1K6JA 2PTGA 1CIVA 4GH5A 4JIGA 2RHRA 5B12A 1KEPA 2YFHA 3I9KA 4RLSA 4WKGA 3TJRA 2IE0A 3H6KA 8ADHA 1EQ2A 3GVXA 3DHNA 1ZUD1 4J9VA 1ZKMA 1SCUA 1XKQA 2W2LA 1LRLA 2UUOA 1D1SA 4OSOA 4YXFA 1UZMA 2X5OA 3ADPA 1V35A 1JDJA 3UFXA 3PQFA 4B3JA 4GMGA 4J7CA 2W90A 3WR5A 4QTZA 1UJMA 1K0UA 4M1QA 1KEUA 5F21A 2J3KA 2Y99A 5FF9A 2ZJ0A 1P0CA 2OORA 3K92A 3LF2A 4MVJG 2W2LD 3VHRA 4BS9A 1SNYA 3OF2A 4CLXA 1FXSA 3L6EA 1HDXA 3U4DA 2BGLA 3MZ0A 4GSKA 2NQTA 3HADA 3ANLA 1E92A 1SB8A 1ZEMA 4GWKA 4BQRA 4FFNA 3UH1A 2IDZA 1RJWA 1M76A 2PWZA 4P8RA 4Y6PA 4XZ3A 1KC3A 2RAFA 4GX1A 1YKFA 5JCXA 2DC1A 4RQUA 3DMTA 4XJTA 2X23A 4FSHA 4F3YA 3G1UA 3H3JA 3KTDA 2FPIA 4S1VA 3JQEA 3OIGA 1ENZA 1E7QA 4I1IA 4F6LA 3LT0A 2WYVA 1ISIA 3E5RA 3Q2KA 1T25A 5CDUA 1I01A 1HKUA 3QP9A 5KCZA 2X5KO 3IMFA 3I6QA 2X7HA 1N1EA 5TNXA 1GCUA 4PLYA 4Q3AA 4U0KA 5ER6A 3H9GA 4IDGA 2PD6A 1DIBA 3CE6A 3JD4A 2PD3A 4AJKA 3OQ1A 1F17A 2YY7A 5JCJD 1PJSA 3ORFA 5G4KA 2AW5A 4UUOA 1NYTA 4AJ2A 3A4VA 4CMEC 1NHGA 2J6IA 1HL3A 2IEDA 3GMDA 4II3A 1R0SA 4CM8B 1GV0A 2C07A 2VUTA 5T6BA 3GT0A 2Q2VA 1QSGA 1ISFA 4D0SA 1LQTA 4O63O 4WCDA 4DMLA 1Y5RA 3ETEA 4Y8VA 1DRVA 2XXJA 4XYLA 1R4NB 2EP7A 1GUZA 1ZJYA 3CTMA 2X9VA 4R68A 1SPXA 4WASA 3LT2A 4BGUA 3RBXA 2O7SA 3FR8A 5JY6A 3R3JA 3GNTA 4CUKA 4BV8A 3DBHA 2GR9A 3ROPA 4YRDA 4R69A 1GUFA 1ZK1A 2PKRA 3RUFA 4E32A 3M2PA 4FJ0A 1QRRA 2WD7A 3QE3A 4J7UA 3V1YA 3ZN2A 5K6AA 3WSWA 1I30A 1PEDA 4L0QA 4CXFA 1GZ6A 2VNSA 3BMNA 4K28A 4MVJH 4J49A 3T7EA 4JJFA 1CETA 3KYDB 5JDIC 2EERA 5L7TA 2G1UA 3PLNA 4TRRA 2Y66A 5BNFA 5A5EA 4W7HA 4XR4A 5TGDA 4BNFA 1ZH8A 1PZFA 3PIDA 1UXKA 4GPD1 3RJ9A 2Q45A 5DBIA 3O8QB 1BXGA 3ZWAA 2DM6A 2P4QA 2VZ0A 4D79A 3PRJA 5L40A 2ET6A 3ZV6A 1AHIA 4W4TA 4WLUA 4OO3A 4E4YA 3TZCA 2P5UA 4HUJA 3K2EA 4ND1A 5F5NA 1V3UA 2C2XA 4R5HA 3RUCA 3QVWA 1QMGA 2HMUA 3H2ZA 3IS3A 1N9GA 1RM3A 3L9XA 4LSWA 1HLPA 4MO2A 3VKVA 4JK3A 1IY8A 2VZ8A 4PLPA 5EN4A 4CV3A 3MJCA 4HADA 4HKTA 4IDBA 3GOHA 5KOIA 2A35A 1AGNA 1PL7A 2WYUA 1V3TA 3F6YA 2X86A 4PZDA 1WP4A 4P4LA 5TSDA 5JS6A 2YHIA 2Y0CA 1D7OA 2VYVA 4CLOB 1PIWA 4ZA2A 4R1NA 3WWZA 4RVUA 4TZKA 3W6UA 1UDAA 3O9ZA 2OUIA 3FWNA 3O38A 1KOLA 3ROMA 4DYVA 3G3EA 3DAGA 3GUYA 4HNHA 2YW9A 2FSVA 2OL4A 2HSDA 3TOZA 5JAIA 3JYPA 3VH1A 1I24A 2BH9A 3QRWA 4CUJA 4J0EA 3R6DA 4MVJE 4I5DA 1XELA 2DPHA 3TFQA 5H82A 4DRYA 1Q2XA 5T8KC 4U0JA 4E2ZA 2EGHA 1DXYA 3CSDA 1H6BA 1ZXBA 3I6IA 1H6DA 1PX0A 4IDFA 3RU9A 3TN7A 4ALMA 4MPDA 3CZKA 4W9NA 3BMOB 4YPOA 1ENYA 3RAJA 3DXFA 3V1TC 3H5RA 3RBVA 2GF2A 4CM9D 2NNLD 3CZRA 1BG6A 1GPDG 1JTVA 3GMSA 4TRNA 5L45A 2OP0A 5AXBA 3PWKA 1ONPA 3S2GA 3GN2A 4BO9A 4KUHA 1TEHA 5L51A 2J5QA 1H9BA 3B1FA 2QHXA 1X0XA 2CZCA 3M6IA 2G0TA 4KZPA 4EITA 4OGWA 1P1FA 2Y68A 1O9BA 1DC6A 2B4TO 2ZB8A 3FF4A 3GF4A 5DBGA 4B79A 3EC7A 4YT4A 5I8WA 2EW8A 2OBYA 2D59A 2Q50A 4TSKA 1JA9A 1PQWA 4ALLA 2O2YA 1TT5A 3DBRB 1RPNA 2POQX 4BVAA 3JD0A 4NJMA 5A3JA 4EGFA 1YWGO 2Z1NA 4BB6A 5A02A 4XRRA 2MAOA 4MVJM 4BNLA 1YJ8A 4KTTE 4DIOA 5TS3A 3VH2A 1U1IA 1HE2A 3OIDA 1FMCA 1KIFA 1PSDA 3P2YA 1AHHA 3ZZNA 3HE3A 3NJ8A 2IZZA 3RI3A 5DOZA 3GZ4A 4J1SA 5DBFA 1PJBA 2WE8A 3PFWO 4ZQBA 1J0XO 4NI5A 1Z74A 3K30A 4NG5A 3RVDA 3QVXA 2V6GA 1IHYA 1FJHA 4AJPA 3VZRA 3NT2A 4UUNA 1K3TA 3UN1A 1GY8A 4BHTA 2NU8A 3SLGA 4RDIA 4EUHA 4FN4A 5BSEA 1AN9A 5H81A 1EEHA 2X5JO 1WAMA 1IL0A 2E4AA 1E3IA 4MINA 1UXJA 1A7KA 4CLHA 2XAAA 4J6FA 1B15A 4YWJA 4CMGA 2NVBA 2I66A 3UEQA 1QG6A 3R1IA 4UEOA 1B3BA 1HSOA 1PR9A 4XCVA 2GD1O 3WTCA 4IS2A 3I52A 1ENOA 3VPXA 3WTBA 2OXIA 3IL2A 3FD8A 5FYDA 4BOYA 4HV4A 4UULA 1LC0A 2EXXA 2G5CA 4EJ6A 4A5OA 2C20A 1UZLA 1X7HA 3K73O 4B7XA 3AFNA 2E37A 3KM0A 1IPFA 3FCOA 4RPKA 4AJJA 2X0JA 1K2WA 2CDAA 5AYVA 2GYYA 3KB6A 1DAPA 4W6ZA 5ILGA 4MVJD 2I67A 3OHSX 2DU8A 2OP1A 4FJ2A 4E21A 3UOGA 4PG4A 3ZWOA 2WEKA 3ZV4A 5G0WA 4DBVO 1PQUA 2BFOA 1O5IA 2NWQA 2PKQP 4E31A 4XD2A 4JGBA 2C0CA 2VOEA 3ZWYA 2V6BA 3DZIA 3HHPA 5CHEA 4ILKA 4CM7A 1LXCA 4LMPA 2JCVA 1YBMA 2V65A 2I99A 3D5QA 3IUSA 4XGIA 1HWYA 3ZHBA 4I08A 2B69A 1NNUA 1W0CA 2Q4EA 2J3IA 3NDRA 4AJ4A 5G0VA 1XG5A 5L95A 4YJFA 2IXBA 4XB1A 5JY1A 1EK5A 4ALKA 2DT5A 2GDZA 1LDBA 2Y1GA 2QYTA 3OFSA 4J90A 3VPHA 4E2YA 3I9MA 4XGKA 2QW8A 3MTGA 4G5HA 3LF1A 2O3RA 4TMFA 3KLPX 4OKNA 2GASA 3UW3A 3QHAA 1SZJG 1VM6A 3C1TA 1EVJA 4LRTB 2X22A 4CM8A 3CINA 5KVQA 4FFRA 4N7RA 1X15A 1DSSG 3JTMA 1LRJA 4WJZA 1P1RA 1KBZA 1NX6A 5GY7A 3WLEA 1Z7BA 1SB9A 1NPDA 2B35A 4MKRA 4R41A 1WZEA 1R4NA 3QQPA 4A73A 5TC4A 5COQA 3AOEC 3BHJA 4FFOA 1F8GA 3E5MA 3UCEA 3O26A 4HY3A 5JW6A 2GZ1A 3PJGA 1KS9A 4Y6SA 1GPJA 4H15A 4PZCA 4WNCA 4J1NA 5DCUA 4CR6A 3F9IA 1SAYA 2YYYA 4J1TA 5A9TA 1F14A 3W8EA 3TDKA 4M8SA 2F00A 1YBAA 5IG2A 5HWSA 2B37A 2Q1UA 1ZO8A 3GR6A 1T24A 5JC8A 1F0YA 1DDOA 1VC2A 2CUKA 2HMSA 5DT9A 5KKCA 1TB4A 3JQ7B 4P4GA 2Q46A 1L7DA 1Y6JA 2CY0A 3KYDA 3HB5X 1Z45A 2MAPA 3NV9A 3NDIA 3F3SA 2TMGA 5J23A 5T57A 5CPBA 3GUCA 3D7LA 2W2KB 4O5OA 3O8QA 4URFA 1PJCA 3DHEA 1HDGO 1R66A 1M2WA 1ADFA 1RM4A 1W6UA 2DVMA 2Q1SA 2ZJ1A 4KWHA 3UCFA 4JP3A 3GEGA 4QX6A 2PZJA 3AUUA 5A5FA 2DTXA 1ZMTA 4WEQA 1ZSNA 5DP2A 1KY5A 3WJ7A 3ITKA 1DFGA 3ZGYA 5I7EA 3L07A 3H9JA 4HFMA 3ZWVA 4N18A 4FPXA 1U3TA 1H94A 2VUUA 1VL0A 4Z9XA 5DDIP 4QFDA 4XX0A 1EBFA 1PJ2A 4GBJA 4CLOA 3GA0A 5L7YA 1ULSA 2GCGA 5IDYA 3GZNB 1C0KA 4GX0A 2C5EA 1HZJA 1QLJA 5H83A 1U3VA 5KTKA 2E82A 3IP3A 3TF5A 2YV3A 4I5EA 3FHLA 1GQ2A 1WWKA 3ICCA 3AY6A 4H7PA 4ROSA 3WLFA 1JKFA 4CM6A 3KBOA 1EUDA 3PYLA 3HDQA 4L4XA 4I5FA 4BO1A 3RUEA 2CMDA 2NTNA 3GDGA 2BFMA 4CQLB 4DXHA 2G76A 1Q0QA 4M86A 3WNQA 2PGDA 5AXAA 5HM8A 4BO2A 2CVQA 3BMOA 3IUPA 3OQBA 4EW6A 3WXBA 3FI9A 1P1IA 3LT4A 5B4VA 3VZSA 1T2CA 5F1KA 3I9OA 3ZU4A 5CAEA 2EG9A 5U4QA 4L4SA 3DMTC 4L9RA 1HYEA 1NR7A 1KEVA 4NBRA 4UVHA 1A7AA 3I3OA 5LDGA 4DYDA 1U8FO 4NZ9A 4W7IA 3QWIA 4WK6A 4I5GA 3KXDA 2OMEA 1IUKA 2GUGA 3K2BA 3QVSA 4C7KA 3U3XA 3WJAA 5TF4A 4UVEA 1R4MB 5ITWA 4YQZA 3H3FA 4GQAA 3DFUA 1RM0A 3H7AA 2NVWA 4PLCA 3GPIA 3VPFA 3QIVA 5EJ2A 2WJPA 2ZYDA 3MEQA 4AYSA 1XQ6A 4Z3KA 4JLWA 1PJ3A 5JE8A 3W4KA 3RKRA 4TVOA 4WLNA 4TKMA 4B7CA 2W4QA 4QO7A 3AI2A 4DBZA 4A27A 1MUUA 3GVHA 1HSZA 5CEJA 4NK4A 2FY8A 5IF3A 2EEZA 2WE7A 1QV6A 3BA1A 1VLLA 3QW2A 3WWYA 5C5IA 4D3DA 2JJYA 1Q1NA 1I8TA 1ZEJA 1PL8A 2C5AA 4Z0PA 2VCYA 3JQ9A 5GZ1A 5I9LA 1UXHA 3ZNNA 3AM3A 3GGOA 4EEZA 4EDFA 1ZK3A 2NVUB 5A9RA 5IXSA 2RCYA 4JBHA 3F47A 4NMHA 3O4RA 5K6AC 3GN1A 1U3UA 4A03A 3EY4A 1U8XX 3RIHA 4XYMA 4F46A 3ONFA 1T4BA 4WLEA 1BWSA 4BO3A 2YJZA 5T5QA 1EUCA 1H6AA 2HQ1A 4XWYA 3RKUA 2HUNA 3IDSA 5DF1A 5CDGA 3BZUA 3ZNQA 1E1NA 3FPLA 3Q6IA 3L4BA 1T2FA 4CR8A 2AHRA 5A03A 4WLOA 3W8DA 4RF3A 1NTOA 2D2IA 3LK7A 3JYLA 1P1HA 1CQIA 2GN4A 4UUPA 3RUHA 1LBEA 4JP2A 3WGQA 4E5PA 1XYGA 3WYBA 4ZN6A 2Y67A 3OICA 1MB4A 2HRBA 1ML3A 4NDNE 1YVEI 3FBGA 1EVZA 4BNGA 1LLQA 4R51A 1XWFA 4FDAA 1LDGA 5I7FA 4CM1A 5EQDA 4RJTA 3GAZA 1C0IA 4KQWA 1U4OA 4OQZA 1E1MA 1ZVMA 4IDAA 1O8CA 3E8XA 1ZW1A 3RJ5A 4MP3A 1U2GA 5TJ9A 4Q3DA 3SJUA 2WD8A 4FBGA 4OKIA 3FTNA 3PPIA 3L0DA 3JSAA 3DOCA 3OQ6A 3WGTA 4Z6KA 1JKJA 3TQHA 1V6AA 2YQ5A 2P5YA 1PU2A 3PJFA 1GYQA 2FR8A 1I10A 1U5CA 4WCFB 4YTEA 4XIJA 1CRWG 2DTDA 1R6DA 1HE5A 1ULUA 2DUUA 1GEGA 4D44A 2A9FA 4D3SA 1PQPA 4M87A 5G0SA 1DFIA 2ZTLA 2BF7A 2DFDA 2PV7A 4W9NC 5LC1A 2DBVO 1QYCA 1DLIA 1U5AA 2UV8A 4BNZA 4OOFA 2FR0A 2QRKA 5CP8A 3NYWA 5MDHA 4BQPA 1PJQA 1OZAA 5C7LO 3TL2A 1HF3A 4N5MA 2ZQZA 3TZQA 1PGQA 4DLBA 5DN9A 3EDMA 1P3DA 4GLOA 1GV1A 1LQUA 2PA3A 1DO8A 1YO6A 3Q1LA 1XU7A 3C7DB 3GH3A 4TRMA 1XEAA 2P9CA 5TRTA 3OSUA 1ENPA 4AG3A 3L9WA 4LCEA 4ND4A 3BHMA 3H8VA 2O48X 3QY9A 2O7QA 4CM3A 1UR5A 3RFXA 4BMVA 3CZLA 4B7UA 5BSHA 4E5NA 3JQGB 4UREA 5BQFA 1G0OA 3S2FA 3JQ7A 1QV7A 3JQFA 3PGJA 4H16A 1VJ0A 2Q1TA 4CUZA 5HS4A 4OXYA 3KEOA 2NUAA 5EMHA 5JXWA 1I3NA 3PTZA 2W2KA 3ITDA 1GFSA 1VL8A 1ZS2A 4R16A 3GNQA 1MW1A 2NLOA 4KMSA 1NBOA 4AJ1A 5JCJA 1I2BA 4GGPA 1YQGA 1UZNA 1L7EA 4Q3BA 1PWZA 1R0KA 3G17A 4EUFA 4JQCA 4WLVA 4L75A 3WYCA 4BO8A 3E9MA 1IPEA 3I23A 3O03A 1QLHA 1HDYA 2AEMA 1DIRA 1F12A 1QYWA 2VHWA 3OEYA 3UICA 4ZQEA 3ZHXA 4XIYA 3BIOA 3LT1A 3ZWWA 1P1JA 1U7HA 3B70A 4BNKA 1ZSVA 2GN8A 4HX5A 4WE3A 2HU2A 2JFHA 3WGOA 3DQPA 5TT1A 2X58A 3BMQB 5KJCA 3GZNA 3I83A 1GQYA 4BNVA 4DQXA 1H0KA 3IAHA 3WFJA 1E0DA 4YJGB 4AJOA 4CLRB 5C37A 2EF1A 5KVSA 2GO1A 2F1KA 4FLQA 1CWUA 5TLSA 3E9QA 1LDEA 3VKUA 4CQLA 2P2SA 4AICA 2YZ7A 3PHGA 3PI7A 1IHXA 5FFFA 3TSCA 2ILTA 3AY7A 3AOGA 4YQYA 5A05A 5CDSA 1IZ9A 4M89A 3D5TA 4LISA 2EV9A 3EK2A 1NAIA 1Y1PA 2VHYA 3PHIA 4GX2A 1D3AA 4I9NA 4P22A 3U09A 1ZK4A 3CEAA 3ZWMA 9LDBA 3UAGA 1MA0A 1JGIA 5JPIA 3D4PA 1XIVA 1YQDA 3P19A 3EHEA 4IM7A 5IN5A 3VZQA 4AVYA 4E12A 4YYZA 2C82A 1R4MA 2IXAA 4J43A 1GUYA 1EQUA 1TLTA 2DQ4A 2P68A 3FRJA 3LC7O 4RPGA 4B8ZA 2V6FA 1ADGA 3ZDFA 2QRJA 3OJLA 4J16A 3VTFA 2JFGA 4YA6A 3EZYA 3HN2A 3AU8A 3DC2A 5DZSA 4MVJI 3QWHA 2BFPA 3SC4A 4P38A 1U9JA 2GZ3A 4BNNA 4ZGWA 5F5LA 1PGOA 2FPPA 3GGPA 4UEJA 3DAPA 1NVTA 2IZ0A 4YAKA 4PLFA 2Z5LA 3STHA 2C7GA 1W4ZA 4LMRA 4P4NA 3ONDA 3AUAA 3VH3A 3FN4A 3M2TA 3NTOA 3TRIA 1OAAA 1DBVO 4IINA 1X1EA 3NDJA 4BO7A 4JNKA 4NH4A 1MC4A 2IYOA 1YE3A 1XLTA 4CM9A 4X54A 2QYSA 2NVUA 4YACA 1P0FA 1MG0A 2CNBA 2Q49A 3U0BA 3PJEA 3LLVA 5TT0A 4R4JA 3N58A 1RYDA 4JN6B 1T2EA 3IIEA 3ZW9A 1N8KA 4DA9A 3U49A 3JCZA 4DUPA 1J49A 4BKOA 1BMDA 3S8MA 2X1HA 4JX8A 3X2FA 3G49A 4K6CA 5JDCA 3MJ4A 4LVUA 2WM3A 3BYZA 4FS3A 4F6CA 4PG6A 4WGGA 3IJPA 4ZVVA 2HMWA 3GGGA 3I4FA 3S2EA 4A2CA 1YRLA 4RVHA 1M66A 1N7HA 3VPSA 1C0LA 4IS3A 1W8DA 3MJVA 4R1UA 3OEWA 3MOGA 2O3SA 2WPGA 3GG2A 2XF8A 3KOUA 2AE2A 3I5MA 3RC7A 3W8FA 1BGVA 1DJNA 4J4HA 3KEQA 3F5QA 2ZCUA 1ZJZA 3OBBA 2OGUA 5DULA 1QORA 3FR7A 4MKXA 3FPCA 5B37A 3VPGA 1E3JA 1OC2A 4QT0A 1N92A 2DPGA 2ZCVA 2PH3A 3DO5A 4IGFA 2QZZA 4GL4A 2QQ5A 4BNWA 4GKVA 2FRDA 3KETA 1FF9A 1C3VA 5L3ZA 2PZLA 3IC5A 4ZU3A 1C1DB 1U7TA 2PGJA 4RF4A 4XA8A 2DBZA 2EHDA 3I1JA 4RZHA 4ZRMA 1DC5A 3UGKA 3DFZA 4DREA 3BTSA 3AW9A 4XDZA 3KSDO 2GLXA 4WCFA 1DHRA 3KYCB 3EAGA 1DFHA 3A9WA 2VZ9A 4NFHA 2O4UX 1P31A 2GN6A 4PLZA 2NU6A 3ADOA 1DPGA 4GWGA 1E6EA 1NPYA 2UVDA 3CXRA 4BGEA 4RQTA 3QA9A 4YBZA 3BTVA 1KVTA 5EESA 1ZK0A 4Y98A 1N2SA 3G0OA 2UAGA 2OFPA 3TOXA 1ADCA 4EUEA 2I5PO 1E7RA 1U2DA 4XQ9A 4RVGA 1UP7A 2JD0A 1B26A 2E48A 1H5QA 2ZK7A 4YEDA 4MVJA 4IXTA 4HNGA 1B0AA 3D0OA 4LVCA 4BKRA 1D8AA 3P7MA 4FD3A 2FN7A 1DRUA 1VSVA 4UVDA 3ST7A 3ZW8A 3BTUA 4BKUA 2QX7A 2VTDA 4R9SA 3JD1A 3C85A 1P44A 4JROA 1H9AA 2ZB4A 4FGWA 2DUWA 4XKJA 3RC1A 4UVIA 3PQEA 4ND3A 2OBNA 2B36A 2VT3A 2PLAA 3EGOA 1XA0A 1PJLA 4II2A 3QVOA 3KV3O 2BD0A 1WNTA 3JQGA 5TJHA 2W8ZA 4BB5A 3NX4A 1NFFA 1AUPA 5AOVA 4C7JA 1QXSA 4BKQA 3NGLA 4HFRA 2VWGA 1A9YA 1PGJA 1A5ZA 4BNTA 1IZ0A 3COSA 3ZWNA 3AM4A 2X0NA 3PDJA 3WYEA 3UCQA 3WGYA 5CG1A 1HLDA 3OM9A 3D1LA 4IJWA 2FOIA 3C1OA 1OC4A 2ZTMA 2O3JA 3HFGA 5KJ1A 1H2BA 5DP1A 4M54A 2IEBA 1HDOA 3AI1A 5IJZA 4BKPA 2C54A 2FR1A 3WIDA 3VDRA 5A06A 2NU7A 3HWRA 3JQ9C 1ZNQO 3QSGA 3HQ4O 1QP8A 4HFJA 1SEPA 3ZU2A 2EJVA 3SJ7A 1I5RA 3LC2O 4DPKA 3ON5A 1E7MA 3EZLA 1HEUA 2FWMX 3B6ZA 1W73A 4YAEA 2B0JA 1ZMOA 2BLLA 1I36A 4S3MA 2ZKLA 1ZBQA 1MFPA 1KVRA 4ZICA 1LRKA 1C1XB 3C7CB 3KUXA 1GYPA 4PRKA 4XJSA 5KKAA 2O3QA 4KDEA 1ORRA 4NQWA 3BMQA 3K6JA 4BNUA 2AE1A 3L4BC 4DC0A 1NAHA 3QVTA 2BRUA 2BELA 4M49A 4D41A 4YJGA 1GCOA 4CLRA 4NBUA 1T4DA 2AMFA 4QO8A 3PHHA 1E3WB 4TQGA 1HDCA 2AA3A 2VQ3A 4BMSA 5HTOA 5EQFA 1DOHA 3CKYA 3X2EA 3Q0EA 2NU9A 1D4FA 4HBGA 5U9CA 1LDYA 1U4SA 2BFAA 1E6UA 3LU1A 3PWZA 2R00A 4CPDA 2Q3EA 3Q11A 4KWIA 4PVDA 1JLLA 1NASA 4RLHA 4RZIA 4CODB 3DZBA 3GY0A 4N54A 1Q0HA 1I33A 4GLLA 4LCJA 1RWBA 1X1TA 2BGMA 3T4EA 1IOLA 1ID1A 3WQQA 1RM5A 3MJTA 3GG9A 4NFSA 3G1TA 3RUIA 1EDZA 2FSSA 4B3HA 1HYGA 4JCOA 2CF6A 1H3LA 3IKVA 3ABIA 1IULA 1N5DA 4K6FA 4FR5A 3JQBA 2CSUA 3EW7A 3CZGA 2HMVA 1PGPA 4KOAA 1BVUA 4DTIA 3JQDA 1E5QA 7MDHA 2EP5A 5DNAA 4ZHSA 2NM0A 1Y81A 1HE4A 4KDFA 5ENVA 2YFQA 2PH5A 4O1MA 1LLUA 2X9NA 5G0UA 1T2DA 4RF2A 1GU7A 1P45A 1MXHA 1Q7CA 2OZPA 2PZKA 3JQ8B 1DC4A 1O6ZA 1O94A 2Y0DA 3DHYA 1ONOA 2D5AA 3MWDB 1TT7A 3OP4A 3JV7A 2AXQA 1CERA 4OYRA 2HK7A 1DLJA 1UXIA 5ADHA 3U9LA 1GDHA 1LEHA 4Q3NA 3WGIA 1E5LA 1A71A 3PIIA 5EL0A 1ISHA 1JVSA
chains in the Genus database with same CATH superfamily
1H5NA 4G8CA 4B09A 5I9BA 3AK4A 1KC1A 3CJRA 5KTMA 1A9QA 1Z56C 4QSMA 2OYRA 2JHCA 2X0IA 3L0SA 4N03A 4WACA 4YAOA 3U4GA 3A6GA 1TW3A 2Q1WA 1MIOA 4LOAA 5CW2A 2IOQA 3V7WA 2C2WA 4KSYA 1CPYA 1V1MA 5C35A 5FR2A 1W0JA 2FG6C 1SVOA 2VHZA 1L3BA 1M3SA 1MDBA 3GCWA 1U81A 3TNJA 1ONBA 2I4NA 2GB4A 2NSJA 3AY3A 1I6WA 1P6UA 2CXSA 2WHXA 3EWSA 3EFOA 4J76A 2DPYA 3Q3EA 2CVPA 2HPVA 5CH8A 3M9LA 2YFYA 2R66A 3HXLA 4LQCA 5IH3A 3RSZA 1QUEA 1NL3A 3HB9A 5K6TA 1K6XA 4CMAA 2PSFA 4NTZA 2ECKA 1HZZA 3QBJA 4PC3A 4MICA 4TWJA 1VE3A 3OFKA 3FTCA 2JCYA 3OPVA 2XRMA 3OZGA 2B4RO 3L8MA 4G0UA 1QX3A 3IQXA 3DBRA 5C8XA 1FP4B 1J9EA 2QPTA 4N12A 3RDPA 3U37A 4QUKA 5AVQA 1KKMA 4KRYA 4OSPA 5F35A 5LBTA 1M34A 5BYBA 2HQSA 3HJAA 5FI3A 2VN8A 1AKQA 1V26A 4C01A 4XRGA 5KNCA 2Z57A 2HHAA 4XIIA 5CJJA 4ONEA 3WLHA 1GSOA 1V48A 4MDHA 3TCKA 5ICSA 1HXHA 3AIKA 4DCVA 3JQAB 1L7AA 3D6NB 3SR4A 1M67A 4IR7A 1X3WA 1MV5A 3HDJA 2BBWA 3GFRA 3PBKA 4K40A 4CF7A 1Z28A 1NMZA 2INGX 2YMQA 2H1VA 1D7AA 3WX0A 1E3EA 1OLUB 5BN5B 2VWPA 2C9CA 5J5AA 1L2TA 2PD4A 2FZGA 3IAUA 4X1KA 4G0ZA 3NBXX 3PJDA 3P0IA 4M1TA 4Z0TA 3EY9A 4ZEVA 1JKIA 1P5ZB 3C3WA 3QX8A 4ZQHA 3DKRA 1MC8A 3HBAA 1D6NA 3UY4A 2NZ2A 3WB2A 5IKPA 3TZ6A 2P0YA 1HNZB 3KNZA 5G53C 3IEUA 3GIDA 2GM4A 1LI5A 5HQ3B 2JLSA 1VPVA 2C3MA 1XR3A 1ZRSA 3DNFA 5EXPA 1WDKA 3BDAA 3VVCA 4EKDA 3VAZA 3EOZA 3EYWA 3K32A 2YXBA 1XL1A 2J0QA 1ATZA 4IIHA 4BO0A 1G8AA 4OFWA 2QSZA 1TYAE 4JSTA 2XIJA 4QGBA 3IQIX 1ZIOA 3LTEA 5ALFA 5E9QA 1WW8A 3WRXC 4D45A 4EAAA 4U00A 4MCJA 2JAHA 4MWZA 4BX3A 3EGCA 3UQYS 4EECA 2RHTA 3DDCA 4W1SA 3RS9A 1ZIPA 3B3FA 3S28A 1OWLA 1UF9A 3C45A 3I0ZA 3RRFA 4DPLA 1PG0A 3DZFA 4XWKA 5KQRA 5BWNA 4XDYA 2JIRA 5JQGA 2QN9A 2ZM5A 1S02A 3CUYA 3PR1A 2HSWA 1T6XA 3PUVA 4ZC8A 1WHTA 1GG5A 3SEAA 2NGRA 3OC6A 1YCFA 1J42A 4LJKA 3OFVA 3PNQA 4AR1A 1LK0A 2A94A 5GONB 2PLNA 3BXOA 3SVTA 4QNMA 2G9ZA 3BJRA 5AM2A 1YONA 3U4MA 4HAYA 5AVTA 2VHJA 1X8LA 1FK8A 2DMRA 4RKWA 3I58A 5FAKA 3H1PA 4Q03A 5FR1A 3RU7A 1QTNA 4F9EA 3H5NA 5E4JA 4QZVA 4EL5A 3AVTA 3MTJA 4HNAB 5GJBA 3Q8KA 2GBFA 3IHLA 1SVLA 3MVEA 4QU0A 3S2UA 2FN3A 3WB0A 4MR9B 1JIVA 2EGGA 3AI3A 3GLTA 1HQYE 1ONNA 4Y2PA 1VGVA 1V16A 3JAWA 2JGNA 3GEPA 2RGCA 2WKSA 1DHTA 4FFLA 1AO0A 4NK5A 4RJJA 1KOJA 5C32A 2FX5A 3T1OA 3UPUA 3OHPA 2GFHA 3IE0A 4MRMB 4GEKA 3SXPA 4OJKA 4KGZA 4PSDA 4PYNA 4Q05A 4WNIA 2KYRA 5KYUA 2BMEA 3ZR4B 1UKAA 5FOUA 4J2HA 1W4BA 4RV5A 5JC1A 2I65A 1Z4OA 3DXXA 3KB2A 3AHCA 4GI1A 4XIGS 4M0MA 2O5EA 4AC9A 4FLMA 5EIHA 2I4MA 1JIKA 2H2IA 4FDVA 4OHXA 5AFSA 2ZJ6A 4QPPA 1HURA 4MAFA 3T54A 4DYHA 2Z6VA 3MJRA 5KJEA 1F2VA 2HEIA 1NIJA 1ZRHA 1SIWA 1FDIA 1NZJA 1IBKB 2AN4A 4RXMA 2XNKA 3HM2A 1KZ1A 2GA8A 4ZX5A 1E8NA 4R01A 5BSTA 3I2FA 3A28A 4ZYXA 1AKRA 1WXWA 1LTHR 2KWIA 2TYSB 3GRVA 3OVMA 4Y6GB 4DDMA 5BN4A 4DMFA 2VHUA 1ESEA 2QRVB 3NTRA 4BWYA 5KS2A 3T12A 4G65A 2PWPA 3AB7A 4ZAZA 3TG2A 1J4AA 3P5BA 1C1XA 1OZ0A 5JDCC 2Z6UA 3EQ9A 4AROA 3QTTA 3ZHCA 1FSGA 1KDTA 2FQ1A 5TEWA 3PC8A 5JJ5A 4O0LA 3EEBA 4LOHA 3IAAA 1IZYA 1CJCA 4JGIA 4QLBA 5CXUA 4KPUA 3MJEA 3CWCA 5JAQA 1UDBA 2X0RA 3IILA 5BN3B 1QK5A 2GZAA 3MB8A 4W5QA 1K9SA 4MV1A 1E1RD 2Z5FA 2ZB2A 3CR3C 2ZXUA 4MPTA 3R6WA 2AEJA 4OMDA 1TO6A 4HNRA 4Z1MA 3RHSA 3EMBA 3KTAB 5LP6C 2Z98A 4XX1A 1EE9A 3SHOA 1AXGA 3RVPA 2XMPA 3FBTA 3I8XA 4MUJA 5JVDB 1Q57A 3HHEA 3B60A 1E3DA 2FWJA 2KB0A 3PDIB 4YCJA 5LYJA 5CB6A 5AESA 4ZZ1A 2IYQA 1I2MA 3CR8A 5KYYA 1WETA 3STTA 3DVAA 1KMHB 1S9HA 3L8ZA 2MMCA 4XVRA 4QUAA 2I4OA 5J4YA 1RTTA 3JALA 2GZHA 1T3ZA 4LHYA 4PS1A 4KAJA 3DP7A 1VHLA 1RI4A 3EXHA 3QUSA 1G3MA 2I03A 4HQFA 3S5UA 4MCAA 3UT6A 1JIJA 4LJLA 5F1OA 4Z7JA 1UQTA 2DHQA 1CY0A 2DTEA 4KMMA 4EELA 4AP9A 2P91A 1TZCA 1VBKA 4DEYA 2FMUA 1SOMA 1YS4A 1DAOA 4KE7A 5JHHB 4Q3KA 5BN1A 1BH2A 3MT7A 2FW8A 4KUGA 3IV9A 1B6TA 3NJ4A 2XNCA 1BO6A 5KUTA 1N3LA 3LW8A 4UBJA 5JRZA 4IIVA 2ZJ7A 1M2VA 2JLYA 4H35A 1WDMA 4J0CA 3FYCA 4ZI7F 8MHTA 1HDRA 2HC9A 4Q4DA 1YS1X 1GR0A 2P5SA 2R5FA 1RP3A 3UTCA 3DNMA 3PC3A 1YXMA 4HH3C 4F45A 4LN1A 4YJFB 4NU5A 4I9FA 5FNVB 1OXXK 3F1KA 4JZYA 4EKNB 3U6KA 3L5OA 4QASA 2GVNA 4RKFA 3WGUA 1XZDA 5KC9A 4H27A 3GHHA 4HDQB 3T7RA 3LLUA 3A05A 3PUKA 2QZPA 1U2DC 2CF5A 1MVYA 1XN1A 2ZSJA 5HFAA 5H8WA 2BSQA 1HORA 5UKDA 2PMBA 1KTIA 3LA6A 1ILWA 1Z0ZA 1TLFA 4NU6A 2PJRA 1PS9A 1QO7A 1B74A 1U80A 2PBRA 4TL7A 3PNLA 2LNDA 3V97A 3IKTA 3RARA 2AEEA 1F60A 1H2XA 1PR3A 3DD5A 5CB4B 4N3BA 4HGZA 1XHEA 4HX2A 2D5CA 2J7KA 2R6HA 4N3NA 4C0HA 4RHYA 3F97A 2CJWB 1NUQA 4H6VA 4NESA 4HGPA 1MAUA 1JW9B 4KXQA 1S7GA 3BS4A 3C3PA 3KR0A 4ALJA 3ROQA 3O73A 4B1FA 3KTFA 1JPUA 4M8KA 4E30A 5G1OA 3DJFA 3WSTA 1U9CA 4YCLA 3IQFA 3GNSA 3BREA 4OIFA 5AKZA 1RWOA 1R9MA 1SY7A 4U02A 4WIAA 4CKZA 3QE2A 3A6DA 3K3PA 4A6XA 5CLIA 4AECA 4ZOCA 3LSYA 4JY7A 5DYGA 4G5FA 5K4GA 5IKXA 4Y1EA 5AM4A 4HX9A 4PCLA 4BB9A 1CEQA 5E6RB 1O08A 2B1GA 4BFXA 4JBXA 3NH6A 3T8YA 2L19A 3C7AA 1YQXA 3ZZMA 4IQ0A 3KDSE 3VSAA 1Y3DE 3B1JA 1QH1A 3QVGB 4IMRA 3TR5A 2JFOA 2Y2VA 4PM4A 1OZGA 3Q9LA 3JRWA 4OQXA 3I6MA 1ESZA 1BXKA 1H42A 1MX9A 2H4YA 5DM2A 4LGVA 1YZTA 3WGZA 2H2HA 4BY9E 1M7HA 1Z37A 2YVLA 3N0TA 5CLGA 4ZEXA 3F6EX 3IJ5A 4LS3A 2BHLA 2GHQA 2HXYA 2OLKA 3BSFA 3H4VA 2PFGA 5E2BA 2PG3A 2VPTA 1QGED 3EARA 4YONB 4CM4B 1L7OA 3C0KA 4EYSA 1GW6A 4UHCA 4JQSA 2BM0A 4B5KA 3D7KA 2EBHX 4O4LF 3OD5A 4KUEA 4DCPA 2VJCA 1BXZA 3TSYA 3ZD9A 1PDWA 4S1WA 4DM4A 4I4TB 1TK2A 3GX1A 4FB5A 3IP9A 5WRFA 1Y8RB 5HF9A 4R9NA 1Y3BE 2COUA 1M1YA 2FB9A 3PHCA 2QIPA 5J3JA 1J70A 2CB9A 3TB4A 1ZI9A 3SHFA 3K70C 1XWWA 3D81A 1BC5A 3WI7A 3ZXYA 1ZXLA 3QWFA 5CVEA 5AT1A 3NBAA 3X44A 5CB0A 2RIRA 4D9MA 3HKDB 2Y1OA 4HNTA 4ENPA 1YUBA 4I6EA 1C9MA 4YQFA 3ZH2A 4LZNA 2O8FB 3EASA 4HEA6 4MV8A 5DM1A 5CFLA 1S6YA 2GT1A 2Z3VA 4ND7A 4RV9A 1A1SA 3BRWA 5AVUA 4JU8A 1QYDA 1THGA 3F7TA 1OV4A 4TYPA 3IR5A 5H4HA 4FEEA 2PN1A 1L5GB 2P6NA 4BLPA 1R18A 2QX4A 3GJRA 5FV7A 3WE7A 5IT9A 1UKEA 1IVSA 4BZPA 2VDWB 4BUCA 1LBIA 1VSUA 5C8VA 5HZHA 2PUTA 4MV9A 5U4XA 1V47A 4XWAA 1FX1A 1H8ED 4EJMA 2BWJA 1SOVA 3QUBA 2OLJA 2NOAA 4U2KA 4NU0A 3IEVA 2RKBA 3CH7A 4ZVNA 1SCBA 4IDEA 3UAYA 1RXIA 4ZAFA 2GRJA 2IELA 4XEHA 5KVVA 5LP6F 4WZAE 4G9GA 3A4NA 2A5DA 3KO8A 4PVCA 1NMXA 5KTSA 2PUFA 4KYIB 3BIFA 2IUTA 4NVRA 1CUEA 3PUWA 4Q16A 4CTJA 3FZQA 4HUQB 1ABEA 1LKZA 1Y82A 3AZQA 4L78A 1E3TA 4YMUA 4TS9A 2JEOA 3G0IA 1BU5A 4K5OA 2V4UA 1INLA 2QRZA 2WPDA 4BUJA 2AX4A 3RRXA 4C08A 2FKAA 2XMQA 2DLNA 3ET5A 3IODA 2A33A 5B3AA 3PNYA 5EUCA 2PZMA 5JZSA 1TZ2A 4RVFA 4R83A 3KXLA 2PS9A 2UVPB 2P3LA 3BD8A 2L42A 4EEXA 4O4JB 5K4HA 3LQFA 3FCYA 3HDVA 4CXMA 4WZBB 3AVXA 2JVKA 3LRPA 2CFCA 4IBOA 2C03A 3GEIA 4NQZA 1QYVA 4RMIA 4X61A 3GRYA 5AJWA 3VNVA 2C29D 3RYFA 4BNDB 2Q99A 1M73E 3H2YA 3WRYC 1QE0A 4MR8B 1C0PA 1TIBA 1ZN9A 1PYOA 2G09A 3ADKA 1SXGA 4XQGA 3PPXA 5IBPA 2XHZA 5L4LA 2XEDA 4JV5B 1KI3A 1IUNA 1QP4A 1XALA 1PS0A 3N86A 3T3HA 2KE5A 5JS7A 5HJ5A 2G9NA 1U2TA 1CNEA 5CX4A 1Q1AA 5JO9A 5FKJA 2Z09A 2HT6A 5AK4A 3QKUA 1NQOA 1TYZA 1WEKA 4AMGA 1NDUA 3BB3A 1G8PA 3WA7A 1BVHA 1YASA 2WZQA 3ZS9A 4ZU1X 3BCUA 1DTWA 4PZUA 3WGJA 2HO4A 2Q6VA 1PHPA 2A0WA 4PLHA 5HIAA 2VCEA 3WYNA 4EHHA 2XBLA 2WUGA 3UPDA 2GMWA 2H00A 3WOVA 3DT9A 1Z33A 4TKLA 4EOGA 3CZPA 3LTNC 4BV2A 1OB2A 1QQ5A 2Z95A 3KVNA 3MWEB 5FI5A 4TXLA 4BQSA 3EOAI 4ZAYA 4AURA 3OUTA 1FFCA 4KP7A 1U6JA 3ETDA 5CX1B 3U7JA 3LC1O 4EK9A 1J2YA 2PNFA 2R1VB 4KXFB 1K1EA 2OWDA 2I6UA 2XOEA 3AEUA 3C1AA 1YRAA 2H16A 3TNYA 2H31A 4X1OA 5BR4A 3D0RA 5JSZB 5JVDF 1CLUA 3H2GA 4CMEA 5F4BA 1T29A 2OZLB 3RTBA 5TX7A 4WWHA 4HH1A 2QRGA 2XXBA 3DL0A 2W2TA 2QZSA 5CXQA 2Y1KA 3RQSA 1PZGA 1KO5A 2NXEA 3D6TB 3QBDA 2O3UA 4S24A 2O8DA 1YI0A 2CXPA 4DSOA 1BEZA 5FD8A 2GFQA 2TMKA 3TH5A 1Q0TA 5CMLA 1PK9A 1YS2X 1KI4A 1KI7A 1YV9A 3EUAA 4NMXB 5JJBA 1GGHA 3GV0A 4FKBA 2PE5A 4GICA 1WU8A 2AOVA 3MCVA 2PO7A 1BZYA 1NW8A 3FFBA 2B1JA 4EVIA 2FFLA 4L07A 5T7BA 1XKLA 4NFLA 3IV7A 3B89A 2R751 4OYHA 3ZGXA 821PA 1FYFA 2J5RA 1S3SA 4Q9HA 1OUMA 1TQDA 2BEJA 1JAXA 1DC3A 5EMMA 4YS6A 2W2OA 3AR6A 1LWNA 1SQGA 5EVCA 2PR2A 4YCBA 1G2OA 1ZONA 1ANKA 4A1OA 3QI2A 3K9GA 4P58A 4DV5B 3DBLA 1G2IA 2NAPA 4RESA 3PGXA 2ZANA 2ZB7A 5JNLA 3OQIB 4CMIA 4EKYA 4PHHA 4U6QA 2GM5A 5GZ6A 2GYUA 3ICWA 3A9VA 4QDUA 1VJTA 3GMIA 5JG7A 2GRAA 4IDPA 2I6XA 5CCBA 3EUFA 4GYYA 4Z2AA 4LTDA 1LS1A 5KYXB 3NUQA 4F4IA 4A6EA 4JUDX 2Q9BA 2JHPA 1QM5A 3OLQA 4C9BA 1HMPA 3UUEA 3ZVLA 1D0VA 1LLCA 2BEUB 3WV4A 4DL9A 2VYNA 3STXA 4B3FX 4WKPA 2IPNA 4X66B 2FVXA 2ZTVA 4X41A 5K2OA 4RTMA 1JQDA 1EFRA 1UPTA 2IHJA 1GNVA 1K2VN 5KJ6A 3HBNA 5HNFA 1CYEA 3OKCA 1QHXA 1T4GA 2X5NA 3UAXA 4A0FA 5HDQA 5CB4F 2VTVA 1DC8A 5EWMB 2JLUA 4MHTA 3OE4A 3E0XA 2DH5A 3NTQA 1Y37A 1FJXA 3H86A 4ID9A 4BLQA 1ZDMA 2B7CA 5KYVA 2FI1A 3V46A 4AO7A 4CMKA 2OBMA 2DKNA 3IQWA 3K0AA 3S81A 4ESEA 1TM1E 1LSSA 3O4FA 1F3LA 1G5AA 4N5IX 3VAYA 5IT5A 3Q3CA 3SQDA 1XRNA 5M5BA 3LVBA 4UFNA 5LM3A 1XC7A 4KTVE 2WZFA 2PUHA 2VXBA 1BMTA 3BE5A 1PL6A 4E2XA 3TI9A 2BMDA 1UBEA 3J81A 3FPGA 2HA2A 8ABPA 3UJHA 3EVFA 2QL6A 3D6AA 4YB8A 3HJUA 1L7NA 3AMVA 3GAFA 3QKTA 5CA0A 1PZHA 2JIMA 3IOBA 5AVJA 1NVXQ 3NIWA 1LC3A 1F2TB 2BHNA 2PUWA 2XYPA 3P1JA 1UJ6A 4JIMA 4NICA 4ENRA 1EVLA 1BSVA 1ZY2A 1K66A 5EP1A 3QJ5A 2NW6A 1OFGA 2P9TA 1LW6E 2QL5A 3GW8A 1XVIA 2QXTA 4GP9A 4MWBA 1HG1A 2LIVA 3FLAA 3GFBA 1QQAA 2JGAA 2YC4C 3BWVA 5DX8A 3TLYA 1ZD2P 2MMGA 2HHJA 1RKVA 1Z0DA 2R6JA 3I9NA 3MGGA 3V4PB 1WMAA 3L3BA 2C7VA 3KKPA 4AZ3A 1Y8ZA 5F98A 1OYVA 3L4EA 5AK6A 4GRDA 3OOHA 2P90A 4FCCA 3E2PA 1VLHA 2PGLA 2ZRGA 3SEFA 3NHSA 5JJKA 1SCKA 3LY9A 2QF7A 1QRDA 4RXTA 3OJEA 2I22A 2OCLA 2ZZNA 4XYBA 2HSJA 4P3NA 4Y2UA 1JFVA 1RLUA 3DEYX 3DPUA 1PJRA 5H4GA 4RHTA 2W6IA 1SHUX 2ZTHA 3HVIA 3PUZA 2BISA 4C7OA 5EE9A 4EYEA 4QYMA 8OHMA 4TKUB 2XGMA 3DB2A 2B83A 4KGDA 3OLCX 4Q00A 4IIUA 2P9EA 1VCNA 1EEXB 2AMVA 3EDRA 1BHSA 1IQUA 2RGEA 4BFYA 1QFZA 3BEOA 1Z5UA 2O0MA 1JAYA 3CH6A 3D4OA 4FC7A 4GX5A 2JFFA 4ZYZA 3KP1A 1WCIA 4QWWA 1CBUA 2NUPB 3JZIA 1RPJA 2FWBA 4YQEA 1H2WA 1U99A 2GAJA 1SURA 2C1ZA 2PO5A 1JMKC 4UUBA 3RG8A 3U7FB 1ISGA 4EA8A 1Z82A 1E0JA 3KRTA 4ENWA 2JLXA 1KPHA 4MWOA 2BLNA 3M5PA 2QTBA 5AVSA 4FLSA 1E59A 4KIJA 4MH0R 2YDXA 3SXUB 1DAIA 2Z3WA 4ENUA 5CD9A 2IDKA 4OBEA 4FEGA 4LW8A 4MV7A 4CNBA 5FDFA 1G20B 3DCYA 5C3UA 3WLKX 4REQA 1QVRA 2ZS8A 4MKHA 1V5FA 3P5SA 1CR4A 3IO5A 4PNEA 1DJLA 5G02A 2C5HA 3AO0B 3GVPA 4HLDA 2BMVA 4JWTA 1YSCA 4PZEA 3SX4A 3OZIA 3OAAD 3GDWA 1OWNA 3NAGA 3N8KA 2OO5A 4AMBA 4MUMA 2AB0A 4JQYA 1TLLA 3OIYA 4DRZA 1CR1A 2IPMA 4UHEA 3IUQA 4D99A 2XTAA 2I3GA 2BBSA 3ILHA 2DHDA 4YUZA 1EFCA 3FUXA 3EH2A 2EARA 5E6SB 2JGDA 3DTYA 2G67A 4BZWA 2XPYA 2X1VA 4JUCA 5CJPA 1XVTA 4I8XA 3FGOA 4B73A 7ADHA 1II8A 4I19A 3RC3A 1M75A 1O95A 5KAPA 1NLMA 4L74A 1IDN1 4CL0A 3RU3A 2XB4A 2RSLA 4P3XA 4AO6A 1BQEA 3DBHB 1JYEA 5AKHA 2M6KA 2JIZD 2QM7A 1ZAKA 1G5TA 1XZ8A 2ZATA 2FFRA 3NHPA 4BDTA 1FZQA 1YQUA 5IJWA 3C5WP 4IRUB 1D6SA 2EBFX 1TUGA 3PFFA 4KQIA 1KO8A 2I4TA 4G8JA 5C53B 2N46A 3FOBA 3HA2A 2G9UA 3OJOA 3ZLVA 5FWNA 2PY6A 3Q44A 1EFAA 3P9SA 3QKIA 2C2YA 4MIYA 5EIOA 3WNVA 2M98A 4GMFA 4RPHA 3HK2A 1X77A 2YUTA 2PGOA 3IPRA 1KZHA 5E4FA 3QFSA 4LXHA 5SZKB 2C9ZA 2J3MA 3BILA 3TM5A 1SUPA 3LCVB 3ZWKA 4MULA 3F5MA 4NCIA 2R6DA 4YMTA 2P6UA 1BXGB 2JVIA 3FTPA 2GAOA 3ZTWA 1LI7A 4C4ZA 2Z8ZA 3V2HA 1MENA 1QO0D 4WGFA 5AMXA 1FX0B 1X7DA 5EJGA 4CEIA 1C9YA 5J4VA 5IZCC 4LUCA 4UPVA 5H3CA 2VIIA 2F43A 1KYTA 3P4YA 2UXCB 1EESA 3MOSA 3ZXIA 1Y3FE 3OFJA 1EE2A 1EHCA 5DHQA 3D6VA 4DLLA 3ANTA 3TB6A 4GEGA 1NQTA 3F6RA 2ECPA 4RK1A 1GGNA 1N9GB 3INGA 3VC7A 3ZNOA 3NDBB 3U3KA 2FQYA 4J0HA 2IOFA 3H9UA 1QZXA 2FZWA 1ZUWA 1RYMA 2YN4A 5A4KA 1IATA 1LA2A 3D3WA 2D4AA 4C78A 4CMHA 3GU3A 3W5UA 4JX9A 1BAPA 2RHHA 3KZXA 4DWVA 4TS1A 4JMLA 2E21A 3KSZO 3WFIA 3F8WA 4D81A 4YUYA 1BMQA 3HGQA 1XGKA 1E20A 1FC0A 3TVTA 1TM7E 1UJNA 1UKBA 2YMPA 4X97A 4HRYA 3VOSA 1DQNA 4L8YA 4E88A 4D8VA 2HCTA 4DQKA 1WMBA 4BBZA 2V7BA 5AJUA 1V5IA 4DIMA 4CV2A 5B55A 1UT8A 2DLDA 5C1IA 3T9CA 4C1BA 4YDRA 2IS2A 1UDCA 4PFKA 3QLUA 4WEOA 1NZDA 3UAVA 1WP9A 2YYZA 3BAZA 3GGJA 5CLLA 3KWMA 1LFAA 5TEVA 3W79A 1KE2A 3ZVRA 2CMHA 2RG1A 4GZMA 4G5XA 4OAQA 1JIXA 2ONJA 3SE7A 1KU6A 2EIHA 3HJBA 2A7XA 2AG5A 4F2DA 4OA8A 1MG5A 3KT6A 4PC7A 3U40A 2OG2A 4OXKA 2CEAA 5L53A 3SG0A 3G8BA 4TN5A 2HDWA 2B98A 2OB1A 3RUDA 3HDGA 4EGSA 5EHGA 2BTQA 1P9WA 1YJAA 3O9VA 3OEEA 2ZJYA 4DNOA 3JVEA 1G6KA 1N7GA 4E1AA 1UJ2A 5BYAA 2A5YB 4BGDA 3NZEA 5DTIA 5JNWA 4GE0A 1NWCA 1JHZA 2ZSEA 3HCRA 4UM7A 1A0OA 2HWWA 1QJ4A 5DWVA 4B8YA 2B5VA 1RC0A 1YJXA 2HJSA 3CUEF 4YJHA 4DQVA 1U0NA 2JLWA 3OZFA 1KYIA 5IK2A 1N0UA 4FZVA 4WUTA 5SZHB 4AYXA 2CCJA 1OB5A 1XFAA 4FT2A 2EAUA 2PH7A 3CKMA 2GJ8A 4XSGA 3ZNPA 3OTOB 3PQ3A 2FHPA 3VISA 2QD4A 3VNAA 1Z5OA 1L4GA 1HS6A 5I7VA 4NATA 3CS3A 2DR3A 2PXAA 1US8A 4OGFA 4OUDB 3O4VA 1W4RA 1CUUA 1GRQA 4D3XA 2JB9A 2Z56A 4IH9A 2Z6QA 1I2ZA 3WQRA 3FKSA 2MWMA 4R3NA 3PLAE 4H7FA 5FPSA 4BU1A 4WRRA 2SKEA 5KWEA 1MT3A 1Q7GA 2JGEA 3U44B 2IYRA 3THXA 4NF2A 2ZRAA 3QPBA 4W63A 3UOAB 1IYZA 3GPBA 2AI2A 2JARA 1TF2A 3M5CA 5LN1A 1FTWA 1NJSA 1RRKA 4GDMA 3D31A 1ZUIA 5HS6A 3ETHA 3LRTA 2VATA 5LL6P 1XNRB 3T1TA 4ME6A 4EY6A 2R9VA 3GEMA 5BSWA 1WPRA 1VMAA 2ZUSA 4HP8A 2C84A 3RIXA 1Z83A 2N1MA 2VOJA 2ZJOA 5F7ZA 2WJHA 2J0SA 5L9AA 1NMSA 3UM9A 2CJXA 1OZHA 5ELMA 5KNDH 5C5DA 1F2UA 1V3QE 3O4IA 1LU9A 3WNZA 1V8BA 1E9RA 4KIUA 4L9AA 5ERGB 5A5DA 3IDZA 3U19A 2AXPA 2CNNA 4J4TA 1DAFA 4L8LA 2AC2A 2VPYA 4U3JA 3H0KA 3MF4A 4LXQA 1N2CA 1AGRA 1Q1EA 2P8SA 2E5FA 5ER9A 1Y7HA 1AKMA 3HO6A 5T3YA 1Z6ZA 2JHGA 2XT6A 3ZDEA 4CKBB 4EMSA 3KYIB 1KZYC 1FFXA 1YA4A 3KZCA 1NRXA 2VJBA 3NP9A 5T4FA 4WD3A 2DJ5A 4Z4HA 2JW5A 4JIGA 1S4MA 1KEPA 2J6BA 2YFHA 4PIPA 5F7OA 1Z6XA 3HLTA 4RLSA 5IXJA 2QTNA 2VPIA 2IE0A 2J9FA 4S1NA 1GVHA 2VXYA 2YJTD 4WXPA 2YS6A 4L5YA 1J2UA 1DCMA 1K08A 5B5SA 5F7XA 1EM8B 5CYOA 5HK8A 1LZLA 2DFLA 4UDOA 4Q7QA 4P0QB 1IIBA 3SVLA 2ZBGA 1B00A 1OE0A 2ICAA 1DOAA 3HC7A 3LP6A 5IDVA 2X5OA 4YXFA 3QTLA 5TR9A 3UFXA 1FMTA 4OHCA 4GMGA 2PM8A 5C18A 3FFTA 4BWFB 1OKKA 4C7XA 2BIFA 4UTOA 1M10A 2V4ZA 1XYYA 3R0XA 4HAVA 2OB2A 5CJ2A 2BHTA 1JFFA 1M2EA 2OORA 2ORED 3E84A 1CDZA 4QJ3A 3DDOA 4RSHA 5JH7F 2PL9A 3LBIA 4RTNA 1T8SA 1SNYA 3OF2A 4CLXA 1KJ8A 3I8SA 2O05A 4QUJA 3AR4A 1JEJA 2BGLA 2VR1A 3G0GA 3HU3A 3MZ0A 4GSKA 3HADA 4XWGA 4AG5A 4C21A 4MV0A 2OQ2A 3FTFA 4X7MA 4KSBA 4BQRA 3VZDA 1T0IA 3UH1A 1DT3A 4DAOA 1M76A 1PR4A 4EY7A 1CDDA 1JALA 2QVCA 5A7GA 1KRXA 1XP5A 3V8RA 1SVIA 4F2GA 3ROEA 4H4CA 2GKOA 4WAUA 4Z0NA 3HYTA 4MQEB 3STWA 3L40A 3DMTA 2G9QA 3SR3A 3B7TA 2VVTA 1A4RA 4FSHA 2FNAA 3I62A 4I81A 3M6WA 3O6VA 5CITA 2FPIA 5JS2A 2V45A 3FMGA 4S1VA 4ZAGA 1TVCA 4AX4A 2QTTA 2CC2A 4IUDS 4IIYA 4F6LA 4AQDA 3UJAA 1ISIA 4E5DA 5ALDA 3CY6A 1G21A 1T5LA 1Z4NA 1SVSA 3MERA 4E3WA 3QP9A 1HKUA 1V96A 1WPGA 1UM8A 2A3RA 2X5KO 2H9YA 3QPCA 4RTJA 1GAXA 4PX3A 1WEHA 2MINB 4J07A 4WJKB 2XWQA 3JSXA 4O2AB 1JG3A 4LDRA 5ALXA 1NX9A 3ODPA 1J8DA 1GCUA 5ER6A 5JAOA 1AB5A 4ZW5A 5FTKA 2F8SA 4WY2A 2I1LA 2C5LA 3JD4A 3JVIA 4G4GA 4PO3X 4AJKA 5HZMA 4CG0A 1F17A 2YY7A 1FEZA 2XWJI 5G4KA 2AW5A 1NYTA 3E15A 3A4VA 1UBSB 5I4KA 1NHGA 1VJCA 2ZBUA 4FCTA 1JHYA 4CM8B 2GPJA 3RTDA 2C07A 3WKAA 4LDNA 1ZCZA 4KNVA 3GT0A 1X1AA 2WIKA 1ISFA 1HBJA 1EX9A 1V4NA 1Y5RA 3ETEA 4IFBA 4P4SA 4WCDA 3RAGA 2R8ZA 1XZQA 2BBTA 2Y76A 3IBTA 4LVNA 3VR6D 4PINA 4NEQA 5EEGA 1M9NA 2C5ZA 3GJSA 1ZJYA 2LBPA 3PX3A 1KJJA 2X9VA 3OSZA 3RVRA 2HF2A 3BK2A 2XRZA 4R68A 1P73A 1SCQA 2HPOA 1I1NA 3A0UA 3PXAA 5CRIA 2Z8XA 5IBCA 4QPEA 1S3IA 5F78A 1OD6A 3A6EA 3R3JA 2G6BA 3FU6A 4BV8A 3NHWA 3Q3JB 4R69A 2G0AA 2PKRA 2H2AA 1E1QD 1FUIA 5CFMA 1Q0RA 2EEPA 5KTYA 2ATXA 1V1RB 3IB6A 3W2EA 3QE3A 2X8WA 1FXUA 3GJXC 4KMRA 5AVZA 2XW6A 3TGLA 1MIHA 1MPXA 2PIAA 1SHLA 4YRSA 2E18A 2XUQA 2P4UA 1D0IA 3BMNA 1X80B 4BVKA 3DV0A 2IHBA 1SIUA 3OM0A 1Y3CE 2QXUA 2ILVA 3A6LA 1CETA 1RE0A 4JFAA 4ER0A 3BSWA 5L7TA 2IBSA 2Q3CA 2VJAA 3LHSA 5EVJA 4ZU6X 5FL7D 2C4VA 5BNFA 2DCUA 3TM4A 1VJDA 4EKGA 5A5EA 4B7AA 4HB0A 1ZH8A 3PIDA 2R87A 5F12A 5IJAA 1ZN8A 2Q45A 1NJ6A 3O8QB 5K3DA 3ZW8A 5HXAA 4TN1A 1FNBA 3H1EA 3GELA 3PRJA 1RYBA 4D79A 1UMCA 2AS0A 1L4YA 3SJBA 1E98A 5IKEA 1Y80A 2O20A 2QJOA 3K2EA 3TUJC 2ALJA 4YRZA 3E7FA 4E08A 1ACJA 1ITZA 3JY6A 4C03A 1QMGA 1NF8A 5DMXA 1RM3A 2J31A 5EIAA 1ZINA 3UT0A 3O8RA 3S40A 3QELB 4DCUA 3H6HA 4FHGA 4PLPA 1TJ5A 4C0SA 5ESRA 5IVKA 5I4CA 2I2CA 3EXG1 1N0HA 2ZBVA 3I9FA 3MJCA 3GOHA 2EDAA 4HADA 3HXKA 4MVWA 4NZMA 1Q3KA 1TTQB 2C8JA 4X3CA 5FQNA 2WYUA 1OFUX 5CVDA 1G5HA 3VR4A 4URVR 3PEVA 3F6PA 3K9CA 3KIPA 4K9OA 4E7PA 3NIDB 2PYZA 4P4LA 5JS6A 1GGJA 4XX0B 3FX2A 4CLOB 4A36A 1PIWA 4ZA2A 3HBMA 1IY2A 5KU1A 1QUFA 1N5JA 3EQ7A 1GARA 3FWNA 4I1UA 3NHUA 1CJVC 3SQLA 1XLVA 3TEMA 4BN0A 4R8SA 3GUYA 4YROA 2FSVA 2OL4A 2X3UA 3HP1A 4GBMA 5JAIA 4KNWA 4F2HA 4RLFA 1OILA 3F7MA 1PW7A 3RIGA 5LOVF 4YJ2A 4OAOA 3MWGA 1E9FA 3REFA 2C3YA 4IFEA 4J0EA 3THWA 1Y8AA 3TFQA 1EWKA 4BLSA 2QL9A 5H82A 3CB4A 2GS9A 4D5GA 5CLFA 3T9DA 4U0JA 5DWQA 2VEDA 3L82B 4E2ZA 1VECA 2DETA 3H04A 1PX0A 2FMKA 2X9LA 4IDFA 1PEKE 4MPDA 5B3KA 2JANA 3CZKA 1C30A 2YJ4A 4YPOA 1ENYA 1Q44A 1GAJA 2XDQB 3DXFA 1U9YA 2NXWA 4H7JA 2VC2B 5LU8A 2D2XA 3C3DA 4UOQA 1NBEA 5JZ9A 1JTVA 1NJ5A 3A4YA 3FLBA 4F72A 1SXPA 3CHQA 1QRTA 1NVAA 2OP0A 3QV2A 3ZY3A 2VDRB 2Y71A 3JPYA 3PWKA 3R09A 3S2GA 3DYBA 1FP6A 2ZBFA 3HSSA 3CWZA 4LYEA 2LE0A 4N8DA 3W9BA 1S9DA 4AQ7A 1L1QA 2QAJA 1B0UA 2E9SA 2FWNA 4KZPA 3UO8B 5B3LA 1P1FA 1PLJA 2PYDA 3FF4A 1P19A 1ZM3A 3VDNB 3GF4A 5HILA 5B6IA 3C7KA 1CEYA 1C1HA 4HCJA 2J5XA 3AILA 3HCOA 1WS6A 4TSKA 1JA9A 1PQWA 1NP6A 3U7IA 3SYMA 1HPLA 1AKWA 1SG7A 3JD0A 2XVXA 1N2HA 5AM5A 1YVPA 3LPCA 3MD9A 4NJMA 3SYTA 3N75A 2JFPA 4WKCA 4EGFA 1YWGO 4UD6A 5REQB 1DCTA 3FUIA 3C98A 4ZGBA 5JALA 3IT2A 4KTTE 4DIOA 3VH2A 3A10A 1HE2A 1GR1A 3IAEA 3OIDA 4IV8A 5GAJA 2BCGY 4QOEA 1PSDA 1WW2A 2PUCA 4YRGA 3UFBA 1AHHA 2WQ6A 2IZZA 4EVRA 5DOZA 2HTEA 4J1SA 1EWQA 3GQBB 5DBFA 2BC9A 1PJBA 3R0ZA 4LSZA 2VO1A 2AZMA 2WE8A 3W3AA 4Q4LA 4UDXX 3KCNA 1I2DA 4C0KA 1IN7A 3UT5B 3GFVA 1W5FA 1GNTA 2GETA 4KWCA 4NG5A 4KO3S 3GI1A 4XWTA 5DSXA 3VO1A 3OX1A 4JJAA 1IHYA 1FJHA 4UJ5A 1E96A 2PUBA 1T0UA 1XQXA 2HWUA 3NT2A 3OI7A 1ZVQA 5T3UA 1WG8A 1WXQA 1DWPA 4ZXFA 1RRFA 3OQOA 1GY8A 5DNDA 5TY0A 5CVCA 2CUZA 1GLNA 4BHTA 1IJEA 4HAIA 2VFAA 1KSJA 2FFHA 3UH0A 4D0LB 2JLAA 5BSEA 5F1YA 3MK31 4JP5A 1EEHA 4K5MA 2ONZA 2NXCA 5I5EA 3CLKA 3SF0A 1IL0A 5DLQC 4UZSA 1JLHA 2II6A 4J6FA 5FNZA 5HRAA 5JNTA 5KNBH 2EX0A 4DA0A 2G8NA 3UEQA 1TVMA 1M2JA 4PAWA 1B3BA 1HSOA 5IXYA 2FDXA 3WTBA 1DP4A 1FRQA 1CQZA 2GM9A 3DMGA 3KXIA 2ZUCA 3KSAC 4HV4A 1K97A 4AYWA 2OGZA 4K6HA 5CIWA 4EJ6A 2G5CA 3NW9A 1X7HA 4WERA 4B7XA 4EM6A 1A1VA 1KYXA 3CX8A 3LG2A 2DWUA 1KDRA 5DRTA 5KX5A 1CQIB 4KLCA 1YF3A 4WXMA 1SM4A 1QZZA 4KFSA 5JQGB 1U0SY 2O14A 4BVBA 1IQPA 3KB6A 5ICEA 5A6SB 2IPLA 3ZHVA 4D97A 2UYGA 3OHSX 4L7VA 4RACA 1AUVA 3UOGA 1Q0SA 3PT9A 1QONA 4AZSA 2ZSDA 2WEKA 3UMVA 4OFXA 5DI3A 4ZTZB 4OBXA 4B3RB 1JR3E 4KRFA 2IS6A 1O5IA 4D8YA 1U7WA 1XVAA 2V6BA 2Z2XA 4F8JA 4DIDA 2FUG1 4CKEB 2FJPA 1X38A 2E3JA 4LMPA 2V65A 1FOEB 3IUSA 1HWYA 3PI6A 1ATIA 4V2UA 1DV2A 3FI0A 1K27A 4LBVA 4RWZA 1WV1A 5K0FA 3PDWA 4IHJB 2ODPA 1CUZA 3IOMA 4ML3A 2P3QA 2FN8A 3EJWA 5FLEX 5G0VA 1GUAA 2J5BA 2MSNA 1OLSA 5M29A 1WZCA 4XB1A 1EK5A 2GDZA 5K0ZA 1GZDA 2Y1GA 1GITA 1LDBA 4B7ZA 5E38A 2FPUA 2A0UA 1XMSA 2OY0A 3P4UA 4G84A 2QBYB 1YR1A 3WMGA 3I9MA 1PNRA 2WKWA 5I8PA 1XWIA 2QW8A 2JJQA 4XGKA 2A88A 4LCBA 3H2JA 4RTSA 3OU2A 1YDHA 3M3DA 4P7BA 1K9VF 2YFKA 1HC7A 3ZIAA 2GASA 4DCNA 4KB5A