4ZQGA

Crystal structure of the moraxella catarrhalis dox-p reductoisomerase in complex with nadh, fosmidomycin and magnesium
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 154
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqgA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqgA01
4NK5A 4GWKA 3V2GA 1ONPA 3ZH2A 3JQ8A 2F00A 3ZDFA 3GHHA 5JCXA 4GAEA 1MVYA 2WD7B 4GX2A 2Y93A 4NIMA 4BNVA 2O3TA 3T4XA 4LUPA 4YCAA 2HRZA 5C5IA 1VI2A 4IJVA 3GT0A 1SCUA 1YDWA 4JIGA 3ZHYA 5DCUA 5G4LA 2DPGA 1F17A 2W8ZA 3KB6A 2OFPA 3L07A 2VZ9A 5AXCA 5C7OO 3ROMA 5EESA 4Y67A 3P2OA 1L1FA 1VL8A 3PWKA 3DQPA 4I9HA 1WDKA 2PK3A 3GDOA 4QSMA 4XYMA 1ENYA 2I66A 4QFDA 2D1YA 3F4BA 4YJDA 3SLKA 1SC5A 1BXZA 3PTZA 2VHYA 4YJGA 4ALIA 2P2SA 2Q2QA 1RYEA 1AHHA 2VHVA 3KBOA 1XHLA 1XKQA 4GX5A 1BDMA 4IM7A 4R3NA 2WD8A 3VC7A 1I5RA 3WGTA 2DKNA 1YH3A 3AU8A 3OF2A 2HKIA 4PLCA 3RUFA 2W98A 4B4UA 4KWHA 2CZCA 2HK9A 4YQZA 2FPIA 3WTCA 4WASA 2HMUA 3WIDA 1F14A 1E92A 2P9CA 4IMPA 2NADA 4B8ZA 5ICSA 3HB5X 1D1TA 4FFOA 4K6CA 2UAGA 3ITKA 4QO8A 5TSDA 4DPLA 3HN2A 2W2LA 3WOHA 1H2HA 4A2CA 4YR9A 3K9QO 4TWRA 1FDVA 2FPPA 3HHPA 3TRIA 1F8GA 4H3VA 1P1IA 1HXHA 1LDMA 2V6FA 4Q3DA 4KP7A 5TGDA 1OR7A 3ZWCA 5L4LA 4CV1A 4E3ZA 2BGKA 1PJ3A 2H6EA 2CSUA 1O8CA 3GNQA 5DOZA 5BQFA 3OJOA 3S8MA 3RROA 1PEDA 2WE8A 4FIZA 4CLDA 1YBVA 3O38A 5FEUA 5MDHA 4DUPA 3EMKA 3JV7A 1LJ8A 1PJ4A 1U7HA 4KWIA 3RBXA 2VT2A 1EMDA 4G5HA 1H94A 3CZEA 3WSVA 4CMIA 4JCOA 1Q0HA 4X54A 5TRTA 5ITVA 4XIJA 3VDRA 4D3SA 2EGHA 4FJ2A 3HADA 3DDNA 5DULA 5J23A 4R41A 4M89A 4J3FA 1RWBA 2O4CA 1MGOA 4GLLA 1Q0LA 3CMCO 1IYZA 2G5CA 2W2LD 3HSKA 5JYEA 1J0XO 1QRRA 4ZQBA 1PJLA 2DUWA 1VKNA 3EY4A 4BNZA 5ILOA 5JY6A 3WFJA 3BA1A 7ADHA 3D4NA 2DBVO 2VWQA 5AXAA 3WDSA 3UH1A 4FC6A 5G0WA 1WMAA 2GLXA 4XWYA 4Z0TA 3BMCB 5BNIA 5DP2A 2AE1A 4N5NA 1JAYA 1GY8A 3AUUA 2BGMA 1QP8A 4R1UA 4WNCA 5LCXA 1C1XB 2DPHA 1LSJA 1GUFA 2C54A 1HYEA 3S2GA 1HLDA 1H2BA 4XB1A 5DCYA 1JKIA 2C20A 3W8FA 1HE3A 1Z7BA 3ROKA 4D3DA 2AQ8A 1P9LA 4JP3A 4O59O 5JDCA 3IJRA 1HE2A 1IE3A 1T1SA 4YYZA 3WYBA 3ZHZA 1Y9EA 4O5OA 5IN5A 4HFJA 4I1IA 1OAAA 2JCVA 2B4TO 4PLGA 3TZHA 2EKPA 4AJEA 5A3JA 2HJRA 4CM8B 3TOZA 1WWKA 3L77A 3A1NA 3D3WB 3QHAA 4DVJA 1E1NA 2IODA 1I2CA 1SPXA 1C0PA 2P5UA 3TJRA 1X7DA 4IGEA 3WB9A 3W6UA 4FQ8A 1I3NA 1NVMB 5AYVA 3AY3A 5AXBA 4B3JA 4CM1A 4Y6RA 1E6WA 1X15A 3L9WA 3RASA 4NNJA 3UUWA 4E2XA 2D8AA 3N58A 1MV8A 4UEKA 1C14A 1Y8QA 4Z0PA 4RDHA 1NPDA 1I3MA 2HRBA 2OBYA 3BMNA 2FSVA 2C2XA 2FZEA 1R0LA 1C0KA 1ZBQA 1N1GA 2WMDA 4HKTA 2WJPA 2FP4A 2NVUB 4R5HA 2GN9A 4UEJA 3CUKA 4CLRB 1C1XA 5FI5A 5I9NA 3I9OA 2AA3A 2W90A 3NTOA 2PD6A 4INAA 3HDJA 4AJJA 3ITDA 3GAFA 3NT5A 2CVQA 3ZWOA 2P4HX 2BI8A 2BFOA 1HEUA 2O3JA 4FGWA 1P45A 2QRKA 4L4SA 4EW6A 1X7HA 5G0UA 4TRMA 1NHGA 3R3JA 4WLEA 5JMPA 3M2TA 2YV3A 1YO6A 1CIVA 1QYXA 4XJSA 4R16A 3D5QA 1KY4A 2V6BA 3D4OA 3V8BA 1S6YA 1HE5A 4OHUA 3VZPA 4CM8A 2BHLA 1P74A 1BWSA 3BMCA 5B4TA 2CY0A 4NHEA 5L45A 3RUAA 3H8VA 1NASA 4CUZA 4ROSA 2O4UX 1VL6A 1VJTA 2DLDA 3DEYX 1PQWA 1Z6ZA 1KVTA 4PFJA 3GZNB 1LC3A 4IXWA 5LDHA 1JW9B 1AN9A 2IZ0A 4IZIA 2ZYGA 3TL2A 5GZ3A 1BVRA 4B3HA 1YRLA 4RVUA 1PGOA 4BUCA 1RJWA 4LVUA 4UVIA 5BSHA 3ANLA 4Y6SA 1H6DA 2Q4BA 3D3EA 5KJCA 3WG9A 2GN6A 2X5JO 3C3XA 4FJ1A 4YJFA 3ZGYA 3QRWA 4YB8A 5DBGA 1HL3A 2W4QA 4J1TA 4A0SA 1ADGA 1PGQA 3CZRA 1XU7A 4RF5A 3VAZA 2PD3A 1B7GO 4FOSA 3RU9A 1Q0QA 3EDMA 2FPGA 2X8LA 1RM4A 2JD0A 3UXYA 1YXMA 2I99A 4BGIA 2YQ4A 1ORRA 1ZK0A 2AW5A 2VUTA 3KLPX 3JYOA 3AUAA 3RSHA 5CDUA 4J91A 1WNTA 5G0SA 4CLEA 3F4LA 1H6CA 4J49A 1JLLA 3HE3A 1UP7A 4PLFA 4U7WA 3DBLB 4ZQEA 2AE2A 2FY8A 2X0JA 5HBRA 3V5NA 4CMEA 3H5RA 4HNGA 3NDIA 3QVSA 2QYSA 2ZK7A 1GZ6A 3JYLA 2X1HA 4I5DA 3OQ6A 3MJ4A 1D1SA 3VDQA 2YDYA 1KERA 2YW9A 1U3VA 1VPDA 5T6BA 3R3SA 1T2CA 1DPGA 2Z1MA 4J0EA 5I9LA 2AEFA 2ZIZA 2PNFA 4LCJA 1HYGA 5TT0A 2Q99A 1NR1A 4BNYA 1H93A 4NPCA 3RKRA 3DHNA 1PJBA 4U6SA 2X6TA 1PWXA 3GNSA 2BD0A 2Q49A 3KSZO 3PZRA 4IBOA 4IQGA 1WAMA 2HK7A 2ZQZA 1C0LA 4KQWA 1E7SA 2PY6A 5U4QA 4MVJE 4ALNA 1KEVA 1T4DA 4G65A 1H5QA 3EVNA 5ENDA 1HDXA 4JBIA 5B1YA 2NU8A 3PWSA 3HDHA 4BS9A 2GYYA 4L73A 1NNUA 1KETA 1M67A 3ZV6A 2ILTA 3PJFA 5CP8A 2FR8A 4ALMA 3DC2A 2OP1A 5KTKA 4NJMB 2JAHA 3TZCA 4OSPA 4RZIA 3D7LA 4BMSA 4HV4A 2R2GA 1KBZA 1JN0A 2C0CA 3DBRA 4I9NA 1QSGA 4FS3A 1V35A 3GPDG 1ZJYA 1E7YA 1RP3A 1DFIA 3ASVA 1HWYA 3ETDA 3JQ9C 2QIOA 4A5OA 3U09A 3BTUA 3GOHA 1T2DA 2Y68A 3IKVA 4ONEA 3F9IA 1R6DA 3IMFA 4WLOA 4R69A 3BTVA 3UEQA 1G5AA 4RVGA 5G0VA 3ZV5A 1WDLA 3PYMA 4TKLA 4W9NA 5A5EA 3TDKA 3ZHBA 4H15A 4XYLA 3DAFA 3HWRA 1F0YA 5F21A 4PN3A 5T8KC 4AVYA 3PXXA 4YRBA 3EC7A 3QIVA 1OZAA 3ICCA 4BIIA 2HMTA 1U5CA 3INTA 2NVBA 1E77A 3B20A 2J3HA 3GC6A 3L6EA 4G2NA 4B4OA 3PGXA 3IIEA 1OC2A 3M2PA 1AXEA 5CEFA 1WVGA 2VYVD 2ZKLA 4MJLA 5A9RA 4FBGA 3FCOA 1X7GA 1U7TA 2GERA 3TFQA 3DOCA 3JQDA 1YJ8A 2H5LA 3NJ8A 3BTOA 3QVXA 1V8BA 1EBFA 5FYDA 1E0DA 1PU2A 4Z3DA 3NGXA 3OH8A 5BSEA 3PK0A 5JNLA 3CKYA 3RC7A 1KEWA 3DHYA 4CJXA 2D5CA 1ADCA 3OEYA 2VT3A 1I3KA 3HZZA 4R3WA 3I5MA 3LF1A 3U4HA 3ZNOA 3QA9A 4PG4A 2UV8A 2DUUA 2Y1FA 1UXIA 5G2OA 2BI7A 2Z1NA 4FR5A 4UUMA 3LYLA 1YVEI 2NLOA 4RO0A 3NDJA 3MJVA 4K9DA 4BKUA 4ZQFA 1T4BA 3ZU3A 4KZPA 2V6GA 4TQGA 2Z5LA 2EERA 2G17A 5L4SA 2HK8A 1ZMOA 3CZKA 3PDUA 5TS3A 4CLHA 1U8FO 3BMQA 1JWBB 4ND2A 1M76A 4BNIA 1X14A 2VRCA 4J0FA 3LC2O 4XIYA 5F1OA 2X0NA 2OUIA 1MW3A 3SC6A 4ZQHA 1WZIA 1XG5A 3NAQA 5GY7A 3COSA 1ZUD1 4BV8A 3DFZA 3MWEB 1UZLA 3ZU4A 4BO4A 3DZHA 1E5QA 1XYGA 4HNHA 3KTDA 1H9AA 4NDNE 3LC1O 1E3LA 1A5ZA 2V65A 3GY0A 5GZ6A 3V1UA 4OL9A 4W82A 1G6KA 4IGFA 2I6TA 1PJSA 1XQ6A 4BO8A 4OM8A 3SJUA 1I33A 2R6JA 4FN4A 2ZTVA 4M86A 1Q7CA 1TXGA 1ZCJA 1TLTA 5A3VA 4EITA 2EEZA 4PLHA 5DNAA 1PSDA 1ULUA 1P77A 3RKUA 4PG8A 3UAGA 3ROPA 1EVJA 4CM5A 3P5SA 2E37A 2LDBA 5K9ZA 1O9BA 2GR9A 3JSAA 4YRAA 3A06A 2HMSA 1NQ5A 1K89A 2ZTUA 4E5MA 1KC3A 3JQBC 3PGJA 5HM8A 3JQFC 1B3RA 1U1IA 3GEGA 5F5NA 3OP4A 1VLLA 1KVSA 1BSVA 1FF9A 1UAGA 4PG6A 3PQEA 3LC7O 4NU5A 3EYWA 1EDZA 3VZRA 1MFZA 3G0OA 1GV0A 2DTDA 3JQGA 3NT4A 3WSWA 3Q0EA 4ND4A 1ONNA 1N1EA 5EN4A 2D5AA 2F1KA 1HRDA 1KVRA 4RPKA 2EIHA 2J6IA 2AQIA 1UDBA 2XPCA 3AI1A 4WNIA 3RUCA 4E32A 2GN4A 5JLAA 3KXDA 1RM3A 3V1YA 1UR5A 1UXGA 1YONA 4OKNA 4ESOA 4BB5A 1OI7A 1XEAA 2A9FA 2OHXA 3G79A 2O3UA 4PZCA 4Y98A 4EEZA 3UN1A 2ZATA 1MB4A 3RUEA 1EEHA 1R12A 4J9VA 2Y99A 4J2HA 4E2YA 4PIVA 2DBQA 5L3ZA 2Y1CA 4BB6A 1BW9A 3LQFA 1NQTA 4WCFA 3Q9NA 1R15A 3PLNA 5EERA 5TJ9A 3E1KA 5KWEA 3VPFA 4N7RA 1RYDA 1T24A 1ZK1A 2YYYA 3ENKA 4PRKA 3H5AA 5ADHA 4NK4A 2BLLA 1MFPA 3BAZA 2E48A 4XD2A 1LSUA 3DBHA 5ITWA 1IOLA 5FF9A 5FI3A 3BHIA 4WLVA 4BL5A 5JO0A 5A1TA 1ZK4A 4CQMD 2JFFA 4BO1A 1DSSG 4UEOA 3QVOA 4LSWA 3P19A 1QYCA 4DLAA 2CFCA 2NU7A 4EJ6A 1XA0A 2Q45A 3PFFA 3AJRA 1VKOA 5JC8A 3AY6A 1UZNA 5CG1A 1ZEJA 5KJFA 5COBA 4DA9A 3QVTA 2J8ZA 2PH5A 3OBBA 3ZWMA 1VRWA 2H63A 3PVZA 4CM4B 1NHWA 4L8VA 3C8MA 5CEJA 3ZWAA 2O2SA 4JN6B 2DFVA 2V6MA 3BZUA 4YAIA 3FNHA 3JQEA 4BKPA 4FFMA 1FDWA 4OXNA 3FHLA 4CQLB 2BF7A 3F5SA 2ZQYA 4PGFA 1BW9B 3F1KA 3ENNA 1BXKA 1V6AA 4A27A 3ZW9A 4CL3A 3M6IA 1SO8A 3GEDA 1E3WA 4EZBA 3FWNA 4LW8A 3TN7A 1GYQA 4DC1A 4RF2A 2Y0EA 4TMFA 3ZI0A 3OECA 4A73A 1ZS2A 1ZH8A 1KOLA 3W4KA 3H2SA 4OIMA 1A4IA 2VN8A 5CPFA 3ZWBA 3PQDA 2PZKA 5KNLA 3AOGA 1LBEA 1EZ4A 1PJCA 2PV7A 1PWZA 5IDQA 5JAZA 3QVWA 2DTEA 1GYPA 3DMTA 4JGBA 5DCWA 4HWKA 3ANNA 1H6AA 3AWDA 3U4DA 4RZHA 1LSOA 1DFGA 1D7OA 2O3QA 5DT9A 3DTYA 3QWIA 5H83A 1ISFA 3ADPA 3CH6A 5B4UA 4BKOA 3ON5A 3WGHA 5TQVA 3GAZA 1BDBA 4MPDA 4R9SA 5DZSA 3HQ4O 2Y1EA 3VH2A 3WFIA 2PGJA 2GPTA 2BFPA 1NBOA 5I7VA 1U2GA 2P68A 3DZGA 3PJDA 4FC7A 4DREA 2VWPA 4EI2A 1E7WA 4KUEA 4DIOA 5BSGA 2X4GA 3DZJA 2YZ7A 3VTFA 1I32A 3LT1A 4IIVA 3RD5A 2CMDA 1PTJA 2FHSA 2NQ8A 4DXHA 1V3VA 2Q50A 6LDHA 3GDGA 3G1TA 1NPTO 1AXGA 3PDJA 4OGWA 1QLJA 1P1JA 1GL3A 1PGJA 1W6UA 3GGPA 4TVBA 1GEEA 1Y7TA 1UP6A 2RCYA 5L51A 5IF3A 4OOEA 4KTVE 1H3LA 4MVJM 3GGGA 1ML3A 4DPMA 3JYPA 4DGSA 1E3WB 5AQ1A 3S2FA 4FLRA 1LTHR 4DWVA 1HDCA 3AUTA 4GSKA 3WYCA 3MEQA 2IE0A 2WD7A 1S7CA 3IOYA 3OA2A 4OH1A 3RU7A 4R1NA 3I3OA 1GDHA 3DONA 4NBWA 1JVBA 4D43A 2J3JA 4WUVA 1SEPA 4Z9FA 2CUKA 3AOEA 4FFRA 2G82A 3A9WA 5CDSA 5U1PA 1U28A 4M87A 3OFSA 4B4VA 4W7HA 5F1KA 2V7PA 1ZXBA 4DBVO 1LI4A 3K92A 3KOUA 3MOGA 4XCVA 5IAAA 4W6ZA 4L4XA 4Q39A 1VJ1A 2YY7A 5I7FA 4DMMA 1JDJA 2MAOA 4JP2A 4FCCA 2YFHA 4E33A 3E8XA 3A28A 1Y81A 4RV9A 2PGDA 4IIUA 2DVMA 1DLIA 3JQ8B 4YWJA 3KLMX 4GI2A 4EEXA 1DEHA 1HF3A 4OYRA 1YDEA 2I67A 2X58A 2W2KA 1LLCA 1EVIA 1YB5A 3DOJA 2VZ8A 5THKA 3JQ9A 3UGKA 4Y9DA 2VUSA 1ID1A 2VYND 3CXRA 4PLVA 1NFFA 4Q3CA 2WM3A 3VVCA 5EIOA 4D44A 1D8AA 1P0FA 2SCUA 1I24A 2IYOA 4Z3KA 3GR6A 3OJEA 4WLUA 4E30A 3KYDB 1P1FA 4J2OA 3OJFA 1M75A 1DO8A 3W1VA 1ZW1A 1A72A 4BNKA 2PGLA 5T8KA 2POQX 2D2IA 1Q7GA 2PH3A 2O48X 1R16A 3WBBA 5HWSA 1ISHA 3I23A 3DB2A 1GR0A 2A35A 4KDFA 1CQJA 5KJ1A 2JHGA 4BNHA 4Y6PA 4RL6A 4EBFA 2AQKA 1YL6A 1UXJA 2HCTA 2J5RA 1J49A 5ILGA 5CDTA 4RCVA 2UUOA 5FFFA 2EF1A 3GN2A 2YFQA 5KOIA 1ULSA 1GCUA 4C7KA 4CV0A 5JDIA 3T4EA 1Q7BA 2NTNA 4HFMA 3JD3A 1TVEA 4YQYA 4ZA2A 3JTMA 4B7UA 4FFLA 5EQDA 1O94A 2IYPA 2NUAA 1DLJA 5HRUA 1H0KA 2J3IA 1VL0A 3ONFA 4XDZA 1GZ3A 4UVGA 3K30A 4WEOA 4QT0A 3TZ6A 1TT5A 1AGNA 2ZJ1A 1EUDA 2YHUA 5B4VA 1HTBA 3AOEC 5A5FA 3RUIA 4BO5A 4DYVA 3KYDA 3L0DA 4RQTA 3ST7A 2NQTA 3NYWA 2AQHA 2VYVA 2RAFA 3PRJA 1PJ2A 4TRRA 4YA6A 2GZ3A 3TWOA 3JQAA 3HDYA 3CINA 1U2DA 4IJKA 4O0LA 3C7AA 1MXFA 1QMGA 3MOIA 3D4PA 3UICA 4JX8A 5IJZA 5KVSA 1DRUA 5B37A 4J43A 5JO9A 1JQBA 1Z7EA 1SOVA 1OMOA 3ROQA 1B8UA 1PS9A 3K31A 4E5KA 2Q4EA 5U9CA 5C37A 5JAIA 3FNFA 4AJOA 1LX6A 1HSOA 2C07A 1EK5A 4PLPA 1C0IA 1G0OA 1W4ZA 3FNGA 3QV1A 5JAQA 1Z74A 3WQQA 1YB1A 4ALJA 4Z0HO 4UULA 3R6DA 4I9UA 3QLJA 4CR6A 4D79A 4IMRA 1WP4A 1R0KA 4NQZA 3MJEA 3MWDB 2QG4A 2PWZA 4GH5A 4ND3A 1OC4A 2DFDA 2UDPA 3H7AA 5F5LA 2EXXA 1LRKA 1TT5B 2Q1WA 4BOYA 2WE7A 4CM9A 4ZU3A 3IP1A 5A9SA 4ND5A 3NUGA 3PIIA 4YEDA 1V3TA 1Y5MA 2QRLA 4RVFA 1K3TA 2UUPA 3JYNA 4GMGA 4GWGA 4B4WA 4E13A 4WOKA 4DPKA 4FLQA 3RFXA 4NJOA 4EUEA 3FR8A 3B1FA 4XRGA 2NTVA 4FGSA 3RAJA 4ZQGA 3OMLA 1O5IA 1NFRA 1R4NA 4U8GA 3WGYA 4Q9NA 4R5MA 2O50A 4JK3A 1P3DA 4MKXA 3ZZNA 1U3TA 4IDBA 2PZLA 1R66A 4YJFB 2Q1TA 3DXFA 5JXWA 4DTIA 4HFNA 4MVJD 3F46A 1UDAA 3PHJA 2RH8A 1DOHA 4NFHA 1O95A 4PG7A 4WPGA 1BG6A 5IFLA 2JL1A 2DC1A 2NM0A 2GASA 2B4QA 4W7IA 4CV3A 3SX2A 2FOIA 4XA8A 2B37A 2GCGA 3WQSB 2IEBA 3AY7A 1K6XA 2Q1SA 2X5OA 5G4KA 1PZFA 2I3GA 4E4YA 3PFWO 2FZWA 3ICPA 1R4MA 1JTVA 2B4RO 3JCZA 1N7HA 3GNTA 3S1LA 2NVWA 4EUFA 2LDXA 2QRJA 3U49A 4TROA 1IUKA 3D5TA 4WECA 2A94A 4WOJA 5BNTA 2GF2A 1A4UA 6ADHA 1T1RA 3NEPX 4OAQA 1MX3A 2H9IA 2P9EA 3TOXA 1TB4A 1VSUA 4PVDA 3CZMA 2OGUA 4YAJA 3B1JA 5EINA 3UCQA 3WGZA 2AG8A 4XB2A 3JQ7B 3LK7A 1RM5A 3WX0A 3QWHA 3K6JA 1PS8A 3AM4A 4QFCA 3VH3A 2X7HA 4HBGA 1QXSA 3Q1LA 1I8TA 3EUWA 3RJ5A 4BO0A 3ASUA 3H9GA 1LQUA 4LGVA 2VRCD 3GPIA 3D3WA 3GMSA 3HFSA 2PLAA 3BMOA 1FMCA 1NAHA 1J5PA 3IJPA 3E9MA 4KUGA 2DBZA 3GVPA 4BNWA 1K2WA 2TMDA 1O6ZA 3ETEA 1W8DA 2FRDA 3C1AA 4XQ9A 1PL8A 1CYDA 1XGKA 1BHSA 1YOVA 1DB3A 1SNYA 3Q3CA 2C7GA 2EP7A 5IG2A 4F45A 2NVUA 3VKVA 4XX0A 3OIFA 1S46A 4LVCA 5A9TA 1WPQA 2JFGA 4Q3NA 1YL7A 3PYLA 1DXYA 2QW8A 1C3VA 1NVTA 2B83A 3DBLA 4GL4A 1GADO 4M49A 1TA4A 1ZO8A 1B26A 3L6DA 1SAYA 1FK8A 5AVOA 4OMUA 5DBFA 2UVDA 5EMHA 3KSDO 4LSMA 2VCYA 3LLSA 4LMPA 3VVBA 4AJHA 1NTOA 2GDZA 4DQUA 1X1TA 1XSEA 1Y8QB 3ADOA 1YGYA 1YKFA 4OO3A 5JDCC 4E31A 1YQDA 4GSLA 2XXBA 4OJNA 1I2BA 4HUJA 4YPOA 2JCYA 4MKZA 1A9YA 2BKAA 4NMHA 3GZNA 4MVJP 1N2SA 3T7CA 1ISMA 3D0OA 4J90A 3F5QA 1IPEA 3C24A 1V9LA 3K5PA 3X2EA 1IULA 1QYVA 2IZ1A 2PD4A 4IS3A 4OQYA 2NWQA 3F47A 4CQMA 1HZZA 3IP3A 1DIGA 4GBJA 4WK6A 3I4CA 1E3SA 3ABIA 3GRKA 3JQ6A 2GUGA 4IS2A 5JCJD 2D4AA 2YV1A 4M54A 2J5KA 4W9NC 1OFGA 2P5YA 4GLOA 4MVJI 2RH4A 3WGGA 5L7WA 7MDHA 3UCEA 1ISJA 1E6UA 3C7CB 4Z6KA 2H1SA 5GZ1A 4E2ZA 3HNPA 2WDZA 3FSRA 1ZK3A 1DRWA 1LLDA 5FWNA 1PZHA 1JAXA 4RORA 4RQUA 2VNAA 4NJMA 4I5GA 3RWBA 1WLYA 5KVCA 1M66A 2I9PA 3ZCXA 4BO7A 4AJ1A 1LDEA 3Q9UA 3E48A 1XELA 4TVOA 3GG2A 3FPLA 4GVLA 4AFNA 1MG5A 1CEQA 2TMGA 4IINA 3VPSA 1Y8RA 2EV9A 1HDYA 4NQWA 3GHYA 1HSZA 5TX7A 3UOGA 5L7TA 1XDWA 2JKVA 4BQRA 5EQFA 3BIOA 4JJGA 1GAEO 2YV2A 4UVDA 4NBUA 2C2YA 4IUYA 4CM4A 2NU9A 5JDIC 1ZMTA 1DAOA 4HADA 4E2WA 5JS6A 1SEVA 1I3LA 3WBFA 1RPNA 4YAEA 4FB5A 5BSFA 2DM6A 1EQ2A 2CDBA 2ZB8A 3EVTA 3FTPA 4R4JA 4AJ4A 3DZIA 1M6HA 3ZU5A 4FPXA 1NFQA 1ISGA 3RBVA 1UXKA 5CG2A 5DDIP 3OICA 3UFXA 4XQGA 4OXKA 3K2BA 5TF4A 3FPCA 1FDUA 1DJQA 1QR6A 1R4NB 3G17A 1T2FA 1BXGA 3OJ0A 4PZDA 3RCBA 3I6QA 1PX0A 1TEHA 1B15A 4FSHA 4MKRA 3VTZA 3FI9A 4ITUA 1GTMA 1BMDA 4RDIA 4L76A 2VZ0A 2W2KB 4BGVA 1RKXA 1HLPA 3NTRA 4C7JA 3E82A 3JD2A 5JW6A 3Q2IA 2VYNA 2C59A 3DBVO 1FJHA 4B79A 1UDCA 1GD1O 1YBAA 1EVYA 1E3EA 1NM5A 1X13A 4Q3BA 1RM0A 2R00C 3H4VA 4J7UA 2UYYA 3O8QA 1E7RA 3OJLA 5KKCA 5C3MA 1GQ2A 2I65A 3DL2A 1FXSA 2OP0A 4J7CA 4EYEA 5I8WA 3GZ4A 4H16A 5DOVA 1ENZA 1GQYA 3UHAA 3INGA 3IQDB 1N92A 3WIEA 2HAEA 3IDSA 2VUUA 1JA9A 1H6BA 1PGPA 3PPIA 1DC6A 3DO5A 1AUPA 5IZCA 4YAGA 3GQVA 4EJ0A 4BQPA 2MAPA 2ZTLA 4L75A 4F46A 4XKJA 3K8ZA 4O63O 3DR3A 1YE3A 1B14A 2DAPA 3F3SA 3OQ1A 1UXHA 4ND1A 4WCDA 1EFLA 3AI3A 3ZNPA 4D0SA 1LC0A 1M6WA 1QV7A 4LMRA 5JCJA 4DRYA 1EUCA 4MP6A 1SMKA 3PZBA 4CM3A 3KO8A 1Z75A 5THQA 5MGBA 1NXQA 2WTBA 1UP4A 1JKJA 4L4RA 3I9JA 4BO6A 1C1DB 4JXKA 3N74A 4IY1A 2B5WA 5JYDA 4HFRA 2DTXA 3VZQA 3MCVA 2PZJA 1IPFA 1BXGB 3W4JA 2AEJA 3AU9A 1NYTA 1P1HA 2OO5A 4PG5A 3Q2KA 2HLPA 4ZJUA 3LT0A 2HMVA 3EK2A 4DC0A 4MIEA 1NVGA 2Y67A 1KY5A 3FTNA 3RC2A 3WTBA 4LN1A 3ZN2A 3LT4A 1PS0A 1PGNA 2O3RA 4GPD1 3WMWA 4CMIB 4ZICA 2ZCUA 3H9EO 2BMAA 3WNQA 2O7QA 2VHWA 1BVUA 4MIOA 3H2ZA 2VHZA 1N9GA 1YS4A 5CDGA 1P44A 1T26A 2CF6A 1IZ9A 3ONDA 3P2YA 3A14A 4O6VA 1ZFNA 4QTZA 4YXFA 4CMAA 4U0JA 3VHRA 4MVJA 1F12A 4GMFA 4EDFA 4I8XA 1X0VA 5A02A 2QYTA 3W8DA 3IC5A 3B1KA 1B0AA 3WJ7A 1KEUA 1SOWA 4YTEA 3VPGA 1DDOA 3EAGA 1CF2O 3L4BA 3R1IA 4A26A 3HJAA 4JBHA 4RLHA 1C1DA 1VC2A 3CPSA 2IXBA 1DAPA 3JQCA 4XJTA 2OOSA 2ZJ0A 2GNAA 1B8PA 1T2EA 3H9JA 1QYWA 3GRPA 4UVEA 4TRNA 4UAGA 4KQXA 3LT2A 2BFMA 1E7QA 4CM9D 3KV3O 5I7EA 4MVJH 3JQBA 3KM0A 3DOOA 3IAHA 4IDDA 2WYWA 3BYZA 4EJMA 3PHLA 3R0IA 4DBZA 3QQPA 3RI3A 2Q3EA 1GV1A 5T67A 3C7DB 5I8ZA 2X23A 3P7MA 3S2IA 3PHGA 2OORA 3W6ZA 2GSDA 1DFHA 2JJYA 1HYHA 1G0NA 1UZMA 3CSDA 3IUPA 3IUSA 2E82A 4PVCA 3RC1A 3GDFA 3HDQA 1WXDA 3DMTC 2Q1UA 1NQOA 5IN4A 2O7SA 4D0RA 1LLUA 1U3WA 3G49A 4CMCA 2HO5A 3GGOA 1Y5RA 4IDCA 1IZ0A 1UH5A 3K96A 3OM9A 5L40A 4DIBA 3LSYA 5C7LO 3GUCA 1DIHA 4PLYA 4D45A 2AXQA 2Y0CA 1LDYA 4BNXA 3WICA 4CODB 2CNBA 1HDGO 3VKUA 2EW8A 2DBRA 2QZ9A 3F1LA 2GGSA 2R00A 2X9NA 1PQUA 4R9RA 2FSSA 4C4OA 3L6OO 4NH4A 4N5MA 2GN8A 2DU8A 3C1OA 5T5QA 4E12A 2O3SA 1ENOA 1CRWG 1DHRA 2HUNA 5CDYA 2EJWA 2QZZA 2VNSA 2Q2VA 2IZZA 4YJHB 3KUXA 3SJ7A 5HS4A 3WYEA 1YQGA 3WGOA 1IHYA 1U9JA 1XR3A 2EW2A 4JNKA 4GVXA 4ZN6A 1HETA 3ZWYA 4UUPA 4J1QA 3V2UA 2C82A 1LNQA 4YAKA 2ZYDA 3C85A 3B6ZA 3W4IA 2FMUA 4R1SA 2G1UA 3WNVA 1ISIA 4XQCA 4FD3A 2CDCA 3ZWWA 5C7IO 4YDRA 4R68A 3SVTA 4S3MA 2VWHA 3Q11A 2X9GA 3SLGA 3AW9A 4S1VA 3FD8A 1IHXA 4XGNA 4BNFA 3D64A 2PKQP 1D3AA 2GD1O 2C29D 3K73O 4FFPA 1ENPA 3VZSA 1VJ0A 5CAEA 4YACA 4GGOA 2CVOA 3U62A 1HT0A 5TT1A 2CD9A 1YQXA 3KZVA 1QYDA 3NRCA 4B7CA 4D3FA 3EHEA 3S2EA 2ZB3A 1LQTA 3JD4A 4K28A 3PJGA 1KIFA 1YL5A 4MDHA 2A4KA 3V1TC 5JAMA 4Q3AA 1E3JA 1Y9AA 2CF5A 2OL4A 3ZNQA 4AJIA 4CPDA 1KC1A 3G3EA 4WLFA 1HDOA 1HZJA 3GVHA 4XGKA 3UCXA 3LLVA 3ZV3A 3ULKA 4ALLA 3ZNNA 4CLOA 4MIYA 2YHIB 3QWAA 1EQUA 1DIAA 3GVCA 1EFKA 2AEMA 5LDGA 2E6UX 3VPXA 2IEDA 2VTEA 4YT5A 1MXHA 4RJTA 5KIAA 3F6YA 3PYXA 2CDAA 1CDOA 1UAYA 4KDEA 1W73A 3AFMA 1CJCA 1B2LA 3GUYA 4AL4A 1KS9A 4II3A 4G81A 4FLSA 4P4LA 4EUHA 1JWAB 3PJEA 3RC9A 1NWCA 4WE3A 1I30A 1P0CA 3NT2A 2BFAA 5B12A 4JLWA 1NWHA 4PZEA 1UUFA 1I36A 1X0XA 3NKLA 4NFYA 2PTGA 4Q3EA 1GCOA 3EGOA 5K6AC 4IQ0A 3E5MA 2XOXA 2XF8A 3Q6IA 2WYVA 4YRDA 1L7EA 8LDHA 3WXBA 4RVHA 5JMWA 2FR0A 3H5NA 1KVUA 2BH9A 3UKOA 4CM6A 5I7SA 3CEAA 4MP8A 5KKAA 3E6AA 3PP8A 5I9MA 3NJ4A 4TRJA 4L9RA 4DMLA 4QEDA 3AUSA 3OIDA 3QW2A 1PR9A 3GVXA 3GFBA 5BT9A 3ZWXA 4CMJA 1JG9A 2VOJA 2GO1A 2NNLD 3GLQA 1GUZA 2BGLA 1BGVA 4F6CA 4AICA 1W0CA 4OQZA 1ADBA 4UUOA 5IDWA 3UF0A 5DP1A 1DIRA 3KEOA 5G4KB 3OETA 3B70A 4KTTE 1KEPA 3VPHA 5CHEA 4D46A 1G1AA 4XQEA 3EZLA 2VOEA 4NR0A 4P4GA 4CUKA 4DYDA 3U3XA 1JGIA 3GA0A 4WGGA 3LDHA 2JCXA 5EPOA 3I83A 4W99A 3FBGA 3DHEA 2HMWA 2DQ4A 2WYUA 3HG7A 5TJHA 1A71A 1PR3A 1MG0A 3CIFA 1YWGO 3BHMA 4QECA 2PZMA 2ZB7A 3S55A 3RFVA 4CLOB 3FN4A 2WEKA 2HU2A 3HN7A 3NTQA 5IDYA 3LZ6A 4AJ2A 4XYBA 5A06A 3ORFA 4WJZA 4EGFA 1KVQA 5A4DA 3MJCA 1HDZA 4F3YA 1EDOA 3X2FA 3ONEA 2VHXA 5TNXA 4K6FA 2OXIA 4Z9YA 1T2AA 3KYCB 3DMYA 1PZGA 3L4SO 5KJ6A 1HE4A 4TKMA 1JKFA 4WEQA 3U9LA 1AE1A 4MVJF 4RGBA 5IXSA 4XDYA 4M55A 3PHHA 1I0ZA 1ZSYA 3NV9A 4LISA 1GPDG 1K5HA 2BRUA 3IL2A 5T57A 3STHA 2JD2A 1ZNQO 1PL7A 4WKGA 2Q2WA 1B16A 1PJTA 1I2ZA 4GKBA 4P22A 1A7AA 3PIDA 4BGEA 2NSDA 1U8XX 3DAPA 3BTSA 4FJ0A 4IQ8A 3WWZA 4DLLA 4H7PA 3LVFO 3AI2A 2FWMX 3GFGA 1K0UA 1I01A 3U0BA 4BMVA 4MOWA 4E21A 3VH1A 1XU9A 4NBRA 4P8RA 4AJNA 3DZKA 4B3IA 4II2A 3I9MA 2GZ2A 1LRLA 4IPTA 1A7KA 1DHTA 5LC1A 3JD1A 4K1LA 1LU9A 1E1MA 4YJGB 4CR7A 4O1MA 1Y6JA 1ZSNA 3GK3A 3BHJA 3RFTA 1EE9A 4E0BA 1MUUA 4LK3A 4BV9A 2X5KO 1JU9A 3AM3A 1XLTA 4ZHSA 3O8QB 3AFNA 3O26A 4B7XA 4NBVA 2JAPA 3OIGA 1M2WA 1N5DA 1R4MB 3M1LA 4OOFA 2O2YA 3TNLA 4IDFA 3LF2A 3NDRA 5A9SB 4AJKA 1L7DA 1LDBA 2C7VA 3G1UA 3GN1A 1LDNA 3I9LA 3TL3A 1TT7A 2E4AA 1GZ4A 1GUYA 2EJVA 3N7UA 3DBRB 3DTTA 2E49A 4BHTA 1R0SA 1MW0A 5HA5A 1FDSA 3GG9A 1R37A 3UVEA 3BMQB 2QHXA 2HJSA 3FNEA 4HP8A 1OOEA 1NAIA 4QO7A 4XR9A 4YT2A 4FDAA 3ZV4A 1NQAO 5TIIA 1XQ1A 9LDBA 2FR1A 1U4OA 2RHRA 4BVAA 1YB4A 1NP3A 3DZBA 3TSCA 1E1LA 4GQAA 1QLHA 2YDXA 2BELA 3DWFA 4ZRMA 4M1QA 3U4IA 1F8FA 3TF5A 2P91A 4OKIA 4BNMA 4BGUA 4J1SA 2QX7A 3QE3A 4B8WA 2Y1GA 2RBEA 1P31A 3EW7A 3KHUA 4JJFA 1WW8A 4W4TA 5CEEA 1N9GB 3T7EA 3OHSX 1EVZA 3FR7A 1LA2A 4FW8A 4CMHA 2ET6A 3RIHA 4PLTA 3WR5A 1E7MA 1X1EA 2YHIA 4I5EA 3JQAB 4CV2A 1JVSA 5JPIA 2AMFA 4OSOA 4KOAA 1I10A 1LSSA 4TZKA 4R1TA 5G0TA 3W8EA 1HKUA 3O9ZA 1DC5A 5DF1A 5KVQA 1K6IA 4I08A 2RHCA 1VM6A 1DBVO 4RF4A 3JD0A 3PLRA 2B35A 3JQ7A 2X22A 1Z45A 2J5QA 5AOVA 5BR7A 4AG3A 4KUHA 4RPLA 1H9BA 1EBUA 3DFUA 4I5FA 1SB9A 3UW3A 3CZLA 2DT5A 1SC6A 3I9KA 1DIBA 3TPCA 3UERA 1AHIA 3DAGA 3E5RA 2PKRA 1J4AA 4JBGA 4BMNA 3KRTA 8ADHA 3MJSA 4E5NA 1YBMA 2X0RA 1ARZA 3GF4A 4CL8A 3BMOB 3ZWVA 4AJLA 4J16A 4PLZA 1IY8A 1DC4A 4BO3A 3RUDA 4P4NA 5L4NA 3TQHA 4DLBA 4CMKA 5JC1A 4P38A 3GEMA 1GPJA 1NR7A 2P9GA 3WLFA 4NZ9A 2B36A 3WMXA 1U3UA 2VQ3A 3CMMA 4IJWA 1V0JA 4XGIA 3H65A 2HSDA 3L9XA 5F1PA 2RIRA 3FF4A 4ZGWA 3H9QA 1LUAA 4QX6A 1GFSA 3UCFA 4HXYA 3V2HA 5IDXA 1ZJZA 4Y8VA 1MW1A 3ANMA 4CM7A 1E5LA 4WCFB 4E5PA 4RPGA 3RJ9A 2PR2A 4NU6A 1QG6A 2B69A 1LEHA 1MC4A 2X86A 5DN9A 2I76A 3IKTA 4GGPA 4IZHA 2AHRA 2Q46A 3RUHA 2D0IA 3A4VA 1P1KA 4CQMB 1LRJA 5L95A 5COAA 5H82A 2HDHA 2GRAA 3OEWA 3IS3A 2XAAA 4DQVA 2NTJA 1B3BA 2IDZA 1IL0A 2X9VA 2JD1A 1Z82A 2JFHA 5HTOA 2G76A 4NFSA 2NACA 4IJUA 4QUKA 5ER6A 3E03A 5JSFA 4MO2A 4MP3A 5TC4A 3H9UA 1EUZA 3ZU2A 3GH3A 4JJIA 4IXTA 3RVDA 3O4RA 4URFA 2ZCVA 3I52A 1OBFO 5IZ4A 3E9QA 4YJHA 5JFOA 2IXAA 4J4TA 4R51A 4AJPA 1YJQA 4ILKA 2YJZA 1MP0A 3QP9A 1CQIA 1O89A 4CLXA 3KYCA 3BMNB 4TSKA 5K6AA 2B5VA 5HS6A 4XYEA 1ZIDA 3QJ5A 1GYRA 2Y66A 2B0JA 2C5AA 1PQPA 4MVJG 5K0ZA 1GEGA 4NI5A 1A9ZA 4QQRA 4YT4A 1TI7A 3WWYA 4BNLA 3OA0A 2QQ5A 3QWBA 2NU6A 5L53A 4AYSA 4M8SA 1PL6A 1CETA 2GZ1A 4ZRNA 4OXYA 1D4FA 4E6PA 3HUDA 4IDEA 4UUNA 4D42A 3INRA 4XEHA 2EP5A 3JQFA 3SEFA 1CERA 1GU7A 5TLSA 4J4HA 3ZWPA 5H81A 4UVHA 4CUJA 2C5EA 4BNTA 5CFZA 4FLOA 5EJ2A 1U4SA 4MINA 3I9NA 4GKVA 1MW2A 1Y1PA 1O0SA 2EHDA 4FFNA 2ZTMA 3O03A 1QV6A 2PA3A 4UREA 4CXFA 5COQA 1B8VA 5JE8A 1SZJG 3E18A 1EK6A 5A05A 1BTOA 1CWUA 1DC3A 1PJQA 4ZVVA 3C1TA 3DBHB 1ADFA 5AXDA 2OBNA 4ID9A 3K2EA 5F3RA 3QY9A 3QWFA 2X0IA 2CVZA 2Y1OA 4Z9XA 1FDTA 1P1RA 2P4QA 5KVVA 1ONOA 3GVIA 2OMEA 1DRVA 3QSGA 4N5LA 1VE9A 1Q2XA 3DZFA 4YBZA 1NPYA 3BXXA 3I4FA 5ICMA 3LU1A 4XZ3A 4L0QA 4PRLA 3FRJA 4NG5A 3WGQA 1VSVA 4JQCA 3MJTA 4WCFC 3KVOA 3ZHXA 3I6IA 4J6FA 1U5AA 3OSUA 1XIVA 3VH4A 2G0TA 2ZYAA 3PEFA 3CE6A 5DBIA 3ZWNA 1LDGA 4ALKA 4XRRA 4J7XA 4HX5A 3WLEA 3H6KA 5JBIA 2WSBA 2PKQO 4BO9A 4D41A 4IDAA 4LRSB 3RBZA 3JYQA 3FBTA 4XR4A 2A92A 1DJNA 3NX4A 3CZGA 4D7AA 5IZCC 1SB8A 2VTDA 1MLDA 4KMSA 1T25A 2Z95A 1HDRA 3M1AA 4XYGA 4LCEA 1ZEMA 2ZB4A 4BKQA 1LLQA 4A03A 5JY1A 1QKIA 1F06A 4ZD6A 5T64A 4NBTA 1NX6A 4J9UE 3L4BC 4QXMA 2WPGA 1E1KA 4RPHA 3FWZA 5KJEA 3ZW8A 4CMEC 3EZYA 1Y8RB 2IRWA 1Z73A 9LDTA 4R01A 3T0YA 2AG5A 4J4BA 4CQLA 2EWMA 3MZ0A 3PWZA 3WS7A 4YVFA 2NV6A 4CMBA 1GQQA 1BRMA 1MA0A 2Y0DA 1IB6A 4GX1A 5ER9A 2EKLA 2HQ1A 1N8KA 3WGIA 4RVSA 3KSUA 5GMOA 3WQRA 3JQAD 4TZTA 5ENVA 3KEQA 5CPBA 4RF3A 2EG9A 4DIFA 2JHFA 3TZKA 1ZZEA 4CMGA 4U6QA 2VWGA 1XCBA 4A7PA 3PHIA 3NGLA 2Y05A 1XWFA 1J6UA 1SBYA 2VRBA 2I3AA 2D59A 3MTGA 5IXYA 2YQ5A 3AM5A 5BNFA 1ZK2A 3WJAA 4N54A 4E5YA 5KCZA 4K26A 2XXJA 3U5TA 2EKQA 1PIWA 3ETGA 4PLWA 4U5QA 1WZEA 1ZSVA 1WDMA 1ZVMA 1ZXLA 4R54A 3TZQA 3VOSA 4F6LA 3SBOA 1KYQA 4FOOA 1N7GA 3KETA 1QORA 3E9NA 4BNUA 4IDGA 4LRTB 3SC4A 2YUTA 2FN7A 3GMDA 4BNJA 4JROA 1P33A 3AK4A 3TFOA 4RVDA 2WWRA 1E3IA 3H3JA 4GX0A 1UJMA 2I5PO 3I1JA 4YT8A 4CR8A 4CLRA 1MC5A 4U0KA 4L74A 5EL0A 4DQXA 1LXCA 3SXPA 5L7YA 1E6EA 2EGGA 3CTMA 5ES3A 2D3TA 3PI7A 4BNGA 4BO2A 3MTJA 3H3FA 4PCVA 2PFGA 3HB4X 5A03A 4A10A 1V3UA 3D1LA 2Y1DA 1WMBA 2OZPA 4HY3A 4RPJA 3U4CA 3OQBA 1ZKMA 4WLNA 1YOVB 1Q1NA 2O23A 4N18A 3RQSA 4DL9A 3KYBA 4BNNA 3HFGA 5L9AA 2J3KA 5A04A 1EE2A 1PZEA 1A27A 4J1NA 4RLSA 1K6JA 3JQGB 3PQFA 2O7GA 4BKRA
chains in the Genus database with same CATH superfamily
2XVXA 1ONPA 1LY1A 1RP1A 1FE8A 4TYWA 2F00A 3ZDFA 5IXJA 1ATZA 4HYEA 5CT6A 1MVYA 3MLBA 4DDKA 1HFJA 3I1YA 2WD7B 1GG5A 1YI1A 4ERNA 3KXLA 4NIMA 3D43A 4XMXA 2BGGA 3WVNA 5FI1B 3ZE1B 4Z4HA 5C5IA 4HAYA 5CB0A 2QVYX 1T0BA 5JS2A 4IJVA 3MQ2A 5GJCA 4ZREA 3N86A 5C3UA 5MGNA 3PDHA 1QIMA 2WTEA 5C7OO 2H4XA 4QJ3A 3KQPA 4Y67A 4ZYUA 1VL8A 1CZKA 1F38A 3DQPA 1T6ZA 3QJYA 3GDOA 1TYAE 5DM1A 1A4RA 3D3NA 4UXHA 1Q0RA 4XI9A 2D1YA 1DG9A 3F4BA 3IALA 3M8KA 3KHKA 3P9QA 1YFZA 4NCXA 4OLFA 1X8LA 4GBGA 2FRVA 1WQ4A 5CX1A 1BXZA 1CZLA 1G8SA 5ALIA 4AKSA 3IOMA 4M53A 3TJMA 5I4IA 1EVQA 3FCYA 2QSZA 4FMPA 2GBLA 3P1JA 4UU8A 1RYEA 1N8NA 2O14A 3A05A 3ZJUA 3UV6A 4Q9AA 4IM7A 1BDMA 1RJ9A 2BH2A 3RR2A 4EMUA 2QTGA 2QVLA 2W9XA 1XAHA 5IJXA 4G23A 5HBGA 3BD7A 3OF2A 4OQLA 1MQ8B 1WD5A 2FAXA 4WOCA 2W98A 3ZR4B 1MMFB 1TU0A 2VNJA 4KAFA 2HEIA 1XEXB 2CZCA 2HK9A 2LGJA 1DAIA 2Q5EA 4NZNA 4WASA 3IDQA 4QGHA 3WIDA 1F14A 2P9CA 2CVPA 3LUGA 1W25A 4WINA 2WHYA 1T1EA 3PXEA 4C7VA 2E4ZA 3PU6A 4LDAA 5TSDA 1ESZA 2CLLB 4A3SA 2J0EA 3HN2A 1N7IA 3MCTA 3QEMA 3O3CA 3PUVA 2JLRA 2AOWA 1J2UA 4V0ME 5FPPA 1H2HA 4BQOA 2R751 4D57A 2OK7A 3W0LB 2BTEA 5KTMA 4RIGA 5IBCA 2ZE8A 2FPPA 4DDUA 4U7GA 4IEIA 3TRIA 1X3ZA 1F8GA 4F8YA 1O57A 2PANA 1P1IA 1DV1A 1Z37A 1LDMA 3HBJA 2HU5A 4KDRA 4KP7A 2GBIA 4OF4A 4MHTA 2IZ7A 4QUIA 1UODA 1V41E 3ESBA 3Q10A 4G1FA 4C76A 3AM1A 1W1IA 2M1ZA 4CV1A 3CRRA 3AKDA 3BSYA 1PJ3A 2CSUA 1LB1B 2XQIA 2BM9A 1KJZA 1ESDA 3STVA 5DOZA 2PMDA 5BQFA 1MPXA 1TM2A 1W85B 1P2TA 1W47A 1NIPA 1U1DA 3RROA 4Y6LA 1YBVA 3A4NA 4L4YA 4LFAB 3O38A 3NOOA 3EMKA 3J81k 1S2DA 3GH1A 4KWIA 1AQJA 3I61A 3EQ9A 3NBZC 3PKIA 1YR3A 3CZEA 1A76A 4OXXA 1T0UA 1YC2A 1Q0HA 2C5GA 5CAEB 2G09A 2JATA 5IUNC 2LWIA 4D3SA 3HADA 1GTJ1 2DT8A 2K87A 5J23A 4G97A 4X0EA 2IV3A 1WHTA 3NP7A 3QTBA 2O4CA 2PL1A 2QR3A 2X4LA 1Q0LA 3V8NA 2WB4A 3AF1A 4TMYA 4RULA 3HYRA 2IHTA 2W2LD 4R1OA 1J0XO 4P5DA 4YALA 3WL8A 1J2RA 1Z2OX 2ZBQA 2JF0A 1D5WA 1PX2A 1AZWA 1YB2A 4RJIA 5JY6A 3HDGA 3ND5A 3X0DA 2E5WA 2EJUA 4GC5A 5AXAA 2OCPA 2GTQA 1MRZA 4GC9A 4UPDA 4ER3A 3HBAA 4GR9A 4YJ2A 4Z0TA 3BMCB 3KZCA 2PEYA 1C3OA 1WCYA 5BNIA 3RVOA 1HBJA 2Q5CA 4URXR 4NWIA 3R8FA 4L2LA 4C2AA 1JAYA 2PS9A 1KKUA 1WX1A 2IQ5A 3D2LA 3STTA 2CXPA 4K3UA 3P0EA 1B6RA 1E1RA 4U7PB 5L3SA 1LSJA 1GUFA 5AW5A 1SXJB 1HYEA 5SY6A 3S2GA 1FTSA 3OHMA 4I9GA 5KNDA 2QRNA 3KZOA 3T7IA 4EQ6B 4OV6B 2G1JA 2ZIXB 2AQ8A 2OCAA 3IAS6 5CVCA 1ZNXA 4DGQA 2R87A 1GUBA 1U7DA 3E81A 4MJ3A 2YNMD 2J3DA 1Q92A 2XNCA 3AFHA 3KXKA 4GGMX 3VKGA 2VAMA 1USUA 2GO7A 4HFJA 2QM8A 4RVCA 5LJLA 2JCVA 1RPAA 3S7ZA 2B4TO 3HL4A 4IWXA 4JDUA 5KAMA 3TO5A 5GIOE 2EKPA 2QXYA 5E4FA 2Z3VA 1A9OA 3TOZA 4JFRA 4KXXA 1XMXA 3L77A 3ESDA 1KDOA 4CKWA 4DVJA 2IODA 3TJRA 1CB7A 1X7DA 4IGEA 3WB9A 2O6HA 3W6UA 4RACA 2QGNA 2ZBEA 5AXBA 1A8HA 1ZS9A 1X15A 3A9RA 4ME6A 3M70A 4NNJA 3HZRA 4EJFA 3NDBB 5A7FA 2D8AA 3V3KA 4RTPA 1MV8A 3K8OE 1C14A 1DVRA 3L7DA 1OXBB 1ORWA 1KQNA 2E6KA 5ALYA 1Y8QA 2Y1WA 2FQXA 3L0CA 3OP1A 4KIJA 4Z0PA 3DE6X 4RDHA 4AMZA 3F2VA 3MBOA 13PKA 3BMNA 1I3MA 2BZSA 4M36A 4WMLA 4A16A 3QE4A 5EIXA 4O3MA 1K1EA 5EHIA 1N1GA 5LYJA 2DF8A 1BX3A 1NVKA 3QU2A 4HMPA 1UK6A 3M33A 1FFCA 1VDMA 4CDGA 5I9NA 4UEJA 1APBA 1OH5A 4CLRB 1C1XA 1V45E 3GNLA 3LOQA 4IDOA 5FI5A 3IGFA 4JC5A 5IH3A 4L5CA 3L82B 5HKKD 3FCEA 1M74A 4DA7A 3WGJA 1JEYB 5C4IA 3HDJA 3QUTA 4BCBA 3ZWOA 2CVQA 3B7SA 4W63A 2BFOA 1O9GA 3R9KA 4E6EA 2O3JA 4TWJA 1P45A 2QRKA 4O0MA 1U7XA 3FFXA 2R97A 3PXGA 5BYJA 1L7OA 3DEHA 4EG6A 2DECA 3MB8A 4GXQA 4HEJA 1CIVA 4PAMA 4ZAVA 1ZPDA 5JNUA 4R16A 1IXKA 1ZCZA 3VR6H 1M72A 2V6BA 5GM1A 4JVMA 2FE1A 5DE3A 5HFJA 3TLGB 1HE5A 3V8BA 4OHUA 3B5IA 3C14C 1GKKA 2D0OB 2BHLA 3BDAA 1IQPA 3N0XA 1HA3A 3RUAA 4MLCA 1NASA 1INLA 1LVHA 1XB2A 2PBZA 2V5UA 2XE4A 3KHSA 3JWEA 4ROSA 5LP6C 3Q1KA 2D7CA 1GILA 1Z6ZA 3R3XA 4QTUB 1KVTA 2ZEJA 3JPWA 1UL1X 5LDHA 2A7OA 1AN9A 1GRNA 2A0FA 2PX2A 4R9NA 3TL2A 3GJQA 4AO7A 4PAOA 1BVRA 5J2TA 1Q77A 4DIEA 3QLUA 1NX9A 1RQXA 3O8OA 4K40A 2I1QA 4NEHB 1WB6A 1AGRA 2EBUA 2R59A 4H6PA 5CT8A 3HWX1 5FD8A 2FFBA 3PX3A 1YUNA 3C3BA 1GO2A 3E58A 4M0PA 3D3EA 1JJFA 1HC7A 4MR8A 3U80A 4G8DA 4YK7A 1B42A 5IM5A 2IOFA 1E5TA 2GN6A 3DFIA 4MVWA 1QHEA 4Q21A 2O0JA 3D6UA 3NTUA 5DBGA 1HL3A 4R8LA 1MPTA 2W4QA 4I4TF 3VKWA 5KNBA 1XMQB 2DFPA 1NJGA 2GBFA 3VKHA 2E4YA 2OQIA 2RJNA 1KIAA 1ZJWA 1E3DA 4BFWA 2GXQA 2RKBA 2QT1A 1KMNA 3HU1A 3VAZA 4P32A 4CCAA 2XNJA 3KQHA 5A71A 5IJ9A 4Y1FA 3SIPA 4RY8A 3SHOA 3Q5DA 1L8XA 1YXMA 1K92A 4RENA 4W8OA 4S0XA 3PCXA 1BDHA 1E2PA 1ORRA 4P31A 1RKUA 2Z2IA 1G21E 4DSZA 2EW1A 2JFNA 5A4KA 3N2KA 2O2CA 1ZK0A 4N8SA 1G42A 2Y92A 3LUBA 3SVLA 2NZ2A 4G5XA 1WNTA 4RUKA 1ZA1A 2YVQA 2H8KA 2GDJA 3CGGA 4PSAA 1WHTB 4Q47A 3TOSA 1YR1A 3NORA 4UXJA 3T5TA 1PNOA 1TUEA 3EXEA 1KY2A 1XNQB 2FY8A 4UCFA 2ZPUA 1A5TA 5JARA 4G9BA 3EVAA 4HNGA 1RRPA 5K45A 3TCKA 3QVSA 2QYSA 1ABEA 2ZK7A 2VJCA 4H3KB 3FMOB 4UASA 4TV9B 2X1HA 3CH5A 3MJ4A 1D1SA 2OHFA 1FUKA 2VS1A 4MW6A 3VDQA 5JNTA 4OJKA 1JXQA 1JYFA 3Q7SA 2VDJA 1VPDA 1K7FB 1QWSA 2V7WA 1WXWA 3R3SA 4BRSA 2X5XA 1Q3HA 3H1AA 1VIYA 4TTSA 4LJRA 4J0EA 3X1DA 1BVYF 1MENA 1R0ZA 4MUHA 3S3TA 1HM5A 1HYGA 2C4TA 4LCJA 3TH5A 1MEOA 3HB0A 2OBXA 4OQMA 3FZEA 1KI6B 2SCUB 4Q9DA 2LV8A 1PJBA 2KBEA 3WKEA 3MRVA 2FV8A 3GNSA 3TF5A 2BD0A 2Q49A 3K7EA 3KSZO 5LD2C 3GDWA 4KQWA 1ESEA 1E7SA 3P9YA 4DFDA 1BE1A 2XUIA 4MVJE 1L3IA 5U4QA 4Q05A 1NVWQ 2QDKA 1MDBA 1PUJA 2BKUA 2BKVA 4JL8A 5ALDA 2WMYA 2G9NA 5KTPA 2GVDC 4MO9A 4M9SA 1RNLA 3HDHA 1OVMA 4PONA 1YCFA 2GYYA 3PGMA 4NV3A 2SKCA 1KETA 1AT1A 4MAAA 1KFKB 1PJ8A 3L49A 1EAYA 4BYGA 5FPHA 1C7QA 1A95A 2KLHA 2EFYA 2IS2A 4V2UA 2JAHA 4HNAB 4MW7A 4R2KA 3TZCA 2ZBVA 1X77A 1CZRA 4EL0A 2R2GA 3WO0A 1EXVA 4HGNA 1SELA 3DXZA 3OOJA 4FGLA 1XU4A 4I9NA 3BD6A 2IELA 2HH9A 4LXGA 1RP3A 1E7YA 1O7JA 2VJDA 3ASVA 3ETDA 4YI5A 2QIOA 1JRLA 5ALXA 2XCLA 2NV2B 3BTUA 5E2IA 5JUWA 4KRXA 1S96A 3DUFB 4BLVA 1SH7A 1QAQA 3CM0A 5HZHA 2JCGA 4K8OA 3IMFA 1L5GB 5DN6D 2JFQA 4YMIA 5ARDA 5JRJA 3VSBA 3AP2A 2ZIVB 4FYPA 2XGMA 4MYHA 4EG5A 2ZWOA 2R4QA 1NVBA 2R8RA 4RHCA 1Y4DE 4MV4A 3TDKA 5A5EA 1FRZA 3PJRA 1U7UA 1Z2EA 5IAGA 1TCAA 2YN0A 1U98A 3DAFA 3G5MA 4MITA 3HM2A 3HWRA 3AEXA 2FSVC 1F0YA 4GRDA 4M0FA 4XARA 5JJ5A 2R70A 3A9TA 1M6VB 3PXXA 1DXQA 3PDWA 4YRBA 1RMTA 1WUTA 1ZJ4A 3HZHA 1OZAA 3L3BA 4FYJA 4LWQA 5DM4A 4C1NA 4ZYYA 4HDRA 5G1NA 2NVBA 1E77A 4GIBA 4HC4A 3I1FA 2J3HA 4X2UA 3A10A 2YMLA 2QBYA 1K06A 1NYQA 3M2PA 3THYB 2HIGA 3ORQA 3IFSA 3KFLA 2UZIR 1GNVA 4O2AA 3HXQA 1OYYA 2PRSA 2LKCA 1DQYA 2RHDA 5LQNA 4DR3B 5DTMA 1AZSC 1U7TA 3LUDA 3EG5A 1NUHA 3OC0A 1J0BA 3KQWA 3FCAA 4HUQA 4TLDA 4QAQA 4F4FA 5KSYA 3BTOA 3QVXA 4MDEA 1V8BA 3W7AA 1EBFA 3D8BA 3DMFA 1PU2A 5BSEA 1CUJA 3PK0A 1ZI6A 3CKYA 1FQKA 1MX9A 3EMVA 1OXKB 3TQOA 4H08A 4JHLA 4DMHA 2D5CA 3ZCPA 3S1SA 3EQ2A 3H6GA 4LZWA 4ZKDA 4IG4A 5J43A 1KSJA 3U4HA 1Y42X 2FEXA 2JA1A 2UV8A 1UXIA 2GF9A 4DG9A 2Z43A 1ISSA 2OO5C 5AW7A 2PGOA 2C4MA 2C3PA 3BRSA 3DVAA 4FR5A 2NLOA 4RO0A 3COJA 4P7BA 1DV2A 1XN1A 2QL6A 2W6ZA 1K8ZB 4BKUA 3ZU3A 4NAVA 2IP1A 4ZEMA 4UQPA 4XN5A 2V6GA 4PEVA 3AKEA 2W5UA 4NH0A 1GCIA 3KAKA 2IPNA 1CY7A 1ZMOA 1G8FA 2NPFA 1AUQA 5JSUA 1KMHA 1NMZA 3BMQA 4YC7A 5JXJA 3IRUA 3BOSA 2PO5A 2V7TA 3JQQA 3H0EA 4GOLD 3ICWA 2I7VA 4BNIA 2VRCA 3IVXA 4LSZA 3C70A 2YCLA 4YV2A 4TZ6A 4R0NA 3AIIA 2CWDA 3IHLA 1L5KA 4BVKA 5BSVA 4XIYA 5F1OA 4X84A 3UFXB 5AVSA 4ZX3A 1L8OA 1EH5A 3ER6A 1QONA 1WZIA 1K7YA 3NAQA 3COSA 3D7KA 4ZCSA 2WIAA 2HWXA 1PSZA 2O52A 3DFZA 3MWEB 1UZLA 3DL0A 1VP3A 3DT9A 2RHMA 1QVWA 3KTDA 1XTRA 3P9PA 1PJRA 3U39A 4FQ5A 3GY0A 4QUEA 2QP3A 2WYIA 2GK6A 4FR2A 1EYZA 2PZ8A 3IBFA 2E7ZA 4M21A 4PRZA 2R86A 3SY8A 1H2FA 3ZDCA 4G0WA 3SJUA 2XQKA 4HWPA 1CUCA 1I33A 2NZXA 2VPIA 2ZTVA 4QHTA 2NXEA 2XBUA 3TUJC 4FSDA 5B6JA 1CX9B 2NOAA 2NQ2C 1KMIY 3LNTA 1VJGA 2DR3A 4RJJA 1ULUA 1P77A 1J0CA 5EKXA 3WYGA 1JXAA 1EVJA 3ROPA 3P5SA 2LDBA 1W4BA 4K5QA 4FXOA 4B48A 3IPLA 4H1UA 1WABA 3CW2A 3SD7A 4BLTA 3A06A 1QJCA 3TR6A 5IANA 4DF3A 1K89A 3BS4A 5AMXA 4QD3A 1GPMA 1KC3A 1U2QA 3ZY6A 1TM4E 1UBRS 5BOVA 4F5WA 2CJWA 1JEAA 3DLAA 3CC8A 4MK4A 1BS9A 2JHPA 5AHOA 1U1IA 3ZQ4A 2EFJA 2EKBA 3TL6A 3PGLA 2BGIA 5IT9A 3I2HA 3ROFA 2XTAA 3NTXA 2HA4A 1CNMA 5IWAB 4NU5A 4WXEA 1BU5A 3DBIA 1P0MA 3ZZ1A 5C32A 4JXXA 2NO5A 4E11A 1EDZA 2FEOA 2O2EA 2R7NA 2VHTA 3VZRA 1NW9B 3EGDA 1POWA 3LL7A 4AURA 4HDKA 4EB8A 4HRXA 5IVKA 2P6MA 1N1EA 3JT1A 1KVRA 1XKXA 2AF4C 5MFZA 2ODTX 3KB2A 2IHNA 1XEFA 3T35A 4EPRA 1F2VA 1J8YF 1BCRB 2Q4DA 4QREA 2WQ6A 1Y1QA 2PSHA 1RM3A 4LECA 1U0GA 3QVLA 3MUNA 2HJWA 3E3LA 4UNQA 4D92A 2E1RA 1LK0A 3KL2A 2JGEA 1RXVA 4PZCA 1URPA 4DB2A 3NRJA 4E70A 1X7WA 4QJIA 2IS4A 1RYFA 2ZATA 4LHEA 3UN1A 1EEHA 5HDBB 1MAUA 2E55A 5EHZA 4FYWA 4A9AA 4FFVA 1G60A 3PRYA 1XZJA 3KJXA 5HNKA 2H8GA 1JV2B 1KQOA 2Q8NA 1DELA 2X14A 1XZLA 3ZE2B 3NASA 4C2TA 4EQ6A 4WOPA 3C5VA 3E1KA 3VPFA 1PRYA 3RK1A 1RYDA 1JJAA 1VSBA 2EAUA 2VTKA 3HGMA 4OFXA 5HKKA 4YMTA 3UMYA 3RANA 2WHPB 5IRCD 1UPBA 4YQFA 1IN7A 3F8WA 2JFOA 3IR5A 1D8TA 2J41A 5CA1B 2BFCA 3AIMA 1ECGA 2FH5B 3HKEA 5D87A 3W9SA 5ITWA 1IOLA 1F9AA 4N0DA 1MD9A 2W7TA 4HGZA 2BFWA 3ZBQA 2C96A 2CCKA 4G5GA 1EG7A 1Y3CE 5F35A 4EH1A 1BQ4A 4NOLA 5BN3A 5JHGB 3K53A 4CQMD 1ORDA 2JFFA 1J42A 3QFHA 1DBIA 3QVOA 4LSWA 3P19A 4I9FA 4UNIA 5BOSA 2GK3A 4NABA 5J63A 4DLAA 3L43A 2X9LA 3O4VA 4PO3X 4EJ6A 5C1IA 2OAP1 4OQQA 4C0QC 2B5OA 1XL1A 1T91A 2ZYIA 5LZ5A 3RU2A 5CG1A 5J4KA 3BWCA 4PS1A 5LMCA 4PM4A 3JVIA 3QVTA 4KMOA 4R7TA 1L5YA 4EK9A 1QCDA 3PVZA 2H63A 4L8VA 3C8MA 2GCNA 3MYYA 1QO7A 4OHXA 2XADA 4Q9KA 1W5BA 5CEJA 5FPKA 4WESB 5KTOA 4KDCA 3JQEA 5BMOA 2W2TA 3GLIA 1R8QA 4FFMA 1FDWA 1LPOA 2GX6A 3IVAA 6YASA 1TTPB 4OXNA 2BF7A 3ND9A 2X3YA 1JQ3A 3TM4A 3WWEA 2AMVA 4YWHA 3WGMA 1BW9B 2CKMA 3FPKA 3TE6A 3F1KA 3QOXA 4AF7A 4EHFA 1Z4IA 4L5IA 5JVDB 3PUKA 3ZW9A 3JZFA 3M6AA 3KQLA 1PUIA 1RS0A 4LW8A 4JB3A 1SK9A 3TN7A 4RS3A 1RVV1 4LZAA 4N9QA 1JU4A 3EVCA 1NDQA 4ISCA 3ZS9A 4DW8A 3N3BC 3ZI0A 3PUXA 4TMFA 3OECA 5ALOA 3AVYA 1AD2A 1ZH8A 1KOLA 4B6FA 3W4KA 3WZMA 1CQZA 1FSZA 3E22A 4F38A 4DEVA 3PQDA 5EUBA 4XXHA 4ZVNA 3LFUA 1W36D 1EUYA 2EVWX 1YI0A 1PJCA 4K2HA 1YRHA 3CNNA 3BXPA 3E1SA 4OUDA 5DCWA 3H0KA 4RCZA 3REFA 1ULHA 1DJLA 3OUZA 4MZDA 3RABA 1UQRA 3U4DA 2L17A 1L3BA 1CUXA 4IHJB 4KL8S 4YRRA 1SKYE 4ZO9A 5LR6A 5J2TB 2XLCA 2BN4A 3OTWA 1GARA 2GFIA 4Q0MA 2PG3A 4DZZA 5BUCA 2NUBA 3N8DA 3ON5A 1UCFA 1RXYA 3GAZA 4MPDA 5DZSA 3SYRA 2Y1EA 3NHWA 1XJ0A 1AK2A 3GEEA 3ROZA 1ZAKA 1U8AA 2GPTA 3WFIA 2BFPA 5BR4A 2RH9B 3B37A 2FSPA 2Y27A 4HQNA 3DLHA 4BPRA 1SXJC 3NIFB 1PG0A 4L28A 1K5PA 4Y6OA 3BIFA 4X63A 5BSGA 1E2NA 1XHFA 2G70A 2R5FA 4LDJA 5FORA 5IBPA 1I32A 3BWBA 5CK5A 1P4HA 4WKCA 3RD5A 3GGSA 1VYVA 1PTJA 1XQVA 2X42A 1OX4A 1PJAA 3E7XA 3FKQA 4NJEB 1NI4B 2Z4TA 3C0KA 2NQ8A 3D8UA 4ZOLB 3RW9A 3SBXA 2DGDA 1AHNA 3GDGA 1PEAA 2OK8A 3G1TA 1QUFA 1SUCA 2QPAA 3NVAA 2EARA 3AEZA 3KELA 3QGMA 4U6NA 3HXOA 4YJ2B 4L4ZA 1PGJA 1NG9A 4TZ0A 1CIJA 4PSCA 2IU6A 1GXSA 4TVBA 4D3XA 2XRZA 1Y7TA 4YLGA 4DM7A 1JFFB 1OFHA 3HCFA 4E3WA 3CWCA 4MVJM 1ML3A 2COKA 1Z6GA 1ZOPA 2WJIA 3MGGA 2WF9A 2DQ6A 4KPYA 3FUKA 1F2UA 1HDCA 2L2QA 4GSKA 3GUHA 4KWEA 4V0KA 3W77A 3LCRA 1UJ2A 5ERYA 4HS9A 1K88A 5EKTA 5BRNA 1MB3A 4R1NA 5I48A 1GDHA 4NBWA 3U56A 3BC1A 2DPLA 3H1TA 2J3JA 1VSTA 3IA2A 1ZN7A 5CDSA 3A9WA 2P6OA 3HRHA 5E9JA 5U1PA 3SDBA 4M87A 1WB4A 4EQZA 5JANA 4W7HA 4NMMA 2V7PA 4QKQA 3JZDA 5A4IS 3F74A 4BFTA 1LI4A 1Q7EA 2WPNA 3KOUA 3E84A 4YRCA 5IAAA 4L4XA 1HFEL 3OPVA 4GI3A 1YVPA 1Z3CA 2A6PA 1R6BX 3GZTB 4RH1A 4MPTA 1OJLA 2UXCB 1RBZA 3M9LA 1RWOA 1WHSB 1JDJA 2VATA 4BVBA 3HCDA 4E09A 2JDID 1BYIA 2FZLA 4RK5A 1H5NA 2WYHA 1QGDA 2JGKA 2PRZA 4IRXA 5AIBA 2QJFA 5CTJA 1KH3A 5EJ5A 3NYRA 4IEEA 2DVMA 5IK2D 4UDYX 3JQ8B 4YWJA 3KLMX 5HKLA 4GI2A 1W30A 3EIUA 1DEHA 1NRXA 4OYRA 4C2UA 1HFKA 1G2OA 2JGIA 1PTKA 5CT9A 1ABFA 2R44A 3W5CA 1EVIA 2FG6C 1KK2A 1F5NA 3BGVA 3DOJA 4AO6A 5LD2B 5LQSA 3JQ9A 3I0ZA 5GADl 1DAKA 2CYBA 3AKYA 2VYND 3L8DA 5DLDA 2QN9A 2I2XB 3P4YA 4KOEC 1YHZA 4PLVA 2QP9X 4I4NA 4G0OA 3NZEA 3UFBA 3PNVA 1NUUA 3G5TA 5DISB 5HCNA 3FW1A 5EZQA 2BY4A 3GR6A 3OJEA 5A4FS 4ETMA 2VNHA 1PFVA 1BN6A 2DXIA 2SKDA 3H2KA 2ONZA 3IP9A 2CLCX 4J2OA 1AKNA 3TSWA 3I8SA 3W1VA 2WAMA 1E1QD 4PYOA 1A72A 1JFRA 1JIXA 2P27A 1S2IA 4WI1A 4XIFA 2VJKA 3LDFA 2POQX 5EIAA 4FKBA 5T8KA 3U7EB 3W5VA 1Z8DA 1VKJA 3E4CA 3VR1A 3WBBA 3E2MA 1UT6A 2CV2A 2IU0A 1PFQA 2Z8YM 3LHFA 3UV3A 1GR0A 1B2RA 1EK0A 4KDFA 4PXYA 1UJNA 1QHIA 2EZTA 1EGHA 2R1UA 4JUFA 2BCGY 2A86A 2M32A 3QEAZ 4RL6A 2DPMA 2ZBFA 1UWCA 3EWSA 4KQJA 5IJ0B 1J49A 2A5YB 5ILGA 4FFSA 5FFFA 2KW5A 2I7TA 4KPGA 2M6RA 2VDKB 2FW6A 2HRDA 2YFQA 5C1BA 2AOTA 4RKRA 4M8NE 4HF7A 3T4EA 1YIOA 4HDCA 5LKRA 2ZM5A 5BV7A 4HFMA 1T5IA 1LTKA 1TVEA 5DCLA 4D9BA 2BR5A 2PL3A 3BA6A 3SPXA 1IHDA 1GRRA 3IOBA 1TJ3A 2Y0PA 5EQDA 2IYPA 1O6CA 4CT5A 4M0EA 2G36A 1B0UA 3QIAA 2J3IA 1MB0A 3HYNA 4W5HA 1Y7PA 2H7CA 2OILA 3C4QA 3PR3A 1P7ZA 2F43B 3R6GA 4X64B 4Q1CA 3RYIA 1TJ5A 1M54A 4QG3A 1I2DA 3OPYI 3MMNA 3AG5A 4UM7A 4DYVA 3KYDA 2A2ZA 4RQTA 5DFAA 2AX4A 1W8IA 2QE6A 5MN5A 2AG0A 1GAWA 1B6TA 1PJ2A 4TRRA 4G41A 2GZ3A 5H80A 3KHTA 4EY8A 3TQIA 2IJGX 2OHHA 2G77B 3R0QA 4IJKA 2XMCA 2NUTB 4F1JA 4RTLA 1QQAA 2CW5A 3V34A 1MXFA 1QMGA 3SQWA 4D9CA 1O5TA 3O90A 1KAGA 5IC6A 1E5XA 1GSHA 4M6WB 3TTSA 4JX8A 1JDTA 2RJ3A 1W46A 3NKVA 4DCCA 1PK8A 4YMVA 5KVSA 4AJ4A 1OY1A 1OZFA 2XRMA 1JQBA 1BFKA 2Y71A 3ROQA 3CHRA 1OMOA 1YMQA 4MRMB 5L8VA 1H19A 4OBXA 3L8MA 2TMYA 4KRGA 1YZTA 1DRKA 3FNIA 3TLYA 4LTDA 2WVGA 4A0HA 1ZW6A 1ZZGA 2FUCA 4KQ6A 3VI3B 3DCYA 1SIUA 2AL7A 2HWWA 4M22A 1SKYB 3ZI4A 5J2UF 3RUPA 3RVJA 2H7XA 4I6EA 4PLPA 1ZOSA 1F8YA 4B82A 1G0OA 3QV1A 1Z74A 2I33A 1TECE 1OLUB 3D8RA 4ALJA 4QOFA 3T1OA 3R6DA 4V38A 4I9UA 4GZMA 1UFRA 1EWKA 3MCAA 1RI3A 2ZRAA 1OZGA 3A1TA 3DJFA 3HYLA 3NBAA 3QLJA 2X2PA 1JDBB 1IBCA 4D79A 4AS1A 4ND3A 2WF7A 3FH0A 3SE7A 1OC4A 3UIEA 2BZGA 5TPZA 2VJ8A 2Q1WA 1TUIA 4BOYA 5AFSA 3SQDA 1D2GA 3RHZA 3T3EA 4CM9A 3IP1A 3NHYA 2BW0A 1ORHA 5K0JA 3NUGA 3PIIA 1FMLA 5IC4A 1Y5MA 4V0RA 3ECSA 5A5VA 4MJ7A 3QF4A 4JVOA 2I3DA 5DGIA 4JOBA 2UUPA 4XWOA 2WTMA 2C99A 1GA4A 3IUQA 4GMGA 4ZI7B 1PV2A 1XQXA 1ZRNA 1R8SA 1R8XA 2QAJA 4LS3A 4P81A 4DPKA 1V26A 1RTTA 3MJHA 4ZI2A 4XRGA 2NTVA 7AT1A 1GL7A 3OMLA 2QYHA 1EP2B 3KJNA 4U8GA 1R4NA 4MS3B 4O4HA 4PPQA 1I7SB 1M2NA 2VAVA 1YJAA 4JK3A 4OU5A 4ZOQI 1XZQA 3URKA 3N7TA 4YJFB 3DXFA 5JD6A 2HW8A 1M0WA 2YYAA 3F46A 1Y33E 3DKVA 3EUEA 1QC5B 2VG8A 1JZTA 1A8IA 1M2JA 3O75A 4LPKA 4QIRA 4NFHA 2C77A 3CNBA 5IFLA 4Y2HA 3QMVA 5ALKA 2NM0A 2GASA 2B4QA 4Y0AA 1I0LA 1Q7TA 3UAVA 3B9QA 4P33A 4F93B 2FOIA 5C8VA 1LW7A 3VO1A 5LP6A 1NURA 1U8EA 1YDHA 2GCGA 2X0EA 3WQSB 2CN1A 2FW0A 3GWZA 1CRPA 1OWLA 1TD9A 2D2EA 4JUAA 4BLOA 4DC9A 2IEIA 2PQ6A 3ENQA 4WNYA 3TIGA 2XUKA 2R25B 1SD2A 3T06B 5DMHA 3C3MA 1T9AA 5EJ9A 4L6IA 5FV4A 5H81A 1IZZA 2WMNB 4F56A 1JLHA 1U3FA 5B5SA 1N7HA 1MIOB 3DKPA 4IFEA 4FZVA 3VYUB 4QMEA 4GE3A 2FDXA 2NVWA 4EUFA 2LDXA 4EY7A 2IXTA 3B2EA 1YS7A 3D5TA 1JFVA 2A94A 4JOQA 3BK7A 3B52X 5BNTA 1NC3A 2XCIA 1J33A 6ADHA 1I7NA 1O03A 1PK7A 1KO4A 3WIOA 2BGJA 5EZ6B 4CE6A 5JTUA 3LWZA 4HDSB 3TOXA 1TB4A 3NHBA 1KOJA 3OU7A 1PR1A 1WCIA 3CZMA 2OO3A 4PVDA 3IVMA 2C3OA 1LV7A 2C03A 2G9QA 3OG9A 2P77A 4ZO6A 4AI6A 3DE4X 3DLCA 4FZ5A 3ZU6A 1V5FA 1XF1A 3LXUX 3EUAA 4KN6A 1P9RA 2FVXA 2OOKA 5CD1A 1NNI1 3DGFC 1RM5A 4FYVA 4F4HA 3QWHA 2YJTD 3AM4A 3VNUA 1NVFA 3CEJA 3DO8A 3UK2A 1JAZA 3Q3IA 2P69A 1JP7A 2BSQA 3L7LA 4HBGA 4IXNA 3H1EA 4M76B 2MCFA 1IG3A 3EUWA 1HURA 3WZLA 3MVEA 2JJ8A 3L6RA 1X7WB 4A6PA 4HJRA 4LGVA 2B9EA 1TTTA 4GMKA 2FWAA 4AKGA 3BCUA 1RKBA 3D3WA 3B85A 3GMSA 4X8HA 2XB2A 5FYQA 1A2OA 1U2TA 2PLAA 2R11A 3BMOA 5BSMA 2P30A 2R68A 5F64A 3VR3D 4CF7A 1IAQA 1TA0A 3HDTA 4BYMA 3B7GA 3MG9A 3PE4A 5A4JA 3E9MA 4F0JA 5DH9A 2DBZA 3TQFA 4BNWA 3IHWA 2TMDA 4G37A 4XN8A 1AUXA 1W8DA 2OXEA 4DOMA 4RETA 1J2JA 1ZYUA 4XQ9A 1PL8A 3IT3A 2JJ1D 3MTDA 2AC7A 4CGZA 4OMDA 1YOVA 2XNSA 3E4DA 1DB3A 2WFZA 1SNYA 3ESYA 2C7GA 3NG1A 2QTZA 3Q3CA 4O29A 3DLBA 2VT7A 1X87A 3GI1A 1C9JA 3FFBA 4K5MA 1KRHA 2BI4A 2VPZA 3KKKA 4JT4A 4B34A 2QJOA 4F45A 1MC1A 1Y3HA 4Q16A 3DVAB 3QNWA 1GFWA 5FRDA 5CT4A 5BN3B 5A9TA 3AV0B 4Y2PA 4Q3NA 2A5JA 1DRJA 2JJ2D 5C5CA 1YL7A 1UPCA 4B74A 1CD5A 5FBWB 5KYXA 1N36B 3DZ8A 2D1RA 2IUTA 3TRKA 4PC6A 1V5WA 4BQEA 2PX5A 3JZIA 3NXSA 3S27A 3RTDA 1V47A 4NCIA 4DLKA 1J09A 5TPZD 5FBLB 1QQBA 2WVAA 2UVDA 4TQAA 3KSDO 1NN5A 2Q3HA 4LSMA 4NQRA 4AS2A 2PH7A 1H42A 4JGGA 4URZR 1MJNA 2ZT8A 5B3AA 3RSFA 4EKIA 4WZZA 3WV5A 4ZXPA 1W5SA 3ADOA 1YGYA 5HQ3A 2IT1A 1B76A 1YKFA 3I58A 4MQEA 2V4UA 4LYAA 3TTXA 5JDCC 3WL4A 2YXBA 4DMCA 4E94A 4EHBA 4GSLA 4O08A 3R4CA 1KQPA 2ZT6A 1YRQA 4HUJA 2H54A 3UENA 2UYQA 3NHJA 5CW1A 4E2FA 2Z5VA 1PZNA 1A9YA 3IEIA 2V4MA 4MKZA 5ETJA 3EBPA 3FI0A 4NMHA 2IDJA 2RI6A 1TVCA 1I1NA 1YMVA 4J0IA 4B73A 3T7CA 3GA5A 1D7AA 3D0OA 3AEQB 3SYNA 3ZJYA 3OEED 2R1TA 4ANFA 1YULA 4POOA 1UQUA 2G88A 1QK4A 4GI1A 2ST1A 2IZ1A 4PTLA 2GZRA 4IS3A 1A4XA 2P8SA 2VPPA 2NSHA 3CSUA 4GYYA 4RNDB 4ND7A 4A15A 1CZOA 3IP3A 2F3QA 3KT3A 1IOWA 2Y9PB 2NZYA 4DRZA 5GVSA 3CNEA 1X80B 4ZV7A 4IS2A 3PHCA 1YB7A 3CX8A 2XTZA 2HJVA 4ENVA 3QNMA 2RH4A 2QLTA 3RVQA 2ZRMA 3A4IA 5I6DA 7MDHA 3OQJA 3JASB 3B9RA 3OF3A 2OO7A 2R47A 2REQA 4K05A 3IAS1 4NU0A 4OHRA 3PRKE 4Z6KA 5AHRA 3FSRA 5AOBA 5BXYA 3U1VA 5KPJA 4BVEA 1YSCA 2C4VA 4M1ZA 1M66A 1G8HA 2OD2A 3VC3A 1BC5A 3ZCXA 5B1DA 1LDEA 3CT4A 4HQOA 3L84A 4JR1A 4AJ1A 3GG2A 1OT3A 4FX2A 4CKCB 5DHSA 4CN8A 4D4JA 1T6YA 4L07A 4OMCA 2TMGA 3I76A 2CXNA 5B2EA 3VPSA 3GLFA 1RRKA 1UKAA 2XUZA 1SUPA 1F20A 4NBSA 1I13A 4JNDA 2GRUA 3NHSA 1P8AA 5TX7A 1Z34A 5BN5B 3WLSA 5L7TA 2BEWA 3BIOA 4JJGA 2B4AA 4L16A 1OPRA 5F78A 3ZGNA 3ESXA 1D6MA 4NBUA 2C2YA 4Q4JB 4UVDA 4RTRA 3TG8A 1ECLA 2NU9A 3C4JA 3DMHA 5AVZA 1DAOA 1FY2A 1UDWA 2H3HA 3WV4A 4BX8A 3W3AA 1T0PA 5ELMA 2ECFA 2YXPX 4FHFA 2PUTA 2J9YB 1RPNA 2OSVA 3KCNA 5BSFA 5ALNA 1AZLA 3LUAA 4KSBA 5BO5A 3UY4A 1ES9A 2QMQA 3EVTA 4KXFB 3FTPA 5GAJA 3DZIA 2I6FA 3L1JA 4MNTA 4XQ0A 3BT7A 3RBVA 5GIPE 1P0IA 3O73A 4OXKA 3I3SR 3B7UX 3OCYA 3P96A 5IT4A 1QMPA 4ZAWA 3IOEA 4FBMA 4DKJA 3FPCA 1UEIA 4IJQA 1FDUA 3JAKA 3RV3A 2AI1A 4PCAA 2P3QA 3SMVA 4PZDA 4B4KA 3I6QA 2WSMA 1VLVA 1B15A 2EX4A 1QFSA 3OHPA 3R4VA 4ITUA 1GTMA 4RDIA 2MYPA 2VZ0A 1UMBB 1E1DA 2GBCA 2I22A 3CRMA 4RD6A 1EFPB 1QHYA 3ITNA 4C7JA 5GONA 2X41A 1CP3A 1EDDA 3D0QA 1IEWA 3GUUA 5A6SB 3ZYZA 3CHYA 5JW6A 1X7YB 2VYNA 4FHZA 4AMGA 3AI7A 3ZBUA 3I04M 1FUYB 4JI1B 1JSZA 4B79A 4BQFA 2LCFA 5FA8A 4YQEA 1YBAA 2ESRA 3VBCA 1X13A 3SCZA 2NYVA 3BXGA 1JI3A 1CJMA 2IGBA 1N5LA 1E7RA 3H4VA 3QKUA 3UJDA 5AM3A 1H4TA 2FSFA 5KKCA 1KEZA 3E3AA 1EB9A 1T4GA 1FXSA 3GZ4A 1DGQA 4G5OA 4HEHA 3AVUA 3QJXA 1N92A 1IQ0A 4MUKA 2HAEA 2HU7A 3TVDA 2ISCA 2H4WA 3VJMA 3B36A 4G1EB 1PGPA 2MU1A 1ESCA 2I8LA 2UXDB 4FHEA 1ZGZA 3HP1A 1KMCA 4TTPA 1QIHA 4XM1A 1IRXA 5C34B 1DC6A 3DO5A 2PQ2A 5JQWA 2GLTA 3O9VA 5IZCA 1SA0B 1RLMA 2C2GA 4FGJA 4LKOA 2ERXA 2MAPA 3HJCA 4L75A 3WHKA 4IX9A 4X7BA 4XKJA 3MT7A 2FPXA 3RYFB 1FJXA 2AOTB 3N2ZB 4UHKA 4WW0A 2E4WA 2Y1XA 4DR7B 2VUIB 4RSRA 5DM0A 4Q1FA 4J0CA 2PMKA 3ZNPA 2H5IA 4TM7A 1LC0A 1M6WA 4D0SA 3KWLA 3LX4A 4HQRA 1F4VA 1ORTA 1YCHA 3TQTA 4UW9A 2C2ZA 2ZR9A 4C4TA 3TRDA 1IHPA 3E15A 2YVAA 3OQMA 4MP6A 3CLSD 3GFVA 3UJNA 2VPTA 2M1XA 3LBNA 3EPKA 4MW4A 1CUBA 4EKYA 3V4SA 5MGBA 1G66A 1XMOB 1NXQA 2ISSD 2WTBA 4KN9S 3UM9A 3E5HA 4BO6A 1QAMA 1C1DB 1G5QA 3OESA 3N74A 4JXKA 1AJEA 1ULTA 5JYDA 4HFRA 2M9MA 2JHC