1RP3A

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
235
structure length
235
Chain Sequence
HMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 95
structure length 235
sequence length 235
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1rp3A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1rp3A02
4RCVA 4FLQA 4Y6PA 5JC1A 2Y1FA 1ZS2A 1R0KA 4FLRA 4AYSA 5JAZA 1Q0HA 1JG9A 5JMPA 5JO0A 3UEQA 3WQRA 1K5HA 1Q0QA 1S46A 4OOEA 1MW2A 4FLSA 3ZHXA 2JCXA 2JCVA 3ZHYA 2Y1GA 1ONNA 1G5AA 4NQWA 4KP7A 3CZGA 3WQSB 1MVYA 3CZKA 1MW3A 3ANLA 4FLOA 1RP3A 3AUAA 3AU9A 3UCQA 2JD0A 2EGHA 2WPGA 1MW1A 3A06A 2Y1DA 2Y1CA 3ZI0A 1OR7A 4GAEA 2MAOA 1JVSA 3N0RA 4ZQFA 5DULA 3WQQA 2O7GA 4ZQHA 4Y6SA 4A03A 4CXFA 3A14A 1R0LA 4Y67A 5JBIA 4LUPA 2JCYA 1SC5A 1Q0LA 2C82A 1ONPA 1T1RA 1MW0A 2Y1EA 3ANNA 4AICA 2LFWA 4ZN6A 2JD2A 4ZQEA 5JMWA 4G97A 1T1SA 2JD1A 4ZQGA 3T0YA 2MAPA 3AU8A 3IIEA 3CZLA 1ONOA 3R0IA 4QICA 5JNLA 1H3LA 4Y6RA 4OOFA 3UERA 3CZEA 3ZHZA 3ANMA 1JGIA 3RASA
chains in the Genus database with same CATH superfamily
4PVBA 4R7LA 3D1IA 2A1TA 3R7KA 4ZW7A 1Y8OA 2AO2A 2VJ8A 1IVHA 3C3LA 3AFEA 1R0KA 5K3GA 2AZEA 5EV7A 3NF4A 4AYSA 3Q43A 3KMLA 3FU0A 3X0XA 3X29A 3UEQA 3WQRA 4QHPA 4HKSA 3FTVA 3FUIA 4XMZA 3FUKA 2XS8A 4MP2A 2XQ0A 2JV7A 3FH5A 2JCXA 2PG0A 4J1VA 3D6BA 2Y1GA 3FTZA 4XN4A 2Z1QA 3PUUA 2DQ6A 1RJ4A 4FZ4A 3TORA 4JIOA 3ANLA 2WZGA 4X28C 1JM6A 1SIRA 2VIGA 3Q0AA 2JD0A 2EGHA 4Q4UA 2OJQA 1GKZA 2Y1CA 3FTWA 3ZI0A 1JVSA 2ZXGA 4XMTA 4XN5A 3WQQA 2RFQA 4L1FA 2DVLA 2O7GA 3TZ2A 5JBIA 4LUPA 3FH8A 5FWQA 2CJ5A 5K3IA 4R5VA 4LQQB 3VADA 4DOYA 1GJVA 3FCJA 2JBRA 5J6AA 2JBSA 4ZN6A 2JD2A 4XN7A 5HNFA 3MXLA 4AI6A 2BU5A 3Q44A 4XN8A 4E02A 2YYKA 2PO4A 2XPZA 4FF4A 3B7TA 2MAPA 1W07A 4GAAA 3IIEA 4Q4IA 1LVCA 3CZLA 3B7SA 4ZX5A 2EC5A 2PL5A 2E80A 1T9GA 3R0IA 5M4PA 3TZ4A 5JNLA 3FU6A 3F29A 3UERA 3JT1A 3ANMA 2BU2A 4Q0TA 3RASA 3SF6A 1UKWA 3MPIA 4OO2A 4RCVA 3FUDA 4DZYA 3FUMA 2XQRB 4HR3A 4XMUA 5JC1A 3CHOA 3FH7A 2C12A 2J7AA 4ZX6A 3T8VA 1X3ZA 1PI1A 5JAZA 5HNHA 2E81A 1JG9A 1RJ1A 5M4MA 2IX6A 2VLAA 1XFWA 3FUFA 3TZ5A 4JNDA 4OOEA 3EBHA 4FLSA 2ZDYA 4XNDA 2REHA 3GNCA 4KSFA 3ZHYA 3HW2A 3VKGA 2PNRA 5B6BA 3MDDA 5HLTA 1GKXA 2JBTA 1XFVA 4X28A 3CZKA 4ZW3A 3B3BA 3AUAA 5BRKA 4MPCA 3UU9A 3CHQA 3RKHA 5BPPA 4LQSB 3FTUA 1Y0VA 3L1TA 4GAEA 2MAOA 3OWMA 2XS1A 3FTSA 3SWOA 4ZQFA 1EGCA 4BKXA 2YGWA 2BTZA 4ZQHA 2YYJA 1EGDA 1XFXA 4M9AA 4QPEA 1MW0A 4XNBA 1JQIA 2C0UA 2R0NA 4K5PA 3FTYA 3UBRA 2PGGA 2YYIA 2VR0A 3Q24A 2YYGA 2FFLA 4RVBA 3B7UX 3QJXA 4G97A 4L3ZA 3RC8A 4IV6A 1T1SA 2WBIA 3TTBA 4XO5A 3T0YA 3EOMA 4MPEA 3KEDA 1FS7A 5AENA 2R05A 2YYMA 3CRKA 4RSYA 4R5TA 4J3BA 4N5FA 4H7QA 3P4TA 3JSZA 4OOFA 2CJ8A 2C5ZA 2F6LA 3BNJA 1SG7A 3II9A 3LG1A 4RM7A 2FP1A 4F0XA 2Q8FA 4MP7A 5K3HA 4V26A 1SK6A 4W9UA 4FLQA 3PFDA 2Y1FA 1FS9A 3D9GA 2GTQA 4Q5CA 1Q0HA 4XMXA 5JO0A 1OAHA 2B61A 1S26A 3MMOA 1XFZA 5K3JA 1S46A 3B96A 3CIAA 4KCFA 5B5VA 3CHRA 2GBBA 2JCVA 2R72A 4FF3A 3SXQA 3Q23A 3VKHA 1G5AA 5B5WA 1XFUA 4KP7A 3B7RL 2JIFA 2BU8A 4L2LA 1PK0A 4XO3A 3WQSB 5BRMA 1MVYA 4DPRA 1MW3A 4FLOA 1X8ZA 4JIZA 1RP3A 4ZYJA 3UCQA 4AR9A 2WPGA 4P13A 5DLLA 2YYLA 1GW6A 4X2UA 3CHPA 1MW1A 3BNGA 3SCEA 4K5MA 4XN1A 3A06A 2ZDXA 2WZFA 2Y1DA 3FULA 2R59A 4XMWA 5M4KA 1OR7A 4XO4A 2RDZA 4IRNA 3FU3A 4PU2A 4AR8A 3D9EA 4AKGA 3B2PA 2UXWA 2RJIA 4A03A 4CXFA 1R0LA 3CE2A 1BUCA 4QMEA 3C2PA 2Q8GA 3CXBA 1SC5A 2E0AA 2C82A 1ONPA 3FUHA 2Y1EA 2R70A 1R3BA 3ANNA 4HKRA 2LFWA 3D2RA 4O5MA 4L3YA 3VVLA 3BNFA 4ZQEA 5JMWA 3C46A 4FCAA 3EBIA 4KS9A 2FONA 2QR4A 3BNHA 3FHEA 1XFYA 2JD1A 3MKHA 2OT4A 5J71A 4AKHA 1ONOA 3MDEA 3EONA 4XNAA 3VVMA 4KTOA 1H3LA 3B34A 3AFFA 4Y6RA 2EBFX 2CJ7A 4ZX4A 3ZHZA 1R2JA 3X0YA 4FF2A 2QJ1A 2A7OA 5DYFA 2OR0A 3FU5A 4P79A 1U8VA 4Y6PA 4R5XA 4ZXVA 2CX9A 3D9DA 4MKTA 1ZS2A 4PW4A 4FLRA 2EBAA 3S7WA 1UDYA 4AKIA 2ZKJA 1RX0A 1SQMA 3D9FA 5JMPA 2RF7A 3U9WA 4Q4EA 2BU7A 2BU6A 4XN2A 1XG2B 4KSAA 1K5HA 3OWAA 2VF1A 1Q0QA 2FP2A 1MW2A 4ZX3A 3FUEA 2HPTA 2DDHA 3ZHXA 1X91A 1ONNA 4H81A 2QVWA 1K93A 4NQWA 1WS9A 4XVXA 2CJ6A 3CZGA 1IS2A 1QDBA 4E00A 4Q5BA 4FF1A 1EGEA 4ZW6A 2HPOA 3AU9A 3Q22A 1GU6A 4ZW5A 2ZAFA 4ARFA 2IX5A 2D29A 4G5EA 2DQMA 3FTXA 3N0RA 3M9VA 5DULA 2R0MA 4MS6A 4WJYA 4K5NA 4Y6SA 4QUOA 2Q8HA 3TZ0A 3A14A 1K8TA 3HWCA 4NXLA 3RC3A 4Y67A 2JCYA 1Q0LA 2R02A 3FO3A 2ZO5A 4ZQTA 1T1RA 4XN9A 1FS8A 4AICA 3GM6A 1SIQA 2HJNA 3OIBA 4MPNA 4U83A 5M4NA 2CJ4A 1X3WA 4K5OA 1X90A 3CHSA 2EBHX 2PUSA 4L3XA 2R03A 3CRLA 5GJWE 4QIRA 4AR1A 2Q8IA 4V25A 4XMVA 3B37A 4ZQGA 3B2XA 3LGQA 3AU8A 1Y8PA 2OEXA 3FUNA 2XPYA 1K90A 4Q17A 4QICA 4K5LA 3EBGA 5GJVE 1HS6A 1Y8NA 4H85A 3MPJA 2OEVA 4L38A 4Q1OA 3CZEA 4ZW8A 1H19A 4E01A 1JGIA 4JEKA 3GQTA 3FUJA
chains in the Genus database with same CATH topology
4PVBA 4R7LA 4ZW7A 2AO2A 2VJ8A 3C3LA 1R0KA 2AZEA 5EV7A 4AYSA 3Q43A 3KMLA 3FU0A 3X29A 3UEQA 3WQRA 4QHPA 4HKSA 3FTVA 3FUIA 4XMZA 3FUKA 2XQ0A 2JV7A 3FH5A 2JCXA 2Y1GA 3FTZA 4XN4A 3PUUA 2DQ6A 4FZ4A 3ANLA 2WZGA 3Q0AA 2JD0A 2EGHA 2Y1CA 3FTWA 3ZI0A 1JVSA 2ZXGA 4XMTA 4XN5A 3WQQA 2O7GA 5JBIA 4LUPA 3FH8A 5FWQA 4R5VA 4ZN6A 2JD2A 4XN7A 5HNFA 4AI6A 3Q44A 4XN8A 2PO4A 2XPZA 4FF4A 3B7TA 2MAPA 4GAAA 3IIEA 4Q4IA 1LVCA 3CZLA 3B7SA 4ZX5A 2EC5A 2PL5A 3R0IA 5JNLA 3FU6A 3UERA 3JT1A 3ANMA 3RASA 4RCVA 3FUDA 3FUMA 4XMUA 5JC1A 3CHOA 3FH7A 4ZX6A 3T8VA 1X3ZA 5JAZA 5HNHA 1JG9A 2VLAA 1XFWA 3FUFA 4JNDA 4OOEA 3EBHA 4FLSA 4XNDA 4KSFA 3ZHYA 3VKGA 5HLTA 1XFVA 3CZKA 4ZW3A 3B3BA 3AUAA 3CHQA 5BPPA 3FTUA 1Y0VA 4GAEA 2MAOA 3FTSA 4ZQFA 4BKXA 2YGWA 4ZQHA 1XFXA 4QPEA 1MW0A 4XNBA 4K5PA 3FTYA 2PGGA 3Q24A 2FFLA 4RVBA 3B7UX 3QJXA 4G97A 3RC8A 1T1SA 4XO5A 3T0YA 3KEDA 5AENA 4RSYA 4R5TA 4J3BA 3JSZA 4OOFA 2C5ZA 2F6LA 1SG7A 2FP1A 4F0XA 1SK6A 4FLQA 2Y1FA 2GTQA 1Q0HA 4XMXA 5JO0A 2B61A 1S26A 1XFZA 1S46A 3CIAA 3CHRA 2GBBA 2JCVA 2R72A 4FF3A 3Q23A 3VKHA 1G5AA 1XFUA 4KP7A 3B7RL 4L2LA 1PK0A 4XO3A 3WQSB 1MVYA 4DPRA 1MW3A 4FLOA 1RP3A 3UCQA 4AR9A 2WPGA 5DLLA 1GW6A 4X2UA 3CHPA 1MW1A 4K5MA 4XN1A 3A06A 2WZFA 2Y1DA 3FULA 2R59A 4XMWA 1OR7A 4XO4A 3FU3A 4PU2A 4AR8A 4AKGA 3B2PA 2RJIA 4A03A 4CXFA 1R0LA 3CE2A 4QMEA 3C2PA 1SC5A 2C82A 1ONPA 3FUHA 2Y1EA 2R70A 3ANNA 4HKRA 2LFWA 3VVLA 4ZQEA 5JMWA 3C46A 4FCAA 3EBIA 4KS9A 2QR4A 3FHEA 1XFYA 2JD1A 4AKHA 1ONOA 4XNAA 3VVMA 1H3LA 3B34A 4Y6RA 2EBFX 4ZX4A 3ZHZA 4FF2A 2QJ1A 2A7OA 5DYFA 3FU5A 4P79A 4Y6PA 4R5XA 4MKTA 1ZS2A 4PW4A 4FLRA 4AKIA 1SQMA 5JMPA 3U9WA 4Q4EA 4XN2A 4KSAA 1K5HA 2VF1A 1Q0QA 2FP2A 1MW2A 4ZX3A 3FUEA 2HPTA 3ZHXA 1ONNA 2QVWA 1K93A 4NQWA 3CZGA 4FF1A 4ZW6A 2HPOA 3AU9A 3Q22A 4ZW5A 4ARFA 2DQMA 3FTXA 3N0RA 5DULA 4MS6A 4K5NA 4Y6SA 4QUOA 3A14A 1K8TA 3RC3A 4Y67A 2JCYA 1Q0LA 4ZQTA 1T1RA 4XN9A 4AICA 1X3WA 4K5OA 3CHSA 2EBHX 2PUSA 5GJWE 4QIRA 4AR1A 4XMVA 3B37A 4ZQGA 3B2XA 3AU8A 3FUNA 2XPYA 1K90A 4QICA 4K5LA 3EBGA 5GJVE 1HS6A 3CZEA 4ZW8A 1H19A 1JGIA 3FUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCV A;  4FLQ A;  4Y6P A;  5JC1 A;  2Y1F A;  1ZS2 A;  1R0K A;  4FLR A;  4AYS A;  5JAZ A;  1Q0H A;  1JG9 A;  5JMP A;  5JO0 A;  3UEQ A;  3WQR A;  1K5H A;  1Q0Q A;  1S46 A;  4OOE A;  1MW2 A;  4FLS A;  3ZHX A;  2JCX A;  2JCV A;  3ZHY A;  2Y1G A;  1ONN A;  1G5A A;  4NQW A;  4KP7 A;  3CZG A;  3WQS B;  1MVY A;  3CZK A;  1MW3 A;  3ANL A;  4FLO A;  1RP3 A;  3AUA A;  3AU9 A;  3UCQ A;  2JD0 A;  2EGH A;  2WPG A;  1MW1 A;  3A06 A;  2Y1D A;  2Y1C A;  3ZI0 A;  1OR7 A;  4GAE A;  2MAO A;  1JVS A;  3N0R A;  4ZQF A;  5DUL A;  3WQQ A;  2O7G A;  4ZQH A;  4Y6S A;  4A03 A;  4CXF A;  3A14 A;  1R0L A;  4Y67 A;  5JBI A;  4LUP A;  2JCY A;  1SC5 A;  1Q0L A;  2C82 A;  1ONP A;  1T1R A;  1MW0 A;  2Y1E A;  3ANN A;  4AIC A;  2LFW A;  4ZN6 A;  2JD2 A;  4ZQE A;  5JMW A;  4G97 A;  1T1S A;  2JD1 A;  4ZQG A;  3T0Y A;  2MAP A;  3AU8 A;  3IIE A;  3CZL A;  1ONO A;  3R0I A;  4QIC A;  5JNL A;  1H3L A;  4Y6R A;  4OOF A;  3UER A;  3CZE A;  3ZHZ A;  3ANM A;  1JGI A;  3RAS A; 
#chains in the Genus database with same CATH topology
 4PVB A;  4R7L A;  3D1I A;  2A1T A;  3R7K A;  4ZW7 A;  1Y8O A;  2AO2 A;  2VJ8 A;  1IVH A;  3C3L A;  3AFE A;  1R0K A;  5K3G A;  2AZE A;  5EV7 A;  3NF4 A;  4AYS A;  3Q43 A;  3KML A;  3FU0 A;  3X0X A;  3X29 A;  3UEQ A;  3WQR A;  4QHP A;  4HKS A;  3FTV A;  3FUI A;  4XMZ A;  3FUK A;  2XS8 A;  4MP2 A;  2XQ0 A;  2JV7 A;  3FH5 A;  2JCX A;  2PG0 A;  4J1V A;  3D6B A;  2Y1G A;  3FTZ A;  4XN4 A;  2Z1Q A;  3PUU A;  2DQ6 A;  1RJ4 A;  4FZ4 A;  3TOR A;  4JIO A;  3ANL A;  2WZG A;  4X28 C;  1JM6 A;  1SIR A;  2VIG A;  3Q0A A;  2JD0 A;  2EGH A;  4Q4U A;  2OJQ A;  1GKZ A;  2Y1C A;  3FTW A;  3ZI0 A;  1JVS A;  2ZXG A;  4XMT A;  4XN5 A;  3WQQ A;  2RFQ A;  4L1F A;  2DVL A;  2O7G A;  3TZ2 A;  5JBI A;  4LUP A;  3FH8 A;  5FWQ A;  2CJ5 A;  5K3I A;  4R5V A;  4LQQ B;  3VAD A;  4DOY A;  1GJV A;  3FCJ A;  2JBR A;  5J6A A;  2JBS A;  4ZN6 A;  2JD2 A;  4XN7 A;  5HNF A;  3MXL A;  4AI6 A;  2BU5 A;  3Q44 A;  4XN8 A;  4E02 A;  2YYK A;  2PO4 A;  2XPZ A;  4FF4 A;  3B7T A;  2MAP A;  1W07 A;  4GAA A;  3IIE A;  4Q4I A;  1LVC A;  3CZL A;  3B7S A;  4ZX5 A;  2EC5 A;  2PL5 A;  2E80 A;  1T9G A;  3R0I A;  5M4P A;  3TZ4 A;  5JNL A;  3FU6 A;  3F29 A;  3UER A;  3JT1 A;  3ANM A;  2BU2 A;  4Q0T A;  3RAS A;  3SF6 A;  1UKW A;  3MPI A;  4OO2 A;  4RCV A;  3FUD A;  4DZY A;  3FUM A;  2XQR B;  4HR3 A;  4XMU A;  5JC1 A;  3CHO A;  3FH7 A;  2C12 A;  2J7A A;  4ZX6 A;  3T8V A;  1X3Z A;  1PI1 A;  5JAZ A;  5HNH A;  2E81 A;  1JG9 A;  1RJ1 A;  5M4M A;  2IX6 A;  2VLA A;  1XFW A;  3FUF A;  3TZ5 A;  4JND A;  4OOE A;  3EBH A;  4FLS A;  2ZDY A;  4XND A;  2REH A;  3GNC A;  4KSF A;  3ZHY A;  3HW2 A;  3VKG A;  2PNR A;  5B6B A;  3MDD A;  5HLT A;  1GKX A;  2JBT A;  1XFV A;  4X28 A;  3CZK A;  4ZW3 A;  3B3B A;  3AUA A;  5BRK A;  4MPC A;  3UU9 A;  3CHQ A;  3RKH A;  5BPP A;  4LQS B;  3FTU A;  1Y0V A;  3L1T A;  4GAE A;  2MAO A;  3OWM A;  2XS1 A;  3FTS A;  3SWO A;  4ZQF A;  1EGC A;  4BKX A;  2YGW A;  2BTZ A;  4ZQH A;  2YYJ A;  1EGD A;  1XFX A;  4M9A A;  4QPE A;  1MW0 A;  4XNB A;  1JQI A;  2C0U A;  2R0N A;  4K5P A;  3FTY A;  3UBR A;  2PGG A;  2YYI A;  2VR0 A;  3Q24 A;  2YYG A;  2FFL A;  4RVB A;  3B7U X;  3QJX A;  4G97 A;  4L3Z A;  3RC8 A;  4IV6 A;  1T1S A;  2WBI A;  3TTB A;  4XO5 A;  3T0Y A;  3EOM A;  4MPE A;  3KED A;  1FS7 A;  5AEN A;  2R05 A;  2YYM A;  3CRK A;  4RSY A;  4R5T A;  4J3B A;  4N5F A;  4H7Q A;  3P4T A;  3JSZ A;  4OOF A;  2CJ8 A;  2C5Z A;  2F6L A;  3BNJ A;  1SG7 A;  3II9 A;  3LG1 A;  4RM7 A;  2FP1 A;  4F0X A;  2Q8F A;  4MP7 A;  5K3H A;  4V26 A;  1SK6 A;  4W9U A;  4FLQ A;  3PFD A;  2Y1F A;  1FS9 A;  3D9G A;  2GTQ A;  4Q5C A;  1Q0H A;  4XMX A;  5JO0 A;  1OAH A;  2B61 A;  1S26 A;  3MMO A;  1XFZ A;  5K3J A;  1S46 A;  3B96 A;  3CIA A;  4KCF A;  5B5V A;  3CHR A;  2GBB A;  2JCV A;  2R72 A;  4FF3 A;  3SXQ A;  3Q23 A;  3VKH A;  1G5A A;  5B5W A;  1XFU A;  4KP7 A;  3B7R L;  2JIF A;  2BU8 A;  4L2L A;  1PK0 A;  4XO3 A;  3WQS B;  5BRM A;  1MVY A;  4DPR A;  1MW3 A;  4FLO A;  1X8Z A;  4JIZ A;  1RP3 A;  4ZYJ A;  3UCQ A;  4AR9 A;  2WPG A;  4P13 A;  5DLL A;  2YYL A;  1GW6 A;  4X2U A;  3CHP A;  1MW1 A;  3BNG A;  3SCE A;  4K5M A;  4XN1 A;  3A06 A;  2ZDX A;  2WZF A;  2Y1D A;  3FUL A;  2R59 A;  4XMW A;  5M4K A;  1OR7 A;  4XO4 A;  2RDZ A;  4IRN A;  3FU3 A;  4PU2 A;  4AR8 A;  3D9E A;  4AKG A;  3B2P A;  2UXW A;  2RJI A;  4A03 A;  4CXF A;  1R0L A;  3CE2 A;  1BUC A;  4QME A;  3C2P A;  2Q8G A;  3CXB A;  1SC5 A;  2E0A A;  2C82 A;  1ONP A;  3FUH A;  2Y1E A;  2R70 A;  1R3B A;  3ANN A;  4HKR A;  2LFW A;  3D2R A;  4O5M A;  4L3Y A;  3VVL A;  3BNF A;  4ZQE A;  5JMW A;  3C46 A;  4FCA A;  3EBI A;  4KS9 A;  2FON A;  2QR4 A;  3BNH A;  3FHE A;  1XFY A;  2JD1 A;  3MKH A;  2OT4 A;  5J71 A;  4AKH A;  1ONO A;  3MDE A;  3EON A;  4XNA A;  3VVM A;  4KTO A;  1H3L A;  3B34 A;  3AFF A;  4Y6R A;  2EBF X;  2CJ7 A;  4ZX4 A;  3ZHZ A;  1R2J A;  3X0Y A;  4FF2 A;  2QJ1 A;  2A7O A;  5DYF A;  2OR0 A;  3FU5 A;  4P79 A;  1U8V A;  4Y6P A;  4R5X A;  4ZXV A;  2CX9 A;  3D9D A;  4MKT A;  1ZS2 A;  4PW4 A;  4FLR A;  2EBA A;  3S7W A;  1UDY A;  4AKI A;  2ZKJ A;  1RX0 A;  1SQM A;  3D9F A;  5JMP A;  2RF7 A;  3U9W A;  4Q4E A;  2BU7 A;  2BU6 A;  4XN2 A;  1XG2 B;  4KSA A;  1K5H A;  3OWA A;  2VF1 A;  1Q0Q A;  2FP2 A;  1MW2 A;  4ZX3 A;  3FUE A;  2HPT A;  2DDH A;  3ZHX A;  1X91 A;  1ONN A;  4H81 A;  2QVW A;  1K93 A;  4NQW A;  1WS9 A;  4XVX A;  2CJ6 A;  3CZG A;  1IS2 A;  1QDB A;  4E00 A;  4Q5B A;  4FF1 A;  1EGE A;  4ZW6 A;  2HPO A;  3AU9 A;  3Q22 A;  1GU6 A;  4ZW5 A;  2ZAF A;  4ARF A;  2IX5 A;  2D29 A;  4G5E A;  2DQM A;  3FTX A;  3N0R A;  3M9V A;  5DUL A;  2R0M A;  4MS6 A;  4WJY A;  4K5N A;  4Y6S A;  4QUO A;  2Q8H A;  3TZ0 A;  3A14 A;  1K8T A;  3HWC A;  4NXL A;  3RC3 A;  4Y67 A;  2JCY A;  1Q0L A;  2R02 A;  3FO3 A;  2ZO5 A;  4ZQT A;  1T1R A;  4XN9 A;  1FS8 A;  4AIC A;  3GM6 A;  1SIQ A;  2HJN A;  3OIB A;  4MPN A;  4U83 A;  5M4N A;  2CJ4 A;  1X3W A;  4K5O A;  1X90 A;  3CHS A;  2EBH X;  2PUS A;  4L3X A;  2R03 A;  3CRL A;  5GJW E;  4QIR A;  4AR1 A;  2Q8I A;  4V25 A;  4XMV A;  3B37 A;  4ZQG A;  3B2X A;  3LGQ A;  3AU8 A;  1Y8P A;  2OEX A;  3FUN A;  2XPY A;  1K90 A;  4Q17 A;  4QIC A;  4K5L A;  3EBG A;  5GJV E;  1HS6 A;  1Y8N A;  4H85 A;  3MPJ A;  2OEV A;  4L38 A;  4Q1O A;  3CZE A;  4ZW8 A;  1H19 A;  4E01 A;  1JGI A;  4JEK A;  3GQT A;  3FUJ A; 
#chains in the Genus database with same CATH homology
 4PVB A;  4R7L A;  4ZW7 A;  2AO2 A;  2VJ8 A;  3C3L A;  1R0K A;  2AZE A;  5EV7 A;  4AYS A;  3Q43 A;  3KML A;  3FU0 A;  3X29 A;  3UEQ A;  3WQR A;  4QHP A;  4HKS A;  3FTV A;  3FUI A;  4XMZ A;  3FUK A;  2XQ0 A;  2JV7 A;  3FH5 A;  2JCX A;  2Y1G A;  3FTZ A;  4XN4 A;  3PUU A;  2DQ6 A;  4FZ4 A;  3ANL A;  2WZG A;  3Q0A A;  2JD0 A;  2EGH A;  2Y1C A;  3FTW A;  3ZI0 A;  1JVS A;  2ZXG A;  4XMT A;  4XN5 A;  3WQQ A;  2O7G A;  5JBI A;  4LUP A;  3FH8 A;  5FWQ A;  4R5V A;  4ZN6 A;  2JD2 A;  4XN7 A;  5HNF A;  4AI6 A;  3Q44 A;  4XN8 A;  2PO4 A;  2XPZ A;  4FF4 A;  3B7T A;  2MAP A;  4GAA A;  3IIE A;  4Q4I A;  1LVC A;  3CZL A;  3B7S A;  4ZX5 A;  2EC5 A;  2PL5 A;  3R0I A;  5JNL A;  3FU6 A;  3UER A;  3JT1 A;  3ANM A;  3RAS A;  4RCV A;  3FUD A;  3FUM A;  4XMU A;  5JC1 A;  3CHO A;  3FH7 A;  4ZX6 A;  3T8V A;  1X3Z A;  5JAZ A;  5HNH A;  1JG9 A;  2VLA A;  1XFW A;  3FUF A;  4JND A;  4OOE A;  3EBH A;  4FLS A;  4XND A;  4KSF A;  3ZHY A;  3VKG A;  5HLT A;  1XFV A;  3CZK A;  4ZW3 A;  3B3B A;  3AUA A;  3CHQ A;  5BPP A;  3FTU A;  1Y0V A;  4GAE A;  2MAO A;  3FTS A;  4ZQF A;  4BKX A;  2YGW A;  4ZQH A;  1XFX A;  4QPE A;  1MW0 A;  4XNB A;  4K5P A;  3FTY A;  2PGG A;  3Q24 A;  2FFL A;  4RVB A;  3B7U X;  3QJX A;  4G97 A;  3RC8 A;  1T1S A;  4XO5 A;  3T0Y A;  3KED A;  5AEN A;  4RSY A;  4R5T A;  4J3B A;  3JSZ A;  4OOF A;  2C5Z A;  2F6L A;  1SG7 A;  2FP1 A;  4F0X A;  1SK6 A;  4FLQ A;  2Y1F A;  2GTQ A;  1Q0H A;  4XMX A;  5JO0 A;  2B61 A;  1S26 A;  1XFZ A;  1S46 A;  3CIA A;  3CHR A;  2GBB A;  2JCV A;  2R72 A;  4FF3 A;  3Q23 A;  3VKH A;  1G5A A;  1XFU A;  4KP7 A;  3B7R L;  4L2L A;  1PK0 A;  4XO3 A;  3WQS B;  1MVY A;  4DPR A;  1MW3 A;  4FLO A;  1RP3 A;  3UCQ A;  4AR9 A;  2WPG A;  5DLL A;  1GW6 A;  4X2U A;  3CHP A;  1MW1 A;  4K5M A;  4XN1 A;  3A06 A;  2WZF A;  2Y1D A;  3FUL A;  2R59 A;  4XMW A;  1OR7 A;  4XO4 A;  3FU3 A;  4PU2 A;  4AR8 A;  4AKG A;  3B2P A;  2RJI A;  4A03 A;  4CXF A;  1R0L A;  3CE2 A;  4QME A;  3C2P A;  1SC5 A;  2C82 A;  1ONP A;  3FUH A;  2Y1E A;  2R70 A;  3ANN A;  4HKR A;  2LFW A;  3VVL A;  4ZQE A;  5JMW A;  3C46 A;  4FCA A;  3EBI A;  4KS9 A;  2QR4 A;  3FHE A;  1XFY A;  2JD1 A;  4AKH A;  1ONO A;  4XNA A;  3VVM A;  1H3L A;  3B34 A;  4Y6R A;  2EBF X;  4ZX4 A;  3ZHZ A;  4FF2 A;  2QJ1 A;  2A7O A;  5DYF A;  3FU5 A;  4P79 A;  4Y6P A;  4R5X A;  4MKT A;  1ZS2 A;  4PW4 A;  4FLR A;  4AKI A;  1SQM A;  5JMP A;  3U9W A;  4Q4E A;  4XN2 A;  4KSA A;  1K5H A;  2VF1 A;  1Q0Q A;  2FP2 A;  1MW2 A;  4ZX3 A;  3FUE A;  2HPT A;  3ZHX A;  1ONN A;  2QVW A;  1K93 A;  4NQW A;  3CZG A;  4FF1 A;  4ZW6 A;  2HPO A;  3AU9 A;  3Q22 A;  4ZW5 A;  4ARF A;  2DQM A;  3FTX A;  3N0R A;  5DUL A;  4MS6 A;  4K5N A;  4Y6S A;  4QUO A;  3A14 A;  1K8T A;  3RC3 A;  4Y67 A;  2JCY A;  1Q0L A;  4ZQT A;  1T1R A;  4XN9 A;  4AIC A;  1X3W A;  4K5O A;  3CHS A;  2EBH X;  2PUS A;  5GJW E;  4QIR A;  4AR1 A;  4XMV A;  3B37 A;  4ZQG A;  3B2X A;  3AU8 A;  3FUN A;  2XPY A;  1K90 A;  4QIC A;  4K5L A;  3EBG A;  5GJV E;  1HS6 A;  3CZE A;  4ZW8 A;  1H19 A;  1JGI A;  3FUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...