1RP3A

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
235
structure length
235
Chain Sequence
HMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 95
structure length 235
sequence length 235
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1rp3A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1rp3A02
3ZHYA 3WQSB 2JCYA 5JMWA 3A06A 4Y67A 1RP3A 1JGIA 5JMPA 4KP7A 2MAOA 3UCQA 4FLOA 4AYSA 5JC1A 4AICA 1R0KA 1ZS2A 2Y1GA 3AUAA 3WQQA 1MW0A 1ONNA 3ZHZA 4Y6SA 1MW1A 2JCXA 3T0YA 4ZQGA 3UERA 2Y1EA 4Y6RA 1Q0LA 4A03A 3WQRA 4ZN6A 3AU9A 3CZLA 5JNLA 4ZQFA 1JG9A 1MVYA 4OOFA 4QICA 2WPGA 4LUPA 4FLSA 3IIEA 4NQWA 3A14A 3ANLA 4FLQA 3RASA 1H3LA 4Y6PA 5JAZA 3ZI0A 5JO0A 2JD0A 5JBIA 4ZQHA 4G97A 2JD2A 3UEQA 4FLRA 1K5HA 4ZQEA 4CXFA 1R0LA 3CZGA 1S46A 1MW3A 4OOEA 2MAPA 2JD1A 2LFWA 1OR7A 1T1RA 3AU8A 2Y1CA 1G5AA 1ONOA 3CZKA 2EGHA 3ZHXA 3R0IA 2Y1FA 2Y1DA 3ANNA 2JCVA 1Q0HA 1ONPA 1JVSA 3N0RA 3CZEA 2O7GA 3ANMA 4GAEA 1Q0QA 1SC5A 1T1SA 1MW2A 5DULA 2C82A 4RCVA
chains in the Genus database with same CATH superfamily
2GTQA 4ZYJA 2JCYA 5JMWA 2OEXA 4L3ZA 2CJ5A 1R3BA 4Q1OA 3CRLA 5JMPA 1EGCA 1FS8A 3EBGA 4XO3A 2YGWA 2MAOA 3UCQA 1EGEA 2RFQA 2R03A 3D2RA 4MPCA 2FP1A 3X29A 4XO5A 3SWOA 3AUAA 2WZFA 2ZO5A 4HR3A 4Q0TA 4WJYA 5GJWE 4Y6SA 3T8VA 1MW1A 2JCXA 4X28A 4ZQGA 3MPJA 4K5MA 2E81A 4HKRA 3FU0A 3FUMA 5HNFA 4ZN6A 2CJ4A 2VF1A 5B5WA 2AO2A 3B37A 5M4NA 2IX5A 1Y0VA 4ZX4A 4ZQFA 4QICA 4P13A 5BRKA 2WPGA 3FTSA 3SCEA 2PUSA 3D6BA 4Q4EA 4ZX6A 3FH7A 4NXLA 3FH5A 4PVBA 2XPZA 3LG1A 4Y6PA 2JV7A 2GBBA 4ZX3A 2OJQA 5J6AA 2ZDXA 4ZQEA 4CXFA 2CJ6A 2PNRA 1R0LA 3CHQA 3EONA 3D9DA 4OOEA 4H81A 1PK0A 4E00A 3BNHA 2XQRB 3TZ0A 2C5ZA 4Q5CA 2E0AA 2YYLA 3Q43A 5EV7A 5HNHA 4FF4A 1ONOA 3MDEA 4L3YA 2EGHA 3GNCA 3ZHXA 2BU6A 5K3JA 3FTXA 4E02A 2FP2A 3JT1A 3FCJA 1SK6A 3UU9A 1Q0HA 3B2PA 1JVSA 3RKHA 3BNGA 4LQSB 3TZ2A 1GKZA 3EOMA 3ANMA 4GAEA 2YYMA 2VLAA 1U8VA 2DDHA 3B7SA 5AENA 5DYFA 1SC5A 2OR0A 3FUKA 4K5PA 4JIOA 1T1SA 3HWCA 1MW2A 3MXLA 4XMTA 2HPOA 2ZAFA 2R05A 4ZW6A 2YYIA 4AR8A 3AFEA 4L3XA 3WQSB 2DVLA 2UXWA 3A06A 1RP3A 4V26A 2A1TA 1RJ4A 1SIRA 2CJ7A 3EBIA 4KP7A 3S7WA 4QUOA 4AR9A 4XNDA 2DQ6A 2BU7A 4XN2A 3L1TA 4RM7A 2VJ8A 1ONNA 4O5MA 3OIBA 1FS7A 4R7LA 4QPEA 2Q8FA 4XO4A 2BTZA 3FUDA 2YYJA 3WQRA 1JQIA 4X28C 3CZLA 3FUIA 3CE2A 3D9FA 3FU5A 3SF6A 3FTWA 1MVYA 3GQTA 4XMZA 4QHPA 3AFFA 4J3BA 4J1VA 2YYGA 5HLTA 4V25A 2R72A 4M9AA 5B6BA 2CX9A 2R0MA 3B34A 5K3GA 4NQWA 1X90A 1IVHA 2F6LA 1H3LA 5JAZA 4RSYA 3VVLA 3X0XA 1SQMA 2JD0A 4MKTA 5JBIA 4ZQHA 4G97A 2PGGA 4G5EA 2JD2A 3B7TA 2JIFA 4XMWA 5M4PA 4FZ4A 4XN8A 2XQ0A 3D9EA 4KSFA 2VIGA 1S46A 1XFUA 1EGDA 1MW3A 5GJVE 2MAPA 2LFWA 3FUEA 3RC3A 3D1IA 1XFWA 2Y1CA 4XN4A 1G5AA 1X3WA 4JNDA 3FU6A 4Q17A 3R7KA 3BNFA 3F29A 2JCVA 4IV6A 2Q8GA 2A7OA 1UDYA 3N0RA 4F0XA 2YYKA 3M9VA 5B5VA 1GW6A 3CZEA 2BU8A 4DZYA 4AKGA 1RJ1A 2XS8A 3RC8A 1OAHA 2BU2A 2BU5A 2PG0A 1XFZA 2QR4A 4ZW3A 2OEVA 1Q0QA 4ZW7A 3OWAA 1HS6A 4Q4UA 1K90A 1LVCA 4H7QA 3FUHA 1JM6A 3FTVA 1R2JA 3ZHYA 1Y8NA 3X0YA 4FF3A 4Y67A 2JBSA 2IX6A 3C46A 3FTZA 2PL5A 2ZXGA 4FLOA 3B7RL 3Q24A 5JC1A 4AICA 2R02A 1Y8PA 2XS1A 3B3BA 2Y1GA 3WQQA 2CJ8A 2Q8IA 4AKHA 2AZEA 2WZGA 2EBAA 2Z1QA 2B61A 4ARFA 3UERA 5DLLA 4X2UA 4Y6RA 3QJXA 3GM6A 3CHPA 3Q0AA 3OWMA 4IRNA 2DQMA 1X91A 4W9UA 1SG7A 3AU9A 3Q23A 3TZ4A 4LQQB 2FFLA 2E80A 2RF7A 4LUPA 3SXQA 5BRMA 4KSAA 4FLSA 3IIEA 4XN7A 3CIAA 4H85A 3FO3A 4N5FA 3ANLA 2D29A 4MP7A 1H19A 2ZDYA 2QVWA 3FUNA 1Y8OA 3C3LA 4XN5A 2HJNA 2FONA 1W07A 4K5OA 1K5HA 4GAAA 3CZGA 4JIZA 3B96A 2R59A 1S26A 4MS6A 4FCAA 3CHOA 3NF4A 1XFVA 1OR7A 1XFXA 3TTBA 1RX0A 3MMOA 2REHA 3Q22A 3TORA 2Y1FA 3PUUA 3VKHA 4FF2A 3HW2A 2XPYA 1UKWA 2VR0A 2R70A 2RDZA 4Q5BA 4KTOA 4XMVA 4XMUA 3CHRA 5K3HA 3UBRA 1GKXA 3PFDA 3U9WA 3P4TA 2C0UA 4MPNA 2EBFX 1QDBA 3KEDA 4ZX5A 2JBRA 4RCVA 2R0NA 3II9A 4XMXA 1WS9A 1BUCA 4K5NA 3MKHA 4E01A 4XN1A 3FTUA 4L1FA 4R5XA 1JGIA 3CHSA 4P79A 2EC5A 4ZXVA 3MDDA 1K93A 4AYSA 3VVMA 4L38A 1R0KA 2J7AA 2PO4A 1ZS2A 1MW0A 3ZHZA 4R5TA 1X8ZA 4PU2A 3T0YA 2Y1EA 1Q0LA 1XFYA 3CRKA 1T9GA 4A03A 4JEKA 3Q44A 5JNLA 3BNJA 4XNAA 1IS2A 4KS9A 4AKIA 3FH8A 1JG9A 4OOFA 1GU6A 3KMLA 5J71A 4XN9A 4DPRA 3FUJA 4DOYA 4FF1A 3A14A 1K8TA 4FLQA 3C2PA 4MP2A 4XVXA 3RASA 1GJVA 3ZI0A 2Q8HA 5JO0A 4PW4A 4ZW5A 4ZQTA 3UEQA 4FLRA 3B7UX 3B2XA 2HPTA 2ZKJA 4QIRA 1XG2B 2C12A 4HKSA 3MPIA 4BKXA 3JSZA 5FWQA 2JD1A 4Q4IA 1PI1A 4L2LA 1T1RA 3EBHA 3AU8A 4U83A 4AI6A 4RVBA 1FS9A 1X3ZA 3CZKA 4R5VA 3R0IA 4AR1A 4XNBA 2Y1DA 3ANNA 3FU3A 2EBHX 5M4MA 3D9GA 3CXBA 3FULA 3VADA 1ONPA 2RJIA 3TZ5A 5BPPA 3FHEA 3FTYA 2O7GA 1SIQA 2JBTA 4ZW8A 5M4KA 3LGQA 2OT4A 3FUFA 4KCFA 4K5LA 4MPEA 2QJ1A 4QMEA 2WBIA 2C82A 5DULA 3VKGA 4OO2A 5K3IA
chains in the Genus database with same CATH topology
2GTQA 2JCYA 5JMWA 5JMPA 3EBGA 4XO3A 2YGWA 2MAOA 3UCQA 2FP1A 3X29A 4XO5A 3AUAA 2WZFA 5GJWE 4Y6SA 3T8VA 1MW1A 2JCXA 4ZQGA 4K5MA 4HKRA 3FU0A 3FUMA 5HNFA 4ZN6A 2VF1A 2AO2A 3B37A 1Y0VA 4ZX4A 4ZQFA 4QICA 2WPGA 3FTSA 2PUSA 4Q4EA 4ZX6A 3FH7A 3FH5A 4PVBA 2XPZA 4Y6PA 2JV7A 2GBBA 4ZX3A 4ZQEA 4CXFA 1R0LA 3CHQA 4OOEA 1PK0A 2C5ZA 3Q43A 5EV7A 5HNHA 4FF4A 1ONOA 2EGHA 3ZHXA 3FTXA 2FP2A 3JT1A 1SK6A 1Q0HA 3B2PA 1JVSA 3ANMA 4GAEA 2VLAA 3B7SA 5AENA 5DYFA 1SC5A 3FUKA 4K5PA 1T1SA 1MW2A 4XMTA 2HPOA 4ZW6A 4AR8A 3WQSB 3A06A 1RP3A 3EBIA 4KP7A 4QUOA 4AR9A 4XNDA 2DQ6A 4XN2A 2VJ8A 1ONNA 4R7LA 4QPEA 4XO4A 3FUDA 3WQRA 3CZLA 3FUIA 3CE2A 3FU5A 3FTWA 1MVYA 4XMZA 4QHPA 4J3BA 5HLTA 2R72A 3B34A 4NQWA 2F6LA 1H3LA 5JAZA 4RSYA 3VVLA 1SQMA 2JD0A 4MKTA 5JBIA 4ZQHA 4G97A 2PGGA 2JD2A 3B7TA 4XMWA 4FZ4A 4XN8A 2XQ0A 4KSFA 1S46A 1XFUA 1MW3A 5GJVE 2MAPA 2LFWA 3FUEA 3RC3A 1XFWA 2Y1CA 4XN4A 1G5AA 1X3WA 4JNDA 3FU6A 2JCVA 2A7OA 3N0RA 4F0XA 1GW6A 3CZEA 4AKGA 3RC8A 1XFZA 2QR4A 4ZW3A 1Q0QA 4ZW7A 1HS6A 1K90A 1LVCA 3FUHA 3FTVA 3ZHYA 4FF3A 4Y67A 3C46A 3FTZA 2PL5A 2ZXGA 4FLOA 3B7RL 3Q24A 5JC1A 4AICA 3B3BA 2Y1GA 3WQQA 4AKHA 2AZEA 2WZGA 2B61A 4ARFA 3UERA 5DLLA 4X2UA 4Y6RA 3QJXA 3CHPA 3Q0AA 2DQMA 1SG7A 3AU9A 3Q23A 2FFLA 4LUPA 4KSAA 4FLSA 3IIEA 4XN7A 3CIAA 3ANLA 1H19A 2QVWA 3FUNA 3C3LA 4XN5A 4K5OA 1K5HA 4GAAA 3CZGA 2R59A 1S26A 4MS6A 4FCAA 3CHOA 1XFVA 1OR7A 1XFXA 3Q22A 2Y1FA 3PUUA 3VKHA 4FF2A 2XPYA 2R70A 4XMVA 4XMUA 3CHRA 3U9WA 2EBFX 3KEDA 4ZX5A 4RCVA 4XMXA 4K5NA 4XN1A 3FTUA 4R5XA 1JGIA 3CHSA 4P79A 2EC5A 1K93A 4AYSA 3VVMA 1R0KA 2PO4A 1ZS2A 1MW0A 3ZHZA 4R5TA 4PU2A 3T0YA 2Y1EA 1Q0LA 1XFYA 4A03A 3Q44A 5JNLA 4XNAA 4KS9A 4AKIA 3FH8A 1JG9A 4OOFA 3KMLA 4XN9A 4DPRA 3FUJA 4FF1A 3A14A 1K8TA 4FLQA 3C2PA 3RASA 3ZI0A 5JO0A 4PW4A 4ZW5A 4ZQTA 3UEQA 4FLRA 3B7UX 3B2XA 2HPTA 4QIRA 4HKSA 4BKXA 3JSZA 5FWQA 2JD1A 4Q4IA 4L2LA 1T1RA 3EBHA 3AU8A 4AI6A 4RVBA 1X3ZA 3CZKA 4R5VA 3R0IA 4AR1A 4XNBA 2Y1DA 3ANNA 3FU3A 2EBHX 3FULA 1ONPA 2RJIA 5BPPA 3FHEA 3FTYA 2O7GA 4ZW8A 3FUFA 4K5LA 2QJ1A 4QMEA 2C82A 5DULA 3VKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHY A;  3WQS B;  2JCY A;  5JMW A;  3A06 A;  4Y67 A;  1RP3 A;  1JGI A;  5JMP A;  4KP7 A;  2MAO A;  3UCQ A;  4FLO A;  4AYS A;  5JC1 A;  4AIC A;  1R0K A;  1ZS2 A;  2Y1G A;  3AUA A;  3WQQ A;  1MW0 A;  1ONN A;  3ZHZ A;  4Y6S A;  1MW1 A;  2JCX A;  3T0Y A;  4ZQG A;  3UER A;  2Y1E A;  4Y6R A;  1Q0L A;  4A03 A;  3WQR A;  4ZN6 A;  3AU9 A;  3CZL A;  5JNL A;  4ZQF A;  1JG9 A;  1MVY A;  4OOF A;  4QIC A;  2WPG A;  4LUP A;  4FLS A;  3IIE A;  4NQW A;  3A14 A;  3ANL A;  4FLQ A;  3RAS A;  1H3L A;  4Y6P A;  5JAZ A;  3ZI0 A;  5JO0 A;  2JD0 A;  5JBI A;  4ZQH A;  4G97 A;  2JD2 A;  3UEQ A;  4FLR A;  1K5H A;  4ZQE A;  4CXF A;  1R0L A;  3CZG A;  1S46 A;  1MW3 A;  4OOE A;  2MAP A;  2JD1 A;  2LFW A;  1OR7 A;  1T1R A;  3AU8 A;  2Y1C A;  1G5A A;  1ONO A;  3CZK A;  2EGH A;  3ZHX A;  3R0I A;  2Y1F A;  2Y1D A;  3ANN A;  2JCV A;  1Q0H A;  1ONP A;  1JVS A;  3N0R A;  3CZE A;  2O7G A;  3ANM A;  4GAE A;  1Q0Q A;  1SC5 A;  1T1S A;  1MW2 A;  5DUL A;  2C82 A;  4RCV A; 
#chains in the Genus database with same CATH topology
 2GTQ A;  4ZYJ A;  2JCY A;  5JMW A;  2OEX A;  4L3Z A;  2CJ5 A;  1R3B A;  4Q1O A;  3CRL A;  5JMP A;  1EGC A;  1FS8 A;  3EBG A;  4XO3 A;  2YGW A;  2MAO A;  3UCQ A;  1EGE A;  2RFQ A;  2R03 A;  3D2R A;  4MPC A;  2FP1 A;  3X29 A;  4XO5 A;  3SWO A;  3AUA A;  2WZF A;  2ZO5 A;  4HR3 A;  4Q0T A;  4WJY A;  5GJW E;  4Y6S A;  3T8V A;  1MW1 A;  2JCX A;  4X28 A;  4ZQG A;  3MPJ A;  4K5M A;  2E81 A;  4HKR A;  3FU0 A;  3FUM A;  5HNF A;  4ZN6 A;  2CJ4 A;  2VF1 A;  5B5W A;  2AO2 A;  3B37 A;  5M4N A;  2IX5 A;  1Y0V A;  4ZX4 A;  4ZQF A;  4QIC A;  4P13 A;  5BRK A;  2WPG A;  3FTS A;  3SCE A;  2PUS A;  3D6B A;  4Q4E A;  4ZX6 A;  3FH7 A;  4NXL A;  3FH5 A;  4PVB A;  2XPZ A;  3LG1 A;  4Y6P A;  2JV7 A;  2GBB A;  4ZX3 A;  2OJQ A;  5J6A A;  2ZDX A;  4ZQE A;  4CXF A;  2CJ6 A;  2PNR A;  1R0L A;  3CHQ A;  3EON A;  3D9D A;  4OOE A;  4H81 A;  1PK0 A;  4E00 A;  3BNH A;  2XQR B;  3TZ0 A;  2C5Z A;  4Q5C A;  2E0A A;  2YYL A;  3Q43 A;  5EV7 A;  5HNH A;  4FF4 A;  1ONO A;  3MDE A;  4L3Y A;  2EGH A;  3GNC A;  3ZHX A;  2BU6 A;  5K3J A;  3FTX A;  4E02 A;  2FP2 A;  3JT1 A;  3FCJ A;  1SK6 A;  3UU9 A;  1Q0H A;  3B2P A;  1JVS A;  3RKH A;  3BNG A;  4LQS B;  3TZ2 A;  1GKZ A;  3EOM A;  3ANM A;  4GAE A;  2YYM A;  2VLA A;  1U8V A;  2DDH A;  3B7S A;  5AEN A;  5DYF A;  1SC5 A;  2OR0 A;  3FUK A;  4K5P A;  4JIO A;  1T1S A;  3HWC A;  1MW2 A;  3MXL A;  4XMT A;  2HPO A;  2ZAF A;  2R05 A;  4ZW6 A;  2YYI A;  4AR8 A;  3AFE A;  4L3X A;  3WQS B;  2DVL A;  2UXW A;  3A06 A;  1RP3 A;  4V26 A;  2A1T A;  1RJ4 A;  1SIR A;  2CJ7 A;  3EBI A;  4KP7 A;  3S7W A;  4QUO A;  4AR9 A;  4XND A;  2DQ6 A;  2BU7 A;  4XN2 A;  3L1T A;  4RM7 A;  2VJ8 A;  1ONN A;  4O5M A;  3OIB A;  1FS7 A;  4R7L A;  4QPE A;  2Q8F A;  4XO4 A;  2BTZ A;  3FUD A;  2YYJ A;  3WQR A;  1JQI A;  4X28 C;  3CZL A;  3FUI A;  3CE2 A;  3D9F A;  3FU5 A;  3SF6 A;  3FTW A;  1MVY A;  3GQT A;  4XMZ A;  4QHP A;  3AFF A;  4J3B A;  4J1V A;  2YYG A;  5HLT A;  4V25 A;  2R72 A;  4M9A A;  5B6B A;  2CX9 A;  2R0M A;  3B34 A;  5K3G A;  4NQW A;  1X90 A;  1IVH A;  2F6L A;  1H3L A;  5JAZ A;  4RSY A;  3VVL A;  3X0X A;  1SQM A;  2JD0 A;  4MKT A;  5JBI A;  4ZQH A;  4G97 A;  2PGG A;  4G5E A;  2JD2 A;  3B7T A;  2JIF A;  4XMW A;  5M4P A;  4FZ4 A;  4XN8 A;  2XQ0 A;  3D9E A;  4KSF A;  2VIG A;  1S46 A;  1XFU A;  1EGD A;  1MW3 A;  5GJV E;  2MAP A;  2LFW A;  3FUE A;  3RC3 A;  3D1I A;  1XFW A;  2Y1C A;  4XN4 A;  1G5A A;  1X3W A;  4JND A;  3FU6 A;  4Q17 A;  3R7K A;  3BNF A;  3F29 A;  2JCV A;  4IV6 A;  2Q8G A;  2A7O A;  1UDY A;  3N0R A;  4F0X A;  2YYK A;  3M9V A;  5B5V A;  1GW6 A;  3CZE A;  2BU8 A;  4DZY A;  4AKG A;  1RJ1 A;  2XS8 A;  3RC8 A;  1OAH A;  2BU2 A;  2BU5 A;  2PG0 A;  1XFZ A;  2QR4 A;  4ZW3 A;  2OEV A;  1Q0Q A;  4ZW7 A;  3OWA A;  1HS6 A;  4Q4U A;  1K90 A;  1LVC A;  4H7Q A;  3FUH A;  1JM6 A;  3FTV A;  1R2J A;  3ZHY A;  1Y8N A;  3X0Y A;  4FF3 A;  4Y67 A;  2JBS A;  2IX6 A;  3C46 A;  3FTZ A;  2PL5 A;  2ZXG A;  4FLO A;  3B7R L;  3Q24 A;  5JC1 A;  4AIC A;  2R02 A;  1Y8P A;  2XS1 A;  3B3B A;  2Y1G A;  3WQQ A;  2CJ8 A;  2Q8I A;  4AKH A;  2AZE A;  2WZG A;  2EBA A;  2Z1Q A;  2B61 A;  4ARF A;  3UER A;  5DLL A;  4X2U A;  4Y6R A;  3QJX A;  3GM6 A;  3CHP A;  3Q0A A;  3OWM A;  4IRN A;  2DQM A;  1X91 A;  4W9U A;  1SG7 A;  3AU9 A;  3Q23 A;  3TZ4 A;  4LQQ B;  2FFL A;  2E80 A;  2RF7 A;  4LUP A;  3SXQ A;  5BRM A;  4KSA A;  4FLS A;  3IIE A;  4XN7 A;  3CIA A;  4H85 A;  3FO3 A;  4N5F A;  3ANL A;  2D29 A;  4MP7 A;  1H19 A;  2ZDY A;  2QVW A;  3FUN A;  1Y8O A;  3C3L A;  4XN5 A;  2HJN A;  2FON A;  1W07 A;  4K5O A;  1K5H A;  4GAA A;  3CZG A;  4JIZ A;  3B96 A;  2R59 A;  1S26 A;  4MS6 A;  4FCA A;  3CHO A;  3NF4 A;  1XFV A;  1OR7 A;  1XFX A;  3TTB A;  1RX0 A;  3MMO A;  2REH A;  3Q22 A;  3TOR A;  2Y1F A;  3PUU A;  3VKH A;  4FF2 A;  3HW2 A;  2XPY A;  1UKW A;  2VR0 A;  2R70 A;  2RDZ A;  4Q5B A;  4KTO A;  4XMV A;  4XMU A;  3CHR A;  5K3H A;  3UBR A;  1GKX A;  3PFD A;  3U9W A;  3P4T A;  2C0U A;  4MPN A;  2EBF X;  1QDB A;  3KED A;  4ZX5 A;  2JBR A;  4RCV A;  2R0N A;  3II9 A;  4XMX A;  1WS9 A;  1BUC A;  4K5N A;  3MKH A;  4E01 A;  4XN1 A;  3FTU A;  4L1F A;  4R5X A;  1JGI A;  3CHS A;  4P79 A;  2EC5 A;  4ZXV A;  3MDD A;  1K93 A;  4AYS A;  3VVM A;  4L38 A;  1R0K A;  2J7A A;  2PO4 A;  1ZS2 A;  1MW0 A;  3ZHZ A;  4R5T A;  1X8Z A;  4PU2 A;  3T0Y A;  2Y1E A;  1Q0L A;  1XFY A;  3CRK A;  1T9G A;  4A03 A;  4JEK A;  3Q44 A;  5JNL A;  3BNJ A;  4XNA A;  1IS2 A;  4KS9 A;  4AKI A;  3FH8 A;  1JG9 A;  4OOF A;  1GU6 A;  3KML A;  5J71 A;  4XN9 A;  4DPR A;  3FUJ A;  4DOY A;  4FF1 A;  3A14 A;  1K8T A;  4FLQ A;  3C2P A;  4MP2 A;  4XVX A;  3RAS A;  1GJV A;  3ZI0 A;  2Q8H A;  5JO0 A;  4PW4 A;  4ZW5 A;  4ZQT A;  3UEQ A;  4FLR A;  3B7U X;  3B2X A;  2HPT A;  2ZKJ A;  4QIR A;  1XG2 B;  2C12 A;  4HKS A;  3MPI A;  4BKX A;  3JSZ A;  5FWQ A;  2JD1 A;  4Q4I A;  1PI1 A;  4L2L A;  1T1R A;  3EBH A;  3AU8 A;  4U83 A;  4AI6 A;  4RVB A;  1FS9 A;  1X3Z A;  3CZK A;  4R5V A;  3R0I A;  4AR1 A;  4XNB A;  2Y1D A;  3ANN A;  3FU3 A;  2EBH X;  5M4M A;  3D9G A;  3CXB A;  3FUL A;  3VAD A;  1ONP A;  2RJI A;  3TZ5 A;  5BPP A;  3FHE A;  3FTY A;  2O7G A;  1SIQ A;  2JBT A;  4ZW8 A;  5M4K A;  3LGQ A;  2OT4 A;  3FUF A;  4KCF A;  4K5L A;  4MPE A;  2QJ1 A;  4QME A;  2WBI A;  2C82 A;  5DUL A;  3VKG A;  4OO2 A;  5K3I A; 
#chains in the Genus database with same CATH homology
 2GTQ A;  2JCY A;  5JMW A;  5JMP A;  3EBG A;  4XO3 A;  2YGW A;  2MAO A;  3UCQ A;  2FP1 A;  3X29 A;  4XO5 A;  3AUA A;  2WZF A;  5GJW E;  4Y6S A;  3T8V A;  1MW1 A;  2JCX A;  4ZQG A;  4K5M A;  4HKR A;  3FU0 A;  3FUM A;  5HNF A;  4ZN6 A;  2VF1 A;  2AO2 A;  3B37 A;  1Y0V A;  4ZX4 A;  4ZQF A;  4QIC A;  2WPG A;  3FTS A;  2PUS A;  4Q4E A;  4ZX6 A;  3FH7 A;  3FH5 A;  4PVB A;  2XPZ A;  4Y6P A;  2JV7 A;  2GBB A;  4ZX3 A;  4ZQE A;  4CXF A;  1R0L A;  3CHQ A;  4OOE A;  1PK0 A;  2C5Z A;  3Q43 A;  5EV7 A;  5HNH A;  4FF4 A;  1ONO A;  2EGH A;  3ZHX A;  3FTX A;  2FP2 A;  3JT1 A;  1SK6 A;  1Q0H A;  3B2P A;  1JVS A;  3ANM A;  4GAE A;  2VLA A;  3B7S A;  5AEN A;  5DYF A;  1SC5 A;  3FUK A;  4K5P A;  1T1S A;  1MW2 A;  4XMT A;  2HPO A;  4ZW6 A;  4AR8 A;  3WQS B;  3A06 A;  1RP3 A;  3EBI A;  4KP7 A;  4QUO A;  4AR9 A;  4XND A;  2DQ6 A;  4XN2 A;  2VJ8 A;  1ONN A;  4R7L A;  4QPE A;  4XO4 A;  3FUD A;  3WQR A;  3CZL A;  3FUI A;  3CE2 A;  3FU5 A;  3FTW A;  1MVY A;  4XMZ A;  4QHP A;  4J3B A;  5HLT A;  2R72 A;  3B34 A;  4NQW A;  2F6L A;  1H3L A;  5JAZ A;  4RSY A;  3VVL A;  1SQM A;  2JD0 A;  4MKT A;  5JBI A;  4ZQH A;  4G97 A;  2PGG A;  2JD2 A;  3B7T A;  4XMW A;  4FZ4 A;  4XN8 A;  2XQ0 A;  4KSF A;  1S46 A;  1XFU A;  1MW3 A;  5GJV E;  2MAP A;  2LFW A;  3FUE A;  3RC3 A;  1XFW A;  2Y1C A;  4XN4 A;  1G5A A;  1X3W A;  4JND A;  3FU6 A;  2JCV A;  2A7O A;  3N0R A;  4F0X A;  1GW6 A;  3CZE A;  4AKG A;  3RC8 A;  1XFZ A;  2QR4 A;  4ZW3 A;  1Q0Q A;  4ZW7 A;  1HS6 A;  1K90 A;  1LVC A;  3FUH A;  3FTV A;  3ZHY A;  4FF3 A;  4Y67 A;  3C46 A;  3FTZ A;  2PL5 A;  2ZXG A;  4FLO A;  3B7R L;  3Q24 A;  5JC1 A;  4AIC A;  3B3B A;  2Y1G A;  3WQQ A;  4AKH A;  2AZE A;  2WZG A;  2B61 A;  4ARF A;  3UER A;  5DLL A;  4X2U A;  4Y6R A;  3QJX A;  3CHP A;  3Q0A A;  2DQM A;  1SG7 A;  3AU9 A;  3Q23 A;  2FFL A;  4LUP A;  4KSA A;  4FLS A;  3IIE A;  4XN7 A;  3CIA A;  3ANL A;  1H19 A;  2QVW A;  3FUN A;  3C3L A;  4XN5 A;  4K5O A;  1K5H A;  4GAA A;  3CZG A;  2R59 A;  1S26 A;  4MS6 A;  4FCA A;  3CHO A;  1XFV A;  1OR7 A;  1XFX A;  3Q22 A;  2Y1F A;  3PUU A;  3VKH A;  4FF2 A;  2XPY A;  2R70 A;  4XMV A;  4XMU A;  3CHR A;  3U9W A;  2EBF X;  3KED A;  4ZX5 A;  4RCV A;  4XMX A;  4K5N A;  4XN1 A;  3FTU A;  4R5X A;  1JGI A;  3CHS A;  4P79 A;  2EC5 A;  1K93 A;  4AYS A;  3VVM A;  1R0K A;  2PO4 A;  1ZS2 A;  1MW0 A;  3ZHZ A;  4R5T A;  4PU2 A;  3T0Y A;  2Y1E A;  1Q0L A;  1XFY A;  4A03 A;  3Q44 A;  5JNL A;  4XNA A;  4KS9 A;  4AKI A;  3FH8 A;  1JG9 A;  4OOF A;  3KML A;  4XN9 A;  4DPR A;  3FUJ A;  4FF1 A;  3A14 A;  1K8T A;  4FLQ A;  3C2P A;  3RAS A;  3ZI0 A;  5JO0 A;  4PW4 A;  4ZW5 A;  4ZQT A;  3UEQ A;  4FLR A;  3B7U X;  3B2X A;  2HPT A;  4QIR A;  4HKS A;  4BKX A;  3JSZ A;  5FWQ A;  2JD1 A;  4Q4I A;  4L2L A;  1T1R A;  3EBH A;  3AU8 A;  4AI6 A;  4RVB A;  1X3Z A;  3CZK A;  4R5V A;  3R0I A;  4AR1 A;  4XNB A;  2Y1D A;  3ANN A;  3FU3 A;  2EBH X;  3FUL A;  1ONP A;  2RJI A;  5BPP A;  3FHE A;  3FTY A;  2O7G A;  4ZW8 A;  3FUF A;  4K5L A;  2QJ1 A;  4QME A;  2C82 A;  5DUL A;  3VKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...