1RP3A

Cocrystal structure of the flagellar sigma/anti-sigma complex, sigma-28/flgm
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
235
structure length
235
Chain Sequence
b'HMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor SIGMA-28 (FliA)
publication title Crystal Structure of the Flagellar Sigma/Anti-Sigma Complex Sigma(28)/FlgM Reveals an Intact Sigma Factor in an Inactive Conformation
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 95
structure length 235
sequence length 235
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04539 Sigma70_r3 Sigma-70 region 3
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1rp3A01
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 1rp3A02
1S46A 5JC1A 4QICA 4NQWA 3AU9A 3RASA 3ZHZA 4G97A 1R0KA 1H3LA 3UEQA 4ZQHA 4AYSA 4Y67A 4FLQA 3WQSB 3ZHYA 4ZQEA 5DULA 1ONOA 1Q0QA 2Y1EA 1R0LA 3ANMA 1Q0HA 2Y1CA 4Y6PA 3CZEA 1MW3A 2JD0A 2JCYA 3ANNA 2Y1GA 4FLRA 4FLSA 1JGIA 2WPGA 2JCXA 1RP3A 5JAZA 3N0RA 3ZI0A 3UERA 3CZGA 4GAEA 1MVYA 2EGHA 3IIEA 3CZLA 3ANLA 2MAOA 2JD2A 4AICA 2JD1A 5JNLA 3WQRA 1MW1A 3CZKA 5JMPA 1JG9A 4A03A 4RCVA 1OR7A 1G5AA 5JBIA 3AU8A 1ONPA 3R0IA 2Y1DA 1T1RA 1SC5A 3AUAA 1Q0LA 3WQQA 2JCVA 2MAPA 4CXFA 3A06A 4OOEA 5JMWA 4Y6RA 1T1SA 3A14A 4ZQFA 1K5HA 4Y6SA 2Y1FA 1MW0A 4ZN6A 2C82A 4KP7A 3UCQA 2O7GA 1JVSA 4LUPA 3T0YA 4ZQGA 3ZHXA 2LFWA 1ONNA 4OOFA 4FLOA 1ZS2A 1MW2A 5JO0A
chains in the Genus database with same CATH superfamily
4MPCA 4ZYJA 5JC1A 3AU9A 3Q23A 3FO3A 2XQRB 3FUEA 2R72A 3KMLA 3CHOA 2WBIA 4AYSA 1EGDA 5B5VA 3TORA 4KSAA 4ZW6A 5BRKA 2VLAA 2GBBA 1R0LA 4XN7A 1WS9A 1Q0HA 4PW4A 2YYIA 3EOMA 4X28C 3TZ4A 3VKHA 1Y8OA 3FUMA 3B7UX 3FUHA 4XNAA 2C5ZA 2DQMA 4F0XA 3FU5A 5EV7A 2JCYA 3OWAA 4AR1A 1R3BA 1GJVA 4M9AA 3FTXA 4R7LA 3CHQA 4ZW8A 2JCXA 1RP3A 1S26A 4L2LA 5JAZA 3D9EA 2PG0A 4X28A 1GKZA 2EGHA 2MAOA 4AICA 4MKTA 4AR8A 3P4TA 5JNLA 2HPTA 4LQQB 3FTVA 4J3BA 1SIRA 2CJ8A 5FWQA 1MW1A 2C0UA 4XN9A 3F29A 4XMXA 4A03A 3FH8A 4RM7A 2OEVA 3CRLA 4XMUA 1OR7A 1G5AA 1T9GA 3B7TA 2BU6A 4Q4EA 3T8VA 4FF2A 4RVBA 3AFEA 3C2PA 2VF1A 3NF4A 1T1RA 3EBIA 4IV6A 3VADA 5M4MA 2MAPA 5GJVE 2RFQA 1IS2A 3FTZA 1XG2B 2XQ0A 2BU7A 2A7OA 1T1SA 2QR4A 2R0MA 4JEKA 3BNJA 3Q0AA 5J71A 4ZW5A 2WZFA 3UCQA 4XN4A 4OO2A 3QJXA 3FTSA 2R59A 2WZGA 4R5TA 5M4PA 5B5WA 5JO0A 2OJQA 4H7QA 3MPIA 2JBSA 2HPOA 3RASA 4K5PA 5K3HA 2FFLA 5DYFA 2Z1QA 1XFZA 3Q24A 3RKHA 1X90A 1JQIA 3B96A 4IRNA 2Q8IA 3UEQA 5BRMA 3D9DA 1X3ZA 3ZHYA 3MMOA 4ZQEA 3II9A 4K5NA 3M9VA 3UU9A 3PUUA 1MW3A 3JT1A 2QJ1A 2FONA 1PK0A 2BU2A 4FZ4A 3ANNA 3TZ2A 2YYLA 4AKIA 4XVXA 4FLRA 3SXQA 1JGIA 2Q8FA 4V26A 3UBRA 4AR9A 2ZDXA 4XO5A 3LG1A 3B3BA 1SK6A 2PNRA 1R2JA 3B37A 2DVLA 2RF7A 1SG7A 4XO3A 2B61A 4L3XA 3UERA 3CZGA 4ZX4A 2HJNA 1GW6A 4GAEA 3CZLA 3ANLA 2OR0A 2JD2A 2E0AA 2YGWA 3MKHA 3R7KA 2JD1A 3RC3A 3FTYA 3U9WA 4ZX3A 3MDDA 4MP7A 4AKHA 3HWCA 1XFYA 3C3LA 4P79A 2JBTA 4QMEA 3GNCA 4BKXA 2F6LA 1X3WA 2EC5A 4RSYA 4LQSB 5GJWE 2CJ6A 4WJYA 1ONPA 4L1FA 3SCEA 5K3JA 4X2UA 1UKWA 3Q43A 2BTZA 4ZX5A 4V25A 1UDYA 4DZYA 4R5VA 1SIQA 3WQQA 3OIBA 3EONA 1XFXA 2CJ7A 2VJ8A 5HNFA 3D1IA 4Q4IA 4CXFA 1X91A 2R05A 4NXLA 2ZXGA 1K5HA 2CJ4A 4FF3A 1X8ZA 2ZDYA 2VIGA 3L1TA 2O7GA 1JVSA 5AENA 2RJIA 4LUPA 3D9FA 4XMVA 3MPJA 4JIZA 3T0YA 2XS1A 4ZQGA 3FUDA 2R02A 1XFVA 3CHPA 3PFDA 2YYMA 4MPNA 4FLOA 4OOFA 2REHA 2EBAA 2ZAFA 2R0NA 5B6BA 1S46A 4ZXVA 4QICA 4NQWA 4XMZA 3TZ0A 2XPZA 1R0KA 1U8VA 1IVHA 3B34A 4ZQTA 4QPEA 1Y8PA 3FU0A 2UXWA 3FCJA 5HNHA 4W9UA 2EBHX 3FUJA 3D9GA 3S7WA 4QHPA 3CZEA 4L3ZA 1K93A 4P13A 3CIAA 2R03A 3FU6A 1EGEA 3D2RA 3FHEA 5DLLA 3B2XA 5M4KA 1GU6A 2Y1GA 2E80A 3VVLA 2WPGA 4K5LA 2D29A 4Q5BA 3EBGA 1EGCA 3ZI0A 4QIRA 3LGQA 1QDBA 4AKGA 1GKXA 3CE2A 3CHSA 4FF1A 4E00A 1MVYA 4MP2A 3IIEA 4FF4A 1RX0A 3WQRA 4ARFA 4PVBA 2CX9A 2GTQA 4KTOA 3X29A 4FCAA 2JIFA 1FS7A 5JBIA 2Q8HA 2OT4A 3B7SA 3C46A 2J7AA 3R0IA 2YYKA 1H19A 4E02A 2BU8A 5J6AA 4PU2A 3AUAA 1Q0LA 3FUNA 4H85A 4HKRA 2JCVA 2DDHA 1W07A 3A06A 3FULA 4Y6RA 1Y8NA 2Y1FA 3FUFA 1MW0A 1XFUA 2ZKJA 2RDZA 3X0XA 4ZW3A 1FS8A 4ZN6A 4L38A 3GM6A 4KP7A 2PL5A 4XN1A 2XS8A 4HKSA 3BNHA 2C12A 2QVWA 1RJ1A 4JIOA 3Q22A 2OEXA 1XFWA 3ZHXA 3FU3A 3MDEA 1ONNA 1ZS2A 3BNGA 1MW2A 2IX6A 4JNDA 3ZHZA 3B2PA 4G97A 1SQMA 3RC8A 4DPRA 1K90A 1H3LA 4ZQHA 1FS9A 1BUCA 2R70A 2EBFX 3FTUA 3FTWA 4Y67A 4FLQA 3WQSB 5K3IA 5DULA 2CJ5A 2Y1EA 1ONOA 1Q0QA 3ANMA 2PO4A 2JBRA 2Y1CA 5HLTA 4Y6PA 2AO2A 2JD0A 2VR0A 2PUSA 3CRKA 2PGGA 4L3YA 3EBHA 3FUKA 4FLSA 1RJ4A 1Y0VA 3SF6A 5K3GA 4MPEA 3N0RA 4ZW7A 1LVCA 2YYGA 3GQTA 3BNFA 4ZX6A 4K5OA 4H81A 2BU5A 3FH7A 2JV7A 1HS6A 4XNBA 3AFFA 2Q8GA 4G5EA 4U83A 4AI6A 4KCFA 1OAHA 4XMTA 3VKGA 4Q4UA 4XNDA 2FP2A 4XN2A 3CZKA 5JMPA 3MXLA 1JG9A 4R5XA 4RCVA 4K5MA 2IX5A 3X0YA 3AU8A 2AZEA 3D6BA 3CHRA 4XN8A 4Q17A 3FUIA 4KS9A 4XMWA 4XO4A 4E01A 5M4NA 3CXBA 2Y1DA 1SC5A 4Q5CA 4GAAA 5BPPA 3KEDA 3Q44A 4OOEA 2DQ6A 2E81A 2YYJA 4DOYA 5JMWA 4Y6SA 3A14A 4ZQFA 2A1TA 2ZO5A 4J1VA 3TTBA 1JM6A 2C82A 1PI1A 2XPYA 3SWOA 4QUOA 1K8TA 3FH5A 3JSZA 4Q1OA 4O5MA 3B7RL 3HW2A 4MS6A 4KSFA 2FP1A 3TZ5A 4HR3A 2LFWA 4XN5A 4Q0TA 4N5FA 3OWMA 3VVMA
chains in the Genus database with same CATH topology
5JC1A 3AU9A 3Q23A 3FUEA 2R72A 3KMLA 3CHOA 4AYSA 4KSAA 4ZW6A 2VLAA 2GBBA 1R0LA 4XN7A 3VKHA 1Q0HA 4PW4A 3FUMA 3B7UX 3FUHA 4XNAA 2C5ZA 2DQMA 4F0XA 3FU5A 5EV7A 2JCYA 4AR1A 3FTXA 4R7LA 3CHQA 4ZW8A 2JCXA 1RP3A 1S26A 4L2LA 5JAZA 2EGHA 2MAOA 4AICA 4MKTA 4AR8A 5JNLA 2HPTA 3FTVA 4J3BA 5FWQA 1MW1A 4XN9A 4XMXA 4A03A 3FH8A 4XMUA 1OR7A 1G5AA 3B7TA 4Q4EA 3T8VA 4FF2A 4RVBA 3C2PA 2VF1A 1T1RA 3EBIA 2MAPA 5GJVE 3FTZA 2XQ0A 2A7OA 1T1SA 2QR4A 3Q0AA 4ZW5A 2WZFA 3UCQA 4XN4A 3QJXA 3FTSA 2R59A 2WZGA 4R5TA 5JO0A 2HPOA 3RASA 4K5PA 2FFLA 5DYFA 1XFZA 3Q24A 3UEQA 1X3ZA 3ZHYA 4ZQEA 4K5NA 3PUUA 1MW3A 3JT1A 2QJ1A 1PK0A 4FZ4A 3ANNA 4AKIA 4FLRA 1JGIA 4AR9A 4XO5A 3B3BA 1SK6A 3B37A 1SG7A 4XO3A 2B61A 3UERA 3CZGA 4ZX4A 1GW6A 4GAEA 3CZLA 3ANLA 2JD2A 2YGWA 2JD1A 3RC3A 3FTYA 3U9WA 4ZX3A 4AKHA 1XFYA 3C3LA 4P79A 4QMEA 4BKXA 2F6LA 1X3WA 2EC5A 4RSYA 5GJWE 1ONPA 4X2UA 3Q43A 4ZX5A 4R5VA 3WQQA 1XFXA 2VJ8A 5HNFA 4Q4IA 4CXFA 2ZXGA 1K5HA 4FF3A 2O7GA 1JVSA 5AENA 2RJIA 4LUPA 4XMVA 3T0YA 4ZQGA 3FUDA 1XFVA 3CHPA 4FLOA 4OOFA 1S46A 4QICA 4NQWA 4XMZA 2XPZA 1R0KA 3B34A 4ZQTA 4QPEA 3FU0A 5HNHA 2EBHX 3FUJA 4QHPA 3CZEA 1K93A 3CIAA 3FU6A 3FHEA 5DLLA 3B2XA 2Y1GA 3VVLA 2WPGA 4K5LA 3EBGA 3ZI0A 4QIRA 4AKGA 3CE2A 3CHSA 4FF1A 1MVYA 3IIEA 4FF4A 3WQRA 4ARFA 4PVBA 2GTQA 3X29A 4FCAA 5JBIA 3B7SA 3C46A 3R0IA 1H19A 4PU2A 4HKRA 3AUAA 1Q0LA 3FUNA 2JCVA 3A06A 3FULA 4Y6RA 2Y1FA 3FUFA 1MW0A 1XFUA 4ZW3A 4ZN6A 4KP7A 2PL5A 4XN1A 4HKSA 2QVWA 3Q22A 1XFWA 3ZHXA 3FU3A 1ONNA 1ZS2A 1MW2A 4JNDA 3ZHZA 3B2PA 4G97A 1SQMA 3RC8A 4DPRA 1K90A 1H3LA 4ZQHA 2R70A 2EBFX 3FTUA 3FTWA 4Y67A 4FLQA 3WQSB 5DULA 2Y1EA 1ONOA 1Q0QA 3ANMA 2PO4A 2Y1CA 5HLTA 4Y6PA 2AO2A 2JD0A 2PUSA 2PGGA 3EBHA 3FUKA 4FLSA 1Y0VA 3N0RA 4ZW7A 1LVCA 4ZX6A 4K5OA 3FH7A 2JV7A 1HS6A 4XNBA 4AI6A 4XMTA 3VKGA 4XNDA 2FP2A 4XN2A 3CZKA 5JMPA 1JG9A 4R5XA 4RCVA 4K5MA 3AU8A 2AZEA 3CHRA 4XN8A 3FUIA 4KS9A 4XMWA 4XO4A 2Y1DA 1SC5A 4GAAA 5BPPA 3KEDA 3Q44A 4OOEA 2DQ6A 5JMWA 4Y6SA 3A14A 4ZQFA 2C82A 2XPYA 4QUOA 1K8TA 3FH5A 3JSZA 3B7RL 4MS6A 4KSFA 2FP1A 2LFWA 4XN5A 3VVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S46 A;  5JC1 A;  4QIC A;  4NQW A;  3AU9 A;  3RAS A;  3ZHZ A;  4G97 A;  1R0K A;  1H3L A;  3UEQ A;  4ZQH A;  4AYS A;  4Y67 A;  4FLQ A;  3WQS B;  3ZHY A;  4ZQE A;  5DUL A;  1ONO A;  1Q0Q A;  2Y1E A;  1R0L A;  3ANM A;  1Q0H A;  2Y1C A;  4Y6P A;  3CZE A;  1MW3 A;  2JD0 A;  2JCY A;  3ANN A;  2Y1G A;  4FLR A;  4FLS A;  1JGI A;  2WPG A;  2JCX A;  1RP3 A;  5JAZ A;  3N0R A;  3ZI0 A;  3UER A;  3CZG A;  4GAE A;  1MVY A;  2EGH A;  3IIE A;  3CZL A;  3ANL A;  2MAO A;  2JD2 A;  4AIC A;  2JD1 A;  5JNL A;  3WQR A;  1MW1 A;  3CZK A;  5JMP A;  1JG9 A;  4A03 A;  4RCV A;  1OR7 A;  1G5A A;  5JBI A;  3AU8 A;  1ONP A;  3R0I A;  2Y1D A;  1T1R A;  1SC5 A;  3AUA A;  1Q0L A;  3WQQ A;  2JCV A;  2MAP A;  4CXF A;  3A06 A;  4OOE A;  5JMW A;  4Y6R A;  1T1S A;  3A14 A;  4ZQF A;  1K5H A;  4Y6S A;  2Y1F A;  1MW0 A;  4ZN6 A;  2C82 A;  4KP7 A;  3UCQ A;  2O7G A;  1JVS A;  4LUP A;  3T0Y A;  4ZQG A;  3ZHX A;  2LFW A;  1ONN A;  4OOF A;  4FLO A;  1ZS2 A;  1MW2 A;  5JO0 A; 
#chains in the Genus database with same CATH topology
 4MPC A;  4ZYJ A;  5JC1 A;  3AU9 A;  3Q23 A;  3FO3 A;  2XQR B;  3FUE A;  2R72 A;  3KML A;  3CHO A;  2WBI A;  4AYS A;  1EGD A;  5B5V A;  3TOR A;  4KSA A;  4ZW6 A;  5BRK A;  2VLA A;  2GBB A;  1R0L A;  4XN7 A;  1WS9 A;  1Q0H A;  4PW4 A;  2YYI A;  3EOM A;  4X28 C;  3TZ4 A;  3VKH A;  1Y8O A;  3FUM A;  3B7U X;  3FUH A;  4XNA A;  2C5Z A;  2DQM A;  4F0X A;  3FU5 A;  5EV7 A;  2JCY A;  3OWA A;  4AR1 A;  1R3B A;  1GJV A;  4M9A A;  3FTX A;  4R7L A;  3CHQ A;  4ZW8 A;  2JCX A;  1RP3 A;  1S26 A;  4L2L A;  5JAZ A;  3D9E A;  2PG0 A;  4X28 A;  1GKZ A;  2EGH A;  2MAO A;  4AIC A;  4MKT A;  4AR8 A;  3P4T A;  5JNL A;  2HPT A;  4LQQ B;  3FTV A;  4J3B A;  1SIR A;  2CJ8 A;  5FWQ A;  1MW1 A;  2C0U A;  4XN9 A;  3F29 A;  4XMX A;  4A03 A;  3FH8 A;  4RM7 A;  2OEV A;  3CRL A;  4XMU A;  1OR7 A;  1G5A A;  1T9G A;  3B7T A;  2BU6 A;  4Q4E A;  3T8V A;  4FF2 A;  4RVB A;  3AFE A;  3C2P A;  2VF1 A;  3NF4 A;  1T1R A;  3EBI A;  4IV6 A;  3VAD A;  5M4M A;  2MAP A;  5GJV E;  2RFQ A;  1IS2 A;  3FTZ A;  1XG2 B;  2XQ0 A;  2BU7 A;  2A7O A;  1T1S A;  2QR4 A;  2R0M A;  4JEK A;  3BNJ A;  3Q0A A;  5J71 A;  4ZW5 A;  2WZF A;  3UCQ A;  4XN4 A;  4OO2 A;  3QJX A;  3FTS A;  2R59 A;  2WZG A;  4R5T A;  5M4P A;  5B5W A;  5JO0 A;  2OJQ A;  4H7Q A;  3MPI A;  2JBS A;  2HPO A;  3RAS A;  4K5P A;  5K3H A;  2FFL A;  5DYF A;  2Z1Q A;  1XFZ A;  3Q24 A;  3RKH A;  1X90 A;  1JQI A;  3B96 A;  4IRN A;  2Q8I A;  3UEQ A;  5BRM A;  3D9D A;  1X3Z A;  3ZHY A;  3MMO A;  4ZQE A;  3II9 A;  4K5N A;  3M9V A;  3UU9 A;  3PUU A;  1MW3 A;  3JT1 A;  2QJ1 A;  2FON A;  1PK0 A;  2BU2 A;  4FZ4 A;  3ANN A;  3TZ2 A;  2YYL A;  4AKI A;  4XVX A;  4FLR A;  3SXQ A;  1JGI A;  2Q8F A;  4V26 A;  3UBR A;  4AR9 A;  2ZDX A;  4XO5 A;  3LG1 A;  3B3B A;  1SK6 A;  2PNR A;  1R2J A;  3B37 A;  2DVL A;  2RF7 A;  1SG7 A;  4XO3 A;  2B61 A;  4L3X A;  3UER A;  3CZG A;  4ZX4 A;  2HJN A;  1GW6 A;  4GAE A;  3CZL A;  3ANL A;  2OR0 A;  2JD2 A;  2E0A A;  2YGW A;  3MKH A;  3R7K A;  2JD1 A;  3RC3 A;  3FTY A;  3U9W A;  4ZX3 A;  3MDD A;  4MP7 A;  4AKH A;  3HWC A;  1XFY A;  3C3L A;  4P79 A;  2JBT A;  4QME A;  3GNC A;  4BKX A;  2F6L A;  1X3W A;  2EC5 A;  4RSY A;  4LQS B;  5GJW E;  2CJ6 A;  4WJY A;  1ONP A;  4L1F A;  3SCE A;  5K3J A;  4X2U A;  1UKW A;  3Q43 A;  2BTZ A;  4ZX5 A;  4V25 A;  1UDY A;  4DZY A;  4R5V A;  1SIQ A;  3WQQ A;  3OIB A;  3EON A;  1XFX A;  2CJ7 A;  2VJ8 A;  5HNF A;  3D1I A;  4Q4I A;  4CXF A;  1X91 A;  2R05 A;  4NXL A;  2ZXG A;  1K5H A;  2CJ4 A;  4FF3 A;  1X8Z A;  2ZDY A;  2VIG A;  3L1T A;  2O7G A;  1JVS A;  5AEN A;  2RJI A;  4LUP A;  3D9F A;  4XMV A;  3MPJ A;  4JIZ A;  3T0Y A;  2XS1 A;  4ZQG A;  3FUD A;  2R02 A;  1XFV A;  3CHP A;  3PFD A;  2YYM A;  4MPN A;  4FLO A;  4OOF A;  2REH A;  2EBA A;  2ZAF A;  2R0N A;  5B6B A;  1S46 A;  4ZXV A;  4QIC A;  4NQW A;  4XMZ A;  3TZ0 A;  2XPZ A;  1R0K A;  1U8V A;  1IVH A;  3B34 A;  4ZQT A;  4QPE A;  1Y8P A;  3FU0 A;  2UXW A;  3FCJ A;  5HNH A;  4W9U A;  2EBH X;  3FUJ A;  3D9G A;  3S7W A;  4QHP A;  3CZE A;  4L3Z A;  1K93 A;  4P13 A;  3CIA A;  2R03 A;  3FU6 A;  1EGE A;  3D2R A;  3FHE A;  5DLL A;  3B2X A;  5M4K A;  1GU6 A;  2Y1G A;  2E80 A;  3VVL A;  2WPG A;  4K5L A;  2D29 A;  4Q5B A;  3EBG A;  1EGC A;  3ZI0 A;  4QIR A;  3LGQ A;  1QDB A;  4AKG A;  1GKX A;  3CE2 A;  3CHS A;  4FF1 A;  4E00 A;  1MVY A;  4MP2 A;  3IIE A;  4FF4 A;  1RX0 A;  3WQR A;  4ARF A;  4PVB A;  2CX9 A;  2GTQ A;  4KTO A;  3X29 A;  4FCA A;  2JIF A;  1FS7 A;  5JBI A;  2Q8H A;  2OT4 A;  3B7S A;  3C46 A;  2J7A A;  3R0I A;  2YYK A;  1H19 A;  4E02 A;  2BU8 A;  5J6A A;  4PU2 A;  3AUA A;  1Q0L A;  3FUN A;  4H85 A;  4HKR A;  2JCV A;  2DDH A;  1W07 A;  3A06 A;  3FUL A;  4Y6R A;  1Y8N A;  2Y1F A;  3FUF A;  1MW0 A;  1XFU A;  2ZKJ A;  2RDZ A;  3X0X A;  4ZW3 A;  1FS8 A;  4ZN6 A;  4L38 A;  3GM6 A;  4KP7 A;  2PL5 A;  4XN1 A;  2XS8 A;  4HKS A;  3BNH A;  2C12 A;  2QVW A;  1RJ1 A;  4JIO A;  3Q22 A;  2OEX A;  1XFW A;  3ZHX A;  3FU3 A;  3MDE A;  1ONN A;  1ZS2 A;  3BNG A;  1MW2 A;  2IX6 A;  4JND A;  3ZHZ A;  3B2P A;  4G97 A;  1SQM A;  3RC8 A;  4DPR A;  1K90 A;  1H3L A;  4ZQH A;  1FS9 A;  1BUC A;  2R70 A;  2EBF X;  3FTU A;  3FTW A;  4Y67 A;  4FLQ A;  3WQS B;  5K3I A;  5DUL A;  2CJ5 A;  2Y1E A;  1ONO A;  1Q0Q A;  3ANM A;  2PO4 A;  2JBR A;  2Y1C A;  5HLT A;  4Y6P A;  2AO2 A;  2JD0 A;  2VR0 A;  2PUS A;  3CRK A;  2PGG A;  4L3Y A;  3EBH A;  3FUK A;  4FLS A;  1RJ4 A;  1Y0V A;  3SF6 A;  5K3G A;  4MPE A;  3N0R A;  4ZW7 A;  1LVC A;  2YYG A;  3GQT A;  3BNF A;  4ZX6 A;  4K5O A;  4H81 A;  2BU5 A;  3FH7 A;  2JV7 A;  1HS6 A;  4XNB A;  3AFF A;  2Q8G A;  4G5E A;  4U83 A;  4AI6 A;  4KCF A;  1OAH A;  4XMT A;  3VKG A;  4Q4U A;  4XND A;  2FP2 A;  4XN2 A;  3CZK A;  5JMP A;  3MXL A;  1JG9 A;  4R5X A;  4RCV A;  4K5M A;  2IX5 A;  3X0Y A;  3AU8 A;  2AZE A;  3D6B A;  3CHR A;  4XN8 A;  4Q17 A;  3FUI A;  4KS9 A;  4XMW A;  4XO4 A;  4E01 A;  5M4N A;  3CXB A;  2Y1D A;  1SC5 A;  4Q5C A;  4GAA A;  5BPP A;  3KED A;  3Q44 A;  4OOE A;  2DQ6 A;  2E81 A;  2YYJ A;  4DOY A;  5JMW A;  4Y6S A;  3A14 A;  4ZQF A;  2A1T A;  2ZO5 A;  4J1V A;  3TTB A;  1JM6 A;  2C82 A;  1PI1 A;  2XPY A;  3SWO A;  4QUO A;  1K8T A;  3FH5 A;  3JSZ A;  4Q1O A;  4O5M A;  3B7R L;  3HW2 A;  4MS6 A;  4KSF A;  2FP1 A;  3TZ5 A;  4HR3 A;  2LFW A;  4XN5 A;  4Q0T A;  4N5F A;  3OWM A;  3VVM A; 
#chains in the Genus database with same CATH homology
 5JC1 A;  3AU9 A;  3Q23 A;  3FUE A;  2R72 A;  3KML A;  3CHO A;  4AYS A;  4KSA A;  4ZW6 A;  2VLA A;  2GBB A;  1R0L A;  4XN7 A;  3VKH A;  1Q0H A;  4PW4 A;  3FUM A;  3B7U X;  3FUH A;  4XNA A;  2C5Z A;  2DQM A;  4F0X A;  3FU5 A;  5EV7 A;  2JCY A;  4AR1 A;  3FTX A;  4R7L A;  3CHQ A;  4ZW8 A;  2JCX A;  1RP3 A;  1S26 A;  4L2L A;  5JAZ A;  2EGH A;  2MAO A;  4AIC A;  4MKT A;  4AR8 A;  5JNL A;  2HPT A;  3FTV A;  4J3B A;  5FWQ A;  1MW1 A;  4XN9 A;  4XMX A;  4A03 A;  3FH8 A;  4XMU A;  1OR7 A;  1G5A A;  3B7T A;  4Q4E A;  3T8V A;  4FF2 A;  4RVB A;  3C2P A;  2VF1 A;  1T1R A;  3EBI A;  2MAP A;  5GJV E;  3FTZ A;  2XQ0 A;  2A7O A;  1T1S A;  2QR4 A;  3Q0A A;  4ZW5 A;  2WZF A;  3UCQ A;  4XN4 A;  3QJX A;  3FTS A;  2R59 A;  2WZG A;  4R5T A;  5JO0 A;  2HPO A;  3RAS A;  4K5P A;  2FFL A;  5DYF A;  1XFZ A;  3Q24 A;  3UEQ A;  1X3Z A;  3ZHY A;  4ZQE A;  4K5N A;  3PUU A;  1MW3 A;  3JT1 A;  2QJ1 A;  1PK0 A;  4FZ4 A;  3ANN A;  4AKI A;  4FLR A;  1JGI A;  4AR9 A;  4XO5 A;  3B3B A;  1SK6 A;  3B37 A;  1SG7 A;  4XO3 A;  2B61 A;  3UER A;  3CZG A;  4ZX4 A;  1GW6 A;  4GAE A;  3CZL A;  3ANL A;  2JD2 A;  2YGW A;  2JD1 A;  3RC3 A;  3FTY A;  3U9W A;  4ZX3 A;  4AKH A;  1XFY A;  3C3L A;  4P79 A;  4QME A;  4BKX A;  2F6L A;  1X3W A;  2EC5 A;  4RSY A;  5GJW E;  1ONP A;  4X2U A;  3Q43 A;  4ZX5 A;  4R5V A;  3WQQ A;  1XFX A;  2VJ8 A;  5HNF A;  4Q4I A;  4CXF A;  2ZXG A;  1K5H A;  4FF3 A;  2O7G A;  1JVS A;  5AEN A;  2RJI A;  4LUP A;  4XMV A;  3T0Y A;  4ZQG A;  3FUD A;  1XFV A;  3CHP A;  4FLO A;  4OOF A;  1S46 A;  4QIC A;  4NQW A;  4XMZ A;  2XPZ A;  1R0K A;  3B34 A;  4ZQT A;  4QPE A;  3FU0 A;  5HNH A;  2EBH X;  3FUJ A;  4QHP A;  3CZE A;  1K93 A;  3CIA A;  3FU6 A;  3FHE A;  5DLL A;  3B2X A;  2Y1G A;  3VVL A;  2WPG A;  4K5L A;  3EBG A;  3ZI0 A;  4QIR A;  4AKG A;  3CE2 A;  3CHS A;  4FF1 A;  1MVY A;  3IIE A;  4FF4 A;  3WQR A;  4ARF A;  4PVB A;  2GTQ A;  3X29 A;  4FCA A;  5JBI A;  3B7S A;  3C46 A;  3R0I A;  1H19 A;  4PU2 A;  4HKR A;  3AUA A;  1Q0L A;  3FUN A;  2JCV A;  3A06 A;  3FUL A;  4Y6R A;  2Y1F A;  3FUF A;  1MW0 A;  1XFU A;  4ZW3 A;  4ZN6 A;  4KP7 A;  2PL5 A;  4XN1 A;  4HKS A;  2QVW A;  3Q22 A;  1XFW A;  3ZHX A;  3FU3 A;  1ONN A;  1ZS2 A;  1MW2 A;  4JND A;  3ZHZ A;  3B2P A;  4G97 A;  1SQM A;  3RC8 A;  4DPR A;  1K90 A;  1H3L A;  4ZQH A;  2R70 A;  2EBF X;  3FTU A;  3FTW A;  4Y67 A;  4FLQ A;  3WQS B;  5DUL A;  2Y1E A;  1ONO A;  1Q0Q A;  3ANM A;  2PO4 A;  2Y1C A;  5HLT A;  4Y6P A;  2AO2 A;  2JD0 A;  2PUS A;  2PGG A;  3EBH A;  3FUK A;  4FLS A;  1Y0V A;  3N0R A;  4ZW7 A;  1LVC A;  4ZX6 A;  4K5O A;  3FH7 A;  2JV7 A;  1HS6 A;  4XNB A;  4AI6 A;  4XMT A;  3VKG A;  4XND A;  2FP2 A;  4XN2 A;  3CZK A;  5JMP A;  1JG9 A;  4R5X A;  4RCV A;  4K5M A;  3AU8 A;  2AZE A;  3CHR A;  4XN8 A;  3FUI A;  4KS9 A;  4XMW A;  4XO4 A;  2Y1D A;  1SC5 A;  4GAA A;  5BPP A;  3KED A;  3Q44 A;  4OOE A;  2DQ6 A;  5JMW A;  4Y6S A;  3A14 A;  4ZQF A;  2C82 A;  2XPY A;  4QUO A;  1K8T A;  3FH5 A;  3JSZ A;  3B7R L;  4MS6 A;  4KSF A;  2FP1 A;  2LFW A;  4XN5 A;  3VVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...