3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transcription regulator/protein binding
molecule keywords Response regulator
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
2Y1EA 3F8NA 4CGZA 2CW0F 1RIOH 1U5TB 4IF4A 3KZZA 4XBFA 5JMWA 4ESBA 1QBJA 2Y0MA 4HF0A 1BI1A 2G9WA 4YIIA 4GYIA 2EGHA 2EA4A 4MEYF 2Z9OA 2P5KA 4P9FA 5LGTA 2Y75A 3VB2A 6PAXA 3BJOA 1EH6A 2V1DA 4KMUX 2QQBA 1ZG5A 2X4HA 2W84A 2A69F 1R36A 2HKOA 1C0WA 2O8XA 1QO0D 3H92A 1S3JA 1HW1A 4GO1A 4R1HA 1L3LA 4IRHA 2JCVA 3I58A 4OOEA 3FM3A 5H6RA 1O3TA 2VN2A 4HAMA 2Z3YA 4QLCU 4RB0A 2A07F 1Q0QA 2HWVA 1J59A 1A04A 4MQ9F 4LG0A 1J0RA 3FMRA 4MHGA 1OYIA 3WQQA 1JHHA 1IAWA 4D0PA 4ZH4F 4YIFA 4UNOA 3D5LA 4EMSA 3GO5A 1XB4A 5JHUA 2VBXA 1LEAA 5DD8A 3ROUA 3ANNA 4RGRA 3WU1B 4LLLA 3J80K 1IRGA 1F9NA 4F7ZA 3TO6A 1G4DA 5CVVA 3U9GA 2J5PA 5D5UB 2OBPA 5JAZA 1J5YA 3OOPA 3WGIA 1AOYA 2JZYA 4G9YA 3QOPA 4KT5C 4BHCA 4CYDA 2F5EA 2FF4A 3WTVC 2VBZA 3NRVA 4XLPF 1SD7A 1UFMA 3DQVC 3T8TA 3TGNA 4RB1A 3J7AO 5LHIA 2Z33A 5HDKA 2JCXA 4L9JA 4LMYA 3RYPA 1FYLA 3ZMUA 4IRGA 4IPAA 3EDPA 4L5IA 1MJBA 2C6YA 1NHAA 3BP8A 3K1NA 3ABUA 2P8TA 1ZAOA 2YPRA 2GQQA 3ZQ7A 4EJWA 1WQ2A 1QNTA 1H3LA 1MDMB 3FM5A 1MGTA 5BS6A 4KMFA 2XIGA 1ODDA 4U7BA 4MQVA 4RGSA 3DP7A 4M71A 3PQJA 4EQQA 4U88A 1U5TA 2K4JA 5HDGA 4EV0A 4QWQA 2K27A 3GW2A 1YLFA 2KIUA 3LA7A 5JI6A 4HF2A 4AYSA 4UVAA 3ZMDA 3WG9A 1ULYA 4LUPA 4P96A 3ZHYA 3ZP5A 2WC2A 2P7CB 2C82A 1O57A 2VE9A 1XN7A 1GHCA 3V7SA 4Y17A 3MWMA 3CZKA 2EFWA 1YW9A 3U2RA 2R7FA 5D6FA 5LEKA 4Y6SA 3F21A 3T1BA 2HYFA 4BAYA 2ADUA 3KLOA 1OKRA 1HKTA 4KA4A 4OIRF 3RTRA 4MEXF 1IN4A 4EM1A 4U0WA 4KICA 1WKMA 3TOAA 3ZHXA 4ENKA 5ICCA 5HLHA 2DTRA 2ZNYA 2KJBA 2HQRA 2NS0A 2EFNA 1MDMA 2XAGA 2M5WA 5DV5A 1TLHB 1YIOA 3K69A 3QP5A 4PZJA 3RKWA 2OZUA 3P9KA 3F8FA 2M1BA 3KEQA 3R61A 3RDIA 4KDPA 4I09A 4AD9A 5ILUA 1SMTA 2WPGA 1FBUA 1GVJA 2V79A 3UCQA 4KFCA 4KP7A 4GCVA 4S05A 4OIQF 1QZYA 2V1UA 5EEGA 4UUVA 1ZYRF 4ETSA 2KRFA 1W7PD 4BXUA 3WTUC 2MH2A 2VODA 1LEBA 4G8XA 3KP4A 1E17A 2VBWA 2A6EF 5JNLA 3M9AA 5K5OA 4LLGF 5ICFA 2VOOA 3FXQA 4L18B 1MZBA 2M30A 1ZLJA 3I59A 2IRFG 5IT9Z 2IT0A 1HW2A 1WI9A 5FB2A 2QQAA 1SC5A 3TQNA 1ZRFA 4HX7A 2UWMA 4Q5SF 5HVQC 4HW0A 1J7KA 4I02A 5E18F 2PI0A 3SXYA 2FMYA 5J6XA 1R22A 2ZO4A 1ZREA 4IXAA 4WWCA 2ACJA 1TNSA 2MLKA 2QBYA 1UCRA 3QPTA 1YS6A 1S46A 2IVMA 4IHSA 1QZZA 2AS5F 4HF1A 2XROA 2K86A 1QQIA 3N97A 4HOBA 5L3GA 4A6DA 5HS7A 1KYWA 2UZKA 1BC8C 1I1SA 2P4WA 4BH9A 4EVIA 1O3QA 3QP6A 3KP3A 3AU8A 3P9CA 4LFUA 2NNNA 3CZGA 2QM3A 3R6SA 3I0TA 1DP7P 3BZ6A 3V7RA 3TO7A 2ESHA 2L4AA 3CDHA 3WQSB 5ICGA 5FLXK 3SHFA 5JFRA 4Z2YA 1HQCA 1SMYF 2HQNA 3GFMA 4R79A 2FEZA 3WODF 3RI4A 4Y15A 2JT1A 1TBXA 2Y1CA 1MKMA 2OQRA 2VXZA 5LHGA 3KCCA 5JC1A 4GAEA 5LGUA 4M73A 5EEHA 5IT3A 4M6YA 5JVTA 4IRIA 3QPHA 4FLRA 2PEXA 5E17F 1SD5A 1B6AA 2EV0A 4Q48A 3QU3A 4MTDA 1YTYA 2LF8A 3KP6A 3F8MA 2QUFA 1S6LA 2GA2A 5LGNA 4HA8A 2DLLA 1MVYA 4GGGA 2Z5UA 1F5TA 2F5CA 5FD6A 1MW0A 1G3TA 1FP1D 3WTZA 3F23A 1Z6RA 1REPC 2QQ9A 2RN7A 3C3WA 3P9IA 4A5NA 5IT9K 1P92A 1FX7A 2FBHA 2DK8A 4G6DA 3T5XA 3GFLA 3LAPA 3R60A 3M8FA 3RYRA 4ZYHA 1U6GA 2RQPA 2DPUA 1BJAA 3DF8A 2BBYA 3BWGA 2JPCA 5DD4A 4GXOA 4CO8A 1ON1A 4RAYA 3V8JA 4B8XA 2FBKA 4EM2A 5AIQA 2M87A 2E7WA 4L0YB 2IPQX 1TQIA 4PGHA 2YX7A 1W5TA 2P7VB 2VC0A 3HIFA 2P6TA 2QYOA 3HTSB 5BOXA 1IW7F 1MW3A 4BHPA 3VOEA 5LLQA 1MJ9A 5CVIA 1FYKA 1ON2A 4HQEA 2Q0OA 3AUAA 2YX4A 3ERED 2PMUA 2H09A 2YSRA 3ZN0A 2FBIA 3HRUA 4YFKF 2LNBA 2CSOA 3E6MA 2HR3A 3V8KA 2EV5A 4LLNA 4LG0B 4LK1F 1DPUA 2EFOA 1W7PB 4EGZA 2MBFA 4Y13A 5FLXZ 5A2QK 1K7AA 3QU6A 2QBYB 3ZMTA 2XUBA 3TDUC 5A2QZ 2G7HA 3KEOA 3JSOA 2CO5A 2V9VA 3TO9A 5D4SA 3ML6A 1USSA 2L4MA 2JPBA 1FWZA 2FXAA 4OU0A 1J9IA 1ONNA 2QLZA 3Q5FA 3PQKA 2VBYA 3VODA 3M1EA 5DDGA 2DT5A 3A14A 2AXLA 1O3SA 1ZG3A 4A12A 2LDUA 1YQAA 2WTEA 1IXCA 4OOFA 1P4WA 5BQTA 2HDCA 3M8EA 4FX4A 1HXDA 3HTUA 3ECHA 4YFXF 1B4AA 2PQ8A 3ULQB 5JBIA 2FU4A 1IN6A 2HKXA 4OMZA 2E1CA 3F22A 4HLYA 2W24A 1G3YA 2ZBKA 2XAJA 5L3FA 2EK5A 3V4GA 2FE3A 4MNUA 4JQFA 2W57A 2RV8A 1LB2A 1RI7A 3R4KA 4U0YA 4DQ2A 2XKPA 3L2CA 2H6BA 1G5AA 2CG4A 5AIPA 4DNCA 1FC3A 2HZTA 2O03A 1ZG1A 1JGIA 1XMAA 5J8CA 1OMIA 3T0YA 2JRTA 2LKPA 2XAFA 4KUMA 3IKTA 4B09A 4L9VA 3GX4X 3LSTA 4KYWA 2FA5A 1R1UA 2EWNA 3HSEA 1YYVA 4I0BA 1W5SA 2DFIA 2GXBA 2R3SA 1FY7A 3DPLC 3GXOA 3F8CA 4O5VA 1IN7A 1U2WA 2DI3A 2OQGA 1R5GA 4ZZLA 2L01A 5D4RA 3K2ZA 2ESNA 5CVUA 1IXSB 3QRFF 2FMLA 2A5YB 4I98B 2L02A 3WU0A 1IUYA 4KIGA 5DUIA 1D5VA 2FSWA 5CVJA 3E6CC 2MLGA 1Z7UA 2NNYA 4WK8F 2PG4A 2JD2A 2RVCA 1H0MA 1MW2A 1OYYA 2GZWA 3T8RA 2VT2A 1G3WA 1P6RA 4FLOA 2Z99A 1FLIA 3MAJA 4UV8A 4WXHA 1DDNA 4FT8A 1Z9CA 2HEOA 2DQLA 2KIFA 5H6QA 1SD6A 2ZKZA 1ZS2A 5D8LB 1B9NA 3CUQA 2YR2A 3E97A 5FFZA 3AAFA 1P2FA 5JMPA 3CUOA 1K78B 2KJCA 3WE2A 1KU7A 4LJZF 4ESJA 1KYZA 2ZXJA 3CJNA 3E5QA 1EH7A 1SFXA 5D5XB 4M6XA 5K5QA 1XCVA 4N9HA 3IC7A 1TW3A 3ANMA 2XGXA 3DFGA 2NRAC 4H0EA 3RIRA 1BC7C 5CLSA 1TQPA 3I54A 2CYYA 2IA2A 1D3YA 3E6BA 3V7CA 1B1BA 1HW5A 5CJ9A 1LJ9A 4IJAA 2DO7A 2PJPA 1TW2A 3KP7A 5LBQA 4LB5A 4KN4X 2ZJ2A 2XAQA 3GZ6A 2XRNA 1FZPB 2HOEA 2XAHA 3GUDA 5JR3A 5DULA 3IIEA 1RUNA 1XSXA 3HRTA 3FMQA 4KIBA 4ZQFA 1R0LA 1CF7A 1S29A 3P7NA 4A6EA 1RP3A 2V6CA 5J8FA 3FHZA 4OOIA 2H27A 2HS5A 2STWA 2VONA 1PUEE 1YO5C 1B9MA 1HSJA 3CTAA 1XDUA 4RS8A 1R23A 1T39A 1YW7A 3BY6A 4Y6RA 1P4AA 3S2WA 1BIBA 5FO5A 1JXSA 1U3EM 2JD1A 3N4MA 4LK0F 1FBSA 4P9UA 4M74A 3E5XA 2DK5A 4I01A 1Q1HA 1Q0HA 2QVOA 2P5VA 5K5RA 2DQRA 4FX0A 2IA1A 1ZARA 3K1MA 2PN6A 1T0FA 3RASA 1TTYA 2PMHA 2BE5F 5DYMA 3M7GA 4ZYDA 3K1PA 2E1NA 1OPCA 4BQAA 2FOKA 3CO6C 1UHWA 4AIKA 4OINF 1YG2A 3GLXA 1IXRC 3EYYA 5LRRA 3RKYA 1UHMA 4OMYA 2JTVA 2VOPA 2H94A 5E1XA 5FFXA 2DU9A 4XLNF 2ISZA 2A3SA 3FMSA 2ZNZA 3H3ZA 4K2EA 1S7OA 5ED4A 3L7WA 5E8IA 5DUKA 4Q47A 4WCGA 4CZZA 4AVPA 1JHFA 1ZRCA 3ZMSA 4CICA 4ASNA 1RNLA 3ZI0A 1BI0A 4G94A 4RB2C 2MD5A 3ABTA 1F1ZA 1XDSA 5LEJA 5HLGA 5D6EA 3B02A 3J81Z 2F5FA 3BJAA 1D8JA 1K78A 4A0ZA 4CHUA 1W4MA 4HX8A 1G6NA 4U0VA 2FRHA 2V1XA 1O3RA 1BI2A 3HYIA 3IRRA 4A0XA 4NB5A 5BMZA 1T2KA 1ZGAA 2K7LA 1RZ4A 3OV8A 2FQ3A 3WE3A 4L9NA 5F1RA 4I2OA 3GVAA 4LD5A 1LDJA 1IF1A 3DEUA 2YU3A 2OA4A 3FXUA 2G7UA 5E20A 2H6CA 1Y0UA 1LQ1A 2M8EA 2TDXA 2ELHA 4BHBA 5F64A 3WGGA 5ICEA 1H9GA 3CO7C 2A61A 2NAZA 1U78A 3ECOA 4ENMA 1F4KA 4EM0B 1O7FA 5ERIA 5LRSA 2FNPA 2DW4A 4P55A 1LDDA 1QGPA 3HRMA 2O3FA 3PFIA 1MD0A 2F5DA 4IHTA 1WRJA 4AIJA 2UXNA 3V8LA 1KQ9A 1CF7B 2EJRA 1KU9A 4LB6B 5KK1A 1Z91A 1ONOA 2MA3A 1I27A 1ZLKA 1R00A 3VEPA 1LDKB 1I5ZA 4NHJA 1Q0LA 1BI3A 3TKYA 3HOSA 2CGPA 1EH8A 1JVSA 1W7PA 2KKOA 2Y48A 2MC3A 2D1HA 2F2EA 1QPMA 2HTJA 3C1DA 3EETA 3HOTA 5HLIA 2QWWA 2QZ8A 1BIAA 1IN8A 3JSPA 2PFBA 4Y67A 2UXXA 2IA0A 4ESFA 2M45A 4ON0A 1ONPA 2K4BA 5FGMA 2Y1GA 2OZ6A 4AICA 5E1WA 4M9ZA 1T1SA 1J75A 2JCYA 1B59A 3GWZA 3WGHA 5DCMA 3O6BB 3FZVA 3SZPA 4G7ZF 2ISYA 3FWEA 3ZPLA 2HYGD 2OAZA 1LVAA 5HS9A 1JG9A 3WTYC 5TRDA 4N0BA 3IL2A 4M9SA 1FBQA 3FX3A 1ZN2A 4JBAA 2RDPA 4RGUA 5L3CA 3F6VA 1S8NA 3L00A 1GXQA 5H20A 4HX4A 3HUGA 3LA2A 2LSOA 1XGMA 4OIOF 4UHTA 2NYXA 4RGXA 2CFXA 1TNTA 2O0YA 1K5HA 2XASA 3FF5A 3KP5A 2CWEA 2ZFWA 3I71A 3VFZA 1FPQA 4FLSA 3SFZA 3E5UA 2EFQA 4HYEA 1P4XA 4LGWA 2A68F 4A5MA 1R5HA 3L09A 5HS8A 4ZQHA 3KE2A 2D45A 4EJOA 1KA8A 3ANLA 1U8RA 3BDDA 2WV0A 3C18A 4EJVA 1BOAA 3Q9VA 3EUHA 4FHTA 1CGPA 1JE8A 4IVNA 2OU2A 1KU3A 5K1YA 4CDGA 1H9TA 3SZTA 4AWXB 2BV6A 3U1DA 1GXPA 1U5TC 2P6SA 3B73A 4YFNF 3KETA 1WSUA 3HHHA 4RCVA 3MZHA 3R0AA 1DUXC 5LHHA 3REOA 3WTXC 2GA1A 2RGVA 3G73A 2CQKA 3HHGA 4O6JA 4ENJA 2RNJA 2X0LA 3KFWX 2Q2EA 2L3DA 2COMA 3JW4A 4Q4ZF 1XGSA 2Y1DA 4HV5A 2IW5A 3EQLF 4WF2A 1KU2A 5TJJA 4RAZA 2MH9A 4N9IA 4MGRA 1TQMA 3WTTC 4L9TA 4PCQA 2BEOA 4WX9A 3LFKA 1SD4A 3NQOA 2GXGA 1FSEA 1RUOA 5AONA 2KIMA 4L5JA 1YW8A 1OYWA 3GZ5A 3ZN1A 1HKQA 1VTNC 2W85A 3CZEA 1ZH5A 4M72A 2ZMEA 3CUQC 5D5VB 1ZGJA 2VE8A 3CUQB 3MFKA 1E2XA 1PDNC 1YS7A 4G6QA 4KN7X 3GFIA 1XMKA 4HQMA 4L0ZB 1STZA 2EV6A 3TDZC 5KVRA 3I5UA 3F72A 1DPRA 2DBBA 4G7OF 3ZHZA 1BM9A 3R0JA 3ELKA 5CVRA 4HDUA 1O7LA 5ILVA 4I0AA 3LWFA 2ZCWA 3L9FA 4FLQA 2EFPA 2BGCA 4HLXA 1J2XA 2J5OA 2A6HF 1D8KA 3D0SA 2L54A 2XKOA 2LF7A 2Y1FA 5BPDA 2GIVA 4PGGA 5HDNA 5ILSA 3ZMVA 4MTEA 2Q8KA 3TOBA 1Z6TA 2GAUA 4XSXF 1WWXA 2ZMEB 1FSHA 1JGSA 3I64A 1XCBA 2XVCA 5DCFA 3JTHA 2O7GA 4G7HF 4KIFA 3RPQA 2XV4S 4ZZDA 2K02A 5HOOA 1FP2A 1IZ1A 3KZYA 4R8HA 2HTSA 2EA2A 1I6XA 4Y6PA 1R1TA 1V3FA 3DPTA 2OD5A 4UXNA 3W6JB 3AU9A 3RKXA 5D8KB 4RB3C 4P5OA 4I7HA 4U7DA 1T98A 3JAMK 1XGOA 2WWYA 4S04A 1V4RA 4HDVA 2BYVE 2RKHA 3HSFA 1SFUA 1LNWA 3JAMZ 3FXRA 3WTSC 3BOQA 3O3KA 4WXDA 2D1VA 2FNAA 3BPVA 2DPDA 1IN5A 3DV8A 2R7DA 3DKWA 1Z05A 2MAOA 3IHUA 2O61A 4O3MA 3I53A 4KNYA 1XGNA 1XD7A 3R0IA 5L3BA 3WTWC 3GFJA 4UV9A 3C7JA 2QENA 3E3VA 2EB7A 3MEXA 1HBXG 4WXCA 2VC1A 5L3DA 1FNNA 4JK1X 2W25A 3EYIA 3BPXA 1USTA 4PDKA 5DEQA 1L0OC 2HFHA 2VT3A 1HSTA 1R0KA 3MZYA 4CXFA 2O6GE 4NQWA 1EV7A 3MCZA 4A2UA 1R58A 3DXJF 1MJAA 2D2WA 3G3ZA 4XSZF 1FT9A 3MQ0A 5L3EA 1FOKA 3J81K 1XSDA 3LA3A 3GYHX 3I59B 1T38A 1ONVA 4M9XA 3ZMZA 1R1VA 1OR7A 2PBIA 3WQRA 4E70A 3HRSA 4ZN6A 2RC4A 2PLYA 1S7AA 3JTGA 4XRFA 3CZLA 1UB9A 1X3UA 4ENNA 1PP7U 1BBYA 1R7JA 4EJTA 3LAJA 4EGYA 3H3UA 1XSVA 3HSRA 1K6OA 2GWRA 5FD5A 3IKVA 2ETHA 3LQQA 4ZYGA 4UVCA 4HV6A 3F3XA 4UVBA 1SAXA 1FYMA 3GEZA 3I4PA 3E6DA 4YG2F 3UERA 1T1RA 2E7XA 5E8GA 4A03A 2HGCA 3RPUA 3BROA 1YFHA 2STTA 1KQ8A 3CLOA 5F6FA 3UEQA 4ZYEA 2DAOA 3ISPA 2P5LC 4BYYA 2JD0A 2IP2A 3F8BA 1PP8F 1SFEA 3W6KB 2JSCA 3O2PE 2MAPA 4GYGA 4OIPF 3QAHA 3Q9SA 5JO0A 5DCMB 4EJUA 1K79A 3J80Z 1ZHFA 2B0LA 1ZRDA 5E1ZB 4ZQGA 3GF2A 2XHKA 3K9TA 1I1GA 4A0YA 3COAC 3IWFA 2IJLA 3KP2A 4AIHA 3LQRA 3K0LA 3IRQA 1HKSA 3RJPA 1T6SA 4HZFA 3SQNA 1IRFA 4TV7A 4ZQEA 3BJ6A 3F6OA 1Z1DA 1KGSA 1G3SA 3NEUA 3IWZA 1AWCA 5CYVA 1MW1A 5D5WB 1KQ0A 3A06A 5BPIA 4HBLA 3KLNA 4BNCA 1BN5A
chains in the Genus database with same CATH superfamily
2AQFA 2HVSA 2IXSA 2Y1EA 3F8NA 2WZGA 1PJRA 1JTXA 2ECCA 4CGZA 2CW0F 1RIOH 2CW8A 2ZXGA 1U5TB 4MFDA 4IF4A 2O9LA 2RNGA 1YI2I 3KZZA 4F52A 4XBFA 4P1WA 1MSFC 1SANA 4L2LA 3OYLA 5JMWA 4ESBA 4XNAA 5GAEJ 1QBJA 3N05A 2Y0MA 4BJTA 4HF0A 1BI1A 3FUDA 2ZJQF 2G9WA 4YIIA 4GYIA 1DQUA 2DMNA 3FHNA 4R5VA 2EGHA 2EA4A 2XRLA 4MEYF 5KNLA 2Z9OA 3ZQCA 2MGQA 2E2HJ 3ERMA 1R5ID 2RJIA 2P5KA 4P9FA 5LGTA 2Y75A 2R5YB 4PK4A 3VB2A 6PAXA 4AR9A 1DGRM 3BJOA 1EH6A 1Y6IA 2M34A 2V1DA 4IHYA 4KMUX 2QQBA 4OAYA 1ZG5A 2X4HA 5GPCA 2W84A 4ZDLA 3QPSA 2A69F 5EGOB 2LD5A 4C2TA 1R36A 3FXMA 4FQGA 2LBFA 2HKOA 3BR6A 1S7EA 3TL4X 2X9DA 3OOUA 1C0WA 2O8XA 2IS1A 1QO0D 3H92A 1S3JA 1Z77A 2DOAA 1HW1A 4GO1A 4R1HA 3CCSI 3ZQFA 1L3LA 1QRYA 4IRHA 2JCVA 3PUFA 4ZDOA 2A6TA 3I58A 4OOEA 3CCVI 3FM3A 4BUPA 5JVGF 3RKQA 3ZR8X 5H6RA 4GAAA 1O3TA 2VN2A 2ZB9A 4HAMA 1BR1A 2Z3YA 4QLCU 4RB0A 2A07F 1Q0QA 1JJ6C 2HWVA 3DPUA 1A04A 2V1NA 1J59A 2H8RA 4MQ9F 4LG0A 1J0RA 3FMRA 4MHGA 1YJ9I 4BS9A 1OYIA 2JK3A 3OYAA 3IAS2 3WQQA 4BQQA 1JHHA 3F0CA 2CV2A 3KPHA 1IAWA 1A35A 3S17J 4D0PA 5IYDJ 4ZH4F 4YIFA 4UNOA 3D5LA 3FTZA 1VQ7I 4EMSA 3GO5A 1YITI 1XB4A 5J1UA 5JHUA 3AG1H 3BG7A 1MNDA 2VBXA 3HJEA 1LEAA 1X1AA 2L9SA 5DD8A 3ROUA 4RGRA 3ANNA 2KQRA 3WU1B 1HC8A 4LLLA 4XLAA 3J80K 4AUXA 4GFBA 1TWGJ 1IRGA 1F9NA 3K4MA 4F7ZA 3TO6A 1G4DA 2DA6A 5CVVA 2PUSA 1P7JA 3U9GA 1ZR4A 2R7ZJ 2J5PA 3PM1A 5D5UB 2OBPA 2Y2ZA 1J5YA 1APLC 5JAZA 4XN7A 2R5YA 2BY3A 2XPVA 3OOPA 3GTGJ 3WGIA 2WAQN 3CCJI 1AOYA 3DEEA 1HLVA 1OCTC 2JZYA 4G9YA 3QOPA 4KT5C 4BHCA 4DYRA 4CYDA 4IL6C 2F5EA 1WHUA 2DDBA 2FF4A 3WTVC 5IPAA 5E3MA 2VBZA 4XN3A 2QCOA 2VPLA 3NRVA 4CCJA 4IHXA 4XLPF 1SD7A 3BR2A 2DOFA 2BVLA 1UFMA 2KLOA 4MIMA 2F48A 3G2BA 3DQVC 3T8TA 3TGNA 4RB1A 3J7AO 5LHIA 2Z33A 4XLFA 5HDKA 3ZQQA 1GDTA 2JCXA 3BR0A 4XLEA 2AXTC 4AC0A 4XMTA 2LK2A 4MS6A 4L9JA 4LMYA 3RYPA 3AL0C 4PSXA 1FYLA 3ZMUA 2PJRB 4DZJA 4IRGA 4IPAA 2EZKA 2JA8J 3EDPA 4W1UA 4L5IA 1MJBA 2C6YA 1NHAA 3BP8A 2V9KA 3K1NA 3ABUA 3WU2C 3QODA 1LFPA 4B3XA 2CUFA 4DZPA 2P8TA 1ZAOA 2YPRA 2GQQA 2Y69H 4ABZA 3ZQ7A 4EJWA 4A3MJ 1WQ2A 3HBLA 1QNTA 1H3LA 1MDMB 3J7ZI 3FM5A 1WH7A 2K9MA 1MGTA 1GUUA 5BS6A 5FLVA 2GOMA 2R72A 4KMFA 3JRGA 2LKXA 2XIGA 1GV5A 1ODDA 3FXKA 4U7BA 2DMUA 2ID6A 4MQVA 4RGSA 4Q4EA 3DP7A 4M71A 3VWBA 4RVBA 1IDYA 3PQJA 4EQQA 2L7ZA 4U88A 1U5TA 2K3PA 2O8KA 2K4JA 2WY7Q 2X1CA 5HDGA 4EV0A 4QWQA 2K27A 3GW2A 1YLFA 2KIUA 2JJ7A 3LA7A 2NS7A 5JI6A 4HF2A 3ASOH 4AYSA 4UVAA 2H1KA 1GLNA 3ZMDA 3WG9A 4QTRA 1ULYA 2CQQA 4LUPA 2XB5A 4BDZA 3K4KA 4P96A 2EILH 3ZP5A 4Y52J 3ZHYA 2WC2A 2ME6A 2GOXB 3ZQIA 2P7CB 2C82A 1O57A 2VE9A 1XN7A 2DMTA 1JKQC 1GHCA 4BL0B 3V7SA 3VVMA 4BGDA 4Y17A 3MWMA 1TT5B 3FTYA 5F0CA 4AYBA 3CZKA 2EFWA 2E1MB 3MN2A 3L2QA 1Y39A 1YW9A 2GIZA 1U9OA 2R7FA 1D1AA 3U2RA 5D6FA 5BNGA 5LEKA 4Y6SA 4C3JJ 3F21A 4RM2A 4FCYA 3T1BA 2HYFA 4BAYA 1OLTA 2ADUA 3IH4A 3KLOA 3KEDA 3HC7A 1Y1WJ 1OKRA 1HKTA 4KA4A 4OIRF 3RTRA 4KISA 4MEXF 4IQJA 5EGOA 1IN4A 2DQMA 4ZW6A 4EM1A 2ELKA 3OIOA 4U0WA 4KICA 1WKMA 2LBFB 2A7OA 3T8VA 3TOAA 1KONA 2KP6A 3ZHXA 1SFKA 4ENKA 5ICCA 5CQGA 5HLHA 2DTRA 2ZNYA 4KJZA 2KJBA 2HQRA 2QKLB 3CHQA 4D5FA 2QJ1A 2NS0A 4C2MJ 2DA4A 3TP3A 4XO4A 2EFNA 1MDMA 3I4MJ 2XAGA 2M5WA 4HG2A 2DJNA 2IS2A 2CUEA 5DV5A 1TLHB 1YIOA 2G0EA 3K69A 3QP5A 4PZJA 3QJXA 4XM3A 4IX7A 2Z1DA 3RKWA 2OZUA 3P9KA 3F8FA 2M1BA 3KEQA 3R61A 3RDIA 1Z21A 4KDPA 4I09A 4AD9A 5ILUA 1SMTA 3RCOA 2WPGA 1FBUA 1J09A 4BE0A 3FHEA 3C2GA 2NVXJ 3D1NI 1GVJA 4CSWA 1X1DA 2V79A 4XN5A 3OSGA 4MKTA 3UCQA 5F08A 5IYBJ 4E7HA 4XOTA 4KFCA 4KP7A 4GCVA 4S05A 2QSGX 4OIQF 1QZYA 1XG1A 2V1UA 2K3FA 1PUFB 5EEGA 4UUVA 3K70C 1HDPA 1ZYRF 4ETSA 2YU9J 2XPYA 5E3NA 1GV2A 1BOBA 2KRFA 3FBNB 4EEFG 1ORKA 3G1MA 4Y33A 2QEXI 1W7PD 3FKJA 4BXUA 3WTUC 3BR1A 1W0UA 2MH2A 2DA2A 2Q1ZB 2KIQA 1UJ8A 2VODA 1QHGA 1LEBA 4NQWB 1TWFJ 2DDAA 4G8XA 5EYRA 3VPRA 3KP4A 2KRHA 1E17A 2VBWA 1XS9A 4AIDA 2A6EF 2EIMH 4R5TA 4BE1A 5JNLA 1MBFA 4N4OB 3M9AA 5FKNA 5K5OA 1R6RA 4LLGF 2E5ZA 5ICFA 3FXQA 2VOOA 4L18B 1E3PA 5J47A 4RDUA 1MZBA 1X2MA 2M30A 1G8XA 1ZLJA 1LKXA 3I59A 1R9TJ 2IRFG 3DBLB 5IT9Z 3SYTA 2IT0A 1QA6A 1HW2A 1WI9A 2L9NA 5FB2A 5IP7J 3JRBA 2DQ6A 2QQAA 3CHRA 1MMSA 1SC5A 3TEDA 3TQNA 1ZRFA 1T56A 4HX7A 2UWMA 4Q5SF 3IUOA 4XN1A 5HVQC 4HW0A 3CCQI 1J7KA 4I02A 5E18F 2PI0A 4HNVA 3SXYA 2FMYA 5J6XA 1R22A 2NXNB 3TMOA 3OYKA 2IGNA 1LVKA 2ZO4A 1ZREA 4IXAA 3FUFA 4XMUA 4WWCA 2R93J 2ACJA 4IOAF 4M3EA 1TNSA 3FTWA 2MLKA 3GTPJ 2QBYA 1UCRA 4ZDPA 2PL5A 1X1CA 3QPTA 2GBYA 4LG3A 1YS6A 1S46A 2IVMA 4IHSA 1QZZA 2DXIA 2AS5F 5DM7F 4HF1A 3RSNA 2XROA 4YELA 3OYIA 2KRCA 2R59A 2K86A 1QQIA 3N97A 4HOBA 5L3GA 2X85A 4A6DA 5EJCA 5HS7A 1KYWA 2JSPA 2UZKA 1BC8C 3M4OJ 1I1SA 2P4WA 5M5XJ 4BXFA 3S1QJ 2HOSA 4BH9A 2LY9A 2BY0A 4HNUA 4ZW5A 4EVIA 1O3QA 1FIPA 3QP6A 1UMQA 3CXBA 3KP3A 3OR1C 3AU8A 3P9CA 4H4KC 3S3OA 4LFUA 2NNNA 1N77A 3CZGA 2QM3A 1ETKA 3R6SA 3I0TA 1DP7P 3BZ6A 3V7RA 1D0ZA 3TO7A 4D5CA 2FQ4A 2ESHA 3L2RA 2VKHA 1UG2A 1FOYA 2F4IA 4E7JA 4NC7A 3KYCB 2WB1N 4BY1J 2L4AA 3CDHA 4XLHA 5H2FC 2HQ5A 5EDNA 3WQSB 3ZXSA 4XO3A 3IV5A 5ICGA 3JRIA 2VXDA 3SHFA 2NVQJ 2ZC2A 5FLXK 2FFLA 1U9NA 5JFRA 4Z2YA 1EF4A 5C3EJ 1HQCA 4XKBA 1SMYF 3VVLA 3SJMA 3HOZJ 2HQNA 1TT0A 3CF2A 3ZRGA 1G59A 3CCRI 1G2HA 3GFMA 4R79A 2FEZA 3DLAA 3W2WA 4XMZA 1H88C 2EPFA 3WODF 3RI4A 4Y15A 3RQIA 2JT1A 1TBXA 3CCYA 2Y1CA 2K9NA 3WHCA 3J7AY 2HPIA 1DP3A 2OCCH 1MKMA 3BLYA 5KAFC 2OQRA 2VXZA 1W0TA 5LHGA 2LVSA 3KCCA 3MKYB 5JC1A 1YRNA 3FTUA 1OJLA 4GAEA 5LGUA 4M73A 5EEHA 5IT3A 4HNTA 4M6YA 5JVTA 4IRIA 4IO9F 3QPHA 2KPMA 4D9JA 4FLRA 5GTIC 4FCAA 2LY2A 3FKIJ 1QU3A 2W82A 2PEXA 5E17F 3DWLE 3VSLA 1MIJA 4Q4IA 3ZQLA 1SD5A 1B6AA 1T08B 2EV0A 3G71I 2A05A 2YUSA 4Q48A 1F36A 2DFEA 3K4BA 3QU3A 4MTDA 1YTYA 1MH3A 2LF8A 1S9HA 3KP6A 5K7FA 3JRAA 3F8MA 2QUFA 4RLQA 1S6LA 4JX5A 1MBKA 1OISA 1WJAA 2GA2A 4HA8A 5LGNA 2DLLA 2E5NA 1E0EA 1MVYA 4IHWA 4GGGA 4A3DJ 2Z5UA 1X3WB 1F5TA 4ZW7A 2XQ0A 2OPTA 1R71A 2F5CA 3UNGC 4PFOA 5FD6A 1JJ8C 1MW0A 1A36A 1MBGA 4PSWA 1B72A 1G3TA 3DTIA 4LIVA 1FP1D 3WTZA 3F23A 4UY8I 1Z6RA 1REPC 2QQ9A 2RN7A 3C3WA 3P9IA 1RR8C 4A5NA 2M3AA 5IT9K 1P92A 3ABLH 1FX7A 3W3CA 1BW5A 2FBHA 2DA7A 1IGNA 2DK8A 4G6DA 3T5XA 5FRNA 3GFLA 4DBQA 4L5EA 5JLWA 3O8GA 3H9JA 3MD2A 3LAPA 4ZW3A 1QZEA 2VQCA 2BXZA 2XPZA 3R60A 2R7OA 1JT0A 1UZCA 1VQKI 3M8FA 3RYRA 4XL9A 4ZYHA 4BBRJ 1X3ZA 1U6GA 4X2UA 3HOXJ 1K4TA 1UG0A 4ZW8A 1BJZA 2RQPA 2LR8A 2DPUA 1BJAA 3DF8A 3BWGA 2BBYA 3DTEA 1FMWA 2JPCA 3D5RC 5DD4A 3ZOBA 4GXOA 4CO8A 1ON1A 4IHVA 4I76A 4RAYA 3V8JA 4B8XA 5EZHA 4NC6A 2FBKA 2ZFUA 3DCFA 3QQAA 5AIQA 4EM2A 2M87A 2E7WA 3B6CA 4L0YB 3M1CA 2IPQX 1TQIA 4A3KJ 3QWLA 1WVRA 5DYFA 2KFDA 2ID3A 1ZGWA 2Z2SB 1WJDA 4PGHA 2YX7A 1W5TA 4CCMA 2P7VB 2VC0A 5J1YA 3S2HJ 3HIFA 1PVEA 2P6TA 2QYOA 2XF6A 3HTSB 5E79C 4CCOA 5BOXA 1IW7F 2O7OA 1SFOJ 1MW3A 4BHPA 4M3FA 3VOEA 5LLQA 1MJ9A 1WFXA 3FU3A 1MBJA 1OCPA 1JKRC 5CVIA 1FYKA 1ON2A 2R0QC 2W1OA 2VKDA 1S5LC 1X58A 5M3FJ 4HQEA 3CJTB 3FUEA 2Q0OA 3AUAA 2YX4A 4C30A 2VKEA 4M3BA 3ERED 1SVLA 3FH7A 2PMUA 2H09A 2YSRA 1ETXA 2CQNA 3ZN0A 1TWHJ 5FKOA 2FBIA 3HRUA 2JUGA 3BQZA 4YFKF 2LNBA 2CSOA 2OJED 3HM5A 3E6MA 4XKVA 3HL2A 2HR3A 3V8KA 4BKXA 3B37A 2EV5A 2UUZA 4LLNA 1SEUA 4LG0B 4D7NA 3FTVA 4LK1F 1DPUA 3CHOA 1E3HA 3M8JA 2RQQA 2JA5J 2EFOA 3K4LA 4RAFA 4ARFA 1W7PB 1FEXA 4EGZA 2MBFA 1BR4A 3OYDA 3GTQJ 1U0JA 4UUTA 4Y13A 5FLXZ 2DFFA 5A2QK 2Z16A 2XB0X 4RAGA 1EKEA 2WB1A 1K7AA 3FUHA 3SFIA 1Q1VA 2VJ5A 3QU6A 3HW2A 3QYBA 2QBYB 4BQOA 3ZMTA 3DLLF 1VQ8I 5B1BH 1P9QC 2XUBA 3TDUC 4ITVA 2LY1A 1A6QA 4MLOA 5A2QZ 2G7HA 3FXOA 2F4MB 3HG9A 3KEOA 1ZTRA 3JSOA 3L2UA 4ZTJA 5C44J 2CO5A 2V9VA 3TO9A 2VASA 3CCUI 4BBSJ 4GRIA 2HYJA 3B7RL 3A0BC 1YE9A 5D4SA 4JX4A 1W5CC 3ML6A 1USSA 2L4MA 4NC8A 1ITYA 2JPBA 1FWZA 3OY9A 2FXAA 4OU0A 1J9IA 1ONNA 2QLZA 3HOUJ 2ZMEC 3Q5FA 3PQKA 2VBYA 3VODA 1RKTA 3M1EA 1R49A 5DDGA 2CH0A 2DT5A 3HB9A 3A14A 2AXLA 1O3SA 4Y3OA 1ZG3A 4A12A 2FOWA 2LDUA 1YQAA 2WTEA 1IXCA 2QA4I 4B48A 1HA8A 4HEA2 3FTSA 1MH4A 4OOFA 1P4WA 2K40A 5BQTA 3CDIA 4F91B 4F93B 3OYGA 2HDCA 3M8EA 4FX4A 4XNBA 1HXDA 3HTUA 3B3BA 3UR3C 2K9QA 3ECHA 3PUBA 4YFXF 1B4AA 2PQ8A 3S1RJ 3KEYA 3A1YA 3ULQB 2HI3A 2FU4A 5JBIA 1IN6A 2HKXA 1RRJA 4OMZA 2E1CA 4LOCA 3F22A 4HLYA 2W24A 1G3YA 2ZBKA 2XAJA 3TBIA 5L3FA 2E19A 3MKWB 5HODA 2EK5A 2WAEA 3V4GA 2FE3A 4MNUA 3HEFA 3PSFA 1TWCJ 1SVOA 3C2BA 4JQFA 3CC4I 2W57A 2CU7A 5F0FA 2RV8A 1LB2A 4II3A 1IJWC 3E0JB 1RI7A 3HXLA 2KT0A 3CJRB 2JN6A 3GCMA 3R4KA 4U0YA 4I6ZA 4DQ2A 2XKPA 2WV1A 3L2CA 2H6BA 1G5AA 2CG4A 3BG9A 4BY7J 3CMEI 5AIPA 4FE7A 3I4NJ 3Q3SA 4DNCA 4RA2A 1IDZA 1JTYA 5IYCJ 1FC3A 5DM6F 1ACIA 4A3BJ 2HZTA 4JNDA 2I5UA 2O03A 1ZG1A 1JGIA 1XMAA 5J8CA 1OMIA 4CCNA 3T0YA 4C2UA 2JRTA 2LKPA 4PFPA 4B47A 2XAFA 2DJIA 4KUMA 3IKTA 5FKMA 4DIQA 3JRCA 4B09A 4A3IJ 2DYRH 4L9VA 2O5RA 3GX4X 1FIAA 3JT1A 3LSTA 4KYWA 2FA5A 1R1UA 2M9HA 4EATA 2E1OA 2EWNA 1VQ5I 3HSEA 3B2PA 1YYVA 3FIWA 4I0BA 1W5SA 2DFIA 2GXBA 3OSFA 2R3SA 5GP9A 5EG0B 3OYJA 1FY7A 2K85A 5KCMA 3CIAA 3HGGA 3DPLC 3PL8A 2X1DA 2VJIA 1IUFA 1FMVA 3SEQA 3GXOA 3F8CA 4O5VA 3HOWJ 1IN7A 3FUJA 1U2WA 2XSDC 4BJ6C 3FK7A 2DI3A 1LPQA 2K9SA 4BQNA 2OQGA 3BZKA 1R5GA 4ZZLA 1MBHA 4QUOA 2L01A 4XN4A 3ZGKA 3K2ZA 5D4RA 2ESNA 2WY8Q 5CVUA 5IP9J 1IXSB 4XN0A 1TZLA 2FMLA 2KMUA 1JT6A 3BTIA 3QRFF 2A5YB 4F3QA 3JRHA 4I98B 2L02A 3WU0A 1IUYA 4KIGA 1X3ZB 3M3YJ 2HVRA 2Y9YA 4X1EA 5J3LA 5DUIA 4K5OA 1D5VA 4BJ5C 4PJNA 5TGTA 2CV0A 2FSWA 5CVJA 2AQEA 3E6CC 2MLGA 2YS9A 3S3MA 1Z7UA 3NAUA 5GAHJ 2NNYA 3GZNB 4WK8F 2PG4A 2JD2A 2RVCA 1H0MA 1MW2A 2LC2A 1UHSA 1OQYA 1OYYA 2B9SA 2GZWA 2DCEA 3T8RA 3K2AA 5DTDA 2VT2A 1TL8A 2VI6A 5J40A 1G3WA 1P6RA 1ETQA 4FLOA 4FE4A 2Z99A 1FLIA 1U8BA 1RETA 3MAJA 1YJNI 4UV8A 4WXHA 1DDNA 4W97A 3FH5A 4FT8A 1Z9CA 3BG5A 3O8HA 3IP4B 3SEZA 2HEOA 2DQLA 2KIFA 4AYBN 3JCUC 5H6QA 2LLKA 2V4JC 3G1LA 3S14J 4A3JJ 1SD6A 2ZKZA 4PJ0C 2XPUA 1T8IA 1ZS2A 5D8LB 1B9NA 3CUQA 2YR2A 3E97A 5FFZA 2AO9A 3RPUD 5GAGJ 3G4SI 3AAFA 1P2FA 5JMPA 4I99C 3DKXA 3DEWA 3CUOA 1K78B 4J00A 2BOLA 2F5VA 2KJCA 3OIPA 3WE2A 5EG0A 1KU7A 3OR2C 4LJZF 4AVZA 4YRVA 4ESJA 1KYZA 3IAM2 2ZXJA 3CJNA 3E5QA 5IY5H 1EH7A 4ZX6A 4D1QA 2H8WA 1SFXA 2MSYA 5D5XB 3L2VA 3K70D 3A4CA 3S1MJ 4M6XA 2R4GA 3VYUB 5FKKA 2DMPA 1XCVA 4N9HA 5K5QA 3IC7A 1TW3A 1Z0XA 1FJLA 3ANMA 2XGXA 3DFGA 2NRAC 4H0EA 2VKVA 1H89C 3RIRA 1BC7C 2IBDA 1TQPA 5CLSA 2XPWA 3Q0WA 3I54A 2CYYA 2IA2A 1D3YA 3E6BA 4X6AJ 3GMEA 1B1BA 3V7CA 1HW5A 5CJ9A 3RC3A 1LJ9A 4IJAA 4XICA 3EUAA 2MG4A 3W6VA 1A5JA 2DO7A 2PJPA 2OF7A 2BVMA 1TW2A 1V54H 3FULA 3G6EI 3CMMA 1QVTA 3KP7A 5LBQA 4LB5A 4KN4X 4ZTFA 2ZJ2A 4G12A 3KIOA 2XAQA 4CZCA 3GZ6A 1SQMA 2IGMA 2XRNA 3ESWB 1WCMJ 2HOEA 2XAHA 3GUDA 4FISA 1FZPB 2VJ8A 5JR3A 5GADJ 5DULA 4LITA 2R7SA 2KZGA 3BR5A 3IIEA 1SVMA 1RUNA 1XSXA 3HRTA 1HDDC 3FMQA 4KIBA 2EZLA 5KHDA 2H1LA 4ZQFA 4ZX3A 3CHPA 1W36C 1OR7C 1R0LA 2OTLI 4XMWA 2X6OA 3CDLA 1CF7A 1S29A 3P7NA 4A6EA 1RP3A 2V6CA 5J8FA 3FHZA 3CCMI 4OOIA 2H27A 3LNQA 2HS5A 3CESA 3LSIA 3QPLA 2STWA 2VONA 1PUEE 1YO5C 1T0FC 1B9MA 1HSJA 2ZSHB 3AG3H 3RQ4A 3CTAA 1M1EB 1XDUA 5E3OA 4RS8A 1R23A 2OTJI 1T39A 1YW7A 3BY6A 5HNFA 2HPMA 4Y6RA 1P4AA 4QSHA 4K5MA 3S2WA 4XN9A 1BIBA 5FO5A 3OIQA 4DYCA 1JXSA 1U3EM 5C4XJ 4BDYA 2JD1A 3QOEA 2L7FP 1X2NA 3N4MA 4LK0F 1FBSA 5CKTA 4XRSA 4P9UA 1IC8A 2WAFA 4M74A 2M0MA 3E5XA 1VQMI 4FASD 2Y0SN 4A3CJ 4DYQA 2DK5A 4I01A 3A02A 1Q1HA 1Q0HA 4QPEA 3H5RA 2QVOA 2P5VA 5K5RA 1VI0A 2DQRA 4FX0A 5DS9A 3S32A 2IA1A 1ZARA 3K1MA 3RZOJ 2PN6A 1T0FA 3RASA 1TTYA 3MKZA 2PMHA 2BE5F 5DYMA 2R70A 3M7GA 4E6KG 4B44A 3HOYJ 1ZKGA 3D5SC 4ZYDA 2PMZA 1BR2A 2BZTA 3CC2I 3K1PA 2R7RA 2E1NA 3PO3J 1I3AA 1OPCA 2BY1A 4BQAA 2VQGA 4KITB 2FOKA 3CO6C 1ZK8A 1UHWA 3BTLA 3H36A 2JV7A 4U87A 4AIKA 2NOJB 4OINF 1X1BA 1OCRH 4YEJA 1HF0A 1YG2A 3GLXA 1IXRC 3K4NA 2N8GA 3EYYA 5LRRA 3RKYA 2QSHX 1UHMA 3PNYA 4OMYA 2XDVA 2JTVA 4E7SA 1E3OC 2VOPA 2M7BA 5M5YJ 2H94A 1YX5A 5E1XA 5FFXA 4CA0A 2DU9A 4XLNF 3X2QH 2K5CA 2ISZA 1ETOA 2A3SA 4JOMA 3FMSA 2JWTA 3ASNH 4YIRX 2ZNZA 3H3ZA 2I10A 4K2EA 1S7OA 5ED4A 4C9YA 3L7WA 4JYKA 4NNJA 5E8IA 2LREA 1HOMA 5DUKA 1VQPI 4Q47A 3HOVJ 2CW7A 4WCGA 3SDBA 4CZZA 2E34A 5JHFA 4AVPA 1S72I 1JHFA 1ZRCA 4RMNA 1FOWA 3ZMSA 1F43A 4CICA 1YX3A 4ASNA 1RNLA 3KYDB 2MD0A 3ZI0A 1BI0A 4G94A 4RB2C 4GDFA 2MD5A 3ABTA 5B3SH 4BE2A 1F1ZA 1XDSA 3DBRB 5LEJA 3I56I 5HLGA 5D6EA 2DYSH 3B02A 3J81Z 2F5FA 3BJAA 1D8JA 1K78A 1WJEA 4A0ZA 4CHUA 1W4MA 1N78A 5CQEA 4XRSG 4HX8A 3JSZA 1G6NA 4U0VA 2FRHA 2V1XA 1O3RA 1BI2A 1YJWI 1EJ9A 3HYIA 3IRRA 4A0XA 4J19A 4NB5A 4RSYA 3PFYA 5BMZA 1T2KA 1ZGAA 2K7LA 1RZ4A 4XKWA 2QSFX 5FWQA 2ZSIB 3OV8A 2FQ3A 4L9NA 3WE3A 3PNVA 5F1RA 3GVAA 4LD5A 1LDJA 1ZQ3P 4I2OA 1LFBA 1IF1A 3DEUA 3TW6A 4IEJA 2YU3A 2OA4A 2Q2EB 3FXUA 2G7UA 1VFCA 2WA0A 4N4NB 1YOVB 5E20A 3FH8A 4XNDA 2E1MC 2H6CA 1Y0UA 1LQ1A 1BW6A 5HLTA 1X4PA 2M8EA 2ELHA 2TDXA 3CP2A 3LOCA 4BHBA 3K10A 5F64A 3WGGA 5ICEA 1H9GA 3CO7C 2A61A 2NAZA 1DGWY 1U78A 1Z3YA 3ECOA 1Y8RB 3H1CA 4ENMA 1F4KA 4EM0B 2P0WA 1O7FA 1P7IA 5ERIA 1VZ0A 5LRSA 4NUBA 3K6GA 1POGA 2IGKA 2FNPA 4XN2A 2DW4A 4P55A 1LDDA 1QGPA 4QIRA 3HRMA 2O3FA 4CYCB 3BQYA 3B34A 1VQOI 1K4SA 3PFIA 1MD0A 2F5DA 2VQHA 2R5ZA 4IHTA 1WRJA 2BW3A 4R7LA 3SDGA 2XAUA 4AIJA 4II2A 2UXNA 3V8LA 1KQ9A 1Y8QB 3H9GA 1MNMC 2HDWA 4E7ZA 1CF7B 3VYSB 1QPIA 2EJRA 1KU9A 2V6EA 4LB6B 1I3QJ 5KK1A 4MO7A 2HQAA 1Z91A 2L2OA 3PSIA 2IS4A 4XORA 3B7UX 1ONOA 4QPQA 2QVWA 3QYEA 3S1NJ 1Z67A 2MA3A 1I27A 1ZLKA 1R00A 3VEPA 2W7NA 1LDKB 2DOEA 1I5ZA 3CCEI 3JRDA 4NHJA 1Z7LA 2FX0A 1D1CA 1Q0LA 4ANJA 1BI3A 3TKYA 3HOSA 2CGPA 3DBHB 3BR3A 1BA5A 1EH8A 5B5EC 3E1SA 2W00A 1JVSA 1W7PA 2Y0SA 1XPXA 3HUGB 2DA1A 2KKOA 1YIJI 5HNHA 2Y48A 3FISA 3OYMA 2MC3A 2D1HA 2F2EA 1QPMA 2HTJA 3C1DA 4OWRB 2NVTJ 3EETA 5E3LA 3ABMH 1K83J 3HOTA 5HLIA 2QWWA 1VF9A 2QZ8A 3L1PA 4HRIA 1BIAA 5IP6A 2EIJH 1IN8A 4Z6YA 3JSPA 2PFBA 4Y67A 2UXXA 2Y31A 2IA0A 5GPAA 4M6VA 2M45A 2W4SA 4B4CA 4ON0A 2WAQA 4ESFA 4JX6A 2K4BA 1D0XA 1ONPA 5FGMA 2DTZA 1K61A 4MFEA 2VB6A 2QF7A 3A01A 1A31A 2OZ6A 2Y1GA 4K5LA 4AICA 5E1WA 4M9ZA 4CH7A 5FRMA 2M0CA 1J75A 4CYCA 1T1SA 4RM3A 2JCYA 1B59A 4PUSA 3BC8A 1DU6A 3GWZA 3WGHA 2LP0A 1R4NB 1IO2A 2E60A 2M7AA 5DCMA 3O6BB 3FZVA 3SZPA 4G7ZF 2ISYA 3LSJA 3FWEA 2X48A 3ZPLA 2XF5A 2HYGD 2OAZA 2ZJPF 5BPPA 1LVAA 3MKLA 3Q0VA 5HS9A 4ZC3A 3BZCA 2VJJA 1JG9A 2CUZA 3B7SA 4XK4A 3FUNA 3WTYC 3EUKL 3B7TA 5TRDA 2RREA 3DTKA 1RPWA 4N0BA 3IL2A 1W36D 4M9SA 3CHSA 3OYFA 3GTMJ 4DPRA 2VLAA 2L5QA 1FBQA 3LSMA 3AL0B 3FX3A 2HOTA 1ZN2A 4JBAA 1I6HJ 3CZ6A 3FK6A 3P5JA 2RDPA 1N25A 1RR7A 3B2XA 5B66C 1MMAA 4RGUA 5L3CA 3F6VA 2R7XA 5LFAA 1S8NA 3L00A 5F1JA 2COBA 1GXQA 1OFCX 2CRGA 2MW8A 3UKGA 3J7YJ 2IS6A 9ANTA 5H20A 3K4JA 2LRDA 4HX4A 3HUGA 3LA2A 2LSOA 1YHQI 1FTTA 1XGMA 3A0HC 2GTQA 2R7VA 5FROA 2ICWG 3FXJA 1Y56A 4OIOF 4UHTA 5J4VA 2NYXA 3BTJA 4RGXA 1VQ6I 2L9RA 1XTAA 1WZ2A 5EV7A 5FLMJ 4X0GA 2L0KA 2DA5A 1ETWA 4PVBA 2XGCA 2CFXA 1TNTA 2O0YA 1K5HA 1AA7A 2XASA 3FF5A 1NTCA 3KP5A 3GTJJ 4XLCA 2CWEA 2ZFWA 4XN8A 3I71A 3VFZA 2NVUB 2MFZA 2R92J 4XONA 1FPQA 3LFUA 1V5FA 4FLSA 5K7HA 1AU7A 2P81A 3SFZA 3E5UA 2EFQA 4HYEA 1JGGA 3H5NA 1ERDA 1P4XA 4LGWA 2A68F 2JA6J 4A5MA 4XIDA 1R5HA 3L09A 2EZHA 5HS8A 4A3LJ 4ZQHA 4XR6A 3KE2A 3GLLA 3GBGA 1T33A 1MMDA 2D45A 4J3BA 2EH3A 4QHPA 4EJOA 2LFBA 1KA8A 3ANLA 2OC6A 3FTXA 4E7LA 1R4MB 3BDDA 1U8RA 2QQ8A 2WV0A 3C18A 4EJVA 2ZJRF 1BOAA 1HCRA 3H3VK 3Q9VA 2I8DA 3EUHA 4FHTA 1CGPA 1MBEA 2X6WA 1X4OA 1JE8A 3S15J 1AHDP 4IVNA 2OU2A 4ZQTA 1KU3A 1V5GA 5K1YA 1XC5A 3EBHA 1BL0A 3CJQB 4CDGA 3LSRA 1H9TA 1VQ4I 3SZTA 4AWXB 2BV6A 4AR1A 3BCBA 4RLFA 3U1DA 1GXPA 3AG2H 3K4CA 1U5TC 2P6SA 3B73A 4BEHB 1K6YA 4YFNF 1I39A 3ZQGA 3EPZA 4C3HJ 3S3NA 2OCEA 3KETA 1WSUA 2HDDA 3HHHA 4RCVA 3MZHA 3R0AA 1DUXC 5LHHA 4QIWN 3REOA 2LOOA 3WTXC 2GA1A 2RGVA 3HKZA 2XF7A 3G73A 2ECBA 2AHQA 2CQKA 1GW6A 5B1AH 3HHGA 4O6JA 4A3EJ 3I3LA 1V55H 4ENJA 2RNJA 1MW7A 2X0LA 2Q2EA 2L3DA 3KFWX 3VSKA 2COMA 3JW4A 3S16J 2WZFA 5F0HA 1A6IA 4PJMA 4Q4ZF 5C4JJ 1WGXA 1XGSA 2Y1DA 2FUG2 2NVYJ 4HV5A 2IW5A 3EQLF 4WF2A 3OYBA 2D5VA 1KU2A 5TJJA 4RAZA 2FD5A 2MH9A 2DT6A 4N9IA 2VPRA 3OYNA 2MYSA 4MGRA 1TQMA 3WTTC 1IG7A 4L9TA 4PCQA 1X19A 4M3DA 1HS6A 1I50J 2BEOA 4WX9A 3LFKA 1SD4A 3NQOA 2GXGA 4A93J 1FSEA 2ZXWH 1RUOA 4E7IA 3HDDA 3GTLJ 2E71A 5AONA 2KIMA 4L5JA 2DA3A 3FU0A 2DODA 1JI8A 1YW8A 1OYWA 3GZ5A 3G1OA 3ZN1A 1HKQA 2JMWA 1VTNC 2LMDA 2R5ZB 2BW3B 2W85A 3CZEA 3MMYB 1ZH5A 4M72A 2ZMEA 3CUQC 2CUJA 5D5VB 1ZGJA 1SAUA 3F9KA 2VE8A 2K9LA 2ME0A 3CUQB 3MFKA 1E2XA 1PDNC 1JUMA 2EIKH 1YS7A 3E7LA 4XMVA 3OMYA 4G6QA 4AU7A 4KN7X 4Y4RA 1T95A 2DMQA 1XMKA 4BEHA 3GFIA 1VQ9I 4HQMA 1WJCA 4L0ZB 4ZX5A 1STZA 4D7MA 2EV6A 3TDZC 3TW7A 1IV6A 4A3GJ 2M4KA 5KVRA 3I5UA 1TWAJ 3F72A 2HU9A 4XMYA 4QMEA 4K5NA 2PX9A 2W48A 1DPRA 2DBBA 1RESA 4G7OF 4V19K 1O4XA 2FJ1A 3ZHZA 3LSGA 1BM9A 1MMNA 2QGUA 3R0JA 1B8IB 3ELKA 5CVRA 4HDUA 1O7LA 5ILVA 4ZX4A 1FOXA 1NG6A 4ZJZA 2KL4A 1IRZA 2R7WA 1D5YA 1NK3P 4I0AA 1D1BA 3NWSA 3LWFA 4DOZA 4UUSB 3U1KA 3FUIA 2ZCWA 3L9FA 2B63J 2EFPA 5LD2C 4FLQA 2HPTA 2BGCA 4HLXA 1J2XA 2L7MP 4BU2A 5J1RA 2CV1A 3AG4H 3S93A 2J5OA 1NH3A 2A6HF 3A03A 1D8KA 1NG7A 3D0SA 4RBOA 4F92B 2RAEA 1WPKA 2L54A 2XKOA 3WG7H 2LF7A 2Y1FA 5BPDA 2GIVA 2V7FA 3A01B 2E36A 4PGGA 5HDNA 3QYFA 5ILSA 3ZMVA 1PYVA 4MTEA 2Q8KA 4XKCA 3TOBA 1WI3A 1Y0NA 1Z6TA 2GAUA 4XSXF 1JKPC 1WWXA 1MMGA 3GTOJ 2ZMEB 4FTHA 2LG4A 5TISC 3Q43A 1FSHA 3L2WA 3W2AA 4A3FJ 1JGSA 2JVGA 3I64A 3OL3A 1XCBA 2XVCA 4IQ4A 5DCFA 3JTHA 3CMYA 2EZIA 4F55A 2KDZA 2O7GA 4G7HF 5EF6A 4KIFA 3H35A 4CUGA 2VQLA 2E35A 4XQFA 5FJ8J 3A2KA 4FETA 2JVHA 3RPQA 2XV4S 3CF5F 4ZZDA 2K02A 5HOOA 1FP2A 3DU5A 1IZ1A 2XC7A 3KZYA 4IZZA 3LSPA 4R8HA 4IOCF 2HTSA 3BTCA 4C3IJ 2V26A 2TCTA 4NDLA 2EA2A 3KYLA 4XMXA 1I6XA 4Y6PA 2NOGA 1DU0A 1R1TA 1V3FA 2M8GX 2VL8A 3PIPF 2GM4A 3DPTA 2OD5A 4UXNA 3W6JB 1TC3C 2BXYA 3AU9A 3PO2J 3RKXA 5D8KB 5F04A 2ZXIA 5F27A 4AR8A 2UV1A 3VDXA 1N75A 1WJ5A 3H5AA 4RB3C 1OCCH 2X6YA 4ZYAA 2DFHA 3CC7I 1LE8A 4P5OA 2KISA 4I7HA 3FUKA 4U7DA 1T98A 3JAMK 5J4YA 1XGOA 4J01A 2WWYA 2ZXHA 1TP4A 4LIUA 4S04A 1V4RA 4HDVA 2BYVE 2RKHA 3HKZN 3HSFA 1SFUA 4G6TB 1LNWA 1D0YA 4XOPA 3JAMZ 3FU6A 1LUJB 2MC4A 1X1PA 1QVUA 3FXRA 3WTSC 1H19A 3BCAA 3IH2A 1V5EA 1Z3XA 2CMPA 3BOQA 5DLLA 2WADA 3VYTB 2XGDA 4DBRA 3O3KA 2IAIA 4WXDA 1RC9A 2D1VA 2LYCA 2FNAA 3I55I 2MABA 3BPVA 2DPDA 1IN5A 2R7TA 3DV8A 2R7DA 3JREA 3DKWA 2CJJA 2Y30A 3S2DJ 3FU5A 1VQLI 1Z05A 4UB8C 3LSHA 1FTZA 2MAOA 4XRMA 3IHUA 4Y7NJ 3OYCA 4O3MA 2O61A 2VJ4A 3I53A 3OS1A 3H0DA 3V42A 3FBIB 4KNYA 1XGNA 3IH3A 1XD7A 4CCLA 3R0IA 5L3BA 3WTWC 3GFJA 4UV9A 4HSTA 3C7JA 2QENA 3E3VA 2EB7A 3MEXA 1HBXG 5KAIC 4WXCA 1KZHA 2VC1A 1IV8A 1PUFA 4AM3A 3AFHA 1FNNA 4JK1X 3HPHA 5L3DA 2W25A 5AENA 3EYIA 1ZELA 3KZIC 3BPXA 3EBIA 4DJAA 1USTA 4PDKA 3FXLA 1ETVA 4DW6A 4E7KA 3VYRB 1AKHA 5EZGA 4BACA 5DEQA 1L0OC 2V9PA 1OCOH 2HFHA 2VT3A 5FKLA 1IRXA 1HSTA 1RKWA 4NBQA 2OUMA 2CQXA 1R0KA 4UB6C 3MZYA 3OYEA 4CXFA 4OAZA 4QPOA 2O6GE 4NQWA 2JA2A 1EV7A 2E2IJ 3M07A 3MCZA 3C2HA 1R58A 2HZDA 3DXJF 1MJAA 4PJJA 4A2UA 4B43A 5CPRB 5IOZA 1VQNI 2D2WA 1B8IA 3G3ZA 2B7EA 4XSZF 1FT9A 3CQZJ 3MQ0A 5L3EA 1FOKA 2HOAA 1MNEA 3NARA 1WJFA 3J81K 1XSDA 2WBMA 3LA3A 4UUSA 3GYHX 3CCLI 3I59B 2HNHA 1T38A 1ONVA 4M9XA 3ZMZA 3OL4A 1R1VA 2LKSA 1OR7A 2PBIA 2QKMB 3WQRA 3H0GJ 4E70A 2LTPA 2PMZN 3HRSA 4K5PA 4ZN6A 2BHYA 3OS2A 3Q0UA 2RC4A 2PLYA 1S7AA 4B3AA 3JTGA 4XO5A 1MSEC 2X6XA 3CD6I 4XRFA 3MVPA 1JUPA 3HGYA 3LL7A 4KT6A 1UB9A 3CZLA 2DT7B 2EQRA 1X3UA 4XNFA 4ENNA 1PP7U 3CMAI 1BBYA 2IEKA 2KDOA 3U9WA 1R7JA 5IOYA 4EJTA 2L7KA 3LAJA 4S0HB 4EGYA 1W1WE 3LMMA 3H3UA 1XSVA 3HSRA 1K6OA 2X1EA 4R5XA 2GWRA 2ELJA 5FD5A 3K7AJ 3IKVA 2VUMJ 3PIOF 2ETHA 2NS8A 4PJLA 1JUSA 3LQQA 3WHBA 3EUHC 4ZYGA 2KZVA 4UVCA 2LH9A 4HV6A 2C5ZA 3F3XA 4UVBA 1AKHB 1SG7A 2HXIA 4IKFA 4E4HA 4V2GA 2Y9ZA 4DGWB 2KHMA 2TRTA 1SAXA 1FYMA 2L9VA 4V2FA 3GEZA 3I4PA 1EA3A 5JLXA 3EBGA 3AKZA 3PUUA 3E6DA 4JP0A 1UELB 4YG2F 3UERA 2BY2A 2R7UA 5GTHC 1T1RA 3DKYA 2E7XA 5E8GA 3JRFA 4A03A 2HGCA 3RPUA 3BROA 3TP0A 3OWTA 1YFHA 2STTA 1KQ8A 3CLOA 5F6FA 3OYHA 3RZDJ 3ABKH 3UEQA 2EINH 4ZYEA 3FUMA 1LE8B 3KX2A 2DAOA 2BHZA 5EEAA 3ISPA 1SC7A 2P5LC 3U21A 4BYYA 3H9QA 2HXOA 3W2VA 2JD0A 2IGOA 2IP2A 1QHHD 2DN0A 2XSJC 3F8BA 1XMXA 1PP8F 1SFEA 2F6CA 3W6KB 2JSCA 3O2PE 3HZJA 2F4OB 2MAPA 4GYGA 3SZGA 2JUCA 3CP8A 4OIPF 4HSRA 3QAHA 1H8AC 3Q9SA 2CFOA 1GT0C 4PU2A 1JKOC 3I9V2 5JO0A 5DCMB 4EJUA 3DU6A 1K79A 3RC8A 2A5WA 4HPQA 3ZCOA 3J80Z 2M4GA 1ZHFA 4PW4A 3LSKA 2B0LA 1ZRDA 2GXAA 5E1ZB 5K7ZA 2HPOA 4ZQGA 3GF2A 2GLOA 2XHKA 1VNDA 3K9TA 1WH5A 1I1GA 1NK2P 3S8PA 4A0YA 1YRNB 3COAC 4M3GA 2JRMA 3IWFA 2IJLA 3KP2A 4AIHA 2VIXA 3Q44A 3LQRA 3BG3A 3K0LA 5M5WJ 2EBIA 2B61A 1ENHA 2X51A 5M3MJ 3IRQA 1HKSA 1UAAA 3BG6A 3RJPA 1T6SA 4HZFA 3SQNA 3OS0A 3FDYA 4CCKA 1IRFA 3CLQA 3B6AA 2JQ7A 4TV7A 2PGGA 3PJRA 4ZQEA 1LFUP 1CQTA 2R7QA 2JA7J 1XX5A 3BJ6A 3GTKJ 3MZ8A 1ETYA 3F6OA 2XGEA 4BXXJ 1Z1DA 2PJRA 3BT9A 1KGSA 4B1RA 1ZR2A 1G3SA 1Y1VJ 1WJBA 3NEUA 2E2JJ 2CQ7A 3IWZA 1AWCA 3ONQA 3JR9A 2OV7A 5CYVA 1MW1A 1GVDA 5D5WB 3PNTA 1KQ0A 1X3WA 3A06A 2M2EA 5BPIA 4A69C 3HPGA 2CS3A 4HBLA 3ZQHA 3KLNA 4BNCA 2HVQA 1B72B 1BN5A 1OCZH 3NWTA
chains in the Genus database with same CATH topology
2Y1EA 3F8NA 2WZGA 4CGZA 2CW0F 1RIOH 2ZXGA 1U5TB 4IF4A 3KZZA 4XBFA 4L2LA 5JMWA 4ESBA 4XNAA 1QBJA 2Y0MA 4HF0A 1BI1A 3FUDA 2G9WA 4YIIA 4GYIA 4R5VA 2EGHA 2EA4A 4MEYF 2Z9OA 2RJIA 2P5KA 4P9FA 5LGTA 2Y75A 3VB2A 6PAXA 4AR9A 3BJOA 1EH6A 2V1DA 4KMUX 2QQBA 1ZG5A 2X4HA 2W84A 2A69F 1R36A 2HKOA 1C0WA 2O8XA 1QO0D 3H92A 1S3JA 1HW1A 4GO1A 4R1HA 1L3LA 4IRHA 2JCVA 3I58A 4OOEA 3FM3A 5H6RA 4GAAA 1O3TA 2VN2A 4HAMA 2Z3YA 4QLCU 4RB0A 2A07F 1Q0QA 2HWVA 1J59A 1A04A 4MQ9F 4LG0A 1J0RA 3FMRA 4MHGA 1OYIA 3WQQA 1JHHA 1IAWA 4D0PA 4ZH4F 4YIFA 4UNOA 3D5LA 3FTZA 4EMSA 3GO5A 1XB4A 5JHUA 2VBXA 1LEAA 5DD8A 3ROUA 3ANNA 4RGRA 3WU1B 4LLLA 3J80K 1IRGA 1F9NA 4F7ZA 3TO6A 1G4DA 5CVVA 2PUSA 3U9GA 2J5PA 5D5UB 2OBPA 5JAZA 1J5YA 4XN7A 3OOPA 3WGIA 1AOYA 2JZYA 4G9YA 3QOPA 4KT5C 4BHCA 4CYDA 2F5EA 2FF4A 3WTVC 2VBZA 3NRVA 4XLPF 1SD7A 1UFMA 3DQVC 3T8TA 3TGNA 4RB1A 3J7AO 5LHIA 2Z33A 5HDKA 2JCXA 4XMTA 4MS6A 4L9JA 4LMYA 3RYPA 1FYLA 3ZMUA 4IRGA 4IPAA 3EDPA 4L5IA 1MJBA 2C6YA 1NHAA 3BP8A 3K1NA 3ABUA 2P8TA 1ZAOA 2YPRA 2GQQA 3ZQ7A 4EJWA 1WQ2A 1QNTA 1H3LA 1MDMB 3FM5A 1MGTA 5BS6A 2R72A 4KMFA 2XIGA 1ODDA 4U7BA 4MQVA 4Q4EA 4RGSA 3DP7A 4M71A 4RVBA 3PQJA 4EQQA 4U88A 1U5TA 2K4JA 5HDGA 4EV0A 4QWQA 2K27A 3GW2A 1YLFA 2KIUA 3LA7A 5JI6A 4HF2A 4AYSA 4UVAA 3ZMDA 3WG9A 1ULYA 4LUPA 4P96A 3ZHYA 3ZP5A 2WC2A 2P7CB 2C82A 1O57A 2VE9A 1XN7A 1GHCA 3VVMA 3V7SA 4Y17A 3MWMA 3FTYA 3CZKA 2EFWA 1YW9A 3U2RA 2R7FA 5D6FA 5LEKA 4Y6SA 3F21A 3T1BA 2HYFA 4BAYA 3KEDA 2ADUA 3KLOA 1OKRA 1HKTA 4KA4A 4OIRF 3RTRA 4MEXF 2DQMA 1IN4A 4ZW6A 4EM1A 4U0WA 2A7OA 4KICA 1WKMA 3T8VA 3TOAA 3ZHXA 4ENKA 5ICCA 5HLHA 2DTRA 2ZNYA 2KJBA 2HQRA 3CHQA 2QJ1A 2NS0A 4XO4A 2EFNA 1MDMA 2XAGA 2M5WA 5DV5A 1TLHB 1YIOA 3K69A 3QP5A 4PZJA 3QJXA 3RKWA 2OZUA 3P9KA 3F8FA 2M1BA 3KEQA 3R61A 3RDIA 4KDPA 4I09A 4AD9A 5ILUA 1SMTA 2WPGA 1FBUA 3FHEA 1GVJA 2V79A 4XN5A 4MKTA 3UCQA 4KFCA 4KP7A 4GCVA 4S05A 4OIQF 1QZYA 2V1UA 5EEGA 4UUVA 1ZYRF 4ETSA 2XPYA 2KRFA 1W7PD 4BXUA 3WTUC 2MH2A 2VODA 1LEBA 4G8XA 3KP4A 1E17A 2VBWA 2A6EF 4R5TA 5JNLA 3M9AA 5K5OA 4LLGF 5ICFA 2VOOA 3FXQA 4L18B 1MZBA 2M30A 1ZLJA 3I59A 2IRFG 5IT9Z 2IT0A 1HW2A 1WI9A 5FB2A 2DQ6A 2QQAA 3CHRA 1SC5A 3TQNA 1ZRFA 4HX7A 2UWMA 4Q5SF 4XN1A 5HVQC 4HW0A 1J7KA 4I02A 5E18F 2PI0A 3SXYA 2FMYA 5J6XA 1R22A 2ZO4A 1ZREA 4XMUA 4IXAA 3FUFA 4WWCA 2ACJA 1TNSA 3FTWA 2MLKA 2QBYA 1UCRA 2PL5A 3QPTA 1YS6A 1S46A 2IVMA 4IHSA 1QZZA 2AS5F 4HF1A 2XROA 2R59A 2K86A 1QQIA 3N97A 4HOBA 5L3GA 4A6DA 5HS7A 1KYWA 2UZKA 1BC8C 1I1SA 2P4WA 4BH9A 4ZW5A 4EVIA 1O3QA 3QP6A 3KP3A 3AU8A 3P9CA 4LFUA 2NNNA 3CZGA 2QM3A 3R6SA 3I0TA 1DP7P 3BZ6A 3V7RA 3TO7A 2ESHA 2L4AA 3CDHA 3WQSB 4XO3A 5ICGA 5FLXK 3SHFA 2FFLA 5JFRA 4Z2YA 1HQCA 1SMYF 3VVLA 2HQNA 3GFMA 4R79A 2FEZA 4XMZA 3WODF 3RI4A 4Y15A 2JT1A 1TBXA 2Y1CA 1MKMA 2OQRA 2VXZA 5LHGA 3KCCA 5JC1A 3FTUA 4GAEA 5LGUA 4M73A 5EEHA 5IT3A 4M6YA 5JVTA 4IRIA 3QPHA 4FLRA 4FCAA 2PEXA 5E17F 4Q4IA 1SD5A 1B6AA 2EV0A 4Q48A 3QU3A 4MTDA 1YTYA 2LF8A 3KP6A 3F8MA 2QUFA 1S6LA 2GA2A 5LGNA 4HA8A 2DLLA 1MVYA 4GGGA 2Z5UA 1F5TA 4ZW7A 2XQ0A 2F5CA 5FD6A 1MW0A 1G3TA 1FP1D 3WTZA 3F23A 1Z6RA 1REPC 2QQ9A 2RN7A 3C3WA 3P9IA 4A5NA 5IT9K 1P92A 1FX7A 2FBHA 2DK8A 4G6DA 3T5XA 3GFLA 3LAPA 4ZW3A 2XPZA 3R60A 3M8FA 3RYRA 1X3ZA 4ZYHA 4X2UA 1U6GA 4ZW8A 2RQPA 2DPUA 1BJAA 3DF8A 2BBYA 3BWGA 2JPCA 5DD4A 4GXOA 4CO8A 1ON1A 4RAYA 3V8JA 4B8XA 2FBKA 4EM2A 5AIQA 2M87A 2E7WA 4L0YB 2IPQX 1TQIA 5DYFA 4PGHA 2YX7A 1W5TA 2P7VB 2VC0A 3HIFA 2P6TA 2QYOA 3HTSB 5BOXA 1IW7F 1MW3A 4BHPA 3VOEA 5LLQA 1MJ9A 3FU3A 5CVIA 1FYKA 1ON2A 4HQEA 3FUEA 2Q0OA 3AUAA 2YX4A 3ERED 3FH7A 2PMUA 2H09A 2YSRA 3ZN0A 2FBIA 3HRUA 4YFKF 2LNBA 2CSOA 3E6MA 2HR3A 3V8KA 4BKXA 3B37A 2EV5A 4LLNA 3FTVA 4LG0B 4LK1F 1DPUA 3CHOA 2EFOA 4ARFA 1W7PB 4EGZA 2MBFA 4Y13A 5FLXZ 5A2QK 3FUHA 1K7AA 3QU6A 2QBYB 3ZMTA 2XUBA 3TDUC 5A2QZ 2G7HA 3KEOA 3JSOA 2CO5A 2V9VA 3TO9A 3B7RL 5D4SA 3ML6A 1USSA 2L4MA 2JPBA 1FWZA 2FXAA 4OU0A 1J9IA 1ONNA 2QLZA 3Q5FA 3PQKA 2VBYA 3VODA 3M1EA 5DDGA 2DT5A 3A14A 2AXLA 1O3SA 1ZG3A 4A12A 2LDUA 1YQAA 2WTEA 1IXCA 3FTSA 4OOFA 1P4WA 5BQTA 2HDCA 4XNBA 3M8EA 4FX4A 1HXDA 3HTUA 3B3BA 3ECHA 4YFXF 1B4AA 2PQ8A 3ULQB 5JBIA 2FU4A 1IN6A 2HKXA 4OMZA 2E1CA 3F22A 4HLYA 2W24A 1G3YA 2ZBKA 2XAJA 5L3FA 2EK5A 3V4GA 2FE3A 4MNUA 4JQFA 2W57A 2RV8A 1LB2A 1RI7A 3R4KA 4U0YA 4DQ2A 2XKPA 3L2CA 2H6BA 1G5AA 2CG4A 5AIPA 4DNCA 1FC3A 2HZTA 4JNDA 2O03A 1ZG1A 1JGIA 1XMAA 5J8CA 1OMIA 3T0YA 2JRTA 2LKPA 2XAFA 4KUMA 3IKTA 4B09A 4L9VA 3GX4X 3JT1A 3LSTA 4KYWA 2FA5A 1R1UA 2EWNA 3HSEA 3B2PA 1YYVA 4I0BA 1W5SA 2DFIA 2GXBA 2R3SA 1FY7A 3CIAA 3DPLC 3GXOA 3F8CA 4O5VA 1IN7A 3FUJA 1U2WA 2DI3A 2OQGA 1R5GA 4ZZLA 4QUOA 2L01A 4XN4A 5D4RA 3K2ZA 2ESNA 5CVUA 1IXSB 3QRFF 2FMLA 2A5YB 4I98B 2L02A 3WU0A 1IUYA 4KIGA 5DUIA 4K5OA 1D5VA 2FSWA 5CVJA 3E6CC 2MLGA 1Z7UA 2NNYA 4WK8F 2PG4A 2JD2A 2RVCA 1H0MA 1MW2A 1OYYA 2GZWA 3T8RA 2VT2A 1G3WA 1P6RA 4FLOA 2Z99A 1FLIA 3MAJA 4UV8A 4WXHA 1DDNA 3FH5A 4FT8A 1Z9CA 2HEOA 2DQLA 2KIFA 5H6QA 1SD6A 2ZKZA 1ZS2A 5D8LB 1B9NA 3CUQA 2YR2A 3E97A 5FFZA 3AAFA 1P2FA 5JMPA 3CUOA 1K78B 2KJCA 3WE2A 1KU7A 4LJZF 4ESJA 1KYZA 2ZXJA 3CJNA 3E5QA 1EH7A 4ZX6A 1SFXA 5D5XB 4M6XA 5K5QA 1XCVA 4N9HA 3IC7A 1TW3A 3ANMA 2XGXA 3DFGA 2NRAC 4H0EA 3RIRA 1BC7C 5CLSA 1TQPA 3I54A 2CYYA 2IA2A 1D3YA 3E6BA 3V7CA 1B1BA 1HW5A 5CJ9A 3RC3A 1LJ9A 4IJAA 2DO7A 2PJPA 1TW2A 3FULA 3KP7A 5LBQA 4LB5A 4KN4X 2ZJ2A 2XAQA 3GZ6A 1SQMA 2XRNA 1FZPB 2HOEA 2XAHA 3GUDA 2VJ8A 5JR3A 5DULA 3IIEA 1RUNA 1XSXA 3HRTA 3FMQA 4KIBA 4ZQFA 4ZX3A 3CHPA 1R0LA 4XMWA 1CF7A 1S29A 3P7NA 4A6EA 1RP3A 2V6CA 5J8FA 3FHZA 4OOIA 2H27A 2HS5A 2STWA 2VONA 1PUEE 1YO5C 1B9MA 1HSJA 3CTAA 1XDUA 4RS8A 1R23A 1T39A 1YW7A 3BY6A 5HNFA 4Y6RA 1P4AA 4K5MA 3S2WA 4XN9A 1BIBA 5FO5A 1JXSA 1U3EM 2JD1A 3N4MA 4LK0F 1FBSA 4P9UA 4M74A 3E5XA 2DK5A 4I01A 1Q1HA 1Q0HA 4QPEA 2QVOA 2P5VA 5K5RA 2DQRA 4FX0A 2IA1A 1ZARA 3K1MA 2PN6A 1T0FA 3RASA 1TTYA 2PMHA 2BE5F 5DYMA 2R70A 3M7GA 4ZYDA 3K1PA 2E1NA 1OPCA 4BQAA 2FOKA 3CO6C 1UHWA 2JV7A 4AIKA 4OINF 1YG2A 3GLXA 1IXRC 3EYYA 5LRRA 3RKYA 1UHMA 4OMYA 2JTVA 2VOPA 2H94A 5E1XA 5FFXA 2DU9A 4XLNF 2ISZA 2A3SA 3FMSA 2ZNZA 3H3ZA 4K2EA 1S7OA 5ED4A 3L7WA 5E8IA 5DUKA 4Q47A 4WCGA 4CZZA 4AVPA 1JHFA 1ZRCA 3ZMSA 4CICA 4ASNA 1RNLA 3ZI0A 1BI0A 4G94A 4RB2C 2MD5A 3ABTA 1F1ZA 1XDSA 5LEJA 5HLGA 5D6EA 3B02A 3J81Z 2F5FA 3BJAA 1D8JA 1K78A 4A0ZA 4CHUA 1W4MA 4HX8A 3JSZA 1G6NA 4U0VA 2FRHA 2V1XA 1O3RA 1BI2A 3HYIA 3IRRA 4A0XA 4NB5A 4RSYA 5BMZA 1T2KA 1ZGAA 2K7LA 1RZ4A 5FWQA 3OV8A 2FQ3A 3WE3A 4L9NA 5F1RA 4I2OA 3GVAA 4LD5A 1LDJA 1IF1A 3DEUA 2YU3A 2OA4A 3FXUA 2G7UA 5E20A 3FH8A 4XNDA 2H6CA 1Y0UA 1LQ1A 5HLTA 2M8EA 2TDXA 2ELHA 4BHBA 5F64A 3WGGA 5ICEA 1H9GA 3CO7C 2A61A 2NAZA 1U78A 3ECOA 4ENMA 1F4KA 4EM0B 1O7FA 5ERIA 5LRSA 2FNPA 4XN2A 2DW4A 4P55A 1LDDA 1QGPA 4QIRA 3HRMA 2O3FA 3B34A 3PFIA 1MD0A 2F5DA 4IHTA 1WRJA 4R7LA 4AIJA 2UXNA 3V8LA 1KQ9A 1CF7B 2EJRA 1KU9A 4LB6B 5KK1A 1Z91A 3B7UX 1ONOA 2QVWA 2MA3A 1I27A 1ZLKA 1R00A 3VEPA 1LDKB 1I5ZA 4NHJA 1Q0LA 1BI3A 3TKYA 3HOSA 2CGPA 1EH8A 1JVSA 1W7PA 2KKOA 5HNHA 2Y48A 2MC3A 2D1HA 2F2EA 1QPMA 2HTJA 3C1DA 3EETA 3HOTA 5HLIA 2QWWA 2QZ8A 1BIAA 1IN8A 3JSPA 2PFBA 4Y67A 2UXXA 2IA0A 4ESFA 2M45A 4ON0A 1ONPA 2K4BA 5FGMA 2Y1GA 2OZ6A 4K5LA 4AICA 5E1WA 4M9ZA 1T1SA 1J75A 2JCYA 1B59A 3GWZA 3WGHA 5DCMA 3O6BB 3FZVA 3SZPA 4G7ZF 2ISYA 3FWEA 3ZPLA 2HYGD 2OAZA 5BPPA 1LVAA 5HS9A 1JG9A 3B7SA 3FUNA 3WTYC 3B7TA 5TRDA 4N0BA 3IL2A 4M9SA 3CHSA 4DPRA 2VLAA 1FBQA 3FX3A 1ZN2A 4JBAA 2RDPA 3B2XA 4RGUA 5L3CA 3F6VA 1S8NA 3L00A 1GXQA 5H20A 4HX4A 3HUGA 3LA2A 2LSOA 2GTQA 1XGMA 4OIOF 4UHTA 2NYXA 4RGXA 5EV7A 4PVBA 2CFXA 1TNTA 2O0YA 1K5HA 2XASA 3FF5A 3KP5A 2CWEA 2ZFWA 4XN8A 3I71A 3VFZA 1FPQA 4FLSA 3SFZA 3E5UA 2EFQA 4HYEA 1P4XA 4LGWA 2A68F 4A5MA 1R5HA 3L09A 5HS8A 4ZQHA 3KE2A 4J3BA 2D45A 4QHPA 4EJOA 1KA8A 3ANLA 3FTXA 1U8RA 3BDDA 2WV0A 3C18A 4EJVA 1BOAA 3Q9VA 3EUHA 4FHTA 1CGPA 1JE8A 4IVNA 2OU2A 4ZQTA 1KU3A 5K1YA 3EBHA 4CDGA 1H9TA 3SZTA 4AWXB 2BV6A 4AR1A 3U1DA 1GXPA 1U5TC 2P6SA 3B73A 4YFNF 3KETA 1WSUA 3HHHA 4RCVA 3MZHA 3R0AA 1DUXC 5LHHA 3REOA 3WTXC 2GA1A 2RGVA 3G73A 2CQKA 1GW6A 3HHGA 4O6JA 4ENJA 2RNJA 2X0LA 3KFWX 2Q2EA 2L3DA 2COMA 3JW4A 2WZFA 4Q4ZF 1XGSA 2Y1DA 4HV5A 2IW5A 3EQLF 4WF2A 1KU2A 5TJJA 4RAZA 2MH9A 4N9IA 4MGRA 1TQMA 3WTTC 4L9TA 4PCQA 1HS6A 2BEOA 4WX9A 3LFKA 1SD4A 3NQOA 2GXGA 1FSEA 1RUOA 5AONA 2KIMA 4L5JA 3FU0A 1YW8A 1OYWA 3GZ5A 3ZN1A 1HKQA 1VTNC 2W85A 3CZEA 1ZH5A 4M72A 2ZMEA 3CUQC 5D5VB 1ZGJA 2VE8A 3CUQB 3MFKA 1E2XA 1PDNC 1YS7A 4XMVA 4G6QA 4KN7X 3GFIA 1XMKA 4HQMA 4L0ZB 4ZX5A 1STZA 2EV6A 3TDZC 5KVRA 3I5UA 3F72A 4QMEA 4K5NA 1DPRA 2DBBA 4G7OF 3ZHZA 1BM9A 3R0JA 3ELKA 5CVRA 4HDUA 1O7LA 5ILVA 4ZX4A 4I0AA 3LWFA 3FUIA 2ZCWA 3L9FA 4FLQA 2EFPA 2HPTA 2BGCA 4HLXA 1J2XA 2J5OA 2A6HF 1D8KA 3D0SA 2L54A 2XKOA 2LF7A 2Y1FA 5BPDA 2GIVA 4PGGA 5HDNA 5ILSA 3ZMVA 4MTEA 2Q8KA 3TOBA 1Z6TA 2GAUA 4XSXF 1WWXA 2ZMEB 3Q43A 1FSHA 1JGSA 3I64A 1XCBA 2XVCA 5DCFA 3JTHA 2O7GA 4G7HF 4KIFA 3RPQA 2XV4S 4ZZDA 2K02A 5HOOA 1FP2A 1IZ1A 3KZYA 4R8HA 2HTSA 2EA2A 4XMXA 1I6XA 4Y6PA 1R1TA 1V3FA 3DPTA 2OD5A 4UXNA 3W6JB 3AU9A 3RKXA 5D8KB 4AR8A 4RB3C 4P5OA 4I7HA 3FUKA 4U7DA 1T98A 3JAMK 1XGOA 2WWYA 4S04A 1V4RA 4HDVA 2BYVE 2RKHA 3HSFA 1SFUA 1LNWA 3JAMZ 3FU6A 3FXRA 3WTSC 1H19A 3BOQA 5DLLA 3O3KA 4WXDA 2D1VA 2FNAA 3BPVA 2DPDA 1IN5A 3DV8A 2R7DA 3DKWA 3FU5A 1Z05A 2MAOA 3IHUA 2O61A 4O3MA 3I53A 4KNYA 1XGNA 1XD7A 3R0IA 5L3BA 3WTWC 3GFJA 4UV9A 3C7JA 2QENA 3E3VA 2EB7A 3MEXA 1HBXG 4WXCA 2VC1A 5L3DA 1FNNA 4JK1X 2W25A 3EYIA 3BPXA 3EBIA 1USTA 4PDKA 5DEQA 1L0OC 2HFHA 2VT3A 1HSTA 1R0KA 3MZYA 4CXFA 2O6GE 4NQWA 1EV7A 3MCZA 4A2UA 1R58A 3DXJF 1MJAA 2D2WA 3G3ZA 4XSZF 1FT9A 3MQ0A 5L3EA 1FOKA 3J81K 1XSDA 3LA3A 3GYHX 3I59B 1T38A 1ONVA 4M9XA 3ZMZA 1R1VA 1OR7A 2PBIA 3WQRA 4E70A 3HRSA 4K5PA 4ZN6A 2RC4A 2PLYA 1S7AA 3JTGA 4XO5A 4XRFA 3CZLA 1UB9A 1X3UA 4ENNA 1PP7U 1BBYA 3U9WA 1R7JA 4EJTA 3LAJA 4EGYA 3H3UA 1XSVA 3HSRA 1K6OA 4R5XA 2GWRA 5FD5A 3IKVA 2ETHA 3LQQA 4ZYGA 4UVCA 4HV6A 2C5ZA 3F3XA 4UVBA 1SG7A 1SAXA 1FYMA