3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transcription regulator/protein binding
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
2F5CA 3ABUA 5FGMA 4G9YA 1JGIA 5DD4A 2JT1A 2G7UA 3FZVA 3E5UA 4U0WA 4EMSA 3P9KA 5AIQA 1CF7A 2DK5A 2OQRA 2DBBA 5FLXK 5BMZA 4EJTA 3GWZA 2RV8A 2QLZA 2O8XA 1QGPA 2C82A 3RTRA 2W24A 1YW7A 2P7CB 2DQLA 2DI3A 4UV9A 1LEBA 2OZ6A 2VC1A 4ASNA 2D2WA 2MD5A 1Y0UA 4MGRA 1IW7F 4KT5C 4ETSA 2FE3A 2IRFG 4YIIA 1Z05A 4LB5A 1UCRA 3REOA 4Y6RA 1XCBA 4L18B 1R23A 1WKMA 5HVQC 2CFXA 1CGPA 2ESNA 1YS6A 1WRJA 2XAFA 3J80Z 3KP6A 2EV6A 2FBHA 4ZZLA 4O6JA 3ZPLA 4GCVA 4AIHA 2PN6A 3EYIA 3M9AA 2KIMA 5E18F 3RPUA 3BJOA 4CYDA 1FYMA 2O0YA 3Q9VA 4ZZDA 1O3SA 3MQ0A 3ZN1A 4EGYA 1XSDA 3WE3A 1BI3A 4A0XA 2XV4S 1OYWA 1EH6A 2HDCA 5L3GA 3ZN0A 4L0YB 2EFNA 4FLQA 4ZQEA 2XUBA 3WQQA 4KIGA 1O3TA 1F1ZA 1K79A 3NEUA 3JTHA 1BBYA 4Y17A 3PQKA 4JK1X 4BH9A 5JAZA 2BV6A 3I5UA 1PDNC 5LEJA 3L9FA 4GGGA 2JCYA 1LJ9A 4M9ZA 1YQAA 4P55A 4MHGA 3E6BA 2CGPA 3WODF 2F2EA 2XAHA 2CWEA 5LGUA 2FBIA 3T1BA 3N4MA 1IN6A 3CUQC 1WQ2A 1B1BA 2ZO4A 4FX0A 2KJBA 2RVCA 1WSUA 3PQJA 2QWWA 4OMYA 2ZKZA 2BEOA 1XDUA 3O2PE 1HW5A 3HOSA 5BPDA 4WX9A 1MZBA 3ML6A 1EV7A 2JPBA 2IA1A 4EM1A 2L54A 5JVTA 3H92A 3DKWA 4BNCA 1SMTA 3FX3A 1I1GA 4LLGF 2FQ3A 1XSVA 1P4WA 3I58A 3F21A 3GVAA 1I27A 4LB6B 3QPHA 3BDDA 1ULYA 5JHUA 2Y1CA 5DCFA 4YIFA 1Z91A 1TLHB 2EV5A 1RUNA 4FLSA 1ZLJA 2VN2A 4ZQFA 4A6DA 2ADUA 3ERED 2D1HA 2NS0A 4JQFA 3K0LA 1G3TA 1EH8A 4MQVA 4HYEA 3CZLA 3DPTA 3VEPA 1LDKB 3LQQA 4Q48A 1BM9A 2EV0A 2KJCA 2J5OA 4LK1F 3EETA 4K2EA 3BJ6A 4RAYA 4AD9A 1FT9A 3F8BA 3W6KB 4RB2C 4OOIA 3MAJA 3RPQA 1I6XA 3RI4A 4HF2A 3CUQA 3EYYA 3KE2A 4UHTA 3GFMA 5LLQA 5L3CA 1IAWA 2BYVE 3R4KA 2DQRA 4EGZA 1U5TC 1MW1A 2OD5A 5D5UB 1ZAOA 2YX4A 4Y6PA 3SZPA 1GXPA 1Z7UA 1MW0A 2FF4A 4KMUX 2VBWA 2Y48A 2WWYA 3C3WA 1OR7A 4FX4A 4I2OA 2XHKA 4ESBA 1ON1A 2KKOA 3RASA 1DPUA 1D8JA 3KEQA 4Q47A 3T8TA 1JGSA 4UNOA 2ZFWA 2ZNYA 4R79A 5E8IA 1R1VA 3HUGA 3I59A 1ONPA 1ZGAA 3B73A 3QPTA 3V4GA 1YYVA 3QOPA 2UXNA 3DXJF 3E6MA 3HRMA 2VODA 2DAOA 1IZ1A 1UHMA 4EJUA 3GF2A 5HS9A 2QVOA 2HYGD 1B59A 4RB3C 2YPRA 3JAMK 1TTYA 3KLNA 2HS5A 3GFIA 1LNWA 2P5KA 3LA7A 2PJPA 3M8EA 3LA2A 3HSFA 4HLXA 3L00A 2JZYA 4LLNA 3K2ZA 4BAYA 5BQTA 3IWZA 3EQLF 4DNCA 2Z9OA 1FC3A 3C1DA 2GIVA 2DU9A 3LFKA 2XRNA 3TQNA 5E8GA 4CDGA 4IPAA 3LQRA 4A12A 3S2WA 4B09A 3R0JA 4KIBA 1IXCA 5JFRA 3GZ6A 1R0LA 2OBPA 3L2CA 4LJZF 3WTWC 4RS8A 1K5HA 1S6LA 2PBIA 1OYIA 1K78A 1W7PD 1FYKA 1KQ9A 5F6FA 3ZHZA 5BPIA 4NB5A 3HYIA 4WWCA 1R36A 2EFWA 3CZKA 3E6DA 1T6SA 1H3LA 2Z3YA 1KU9A 2DPUA 2LSOA 4QWQA 4KFCA 5CJ9A 1SD4A 1Q0LA 1S7OA 4KIFA 2EFQA 3FM3A 3GW2A 3ZI0A 3L09A 2QM3A 2HR3A 2PEXA 5L3FA 5H6RA 3V8LA 1TW3A 3J81K 3UEQA 4OMZA 1OYYA 4Y6SA 1HQCA 3K69A 1JG9A 2A5YB 4MQ9F 3WQSB 4KN4X 4I02A 1IUYA 2BBYA 1J2XA 1LEAA 1G4DA 2QQ9A 1LQ1A 4L9NA 2XKPA 1R7JA 2VT3A 2XAGA 3N97A 1E2XA 1J7KA 1ZREA 5E1XA 4A2UA 4L5JA 1FX7A 3QAHA 4HF1A 1WWXA 4G7HF 5ICGA 1X3UA 1KYZA 4R8HA 2ZJ2A 5TJJA 1YTYA 5FO5A 2VC0A 1FBUA 1G3WA 4OINF 3RDIA 1TQIA 3HSEA 5E20A 5CVRA 3RKWA 5DUIA 1IN7A 1RZ4A 3G73A 2O3FA 2OQGA 5JO0A 1XGNA 4IHSA 3A14A 1ZARA 4A0YA 2E1NA 3ANNA 1ZH5A 1W4MA 2WV0A 5LEKA 4LD5A 3GYHX 4H0EA 2DO7A 2XROA 2CO5A 3SFZA 4AWXB 1S46A 1REPC 4GO1A 2ACJA 1A04A 4AYSA 1IRGA 2Z99A 2FSWA 3BJAA 2IP2A 3F8FA 2UZKA 1W7PA 3R60A 5DEQA 1U78A 4MNUA 1DDNA 3J7AO 5CVVA 2RKHA 1MW2A 1BIBA 5JNLA 3GZ5A 1T98A 3MZYA 5FFZA 3RYPA 2Q2EA 2PG4A 1YFHA 1KQ0A 1R1UA 4RGRA 2BGCA 3P7NA 3RJPA 1S3JA 2QYOA 1C0WA 4IHTA 3KLOA 3ULQB 2YR2A 4EJVA 1PP8F 2K4JA 2MLKA 2QUFA 3GXOA 1SC5A 2A69F 4TV7A 5HS7A 5CVUA 1L0OC 4E70A 4OIOF 3WG9A 4HOBA 2HTJA 5TRDA 3F8MA 4ON0A 5D8LB 3ZMZA 4BHPA 1LB2A 3HIFA 3IKVA 2Q0OA 5JBIA 4LGWA 3KP4A 2V9VA 2ISYA 2QBYA 5CVIA 4IF4A 2ZXJA 5D5WB 1ZLKA 1V4RA 4M6YA 1T39A 1T2KA 4YFKF 1O7FA 3KP2A 3WTUC 1D8KA 1R0KA 1STZA 4KP7A 2W85A 1YIOA 1HW2A 1AOYA 4RGUA 1ONNA 2JD0A 4S04A 4LLLA 1HW1A 1CF7B 1H9TA 4WF2A 3TOBA 1IN8A 2EK5A 5HOOA 5F64A 2VOPA 3IIEA 3MFKA 2M1BA 4PGHA 5H6QA 1G3YA 4M9SA 3RYRA 4PGGA 2K27A 2EA4A 4ZN6A 3K1PA 5ERIA 1RI7A 4WXCA 2IPQX 3EUHA 1G3SA 1QZYA 2K02A 2VONA 1TNTA 2M30A 2V6CA 1DUXC 3WTXC 2GA2A 2KRFA 2CYYA 1EH7A 3UCQA 3DP7A 3HRSA 4OIRF 3QU6A 3CZGA 3F8CA 3I4PA 1YO5C 2NNNA 1YW9A 4I98B 2E7XA 4RGXA 1U2WA 3SHFA 2HGCA 3IRRA 5E17F 4I7HA 3E5XA 1BN5A 3ZMSA 2M87A 1ZGJA 2O61A 2V1UA 2MAOA 3WGIA 4I0AA 2HEOA 2FMLA 1ZG3A 4ZYHA 1KYWA 5KVRA 2EGHA 2X0LA 4HF0A 5DCMA 1UB9A 4P9UA 3T5XA 2L3DA 1MGTA 2JCXA 4M71A 1H0MA 3KZZA 3HSRA 3KZYA 3BZ6A 2DT5A 3CUOA 1RP3A 1S8NA 2PMUA 3E97A 3QP6A 1WI9A 2OAZA 4A5MA 4JBAA 5BS6A 4Z2YA 4F7ZA 3FWEA 4LK0F 5DD8A 3K1NA 2Y1FA 4L9VA 1O3RA 4MTEA 3WGHA 4WXDA 1R5HA 1MD0A 1FPQA 3WGGA 4L9JA 1XGOA 2PLYA 3WU1B 4P96A 4FT8A 3R61A 4L9TA 2J5PA 2LDUA 5A2QZ 1XD7A 2MH2A 4UVBA 2Y1EA 2R7FA 2Y0MA 3IL2A 4HBLA 3V7RA 3LSTA 4CICA 3GLXA 3K9TA 4A6EA 3JW4A 2A07F 4OU0A 5FD5A 1B9MA 2IA0A 3Q9SA 3V7SA 1P2FA 3HHHA 4AIKA 4FLRA 4IJAA 4OOFA 3M7GA 3HOTA 4HX4A 2CG4A 3ZHXA 3VOEA 3KP3A 4LUPA 5DYMA 4ENNA 1P92A 3ZQ7A 5ILUA 1MW3A 2FEZA 4GXOA 2VBZA 4YG2F 2MLGA 4WCGA 3L7WA 5J8FA 1MVYA 3HHGA 1YW8A 2DFIA 5H20A 5LBQA 4N9HA 3QRFF 4ZQHA 4LG0A 5JC1A 3HRUA 1LDJA 2XAJA 5HLHA 2GWRA 5CVJA 3SZTA 1ZRCA 5D8KB 4Y13A 1XDSA 3MEXA 1IF1A 1KU7A 3BROA 3R6SA 1KQ8A 4G6DA 2EB7A 3GO5A 3MZHA 5EEHA 3TO9A 3G3ZA 3F6VA 4RGSA 5IT9K 4I01A 2NNYA 3CUQB 2NYXA 2JPCA 3U1DA 2W84A 3ABTA 3WQRA 5BOXA 5KK1A 2CW0F 1ZN2A 5D4SA 3EDPA 4IVNA 4D0PA 2HOEA 5AONA 4OIPF 4EVIA 4UUVA 4UV8A 4HV5A 3IRQA 1U5TA 2XIGA 3ZMVA 4AIJA 4ENJA 1BI2A 1FP2A 4G6QA 2K7LA 1HKQA 1JE8A 4P5OA 4I09A 3P9IA 4BHBA 2UWMA 4P9FA 2ZMEA 2RC4A 1XCVA 5LHHA 1ONOA 4ZH4F 3BWGA 3I59B 1XMAA 4LG0B 4L5IA 3FXQA 2L01A 1U8RA 5ED4A 3R0IA 1NHAA 1FSEA 4CZZA 4ENKA 4MEXF 1KU2A 1Q1HA 5D6EA 2V1XA 1W5TA 3JTGA 1UHWA 3SQNA 4HLYA 3WTSC 2M5WA 1FNNA 5CYVA 3JAMZ 3ECHA 5JR3A 1HSJA 2RQPA 3B02A 4Q4ZF 4Y15A 1ZS2A 2MC3A 2FRHA 3KCCA 4RB1A 3ANLA 4IRIA 1SD6A 1G6NA 3ZHYA 1R58A 4ESFA 3D5LA 1QNTA 1QZZA 3Q5FA 4BHCA 1JVSA 4XRFA 3A06A 1IN4A 1P4AA 3VB2A 1SD5A 1MKMA 3UERA 1ZG5A 1FYLA 2D45A 2PI0A 2IA2A 2H09A 5F1RA 2DK8A 4PDKA 1IRFA 1HKTA 1F5TA 3I0TA 3OOPA 1DPRA 3JSOA 4EQQA 2MAPA 2JD1A 2DPDA 4HW0A 2P5LC 5L3EA 2CQKA 3QU3A 2AXLA 4WK8F 1J75A 4Y67A 4A5NA 2LNBA 3GFLA 2ZMEB 5ILSA 3FHZA 2X4HA 4HX7A 4UXNA 1BIAA 2M8EA 1K78B 1OMIA 1TBXA 1QO0D 2JD2A 2VBXA 4ESJA 4EM0B 2A6HF 1D5VA 1UFMA 3RIRA 1B4AA 2EWNA 3CO6C 3ZMUA 4MTDA 4PCQA 5FFXA 1SFUA 3J81Z 4R1HA 5K5OA 2ETHA 3CLOA 2VXZA 2DW4A 1FOKA 2COMA 2GXGA 1ON2A 5EEGA 4U0YA 3ISPA 3M1EA 1SFXA 2H6CA 4IRHA 3J80K 4U0VA 4GYGA 2RNJA 1Z1DA 5D5XB 3ZP5A 4ZYGA 1TQMA 1FLIA 1U6GA 2P4WA 1KGSA 4XLPF 2QENA 3H3UA 4HV6A 3CJNA 2LKPA 2ZCWA 5E1ZB 2FOKA 2V1DA 4UVCA 3GX4X 2HQNA 4WXHA 2IT0A 4XSZF 4N9IA 2VT2A 4EM2A 2WTEA 2HQRA 2VE8A 1G5AA 3VODA 3BOQA 3I53A 4BQAA 1R1TA 2YSRA 3WTZA 2P8TA 2MH9A 3IKTA 1I5ZA 1MJ9A 3F8NA 1XGMA 1F9NA 1T38A 5JMPA 3BY6A 4HQMA 3P9CA 1J9IA 4N0BA 3F23A 2HWVA 3F6OA 1FZPB 3TKYA 5CLSA 2C6YA 4M6XA 2CSOA 2FXAA 2VBYA 2W25A 2LF8A 3ECOA 4NQWA 5HS8A 1K6OA 3TO7A 1F4KA 4L0ZB 1W7PB 1XMKA 5J6XA 1FBSA 3FF5A 1PUEE 1TQPA 2Q8KA 3BPXA 3DV8A 1IXRC 2IJLA 2L02A 1HSTA 4IRGA 1MDMA 1D3YA 2HFHA 3NQOA 1TNSA 3DEUA 5FLXZ 3I71A 4UVAA 5K5QA 3E6CC 4M9XA 1JHFA 1ZRFA 2A3SA 4NHJA 1ODDA 3T8RA 2FU4A 4KYWA 3PFIA 4RAZA 4HX8A 2G7HA 3E3VA 1ZYRF 1GVJA 2H6BA 1QPMA 1HBXG 2FBKA 2OA4A 4EV0A 1T1SA 3CO7C 4G7OF 4ZYEA 2XAQA 2Y1GA 2UXXA 3FXRA 3MWMA 2FNAA 1USSA 5HLIA 4CO8A 4GAEA 1E17A 3FMRA 2YU3A 1ZHFA 2HTSA 3WTVC 4G7ZF 1SAXA 2MBFA 3HTSB 3AU9A 4M73A 2W57A 3GEZA 2GQQA 4U7DA 2JTVA 1Q0QA 2QBYB 4YFXF 3O3KA 2A61A 2STTA 3FMSA 1YS7A 2KIFA 2P6SA 3COAC 3CZEA 5LRSA 5A2QK 1O3QA 3C7JA 2O7GA 5L3BA 2E7WA 2P5VA 3SXYA 2YX7A 1RUOA 3AAFA 1R00A 1KU3A 4MEYF 1MDMB 2XKOA 1L3LA 2K86A 1RIOH 1IN5A 3TDZC 1RNLA 4HA8A 5ILVA 4ZQGA 3GUDA 1R5GA 3W6JB 2RN7A 3WU0A 2EFOA 2GA1A 1XN7A 5LHIA 2G9WA 3I64A 3ZMTA 2NAZA 5HDGA 3T0YA 5JI6A 6PAXA 4EJOA 4O3MA 4EJWA 1BI1A 2JRTA 1B9NA 2STWA 4FHTA 2VOOA 1S29A 3F22A 2F5EA 1MJAA 1DP7P 1USTA 2NRAC 3LAJA 3U9GA 3V7CA 2E1CA 1HXDA 4LMYA 1P6RA 2D1VA 2FNPA 1OKRA 2H27A 4IXAA 2GAUA 1SMYF 2Z33A 2HKXA 4XBFA 2ZBKA 2R7DA 5HLGA 1LDDA 1Z9CA 3TOAA 4DQ2A 4HAMA 3WTYC 5E1WA 2GZWA 1ZRDA 2L4AA 2PMHA 3AUAA 2BE5F 4KA4A 3U2RA 2XVCA 3DPLC 3IWFA 4M74A 4LFUA 3KP7A 1GXQA 3ELKA 5FB2A 2HZTA 2M45A 4RCVA 5D5VB 1BC8C 3I54A 5LGNA 3TO6A 4FLOA 5ICFA 1J5YA 2XASA 2L4MA 5DCMB 2F5FA 4CGZA 1GHCA 3F3XA 4G8XA 5JMWA 2GXBA 1HKSA 5D4RA 5J8CA 4S05A 2WC2A 4RB0A 1P4XA 4AVPA 2ELHA 1V3FA 2Y75A 3LAPA 3OV8A 4ZYDA 3IC7A 3FXUA 5IT3A 1BC7C 2QZ8A 2A68F 3R0AA 4HDUA 4KN7X 2KIUA 1ZG1A 2WPGA 1VTNC 2ISZA 4KICA 5L3DA 4YFNF 5HDNA 2OU2A 3MCZA 4KDPA 5LRRA 5DDGA 2EA2A 4I0BA 2R3SA 1OPCA 1H9GA 3WTTC 5K1YA 3DQVC 2V79A 3ANMA 2P6TA 2LF7A 3V8KA 1T1RA 4PZJA 4KUMA 1O7LA 1QBJA 2QQBA 3D0SA 3O6BB 4XLNF 1W5SA 1Z6RA 1KA8A 4G94A 1LVAA 5ICEA 3FMQA 1TW2A 1B6AA 5DV5A 4M72A 3BPVA 3M8FA 3KFWX 1FBQA 3KEOA 1T0FA 1FWZA 3ZMDA 3CTAA 2RGVA 2B0LA 4AICA 4HZFA 2EFPA 4GYIA 2VE9A 1JXSA 2A6EF 1IXSB 2O03A 2ESHA 3RKYA 3GFJA 3LWFA 2XGXA 1XGSA 3TDUC 3FM5A 3QP5A 2RDPA 1PP7U 2PQ8A 2K4BA 5IT9Z 5LGTA 1QQIA 4U7BA 2JSCA 3ROUA 2PFBA 3DF8A 1Q0HA 2HYFA 1FY7A 4U88A 4HDVA 1BOAA 2DLLA 2IVMA 5D6FA 5HDKA 3NRVA 4B8XA 1AWCA 2FA5A 4QLCU 5ICCA 1FSHA 5LHGA 1S7AA 4XSXF 4OOEA 1XSXA 3VFZA 2H94A 1O57A 1SFEA 1ONVA 2P7VB 1U5TB 3BP8A 1U3EM 2Y1DA 3LA3A 5AIPA 2AS5F 2EJRA 3DFGA 5DUKA 1YLFA 1J59A 4CHUA 1SD7A 2Z5UA 3KP5A 1Z6TA 3E5QA 1YG2A 3AU8A 3HTUA 5FD6A 3TGNA 3CDHA 2ZNZA 4HQEA 4A03A 2QQAA 3C18A 1BJAA 2HKOA 3F72A 1I1SA 1MJBA 2JCVA 3K1MA 2TDXA 3KETA 3JSPA 2FMYA 3IHUA 4ENMA 1FP1D 4CXFA 1K7AA 2IW5A 2MA3A 3RKXA 4Q5SF 2DTRA 1XB4A 4A0ZA 4KNYA 3HRTA 3WE2A 4BYYA 3H3ZA 2O6GE 4OIQF 2F5DA 1JHHA 1BI0A 4O5VA 2OZUA 5DULA 1R22A 3V8JA 4KMFA 5K5RA 1J0RA 4BXUA
chains in the Genus database with same CATH superfamily
4MFEA 2E71A 2F5CA 2GXAA 3ABUA 1MMSA 5FGMA 3AL0C 4G9YA 2MW8A 3SDBA 1E3HA 1JGIA 5DD4A 1LPQA 2JT1A 4ZW5A 2G7UA 1ORKA 1TT0A 2ZXWH 3E5UA 3FZVA 4U0WA 4EMSA 3P9KA 5AIQA 1CF7A 4CSWA 4E7LA 4QMEA 2DK5A 1JTXA 3MKLA 1VQ9I 3I4NJ 3FUMA 1WH7A 3EUHC 3ZQQA 1QHGA 4XNAA 2K40A 2KP6A 2OQRA 2DBBA 4V2FA 5FLXK 5BMZA 4EJTA 5KAIC 2NS7A 3GWZA 3BTLA 2XPWA 4HSRA 1NG6A 4RAGA 1MBJA 2RV8A 3L2UA 2QLZA 1MMDA 2QKMB 2O8XA 3B7RL 1QGPA 1D0YA 2C82A 3RTRA 4K5PA 1IJWC 2W24A 1YW7A 3GTLJ 2P7CB 2DQLA 2DI3A 4UV9A 1NG7A 1LEBA 2OZ6A 2VC1A 1ZELA 4ASNA 1WI3A 2VPLA 3VVMA 4N4NB 1VQOI 3S1NJ 4RBOA 2VUMJ 1K4SA 2KPMA 5EZHA 4QIRA 4CCJA 4BQOA 2D2WA 2MD5A 3TW6A 1Y0UA 4DPRA 4MGRA 1IW7F 2B9SA 1PJRA 4KT5C 4ETSA 2FE3A 2IRFG 4BJ6C 2AHQA 4YIIA 2OCEA 1Z05A 3FDYA 4LB5A 3ZQFA 1UCRA 1HCRA 2V9PA 3REOA 3GTJJ 4IOCF 2DA4A 4Y6RA 1XCBA 4QSHA 2CUFA 1MIJA 1R23A 5B3SH 4L18B 1WKMA 5HVQC 4XRSA 2CFXA 1CGPA 2ESNA 1IGNA 2R93J 1YS6A 1WRJA 3HG9A 2XAFA 2JRMA 3J80Z 3KP6A 2EV6A 2FBHA 4KT6A 4ZZLA 4O6JA 1S72I 1X2MA 1F36A 3ZPLA 4GCVA 3GTKJ 3JSZA 4AIHA 3VYSB 4QIWN 4B48A 1UZCA 2FJ1A 2R7TA 2PN6A 3EYIA 4A93J 5EJCA 3G71I 2CUJA 3M9AA 3EUAA 2VI6A 2KIMA 2W1OA 3CIAA 3OR1C 5E18F 3RPUA 3BJOA 3VSLA 4CYDA 3ERMA 2R7WA 1FYMA 2O0YA 3Q9VA 4ZZDA 1O3SA 3MQ0A 3HOUJ 3ZN1A 4EGYA 2F4OB 3LSGA 1XSDA 1XC5A 3WE3A 1BI3A 2O5RA 4A0XA 2XV4S 1OYWA 1UMQA 2Q1ZB 1EH6A 3JREA 2JWTA 5L3GA 3AFHA 2HDCA 5IP7J 3ZN0A 3PFYA 5GAGJ 4L0YB 2EFNA 4FLQA 4RAFA 1FTTA 4ZQEA 2GOMA 4MLOA 4RA2A 3Q0UA 2K3FA 4RMNA 2XUBA 3WQQA 2E5NA 4KIGA 1O3TA 1F1ZA 3E0JB 1K79A 3NEUA 1YI2I 3JTHA 2QF7A 2DTZA 1BBYA 4Y17A 3PQKA 3QQAA 4JK1X 3CDLA 4BH9A 1VQ8I 2ZXGA 1WFXA 5JAZA 2BV6A 3I5UA 3J7AY 1UG0A 1JGGA 1PDNC 1SEUA 5LEJA 1Z0XA 4DBRA 4X2UA 3L9FA 2Z2SB 4GGGA 2JCYA 1LJ9A 4R5TA 4M9ZA 1YQAA 2LTPA 4XRMA 2QCOA 4XO4A 4P55A 2XB0X 4IHVA 2NS8A 4MHGA 3FULA 3E6BA 2CGPA 3WODF 4BACA 2F2EA 2XAHA 3SDGA 4M3BA 3UNGC 2E2HJ 2CWEA 3K6GA 2DMNA 5LGUA 2BY2A 2FBIA 4RSYA 2EZHA 3T1BA 1IN6A 3CUQC 3N4MA 4BXXJ 1WQ2A 1QHHD 3DBLB 2F5VA 1B1BA 2ZO4A 4FX0A 2KJBA 1Z77A 2EH3A 1OCRH 2GOXB 2RVCA 1WSUA 3PQJA 2QWWA 4IEJA 5E3OA 4OMYA 2M9HA 3CC2I 4PSWA 3LMMA 2ZKZA 4XRSG 3OYAA 4NQWB 1N25A 3FBNB 2BEOA 2R59A 1N77A 1XDUA 3O2PE 1X3ZA 4XKWA 1HW5A 3DBHB 3OWTA 3HOSA 5BPDA 2DFHA 1HLVA 4WX9A 1WJAA 1MZBA 2OUMA 3ABMH 4W1UA 3ML6A 1EV7A 2W4SA 4ZDPA 2JPBA 3HL2A 2IA1A 3BR1A 4EM1A 4BKXA 1B8IA 2PGGA 2L54A 3A03A 5JVTA 3H92A 3DKWA 4XN3A 4K5LA 4BNCA 3B3BA 1R6RA 3OYLA 1SMTA 3FX3A 1I1GA 4LLGF 2FQ3A 1XSVA 1P4WA 2JV7A 2XGEA 3I58A 4C9YA 3F21A 3GVAA 4XLCA 4CCLA 2MG4A 3DKXA 1I27A 4F52A 4LB6B 4PVBA 3QPHA 4BXUA 4DOZA 3BDDA 1ULYA 4RM3A 5JHUA 2Y1CA 4KITB 2PMZA 5DCFA 4YIFA 4J01A 2ZSIB 1Z91A 3ASOH 4ANJA 4BY1J 3A01A 3L2RA 1TLHB 2EV5A 1RUNA 3RC3A 2OCCH 4FLSA 4V2GA 1Y6IA 3HOZJ 3GTOJ 1ZLJA 2VN2A 4ZQFA 4A6DA 2ADUA 3ERED 2D1HA 4XOTA 1E3PA 2NS0A 2KT0A 1WVRA 2IGKA 1MH4A 4LITA 2XSJC 4JQFA 3M8JA 3FTVA 4PJJA 3K0LA 3EBGA 1LVKA 1G3TA 1EH8A 3OYBA 4MQVA 4ZJZA 4HYEA 4DYCA 3CZLA 4BUPA 1XTAA 3DPTA 5FKMA 5IY5H 4G12A 3VEPA 5GADJ 1LDKB 3LQQA 4Q48A 1BM9A 3WHCA 1ACIA 3WU2C 2EV0A 2KJCA 1W36D 4F3QA 2J5OA 5FROA 4LK1F 1V55H 3EETA 1Z3XA 3TP3A 4QUOA 4K2EA 4B3XA 1W36C 3BJ6A 4RAYA 4AD9A 1FT9A 3F8BA 2MFZA 5FLVA 3W6KB 4RB2C 2ELJA 4ITVA 4YELA 2F48A 3BG7A 4OOIA 5J4VA 3MAJA 1QPIA 3RPQA 3OS0A 1I6XA 3RI4A 2L0KA 4HF2A 3CUQA 3EYYA 1JKOC 3KE2A 4F93B 5F04A 4UHTA 4K5NA 1V5FA 3GFMA 3DCFA 2L7FP 4NUBA 5LLQA 2IS4A 2V7FA 5J4YA 5L3CA 1IAWA 2BYVE 3BCAA 4L2LA 3R4KA 2AO9A 2B7EA 2DQRA 1SANA 4EGZA 2JMWA 4U87A 1YOVB 1U9OA 3FU5A 1U5TC 2H8RA 1YHQI 1MW1A 3PSFA 1TWFJ 5K7FA 2OD5A 5D5UB 3OYIA 1ZAOA 2YX4A 4FCAA 3A4CA 2VKHA 4BBSJ 3G1OA 3B7SA 4Y6PA 3PO2J 4ZX5A 2E35A 2GTQA 4XNDA 5E79C 2JJ7A 3SZPA 1GXPA 1Z7UA 2ZMEC 1SVOA 2VKVA 1MW0A 2FF4A 2JUCA 2LG4A 4KMUX 2VBWA 2Y48A 2WWYA 3C3WA 1OR7A 4FX4A 1EF4A 1OISA 4I2OA 2XHKA 3BG6A 4ESBA 5KAFC 1BR2A 4B47A 1X1PA 1ON1A 2KKOA 2UUZA 3RASA 1HS6A 1DPUA 1D8JA 3KEQA 4Q47A 3K4JA 3FH5A 3T8TA 3S32A 1JGSA 3CC7I 2KZGA 4UNOA 2ZFWA 2ZNYA 4R79A 2X48A 2M7BA 1R1VA 5E8IA 4PJ0C 3HUGA 3I59A 4HPQA 1ZGAA 1ONPA 1BL0A 3B73A 3PNYA 2Y30A 3QPTA 3CHRA 2F4MB 2O9LA 2NVXJ 2KDOA 5EYRA 3V4GA 1YYVA 3QOPA 2CV2A 2UXNA 4ZTFA 1S7EA 1EJ9A 2ECCA 3DXJF 3E6MA 3HRMA 4AC0A 2VODA 2DAOA 2EZIA 1VFCA 4LIUA 4AUXA 1YJWI 1LKXA 1IZ1A 1UHMA 1Z3YA 2VPRA 4EJUA 4CYCA 3UKGA 4IL6C 3GF2A 2R7XA 4A69C 2LFBA 2OF7A 4JX5A 1ETWA 3BR3A 2PMZN 2ZFUA 1Y8QB 4CCMA 3PIOF 3S3NA 5HS9A 2QVOA 2GLOA 2R5ZA 2XSDC 2HYGD 1B59A 4RB3C 4XK4A 2YPRA 1YJ9I 1EA3A 1X58A 3JAMK 1TTYA 2LY1A 3KLNA 2R0QC 4XMWA 2I5UA 2HS5A 2OC6A 3IAS2 1LNWA 3GFIA 1JTYA 4C2UA 2B63J 2P5KA 3LA7A 2G0EA 2PJPA 3CLQA 3M8EA 2WAEA 3LA2A 4BEHA 3HSFA 4HLXA 2DDAA 4XICA 3K4MA 3IAM2 3L00A 2JZYA 3K2AA 4LLNA 3K2ZA 4AYBA 4BAYA 5BQTA 1K83J 3IWZA 1MBFA 4A3JJ 2OJED 3S15J 2DA5A 1WJDA 4EEFG 1DQUA 3HB9A 1YITI 3EQLF 2AQEA 1WHUA 5GPAA 2L9NA 4DNCA 2Z9OA 1FC3A 3C1DA 2WBMA 2GIVA 2DU9A 2M34A 3CCEI 1R9TJ 3LFKA 2R7QA 5M5WJ 1TC3C 2XRNA 2BVLA 2XAUA 4EATA 3TQNA 2VASA 5E8GA 4CDGA 3CCLI 2QEXI 4IPAA 2A7OA 1VQKI 3LQRA 4A12A 2O8KA 2R92J 1ETVA 3PO3J 3VDXA 3HPGA 3S2WA 4B09A 3L2QA 1WH5A 3R0JA 4KIBA 3ZGKA 1IXCA 4XMYA 5JFRA 3GZ6A 1R0LA 2OBPA 3L2CA 4LJZF 3WTWC 4RS8A 1K5HA 1S6LA 2PBIA 1OYIA 3ZQCA 1RRJA 1W7PD 1K78A 2IXSA 3FKIJ 1FYKA 1VQ5I 2HVSA 1KQ9A 4PUSA 5F6FA 5FRNA 1TWCJ 3ZHZA 5BPIA 4NB5A 3HYIA 1QZEA 4WWCA 1R36A 2JA7J 3DEWA 2EFWA 3CZKA 1FIAA 3E6DA 1T6SA 5FKOA 1H3LA 4QHPA 2Z3YA 1KU9A 2DPUA 2LSOA 4QWQA 2OV7A 3IV5A 4KFCA 1OCZH 5CJ9A 1SD4A 4HNVA 1A6IA 1Q0LA 3LNQA 1S7OA 4KIFA 2EFQA 3CF5F 5LD2C 3FM3A 3GW2A 3ZI0A 2GBYA 1Y39A 2EIJH 3QYEA 4E7SA 1MBHA 5CQGA 3L09A 4NNJA 2NVTJ 2QM3A 2HR3A 2PEXA 5L3FA 4ZX4A 3HOYJ 2W7NA 3LOCA 5H6RA 3V8LA 2DOEA 1TW3A 3J81K 4I6ZA 3UEQA 4OMZA 3H0GJ 1OQYA 1OYYA 4Y6SA 1HQCA 1SC7A 1RPWA 3K69A 1RKWA 2R7ZJ 1JG9A 2A5YB 4MQ9F 3AG1H 4XN7A 3WQSB 3HC7A 4II2A 4KN4X 5JVGF 2M4KA 4I02A 1IUYA 2HVQA 1RR7A 3CQZJ 2BBYA 3PJRA 1J2XA 1LEAA 2E2IJ 1G4DA 3B6CA 2QQ9A 1LQ1A 4HG2A 3ABLH 3BC8A 4L9NA 4XR6A 2XKPA 4DYRA 5KCMA 1X4OA 1BOBA 4ZTJA 1VQNI 4BS9A 1R7JA 2VT3A 2XAGA 3N97A 2NVYJ 1E2XA 2EIKH 2W00A 1J7KA 1G59A 1ZREA 5E1XA 2R72A 4A2UA 4L5JA 1FX7A 3QAHA 4HF1A 3S17J 1MBGA 3DU6A 1WWXA 4G7HF 5ICGA 1X3UA 1KYZA 1WJEA 4C3IJ 3I56I 4R8HA 2ZJ2A 2XF7A 5TJJA 1YTYA 1YJNI 1OLTA 3K7AJ 5FO5A 5EG0B 4XLFA 3MKYB 2VC0A 1FBUA 3SEQA 3JRGA 1G3WA 2VL8A 4OINF 3RDIA 2V6EA 1TQIA 2WY7Q 3RZOJ 3HSEA 5E20A 5CVRA 3RKWA 1X3WA 5DUIA 5HNHA 2WADA 2DJNA 1IN7A 3RKQA 1RZ4A 3G73A 2BY1A 2O3FA 3L1PA 1FOYA 4XN5A 2OQGA 5JO0A 1AU7A 1IC8A 1IG7A 1XGNA 4IHSA 3A14A 2ZXHA 1ZARA 4A0YA 2E1NA 3ANNA 2Y9YA 1ZH5A 2IEKA 3DKYA 1LFPA 4BJ5C 2WA0A 4XMXA 4UB6C 1W4MA 2WV0A 5KHDA 5LEKA 4LD5A 3GYHX 4H0EA 5F27A 2DO7A 2E1MB 1RKTA 2JA2A 2XROA 2CO5A 3B2PA 3SFZA 4AWXB 1JKPC 1S46A 1REPC 4GO1A 2ACJA 1A04A 4AYSA 3JRHA 1SFOJ 1O4XA 1YIJI 1GDTA 1IRGA 3EUKL 2Z99A 2FSWA 3BJAA 5CKTA 3LSKA 3M1CA 2IP2A 3A0BC 2R5YA 2QSGX 3F8FA 2UZKA 1W7PA 1VQ4I 3ASNH 4CA0A 4LOCA 1SG7A 3R60A 5DEQA 5DM6F 1AKHB 2VB6A 4CCKA 1U78A 1MMNA 2BXZA 2YUSA 4ZW7A 4MNUA 4HRIA 1DDNA 2ELKA 3J7AO 5CVVA 2RKHA 5IP9J 1MW2A 1BIBA 2MC4A 5JNLA 2VQCA 3GZ5A 1T98A 3BLYA 3MZYA 2CQ7A 5FFZA 3RYPA 4R5VA 2LD5A 4IZZA 1FMWA 2V9KA 3OSFA 1JJ6C 3M3YJ 4UY8I 3OOUA 2DYSH 2Q2EA 2PG4A 1YFHA 4C3HJ 2LC2A 2R7OA 1KQ0A 1R1UA 3A0HC 3BTJA 3K4LA 1WJCA 4B4CA 3PL8A 2B61A 4XKBA 4RGRA 3OIOA 2BGCA 3P7NA 4FISA 3RJPA 1S3JA 3E7LA 2QYOA 2A5WA 5IOYA 1JJ8C 3MKWB 1C0WA 3OIQA 4IHTA 3KLOA 3ULQB 2YR2A 4E7HA 3SFIA 2DDBA 2Y0SN 2ME6A 2LREA 2VQLA 1TWGJ 4EJVA 3B7TA 1D0ZA 1PP8F 3D5RC 1WPKA 2RQQA 3FISA 3ZQIA 1SVMA 3H9GA 2ZSHB 2VIXA 2E5ZA 2K4JA 2MLKA 2QUFA 1X2NA 2PUSA 2VJ5A 3W2AA 3HW2A 1PYVA 3GXOA 1SC5A 2A69F 1P7JA 2XRLA 4TV7A 5HS7A 3GTMJ 5CVUA 3LL7A 3PNVA 2DCEA 4R7LA 1L0OC 3KZIC 4E70A 3CCVI 4OIOF 4X6AJ 3WG9A 1R4NB 4A3BJ 4HOBA 2HTJA 1T8IA 4XIDA 1GVDA 5TRDA 1NTCA 2CV0A 3F8MA 4ON0A 3CZ6A 3JRAA 3FUNA 4ZDOA 5D8LB 3BCBA 3ZMZA 4BHPA 1LB2A 1Y8RB 4IKFA 3HIFA 3MVPA 2BXYA 3IKVA 2Q0OA 4X1EA 5JBIA 5FKKA 3FUDA 4LGWA 3W2WA 2TCTA 3KP4A 4DYQA 1B72A 4E6KG 4ZW6A 1VQMI 3FUHA 2V9VA 2ISYA 4NC8A 3BG3A 3CESA 2QBYA 2CW7A 3Q0WA 5CVIA 4IF4A 2ZXJA 2E2JJ 5D5WB 1ZLKA 1V4RA 4M6YA 4F55A 1T39A 2E60A 3D5SC 1T2KA 3H5NA 3MD2A 3OR2C 3BQYA 4H4KC 4YFKF 3H0DA 1O7FA 2KISA 3KP2A 3WTUC 1D8KA 2EPFA 2LRDA 1OCOH 3OYEA 1R0KA 1STZA 4KP7A 3GTPJ 1D0XA 2E34A 2W85A 4HNUA 5CPRB 3Q44A 2VKDA 1YIOA 1SAUA 1HW2A 4AR8A 1AOYA 3QJXA 4R5XA 5DYFA 3B37A 4RGUA 1ONNA 3G2BA 2M3AA 4FASD 5EZGA 4MIMA 2JD0A 2VQGA 3S93A 4S04A 2R70A 4Z6YA 4LLLA 1HW1A 4FQGA 1CF7B 1H9TA 4WF2A 3TOBA 3G1MA 2XQ0A 2L7MP 1IN8A 2EK5A 4KISA 9ANTA 5HOOA 2DYRH 5F64A 2X1CA 2VOPA 3IIEA 3FBIB 5FJ8J 3JRDA 3MFKA 2M1BA 4PGHA 5H6QA 1G3YA 4M9SA 4A3IJ 4MKTA 2MGQA 4PGGA 2K27A 3RYRA 2EA4A 4ZN6A 3K1PA 5ERIA 4LG3A 4M6VA 3AKZA 1RI7A 4WXCA 2IPQX 3EUHA 1G3SA 1QZYA 3VVLA 2HZDA 4IHXA 2IGOA 2K02A 2VONA 1TNTA 2M30A 2NOGA 2V6CA 1S5LC 1DUXC 5J1UA 3ZRGA 2DA6A 4XLHA 3WTXC 1IRXA 1K61A 3HZJA 1GW6A 2GA2A 2LKXA 2X1EA 5B5EC 2KRFA 1EH7A 2CYYA 3MZ8A 3UCQA 1LFUP 3DP7A 1IDYA 3HRSA 1Z21A 5HLTA 4OIRF 3QU6A 3CZGA 2R7RA 4IOAF 3OYMA 3F8CA 2HU9A 2DJIA 3I4PA 2A6TA 2NNNA 4FETA 1G8XA 1YO5C 1FEXA 1YW9A 4I98B 2HXIA 1TZLA 2DMPA 4M3EA 3VPRA 5F1JA 2L9SA 4A3CJ 5LFAA 2E7XA 1B72B 4RGXA 4A3DJ 1Y1WJ 1U2WA 2OTJI 3SHFA 2IS2A 3K70D 2HGCA 3IRRA 4B43A 3S1QJ 2LYCA 3K70C 4GRIA 5E17F 1QVUA 2L9VA 4I7HA 5BPPA 5C4JJ 3CHQA 3E5XA 1BN5A 3ZMSA 2M87A 3G4SI 1ZGJA 2O61A 2V1UA 2MAOA 3WGIA 2CMPA 4I0AA 2HEOA 1W5CC 3GZNB 3B2XA 2FMLA 2IS6A 2K85A 2R7UA 3TW7A 2DQ6A 3DTIA 3U9WA 4IO9F 1ZG3A 3QYBA 2LH9A 4ZYHA 1KYWA 5KVRA 5M3MJ 1MMGA 1N75A 3EPZA 4XMZA 2EGHA 2EINH 3KEDA 2X0LA 3ZQGA 3KIOA 4HF0A 5DCMA 1UB9A 3PM1A 4P9UA 3T5XA 5EEAA 2L3DA 3MKZA 2HXOA 1MGTA 3ESWB 1OJLA 1ITYA 3AL0B 3QODA 2JCXA 4M71A 3PNTA 4XMVA 3J7YJ 1H0MA 3KZZA 3HSRA 3KZYA 3BZ6A 4AR9A 2DT5A 3CUOA 1RP3A 2F6CA 1S8NA 2PMUA 3E97A 4DJAA 3QP6A 3OYFA 5TISC 1WI9A 2OAZA 2M8GX 4A5MA 1MBEA 4JBAA 5BS6A 2UV1A 4Z2YA 4F7ZA 3CHOA 3FWEA 4LK0F 3S3OA 3L2VA 5DD8A 3K1NA 2Y1FA 4L9VA 1O3RA 4MTEA 3WGHA 4J00A 1GUUA 2NXNB 4D5CA 4WXDA 1R5HA 3H3VK 1MD0A 1FPQA 3WGGA 1ZR4A 4L9JA 1XGOA 4D7MA 2PLYA 3CHPA 2VJIA 3FXKA 3WU1B 2BY0A 3OYKA 3B34A 4P96A 4XMTA 4FT8A 4K5OA 1JUSA 2HI3A 3R61A 3M4OJ 4L9TA 4CZCA 2J5PA 2LDUA 2PJRA 5A2QZ 3Q43A 3FTUA 1XD7A 2MH2A 4UVBA 2Y1EA 1E0EA 2R7FA 2LKSA 3OYDA 2Y0MA 3IL2A 4HBLA 1UELB 3CCYA 4CUGA 4BBRJ 2QVWA 3V7RA 3LSJA 3A1YA 3LSTA 2LBFA 4A3GJ 4CICA 3GLXA 4QPEA 1A6QA 3K9TA 4A6EA 3JW4A 2WY8Q 2A07F 4OU0A 3S8PA 2KZVA 1X3ZB 2ME0A 5FD5A 1B9MA 2IA0A 3Q9SA 3MMYB 3V7SA 3TEDA 2XPZA 3Q3SA 2KIQA 4QTRA 4ZX6A 1P2FA 4X0GA 2VJJA 3HHHA 4AIKA 2BHYA 4BQNA 4FLRA 4IJAA 4OOFA 3J7ZI 3M7GA 3HOTA 4XO3A 2ZJQF 1ZTRA 4HX4A 4C2TA 3FTYA 2CG4A 1B8IB 3ZHXA 3VOEA 2WV1A 2HOSA 3CC4I 2MABA 3KP3A 2KRCA 1U8BA 4AR1A 3O8HA 5H2FC 4LUPA 2IAIA 2DMTA 2Z16A 1UG2A 5DYMA 4ENNA 4CH7A 1P92A 3ZQ7A 3QOEA 3E1SA 5ILUA 3NWSA 5JLXA 1MW3A 1HOMA 2IBDA 2FEZA 4GXOA 2VBZA 4YG2F 1XMXA 2MLGA 4BDYA 1OFCX 3L7WA 4WCGA 5J8FA 3GTGJ 1MVYA 3HHGA 1YW8A 2DFIA 2DOAA 1Y56A 5H20A 4Y52J 3IH2A 1MH3A 3A01B 5LBQA 4N9HA 3T8VA 4UUTA 4BXFA 1P7IA 3QRFF 4ZQHA 2QSHX 2O7OA 4YRVA 4LG0A 5JC1A 1ZK8A 3HRUA 3DLLF 1LDJA 3ONQA 2XAJA 3FXOA 4FE4A 2MD0A 2GWRA 2M7AA 2DA7A 3TBIA 5HLHA 5CVJA 3DLAA 1HDDC 2NVUB 4GDFA 5IYDJ 1D5YA 3SZTA 1AHDP 1ZRCA 2XPUA 2HYJA 5D8KB 4Y13A 4XQFA 1V54H 4Y3OA 2A05A 1XDSA 3LSMA 4RVBA 3MEXA 1IF1A 4OWRB 3A2KA 1KU7A 1QVTA 2VXDA 3HKZA 3BROA 4BE1A 3R6SA 4C30A 1KQ8A 5C4XJ 3FXMA 2ECBA 2IGMA 4G6DA 2EB7A 2PJRB 2WB1A 2CS3A 3GO5A 1E3OC 1ETKA 2KMUA 3L2WA 4IX7A 3MZHA 2D5VA 1T33A 5EEHA 1PUFA 3TO9A 4UB8C 3G3ZA 3F6VA 4RGSA 5E3NA 5IT9K 4I01A 3NAUA 2NNYA 3CUQB 5BNGA 1Y1VJ 2JPCA 2NYXA 3GTQJ 3U1DA 2W84A 3ABTA 2RJIA 3WQRA 3FK6A 3PUBA 2QQ8A 5F08A 1SVLA 5BOXA 2M4GA 2AQFA 5KK1A 2CW0F 1ZN2A 2H8WA 3H5AA 5D4SA 2ZJPF 3EDPA 4IVNA 2ICWG 1IV6A 2JK3A 2FUG2 4ABZA 4D0PA 1WZ2A 2HOEA 5AONA 4OIPF 4EVIA 4UUVA 4UV8A 4HV5A 5C44J 3IRQA 5J1RA 1U5TA 2DMUA 2XIGA 3ZQHA 3ZMVA 4AIJA 4ENJA 1BI2A 1FP2A 4G6QA 4CCOA 2M0MA 1I3QJ 2BOLA 2K7LA 2JQ7A 1UHSA 1HKQA 1JE8A 4P5OA 5B1BH 4J19A 5FKLA 4I09A 1BW5A 3P9IA 4BHBA 1OCTC 2UWMA 4P9FA 2ZMEA 2RC4A 1ZR2A 1XCVA 5LHHA 3K4NA 1W0TA 1ONOA 3SJMA 4ZH4F 1X4PA 3BWGA 3HUGB 3I59B 5IYCJ 3FXJA 2KL4A 1XMAA 3IUOA 2LY9A 4LG0B 2JVGA 4L5IA 4UUSA 3ABKH 3FIWA 3FXQA 2L01A 1U8RA 5ED4A 3R0IA 1NHAA 2HQAA 3HDDA 1FSEA 4CZZA 3CCMI 4ENKA 4MEXF 1KU2A 1Q1HA 4BU2A 2JSPA 3HJEA 2ID3A 5HNFA 1EKEA 4E7ZA 3CCRI 5D6EA 2V1XA 1W5TA 2BW3A 3JTGA 3K10A 3U21A 1H19A 1OCPA 2EIMH 4CYCB 5M5XJ 1DGRM 1UHWA 3SQNA 4HLYA 3WTSC 2M5WA 3CMMA 1FNNA 3DTKA 5CYVA 1NK2P 2DQMA 1SQMA 3JAMZ 3AG4H 3ECHA 3I3LA 5JR3A 1APLC 1HSJA 3S16J 2RQPA 2BVMA 3H36A 1I39A 3B02A 4Q4ZF 4Y15A 3CMAI 2R5ZB 1LE8A 1ZS2A 2MC3A 2FRHA 2KLOA 3KCCA 4RB1A 3ANLA 4I99C 1KONA 3HOWJ 1I3AA 4IRIA 1IDZA 1OCCH 4XN4A 5M5YJ 2M2EA 1SD6A 1PUFB 2WAQA 2X6YA 1G6NA 2CU7A 3CJRB 3HGGA 3ZHYA 2COBA 3CCSI 5J40A 3EBHA 1R58A 4ESFA 3JRCA 3D5LA 1QNTA 4BY7J 2F4IA 1QZZA 3Q5FA 1AA7A 4BHCA 4V19K 1JVSA 1FIPA 4XRFA 3A06A 4BEHB 1IN4A 1P4AA 1BR1A 3OMYA 3VB2A 1SD5A 1MKMA 4L5EA 5GAHJ 1ZG5A 1FYLA 3UERA 2D45A 2PI0A 2IA2A 2H09A 5F1RA 1J0RA 1V5EA 2DK8A 4XNBA 4PDKA 1IRFA 1HKTA 1F5TA 1XPXA 5EF6A 2M0CA 2X1DA 5GTIC 3I0TA 2JA5J 1FTZA 3OOPA 3FUEA 1GV2A 4D9JA 1DPRA 3JSOA 4EQQA 2MAPA 3JRBA 4JX4A 2JD1A 1JKRC 3ZXSA 2DPDA 3I4MJ 4HW0A 2P5LC 3CCUI 5E3MA 5L3EA 2DT7B 2HVRA 4Q4IA 2CQKA 5IPAA 5DS9A 3QU3A 2AXLA 3VWBA 3X2QH 4WK8F 1J75A 4Y67A 4A5NA 2LNBA 3GFLA 3LFUA 4HNTA 2DA2A 2DOFA 1GV5A 2LLKA 3DPUA 3KYDB 4RLFA 1H88C 2ZMEB 5ILSA 1HF0A 2W82A 3ZQLA 3FHZA 2X4HA 4HX7A 4UXNA 3OS1A 1BIAA 4PU2A 3V42A 1XG1A 2M8EA 1K78B 1OMIA 1ZGWA 1TBXA 4AU7A 5KNLA 2BY3A 4RDUA 4AYBN 1QO0D 2JD2A 2NOJB 2VBXA 4ESJA 3OYHA 4EM0B 2CUZA 2A6HF 1ETOA 1D5VA 1UFMA 3RIRA 3BR0A 3JRIA 4NC6A 1B4AA 2EWNA 3CO6C 2E36A 5GPCA 3ZMUA 4MTDA 2CQXA 2K9SA 4PCQA 2L9RA 3QWLA 5FFXA 1SFUA 3KX2A 3GBGA 2LOOA 3J81Z 4R1HA 2FFLA 5K5OA 3WG7H 2ETHA 2FD5A 3CLOA 2VXZA 2DW4A 5E3LA 3DBRB 2COMA 3RPUD 3WHBA 2GXGA 4Y33A 3FKJA 1LE8B 1ON2A 5EEGA 4U0YA 1LFBA 3ISPA 1JI8A 3M1EA 1NK3P 3B7UX 1SFXA 2EZKA 2H6CA 4IRHA 2CFOA 3J80K 4A3LJ 3CJQB 4U0VA 1QU3A 2XF6A 2E1OA 2Y9ZA 2AXTC 3BG9A 4GYGA 2RNJA 1Z1DA 2VKEA 2WAFA 5D5XB 2X6XA 3ZP5A 2ZXIA 4N4OB 4ZYGA 2LP0A 1TQMA 1RESA 2EBIA 2W48A 2HDWA 3RSNA 1FLIA 1U6GA 2BZTA 2P4WA 1KGSA 4XLPF 3KYCB 3OSGA 1G2HA 2QENA 1YRNA 3H3UA 4HV6A 3CJNA 2L5QA 3FUJA 2LKPA 2ZCWA 5E1ZB 2FOKA 3MN2A 2V1DA 4UVCA 1WJBA 5DM7F 3H9QA 2JVHA 3GX4X 2HQNA 4PFPA 4WXHA 2IT0A 3PUFA 4XSZF 4N9IA 1R49A 2VT2A 4EM2A 3UR3C 2IS1A 2Y2ZA 1ETQA 3FXLA 2WTEA 2HQRA 2VE8A 3IH3A 1G5AA 3VODA 3BOQA 1WCMJ 3I53A 2WAQN 1CQTA 4ZYAA 4BQAA 1T95A 3DTEA 3FHNA 1X3WB 2DMQA 2RREA 1R1TA 2YSRA 4M3FA 4OAYA 3WTZA 4XN1A 2P8TA 2NVQJ 2MH9A 3IKTA 4YEJA 1A36A 1I5ZA 1MJ9A 3F8NA 1XGMA 3HOVJ 1F9NA 1T38A 4XKCA 3BY6A 4XLEA 4FTHA 4HQMA 5JMPA 2Y31A 2LY2A 3P9CA 1J9IA 4N0BA 3F23A 2HWVA 3F6OA 1FZPB 1DU6A 3TKYA 1JUMA 5CLSA 2VJ4A 1DP3A 3OYNA 2C6YA 4D1QA 3BQZA 2CW8A 4M6XA 1MNMC 1VQLI 4P1WA 5J1YA 3JCUC 2CH0A 2CSOA 3LSRA 2FXAA 2VBYA 1XS9A 3GLLA 2RAEA 3A02A 4BJTA 2W25A 3S1RJ 3VYRB 2LF8A 3ECOA 2TRTA 3BG5A 4NQWA 5HS8A 2R5YB 1K6OA 3TO7A 1F4KA 1D1BA 4L0ZB 1W7PB 1IV8A 1XMKA 5J6XA 2XB5A 5F0HA 1R71A 1FBSA 5B66C 3FF5A 1PUEE 1TQPA 2Q8KA 3BPXA 4ZDLA 3DV8A 1IXRC 5JLWA 2KDZA 2R7VA 4JYKA 1X1BA 3QYFA 1D1CA 2IJLA 2L02A 1HSTA 1N78A 4IRGA 1MDMA 1D3YA 1NH3A 2HFHA 3NQOA 1SFKA 1TNSA 3DEUA 3TL4X 2WZGA 2CQQA 5FLXZ 3I71A 2DXIA 4DBQA 4UVAA 5K5QA 1UJ8A 1ETYA 4PW4A 2WZFA 2Q2EB 3E6CC 2LVSA 1U0JA 4M9XA 1FMVA 1JHFA 1KZHA 1T08B 1ZRFA 2A3SA 1BR4A 4IQJA 4NHJA 1VZ0A 4B1RA 1ODDA 3T8RA 3VSKA 2FU4A 4A3KJ 1YRNB 3PFIA 4KYWA 4FCYA 4RAZA 1U9NA 4HX8A 3CHSA 4DGWB 5J3LA 2G7HA 3E3VA 1ZYRF 3N05A 3S14J 1GVJA 1QA6A 5DLLA 4E7IA 2GM4A 2H6BA 2I8DA 1QPMA 1HBXG 2FBKA 2OA4A 4EV0A 1T1SA 3CO7C 4G7OF 1HA8A 1FOKA 5F0CA 4ZYEA 5M3FJ 2XAQA 1IUFA 2K9LA 2Y1GA 3CD6I 2UXXA 2V26A 4LIVA 2HNHA 2DFEA 2IGNA 3FXRA 3MWMA 2FNAA 1USSA 2K5CA 4M3DA 4XM3A 5HLIA 4CO8A 3FMRA 1E17A 1F43A 2YU3A 1ZHFA 2HTSA 4GAEA 4ZQTA 3WTVC 5EGOA 3FHEA 3FU0A 3IP4B 4G7ZF 1SAXA 3FTZA 2MBFA 3HTSB 3AU9A 4XN2A 4M73A 2W57A 3KEYA 3B6AA 3GEZA 4IHWA 2GQQA 4XN0A 4U7DA 2JTVA 2L7ZA 4QPQA 1JT0A 4D5FA 1Q0QA 2QBYB 4YFXF 3O3KA 3FUKA 4XLAA 5FRMA 1VI0A 2A61A 5AENA 2DFFA 2STTA 3FMSA 4XN8A 1YS7A 2KIFA 2P6SA 3COAC 3CZEA 4S0HB 5LRSA 2ID6A 5A2QK 3W3CA 1PVEA 3C2HA 3RQIA 3Q0VA 1O3QA 1VQPI 1VQ7I 1I6HJ 3CCQI 1W0UA 2YU9J 3C7JA 2O7GA 5L3BA 4ZC3A 2E7WA 5C3EJ 3CMEI 2P5VA 3SXYA 2H1KA 5FKNA 2YX7A 4BDZA 1VF9A 4Q4EA 2XC7A 1GLNA 2DN0A 3AAFA 1RUOA 5FLMJ 4RM2A 1R00A 1KU3A 4MEYF 1MDMB 2XKOA 1LUJB 1L3LA 2K86A 1OR7C 1RIOH 1ETXA 1IN5A 3TDZC 2CUEA 5DTDA 1RNLA 4HA8A 4DW6A 5ILVA 4ZQGA 3GUDA 2JN6A 4FE7A 2HOTA 4GFBA 1R5GA 3VYTB 3CF2A 3W6JB 2RN7A 3WU0A 3FU6A 1S9HA 2EFOA 2GA1A 2HPTA 4D7NA 1XN7A 4E4HA 1DU0A 3FTXA 4JNDA 5LHIA 4AM3A 2G9WA 4A3MJ 3I64A 1X1CA 3ZMTA 5B1AH 2NAZA 3PUUA 1I50J 2QGUA 3BR2A 5HDGA 3T0YA 5JI6A 2KQRA 3FH8A 6PAXA 1BA5A 4EJOA 4O3MA 4EJWA 1BI1A 3CDIA 1T56A 5K7ZA 2JRTA 1B9NA 2HDDA 2STWA 4FHTA 2VOOA 1S29A 3F22A 2F5EA 1IRZA 1MJAA 4CCNA 1DP7P 2CJJA 1USTA 2NRAC 3LAJA 3U9GA 3V7CA 2E1CA 2R7SA 1HXDA 4LMYA 1GT0C 1P6RA 2D1VA 2FNPA 1OKRA 2K9NA 1TWAJ 2H27A 4IXAA 2GAUA 1J09A 4XORA 2JUGA 3NWTA 1SMYF 3BZKA 2Z33A 2HKXA 3NARA 4XBFA 1MSEC 2ZBKA 1FJLA 2R7DA 2XGCA 4AIDA 4PK4A 2OPTA 5GAEJ 1LDDA 5HLGA 5EGOB 1MSFC 3DEEA 1Z9CA 3JT1A 3TOAA 4DQ2A 1QRYA 4HAMA 3M07A 3WTYC 3BR5A 3CMYA 5E1WA 2GZWA 1ZRDA 3LSPA 1XX5A 2XF5A 2L4AA 2PMHA 4PSXA 2BE5F 2EQRA 2N8GA 4KA4A 3AUAA 3U2RA 4DIQA 2XVCA 3OL3A 4Y4RA 3PSIA 5EV7A 3DPLC 3K4KA 3IWFA 1V5GA 4M74A 4XN9A 4LFUA 2V1NA 3KP7A 3DWLE 3SEZA 1GXQA 1K6YA 3ELKA 2KFDA 1MBKA 2HOAA 3AG2H 3LSHA 1WJFA 5FB2A 4E7JA 2HZTA 2M45A 4RCVA 4IQ4A 5D5VB 2FOWA 1BC8C 3I54A 5LGNA 3TO6A 2YS9A 2X51A 3OYGA 4FLOA 1T0FC 2CV1A 5ICFA 1J5YA 2XASA 5GTHC 2L4MA 4F92B 3QPSA 5DCMB 2H1LA 3FUIA 2F5FA 4CGZA 5GP9A 2Z1DA 1GHCA 2X9DA 4MS6A 1MW7A 1Q1VA 4AVZA 3F3XA 1YX5A 4G8XA 3C2BA 1MMAA 3CJTB 4PJMA 1WGXA 5JMWA 5J47A 1HKSA 2GXBA 2FX0A 5D4RA 5J8CA 4S05A 2WC2A 4RB0A 1P4XA 3I55I 3S3MA 4AVPA 5F0FA 2ELHA 4XKVA 1V3FA 3G6EI 2Y75A 2DT6A 2E1MC 4BQQA 2E19A 3LAPA 1HC8A 1X1AA 3OV8A 4ZYDA 3RC8A 1VNDA 3IC7A 3FXUA 2Y69H 5IT3A 1BC7C 2QZ8A 3OY9A 3OYJA 2A68F 2CRGA 4J3BA 3R0AA 3KPHA 4HDUA 3OIPA 4ZX3A 2ZC2A 4KN7X 2KIUA 1RETA 2HQ5A 3SZGA 3RZDJ 1ZG1A 2WPGA 3EBIA 1UAAA 1A5JA 4A3FJ 3OS2A 2QA4I 1VTNC 2LBFB 3QPLA 3HGYA 4II3A 2ISZA 4KICA 1ZKGA 2VLAA 3LSIA 5L3DA 4YFNF 2K9MA 1ERDA 4XNFA 5HDNA 2OU2A 3MCZA 2VJ8A 4PJNA 4KDPA 5IYBJ 1P9QC 2ZJRF 2X6WA 5LRRA 4YIRX 4XO5A 4HEA2 5DDGA 2EA2A 4I0BA 2R3SA 4XONA 1OPCA 1H9GA 3WTTC 1VQ6I 3HPHA 5K1YA 3F9KA 4BGDA 3DQVC 2JA8J 4JOMA 5JHFA 2V79A 1YX3A 1ZQ3P 3ANMA 1TP4A 2P6TA 2LF7A 3V8KA 1T1RA 1Y0NA 4NBQA 4PZJA 2CQNA 4KUMA 4JP0A 2ZB9A 1O7LA 1QBJA 2HPIA 2XPYA 2FQ4A 2QQBA 3D0SA 1K4TA 3S2DJ 5HODA 2K3PA 2MSYA 3FUFA 3O6BB 3JRFA 4XLNF 1W5SA 3H1CA 2EILH 2OTLI 1YE9A 1Z6RA 1KA8A 3HM5A 4G94A 4F91B 1LVAA 2PX9A 1R4MB 5ICEA 4OAZA 1H8AC 3FMQA 3HOXJ 3ZCOA 1TW2A 1B6AA 2DA3A 5DV5A 4M72A 3BPVA 1Z67A 4KJZA 3M8FA 3KFWX 5EG0A 1FBQA 3H35A 3KEOA 1T0FA 1FWZA 5EDNA 1TL8A 2PL5A 3ZMDA 3CTAA 1TT5B 3DU5A 2RGVA 2B0LA 2QKLB 1HDPA 2LR8A 4HZFA 4B44A 4AICA 2P0WA 3FK7A 3S1MJ 1TWHJ 3P5JA 4HSTA 2EFPA 3K4BA 4GYIA 2VE9A 1JXSA 4ZW3A 3TMOA 2A6EF 2KRHA 3C2GA 4MO7A 1IXSB 3JR9A 2O03A 4PFOA 2ESHA 3O8GA 1FOXA 2JA6J 3RKYA 1FOWA 2P81A 1A31A 3GFJA 3LWFA 2XGXA 4NDLA 1XGSA 3TDUC 3FM5A 3QP5A 2RDPA 1PP7U 2PQ8A 3FU3A 2K4BA 3HEFA 4A3EJ 5IT9Z 1POGA 5LGTA 2X6OA 3GMEA 2X85A 4BL0B 1QQIA 4U7BA 5IP6A 1Z7LA 2JSCA 3ROUA 2PFBA 3DF8A 4K5MA 2XPVA 2HYFA 1Q0HA 1FY7A 3AG3H 2Y0SA 4U88A 1IO2A 1AKHA 4ZW8A 4JX6A 4HDVA 1BOAA 2DLLA 2IVMA 5D6FA 2QJ1A 5HDKA 3FTSA 1MNDA 3NRVA 4XMUA 2LMDA 4B8XA 1AWCA 2FA5A 3W6VA 4QLCU 3FH7A 5ICCA 1FSHA 4XOPA 3G1LA 1W1WE 4DZPA 3H9JA 3OL4A 5LHGA 1S7AA 1BJZA 1RC9A 4G6TB 4IHYA 3CXBA 4XSXF 1X19A 3ZR8X 4OOEA 3BT9A 1MNEA 3HKZN 1RR8C 1XSXA 2XDVA 1JUPA 1X1DA 3VFZA 2H94A 1O57A 2BHZA 1SFEA 1ONVA 3D1NI 3TP0A 2P7VB 2V4JC 2WB1N 1U5TB 4BE0A 3ZOBA 4DZJA 4Y7NJ 4GAAA 3BP8A 1U3EM 3BTCA 1ENHA 2Y1DA 3LA3A 4MFDA 3BTIA 5IOZA 5AIPA 2AS5F 3GCMA 3W2VA 3CCJI 2EJRA 3BR6A 3DFGA 5DUKA 1YLFA 1J59A 4CHUA 1SD7A 2K9QA 1BW6A 5FWQA 2MYSA 2Z5UA 2DA1A 4W97A 4E7KA 3CP2A 3KP5A 1Z6TA 3E5QA 1YG2A 3AU8A 3HTUA 5FD6A 2I10A 3HXLA 3I9V2 3TGNA 2R4GA 3CDHA 2ZNZA 3H5RA 4HQEA 4A03A 2QQAA 3HBLA 4B3AA 3C18A 4C3JJ 1BJAA 2HKOA 1D1AA 2KHMA 3F0CA 3F72A 4UUSB 1R5ID 3IH4A 2HPMA 1I1SA 1MJBA 3FTWA 4PJLA 2JCVA 3BZCA 2EZLA 2C5ZA 3KYLA 3K1MA 2TDXA 4C2MJ 3KETA 3JSPA 2VQHA 2FMYA 2HPOA 3IHUA 4RLQA 2RNGA 5TGTA 4ENMA 2BW3B 1FP1D 4CXFA 1H89C 1K7AA 2QSFX 4I76A 4ARFA 1JKQC 4M3GA 2IW5A 2MA3A 1DGWY 3RKXA 4BE2A 3U1KA 2LK2A 4Q5SF 2DTRA 3RCOA 1JT6A 1XB4A 4A0ZA 4KNYA 3HRTA 3WE2A 3PIPF 5K7HA 4XL9A 3CP8A 4BYYA 3H3ZA 3RQ4A 3VYUB 5CQEA 2O6GE 4OIQF 2DODA 3SYTA 2F5DA 1JHHA 1BI0A 4O5VA 4QPOA 2L7KA 2OZUA 5DULA 1R22A 3OYCA 3V8JA 3S2HJ 1M1EB 4NC7A 4KMFA 2XGDA 3K4CA 1WJ5A 2L2OA 5K5RA 2GIZA 1A35A
chains in the Genus database with same CATH topology
2F5CA 3ABUA 5FGMA 4G9YA 1JGIA 5DD4A 2JT1A 4ZW5A 2G7UA 3FZVA 3E5UA 4U0WA 4EMSA 3P9KA 5AIQA 1CF7A 4QMEA 2DK5A 3FUMA 4XNAA 2OQRA 2DBBA 5FLXK 5BMZA 4EJTA 3GWZA 2RV8A 2QLZA 2O8XA 3B7RL 1QGPA 2C82A 3RTRA 4K5PA 2W24A 1YW7A 2P7CB 2DQLA 2DI3A 4UV9A 1LEBA 2OZ6A 2VC1A 4ASNA 3VVMA 4QIRA 2D2WA 2MD5A 1Y0UA 4DPRA 4MGRA 1IW7F 4KT5C 4ETSA 2FE3A 2IRFG 4YIIA 1Z05A 4LB5A 1UCRA 3REOA 4Y6RA 1XCBA 4L18B 1R23A 1WKMA 5HVQC 2CFXA 1CGPA 2ESNA 1YS6A 1WRJA 2XAFA 3J80Z 3KP6A 2EV6A 2FBHA 4ZZLA 4O6JA 3ZPLA 4GCVA 3JSZA 4AIHA 2PN6A 3EYIA 3M9AA 2KIMA 3CIAA 5E18F 3RPUA 3BJOA 4CYDA 1FYMA 2O0YA 3Q9VA 4ZZDA 1O3SA 3MQ0A 3ZN1A 4EGYA 1XSDA 3WE3A 1BI3A 4A0XA 2XV4S 1OYWA 1EH6A 2HDCA 5L3GA 3ZN0A 4L0YB 2EFNA 4FLQA 4ZQEA 2XUBA 3WQQA 4KIGA 1O3TA 1F1ZA 1K79A 3NEUA 3JTHA 1BBYA 4Y17A 3PQKA 4JK1X 4BH9A 2ZXGA 5JAZA 2BV6A 3I5UA 1PDNC 5LEJA 4X2UA 3L9FA 4GGGA 2JCYA 1LJ9A 4R5TA 4M9ZA 1YQAA 4XO4A 4P55A 3FULA 4MHGA 3E6BA 2CGPA 3WODF 2F2EA 2XAHA 2CWEA 5LGUA 2FBIA 4RSYA 3T1BA 3N4MA 1IN6A 3CUQC 1WQ2A 1B1BA 2ZO4A 4FX0A 2KJBA 2RVCA 1WSUA 3PQJA 2QWWA 4OMYA 2ZKZA 2BEOA 2R59A 1XDUA 3O2PE 1X3ZA 1HW5A 3HOSA 5BPDA 4WX9A 1MZBA 3ML6A 1EV7A 2JPBA 2IA1A 4EM1A 4BKXA 2PGGA 2L54A 5JVTA 3H92A 3DKWA 4K5LA 4BNCA 3B3BA 1SMTA 3FX3A 1I1GA 4LLGF 2FQ3A 1XSVA 1P4WA 2JV7A 3I58A 3F21A 3GVAA 1I27A 4PVBA 4LB6B 3QPHA 3BDDA 1ULYA 5JHUA 2Y1CA 5DCFA 4YIFA 1Z91A 1TLHB 2EV5A 1RUNA 3RC3A 4FLSA 1ZLJA 2VN2A 4ZQFA 4A6DA 2ADUA 3ERED 2D1HA 2NS0A 4JQFA 3FTVA 3K0LA 3EBGA 1G3TA 1EH8A 4MQVA 4HYEA 3CZLA 3DPTA 3VEPA 1LDKB 3LQQA 4Q48A 1BM9A 2EV0A 2KJCA 2J5OA 4LK1F 3EETA 4QUOA 4K2EA 3BJ6A 4RAYA 4AD9A 1FT9A 3F8BA 3W6KB 4RB2C 4OOIA 3MAJA 3RPQA 1I6XA 3RI4A 4HF2A 3CUQA 3EYYA 3KE2A 4UHTA 4K5NA 3GFMA 5LLQA 5L3CA 1IAWA 2BYVE 4L2LA 3R4KA 2DQRA 4EGZA 3FU5A 1U5TC 1MW1A 2OD5A 5D5UB 1ZAOA 2YX4A 4FCAA 3B7SA 4Y6PA 4ZX5A 2GTQA 4XNDA 3SZPA 1GXPA 1Z7UA 1MW0A 2FF4A 4KMUX 2VBWA 2Y48A 2WWYA 3C3WA 1OR7A 4FX4A 4I2OA 2XHKA 4ESBA 1ON1A 2KKOA 3RASA 1HS6A 1DPUA 1D8JA 3KEQA 4Q47A 3FH5A 3T8TA 1JGSA 4UNOA 2ZFWA 2ZNYA 4R79A 5E8IA 1R1VA 3HUGA 3I59A 1ONPA 1ZGAA 3B73A 3QPTA 3CHRA 3V4GA 1YYVA 3QOPA 2UXNA 3DXJF 3E6MA 3HRMA 2VODA 2DAOA 1IZ1A 1UHMA 4EJUA 3GF2A 5HS9A 2QVOA 2HYGD 1B59A 4RB3C 2YPRA 3JAMK 1TTYA 3KLNA 4XMWA 2HS5A 3GFIA 1LNWA 2P5KA 3LA7A 2PJPA 3M8EA 3LA2A 3HSFA 4HLXA 3L00A 2JZYA 4LLNA 3K2ZA 4BAYA 5BQTA 3IWZA 3EQLF 4DNCA 2Z9OA 1FC3A 3C1DA 2GIVA 2DU9A 3LFKA 2XRNA 3TQNA 5E8GA 4CDGA 4IPAA 2A7OA 3LQRA 4A12A 3S2WA 4B09A 3R0JA 4KIBA 1IXCA 5JFRA 3GZ6A 1R0LA 2OBPA 3L2CA 4LJZF 3WTWC 4RS8A 1K5HA 1S6LA 2PBIA 1OYIA 1K78A 1W7PD 1FYKA 1KQ9A 5F6FA 3ZHZA 5BPIA 4NB5A 3HYIA 4WWCA 1R36A 2EFWA 3CZKA 3E6DA 1T6SA 1H3LA 4QHPA 2Z3YA 1KU9A 2DPUA 2LSOA 4QWQA 4KFCA 5CJ9A 1SD4A 1Q0LA 1S7OA 4KIFA 2EFQA 3FM3A 3GW2A 3ZI0A 3L09A 2QM3A 2HR3A 2PEXA 5L3FA 4ZX4A 5H6RA 3V8LA 1TW3A 3J81K 3UEQA 4OMZA 1OYYA 4Y6SA 1HQCA 3K69A 1JG9A 2A5YB 4MQ9F 4XN7A 3WQSB 4KN4X 4I02A 1IUYA 2BBYA 1J2XA 1LEAA 1G4DA 2QQ9A 1LQ1A 4L9NA 2XKPA 1R7JA 2VT3A 2XAGA 3N97A 1E2XA 1J7KA 1ZREA 5E1XA 2R72A 4A2UA 4L5JA 1FX7A 3QAHA 4HF1A 1WWXA 4G7HF 5ICGA 1X3UA 1KYZA 4R8HA 2ZJ2A 5TJJA 1YTYA 5FO5A 2VC0A 1FBUA 1G3WA 4OINF 3RDIA 1TQIA 3HSEA 5E20A 5CVRA 3RKWA 1X3WA 5DUIA 5HNHA 1IN7A 1RZ4A 3G73A 2O3FA 4XN5A 2OQGA 5JO0A 1XGNA 4IHSA 3A14A 1ZARA 4A0YA 2E1NA 3ANNA 1ZH5A 4XMXA 1W4MA 2WV0A 5LEKA 4LD5A 3GYHX 4H0EA 2DO7A 2XROA 2CO5A 3B2PA 3SFZA 4AWXB 1S46A 1REPC 4GO1A 2ACJA 1A04A 4AYSA 1IRGA 2Z99A 2FSWA 3BJAA 2IP2A 3F8FA 2UZKA 1W7PA 1SG7A 3R60A 5DEQA 1U78A 4ZW7A 4MNUA 1DDNA 3J7AO 5CVVA 2RKHA 1MW2A 1BIBA 5JNLA 3GZ5A 1T98A 3MZYA 5FFZA 3RYPA 4R5VA 2Q2EA 2PG4A 1YFHA 1KQ0A 1R1UA 2B61A 4RGRA 2BGCA 3P7NA 3RJPA 1S3JA 2QYOA 1C0WA 4IHTA 3KLOA 3ULQB 2YR2A 4EJVA 3B7TA 1PP8F 2K4JA 2MLKA 2QUFA 2PUSA 3GXOA 1SC5A 2A69F 4TV7A 5HS7A 5CVUA 4R7LA 1L0OC 4E70A 4OIOF 3WG9A 4HOBA 2HTJA 5TRDA 3F8MA 4ON0A 3FUNA 5D8LB 3ZMZA 4BHPA 1LB2A 3HIFA 3IKVA 2Q0OA 5JBIA 3FUDA 4LGWA 3KP4A 4ZW6A 3FUHA 2V9VA 2ISYA 2QBYA 5CVIA 4IF4A 2ZXJA 5D5WB 1ZLKA 1V4RA 4M6YA 1T39A 1T2KA 4YFKF 1O7FA 3KP2A 3WTUC 1D8KA 1R0KA 1STZA 4KP7A 2W85A 3Q44A 1YIOA 4AR8A 1HW2A 1AOYA 3QJXA 4R5XA 5DYFA 3B37A 4RGUA 1ONNA 2JD0A 2R70A 4S04A 4LLLA 1HW1A 1CF7B 1H9TA 4WF2A 3TOBA 2XQ0A 1IN8A 2EK5A 5HOOA 5F64A 2VOPA 3IIEA 3MFKA 2M1BA 4PGHA 5H6QA 1G3YA 4M9SA 4MKTA 3RYRA 4PGGA 2K27A 2EA4A 4ZN6A 3K1PA 5ERIA 1RI7A 4WXCA 2IPQX 3EUHA 1G3SA 1QZYA 3VVLA 2K02A 2VONA 1TNTA 2M30A 2V6CA 1DUXC 3WTXC 1GW6A 2GA2A 2KRFA 2CYYA 1EH7A 3UCQA 3DP7A 3HRSA 5HLTA 4OIRF 3QU6A 3CZGA 3F8CA 3I4PA 1YO5C 2NNNA 1YW9A 4I98B 2E7XA 4RGXA 1U2WA 3SHFA 2HGCA 3IRRA 5BPPA 5E17F 4I7HA 3CHQA 3E5XA 1BN5A 3ZMSA 2M87A 1ZGJA 2O61A 2V1UA 2MAOA 3WGIA 4I0AA 2HEOA 3B2XA 2FMLA 2DQ6A 3U9WA 1ZG3A 4ZYHA 1KYWA 5KVRA 4XMZA 2EGHA 3KEDA 2X0LA 4HF0A 5DCMA 1UB9A 4P9UA 3T5XA 2L3DA 1MGTA 2JCXA 4M71A 4XMVA 1H0MA 3KZZA 3HSRA 3KZYA 3BZ6A 4AR9A 2DT5A 3CUOA 1RP3A 1S8NA 2PMUA 3E97A 3QP6A 1WI9A 2OAZA 4A5MA 4JBAA 5BS6A 4Z2YA 4F7ZA 3CHOA 3FWEA 4LK0F 5DD8A 3K1NA 2Y1FA 4L9VA 1O3RA 4MTEA 3WGHA 4WXDA 1R5HA 1MD0A 1FPQA 3WGGA 4L9JA 1XGOA 2PLYA 3CHPA 3WU1B 3B34A 4P96A 4XMTA 4FT8A 4K5OA 3R61A 4L9TA 2J5PA 2LDUA 5A2QZ 3Q43A 3FTUA 1XD7A 2MH2A 4UVBA 2Y1EA 2R7FA 2Y0MA 3IL2A 4HBLA 2QVWA 3V7RA 3LSTA 4CICA 3GLXA 4QPEA 3K9TA 4A6EA 3JW4A 2A07F 4OU0A 2XPZA 5FD5A 1B9MA 2IA0A 3Q9SA 3V7SA 4ZX6A 1P2FA 3HHHA 4AIKA 4FLRA 4IJAA 4OOFA 3M7GA 3HOTA 4XO3A 4HX4A 3FTYA 2CG4A 3ZHXA 3VOEA 3KP3A 4AR1A 4LUPA 5DYMA 4ENNA 1P92A 3ZQ7A 5ILUA 1MW3A 2FEZA 4GXOA 2VBZA 4YG2F 2MLGA 4WCGA 3L7WA 5J8FA 1MVYA 3HHGA 1YW8A 2DFIA 5H20A 5LBQA 4N9HA 3T8VA 3QRFF 4ZQHA 4LG0A 5JC1A 3HRUA 1LDJA 2XAJA 5HLHA 2GWRA 5CVJA 3SZTA 1ZRCA 5D8KB 4Y13A 1XDSA 4RVBA 3MEXA 1IF1A 1KU7A 3BROA 3R6SA 1KQ8A 4G6DA 2EB7A 3GO5A 3MZHA 5EEHA 3TO9A 3G3ZA 3F6VA 4RGSA 5IT9K 4I01A 2NNYA 3CUQB 2NYXA 2JPCA 3U1DA 2W84A 3ABTA 2RJIA 3WQRA 5BOXA 5KK1A 2CW0F 1ZN2A 5D4SA 3EDPA 4IVNA 4D0PA 2HOEA 5AONA 4OIPF 4EVIA 4UUVA 4UV8A 4HV5A 3IRQA 1U5TA 2XIGA 3ZMVA 4AIJA 4ENJA 1BI2A 1FP2A 4G6QA 2K7LA 1HKQA 1JE8A 4P5OA 4I09A 3P9IA 4BHBA 2UWMA 4P9FA 2ZMEA 2RC4A 1XCVA 5LHHA 1ONOA 4ZH4F 3BWGA 3I59B 1XMAA 4LG0B 4L5IA 3FXQA 2L01A 1U8RA 5ED4A 3R0IA 1NHAA 1FSEA 4CZZA 4ENKA 4MEXF 1KU2A 1Q1HA 5HNFA 5D6EA 2V1XA 1W5TA 3JTGA 1H19A 1UHWA 3SQNA 4HLYA 3WTSC 2M5WA 1FNNA 5CYVA 2DQMA 1SQMA 3JAMZ 3ECHA 5JR3A 1HSJA 2RQPA 3B02A 4Q4ZF 4Y15A 1ZS2A 2MC3A 2FRHA 3KCCA 4RB1A 3ANLA 4IRIA 4XN4A 1SD6A 1G6NA 3ZHYA 3EBHA 1R58A 4ESFA 3D5LA 1QNTA 1QZZA 3Q5FA 4BHCA 1JVSA 4XRFA 3A06A 1IN4A 1P4AA 3VB2A 1SD5A 1MKMA 3UERA 1ZG5A 1FYLA 2D45A 2PI0A 2IA2A 2H09A 5F1RA 4XNBA 2DK8A 4PDKA 1IRFA 1HKTA 1F5TA 3I0TA 3OOPA 3FUEA 1DPRA 3JSOA 4EQQA 2MAPA 2JD1A 2DPDA 4HW0A 2P5LC 5L3EA 4Q4IA 2CQKA 3QU3A 2AXLA 4WK8F 1J75A 4Y67A 4A5NA 2LNBA 3GFLA 2ZMEB 5ILSA 3FHZA 2X4HA 4HX7A 4UXNA 1BIAA 4PU2A 2M8EA 1K78B 1OMIA 1TBXA 1QO0D 2JD2A 2VBXA 4ESJA 4EM0B 2A6HF 1D5VA 1UFMA 3RIRA 1B4AA 2EWNA 3CO6C 3ZMUA 4MTDA 4PCQA 5FFXA 1SFUA 3J81Z 4R1HA 2FFLA 5K5OA 2ETHA 3CLOA 2VXZA 2DW4A 1FOKA 2COMA 2GXGA 1ON2A 5EEGA 4U0YA 3ISPA 3M1EA 3B7UX 1SFXA 2H6CA 4IRHA 3J80K 4U0VA 4GYGA 2RNJA 1Z1DA 5D5XB 3ZP5A 4ZYGA 1TQMA 1FLIA 1U6GA 2P4WA 1KGSA 4XLPF 2QENA 3H3UA 4HV6A 3CJNA 3FUJA 2LKPA 2ZCWA 5E1ZB 2FOKA 2V1DA 4UVCA 3GX4X 2HQNA 4WXHA 2IT0A 4XSZF 4N9IA 2VT2A 4EM2A 2WTEA 2HQRA 2VE8A 1G5AA 3VODA 3BOQA 3I53A 4BQAA 1R1TA 2YSRA 3WTZA 4XN1A 2P8TA 2MH9A 3IKTA 1I5ZA 1MJ9A 3F8NA 1XGMA 1F9NA 1T38A 5JMPA 3BY6A 4HQMA 3P9CA 1J9IA 4N0BA 3F23A 2HWVA 3F6OA 1FZPB 3TKYA 5CLSA 2C6YA 4M6XA 2CSOA 2FXAA 2VBYA 2W25A 2LF8A 3ECOA 4NQWA 5HS8A 1K6OA 3TO7A 1F4KA 4L0ZB 1W7PB 1XMKA 5J6XA 1FBSA 3FF5A 1PUEE 1TQPA 2Q8KA 3BPXA 3DV8A 1IXRC 2IJLA 2L02A 1HSTA 4IRGA 1MDMA 1D3YA 2HFHA 3NQOA 1TNSA 3DEUA 2WZGA 5FLXZ 3I71A 4UVAA 5K5QA 4PW4A 2WZFA 3E6CC 4M9XA 1JHFA 1ZRFA 2A3SA 4NHJA 1ODDA 3T8RA 2FU4A 4KYWA 3PFIA 4RAZA 4HX8A 3CHSA 2G7HA 3E3VA 1ZYRF 1GVJA 5DLLA 2H6BA 1QPMA 1HBXG 2FBKA 2OA4A 4EV0A 1T1SA 3CO7C 4G7OF 4ZYEA 2XAQA 2Y1GA 2UXXA 3FXRA 3MWMA 2FNAA 1USSA 5HLIA 4CO8A 4GAEA 1E17A 3FMRA 2YU3A 1ZHFA 2HTSA 4ZQTA 3WTVC 3FHEA 3FU0A 4G7ZF 3FTZA 1SAXA 2MBFA 3HTSB 3AU9A 4XN2A 4M73A 2W57A 3GEZA 2GQQA 4U7DA 2JTVA 1Q0QA 2QBYB 4YFXF 3O3KA 3FUKA 2A61A 5AENA 2STTA 3FMSA 4XN8A 1YS7A 2KIFA 2P6SA 3COAC 3CZEA 5LRSA 5A2QK 1O3QA 3C7JA 2O7GA 5L3BA 2E7WA 2P5VA 3SXYA 2YX7A 4Q4EA 1RUOA 3AAFA 1R00A 1KU3A 4MEYF 1MDMB 2XKOA 1L3LA 2K86A 1RIOH 1IN5A 3TDZC 1RNLA 4HA8A 5ILVA 4ZQGA 3GUDA 1R5GA 3W6JB 2RN7A 3WU0A 3FU6A 2EFOA 2GA1A 2HPTA 1XN7A 3FTXA 4JNDA 5LHIA 2G9WA 3I64A 3ZMTA 2NAZA 3PUUA 5HDGA 3T0YA 5JI6A 3FH8A 6PAXA 4EJOA 4O3MA 4EJWA 1BI1A 2JRTA 1B9NA 2STWA 4FHTA 2VOOA 1S29A 3F22A 2F5EA 1MJAA 1DP7P 1USTA 2NRAC 3LAJA 3U9GA 3V7CA 2E1CA 1HXDA 4LMYA 1P6RA 2D1VA 2FNPA 1OKRA 2H27A 4IXAA 2GAUA 1SMYF 2Z33A 2HKXA 4XBFA 2ZBKA 2R7DA 5HLGA 1LDDA 1Z9CA 3JT1A 3TOAA 4DQ2A 4HAMA 3WTYC 5E1WA 2GZWA 1ZRDA 2L4AA 2PMHA 3AUAA 2BE5F 4KA4A 3U2RA 2XVCA 5EV7A 3DPLC 3IWFA 4M74A 4XN9A 4LFUA 3KP7A 1GXQA 3ELKA 5FB2A 2HZTA 2M45A 4RCVA 5D5VB 1BC8C 3I54A 5LGNA 3TO6A 4FLOA 5ICFA 1J5YA 2XASA 2L4MA 5DCMB 3FUIA 2F5FA 4CGZA 1GHCA 4MS6A 3F3XA 4G8XA 5JMWA 2GXBA 1HKSA 5D4RA 5J8CA 4S05A 2WC2A 4RB0A 1P4XA 4AVPA 2ELHA 1V3FA 2Y75A 3LAPA 3OV8A 4ZYDA 3RC8A 3IC7A 3FXUA 5IT3A 1BC7C 2QZ8A 2A68F 4J3BA 3R0AA 4HDUA 4ZX3A 4KN7X 2KIUA 1ZG1A 2WPGA 3EBIA 1VTNC 2ISZA 4KICA 2VLAA 5L3DA 4YFNF 5HDNA 2OU2A 3MCZA 2VJ8A 4KDPA 5LRRA 4XO5A 5DDGA 2EA2A 4I0BA 2R3SA 1OPCA 1H9GA 3WTTC 5K1YA 3DQVC 2V79A 3ANMA 2P6TA 2LF7A 3V8KA 1T1RA 4PZJA 4KUMA 1O7LA 1QBJA 2XPYA 2QQBA 3D0SA 3FUFA 3O6BB 4XLNF 1W5SA 1Z6RA 1KA8A 4G94A 1LVAA 5ICEA 3FMQA 1TW2A 1B6AA 5DV5A 4M72A 3BPVA 3M8FA 3KFWX 1FBQA 3KEOA 1T0FA 1FWZA 2PL5A 3ZMDA 3CTAA 2RGVA 2B0LA 4AICA 4HZFA 2EFPA 4GYIA 2VE9A 1JXSA 4ZW3A 2A6EF 1IXSB 2O03A 2ESHA 3RKYA 3GFJA 3LWFA 2XGXA 1XGSA 3TDUC 3FM5A 3QP5A 2RDPA 1PP7U 2PQ8A 3FU3A 2K4BA 5IT9Z 5LGTA 1QQIA 4U7BA 2JSCA 3ROUA 2PFBA 3DF8A 4K5MA 1Q0HA 2HYFA 1FY7A 4U88A 4ZW8A 4HDVA 1BOAA 2DLLA 2IVMA 5D6FA 2QJ1A 5HDKA 3FTSA