3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transcription regulator/protein binding
molecule keywords Response regulator
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
1FSHA 2EV0A 2FNPA 2D2WA 2Q0OA 2CSOA 3J7AO 2XAQA 1ONVA 4U7DA 3K1MA 4ESFA 3ZN1A 1SMTA 3FMRA 2AXLA 2V1DA 3DXJF 3V4GA 5J8CA 1HW2A 2QWWA 1TLHB 5HLHA 4Y17A 2EA2A 3RASA 4CZZA 2UXXA 4HX8A 2HYFA 5ICCA 3GFJA 2HWVA 4HQEA 1R22A 3R61A 2ESHA 4ZYEA 3HSEA 1P2FA 1IZ1A 3F72A 3KEOA 2MAOA 4A03A 3I0TA 5AONA 1V3FA 4L0ZB 2VXZA 4YG2F 2BYVE 1U5TB 5DDGA 5FFXA 2JZYA 2P6TA 2A07F 3U1DA 2NRAC 4A6DA 3V8JA 3WGHA 1FYMA 1QZZA 1YS6A 3HOTA 2RVCA 5K5QA 2Y48A 4U88A 3R0JA 1XGMA 2Y1FA 4GGGA 4A0XA 2CG4A 1SAXA 5FD6A 2UXNA 3Q9SA 2Y1GA 2IT0A 5CJ9A 2BGCA 4M9SA 3FHZA 2EFOA 3J80K 2W84A 5DYMA 3T1BA 3I54A 1DPUA 4G7ZF 1Q1HA 2GA2A 4WXHA 1T39A 2QBYB 3I53A 3CTAA 2PEXA 2FSWA 4N9HA 1JHHA 5ICGA 1H0MA 1ZREA 1IXRC 3QU6A 2RNJA 3ZI0A 1IN6A 1WQ2A 2OU2A 2VODA 4KP7A 3TO6A 3F21A 1R1UA 1MD0A 1UB9A 5L3DA 2FA5A 2ESNA 3ANNA 3V7CA 3QAHA 1BOAA 2DW4A 4YFKF 3FX3A 4BYYA 1MW2A 4ZZDA 4NQWA 1KA8A 5E18F 2WTEA 1E2XA 2GIVA 4RS8A 5CYVA 3RKWA 4EJWA 3ELKA 5JVTA 3ROUA 2YSRA 3WGIA 4GYGA 3C3WA 2D45A 3KFWX 3P9CA 3R0AA 4OMYA 3K0LA 3ABTA 3HRUA 4BHPA 3LFKA 4PCQA 3TQNA 1BM9A 3GUDA 3RYRA 3FMSA 3KP6A 2CO5A 2XKOA 1GXQA 3ECOA 4IXAA 1ZRDA 3UEQA 4CO8A 1TTYA 1Z1DA 2JCVA 2VC1A 3J81K 4I98B 4A2UA 1K5HA 2COMA 3GW2A 1T38A 1MDMA 2WWYA 5JAZA 2HQNA 1U5TA 2K4JA 2M8EA 1HXDA 4EJTA 3BDDA 5E8GA 2XAHA 1TW3A 3NRVA 3LSTA 5DCMB 5ERIA 1FYKA 2L54A 1SD5A 1EH8A 5LRRA 3CDHA 3WE2A 3IC7A 3E6BA 2O8XA 1V4RA 1PUEE 4ZH4F 1W7PB 2A6HF 2HDCA 4UUVA 4I01A 3I71A 4AIKA 3N97A 1WKMA 1K6OA 3M7GA 1QQIA 3DFGA 4IRGA 4EGZA 1R00A 4FT8A 2STWA 4DQ2A 1HQCA 3HRTA 2PQ8A 3JTHA 2QM3A 2KJCA 3IIEA 1XGNA 1NHAA 1F9NA 1Y0UA 3HSFA 3RKYA 3M9AA 4M9ZA 5F6FA 4XLNF 5DCMA 1J7KA 2UWMA 5IT3A 2BV6A 4YIIA 2E1CA 5DUIA 4IHSA 1ZLJA 2VBWA 2A6EF 4LG0B 2P5VA 4MHGA 2E7XA 2A68F 5HLIA 4ZQFA 3KLNA 4G8XA 1YYVA 4LMYA 3HRSA 2ZO4A 5AIPA 1REPC 3GXOA 1A04A 1QPMA 1J0RA 4HX7A 1W5SA 5D5WB 1FX7A 2QYOA 1ZARA 4GCVA 1R36A 4Y13A 1MW3A 1OKRA 5JNLA 3ANMA 1TNSA 3KP7A 4HLYA 3IWFA 1T6SA 5JC1A 3WTXC 1FSEA 2RC4A 3BPXA 5LEJA 1XSDA 1JGSA 3RJPA 3GWZA 2YU3A 2HS5A 3WQSB 2BEOA 4L0YB 1QO0D 2IP2A 3GVAA 4RGXA 1EH7A 3K1NA 3E6CC 2ISYA 2E1NA 3ZHYA 5BS6A 4KA4A 4ESBA 1IN7A 4Q47A 1MZBA 1ON2A 3E5XA 5JI6A 4OIQF 4BHBA 5ILVA 2LNBA 4BAYA 4FLRA 3IRQA 4HF2A 4Q4ZF 4LLGF 1J5YA 2FMLA 3GFMA 2JPCA 2JPBA 4KT5C 2FRHA 3CUQA 4FX0A 1DPRA 2Y1CA 2HKXA 4XSZF 2HR3A 4Y67A 1ZG1A 2EWNA 2DPUA 3I59B 4HA8A 3WG9A 5CVVA 1W7PD 2B0LA 1QGPA 4IVNA 2O3FA 3COAC 1MJ9A 1YTYA 1J75A 4HF0A 1XMAA 3TDZC 3B73A 2JRTA 2A61A 4CICA 2DFIA 1TBXA 3WU1B 5TRDA 1G3YA 4AIHA 5LBQA 2GZWA 1I1GA 3QPTA 2RV8A 4EVIA 1P4XA 1F4KA 1B1BA 2STTA 1BBYA 4OIOF 1OYWA 1U2WA 2Q2EA 2Y1DA 5D5VB 1I27A 3WTUC 4GYIA 3ZMZA 1L0OC 2FOKA 5BPDA 2G7UA 5K5RA 2QBYA 3H92A 4WXDA 1LB2A 3KP5A 3GF2A 1S7OA 3F6VA 4LG0A 3MFKA 2ZFWA 2AS5F 1KQ8A 1E17A 5A2QZ 1UHMA 3MZHA 1J9IA 5E1XA 4XSXF 1MVYA 4KIBA 3C1DA 1YW8A 2MH2A 3WODF 5LRSA 2FXAA 3O3KA 3C7JA 2HTSA 1DP7P 1ZG5A 3VEPA 2V79A 4HLXA 4UV8A 4KNYA 1Z05A 3G73A 4UVBA 1RP3A 3V7SA 4G6DA 1O7LA 1UCRA 2VT2A 1W7PA 2PMHA 4HDVA 2LKPA 4CHUA 2IA0A 4WK8F 3BROA 2RDPA 3CZEA 2HGCA 3KETA 2NNYA 1ZYRF 4ENMA 1USSA 4RGUA 3EDPA 5L3FA 2BE5F 1DDNA 4ZQEA 1YG2A 3ZMSA 4YIFA 1LJ9A 1GXPA 3QP5A 2X4HA 2F2EA 2IA2A 3LQRA 2DTRA 3DF8A 5HS7A 4RAYA 3GLXA 2M45A 5J8FA 4UV9A 2FBKA 3REOA 2TDXA 2Y75A 1R0KA 2O61A 1ONPA 4OOEA 5FLXK 1S8NA 2LSOA 4ENKA 3LQQA 3D0SA 1BI1A 1F5TA 3GX4X 4LD5A 2JD2A 1XN7A 4HF1A 1BIAA 4G9YA 1ZAOA 4U0YA 3V8KA 5E1ZB 2UZKA 3SXYA 1R0LA 1LDDA 5LGUA 2XHKA 1IXCA 1D3YA 4RCVA 1BC7C 2EB7A 4NHJA 2JD0A 2EFNA 4EJOA 2Q8KA 3T5XA 2H6CA 2P5KA 5LLQA 4G94A 4I0BA 3RYPA 3WTWC 1SD6A 1MW1A 2RN7A 2LDUA 1KYWA 3TDUC 1YW9A 3K2ZA 3SZTA 3IWZA 3F8NA 4H0EA 3KLOA 2K02A 4ZQHA 1HSTA 2PMUA 5FB2A 4GO1A 4G7OF 5DUKA 1HKSA 2ZNYA 3QPHA 1DUXC 1FC3A 1O57A 5LGNA 4K2EA 4OU0A 3S2WA 1K78B 3CUQB 4RGSA 2K27A 4I7HA 4O3MA 4RB0A 4M71A 2RKHA 5EEGA 1YW7A 1R1VA 4KICA 2QENA 2HEOA 4CDGA 3L00A 2HTJA 1KU7A 2FMYA 4CXFA 4G7HF 2QQBA 1G3TA 2ZJ2A 4ZZLA 2O6GE 1RUOA 4YFXF 4A0YA 2ZBKA 3I5UA 4U0VA 2VN2A 4U0WA 1GHCA 3ZMUA 3P9KA 4M72A 1D8KA 3HUGA 1FP1D 4WXCA 3E6DA 4ESJA 2WPGA 5H20A 1MGTA 4GAEA 3F8FA 3R60A 3T8RA 4S04A 2M30A 4L5JA 4BXUA 3PFIA 4L9TA 2OD5A 2DU9A 4UXNA 4MNUA 4L5IA 1FBQA 5LEKA 2ADUA 4OIRF 1CF7A 3A06A 3WQQA 5JO0A 2P5LC 3OOPA 4XRFA 4AYSA 3EYIA 5JMWA 3HOSA 3NEUA 1MW0A 1QZYA 3KZZA 2JCXA 4QLCU 2R7FA 1G3SA 2IW5A 4JQFA 2P6SA 1ZH5A 5L3GA 1XCVA 1MDMB 2H27A 3WU0A 2JCYA 4I09A 3LA2A 3HYIA 3O2PE 4LK1F 4I2OA 3I4PA 2GAUA 1FP2A 2XVCA 1T1SA 1Z9CA 4LLLA 1LEAA 1CF7B 2W24A 3VODA 3K1PA 3HRMA 5HOOA 4JBAA 3RPUA 2IJLA 5BOXA 1MKMA 3DQVC 2CYYA 3E5UA 1P4AA 5LHGA 2L4AA 1G6NA 2G9WA 3UCQA 1ZHFA 3ISPA 2OQGA 5HS9A 2KJBA 1ULYA 1R5GA 5D4SA 1JHFA 1P4WA 3CZKA 4ZYDA 4KDPA 1YQAA 1STZA 4NB5A 2A69F 4EM1A 2OA4A 4UNOA 2MH9A 2XKPA 2FBIA 3GZ6A 1ZS2A 2Y1EA 4XLPF 2HZTA 3HHGA 2FF4A 1PP8F 1FZPB 1FYLA 3E5QA 5LHIA 1JE8A 1D8JA 4EM2A 3QOPA 4QWQA 3RTRA 4IF4A 1BI0A 2EFWA 1HW5A 2ELHA 2XROA 2F5FA 2H94A 2HFHA 2D1HA 3CO6C 5CVUA 4HBLA 4P9UA 2LF7A 3TOAA 3JTGA 4L9JA 5FO5A 3FF5A 4BHCA 3RPQA 2L02A 1IN8A 4ENJA 1ZN2A 3WTYC 5E17F 1WI9A 2Z3YA 3T0YA 5E8IA 1KU2A 1Z91A 2L4MA 3P9IA 4ENNA 5HS8A 1R5HA 4IRHA 2EK5A 1YO5C 1EV7A 3B02A 4CYDA 4EGYA 4ZQGA 1Z6RA 3ERED 1SFXA 1OR7A 5H6RA 3ZMDA 1AWCA 1XDSA 3Q9VA 2ISZA 2QVOA 1OYIA 4LB5A 2DPDA 1YLFA 1PP7U 3ML6A 1KU3A 2EFPA 2DI3A 3SHFA 4MGRA 2HQRA 2M5WA 1R7JA 2GA1A 2OQRA 2CFXA 4F7ZA 2DLLA 1WRJA 2QUFA 3AU9A 2HOEA 1LDJA 2CWEA 1FBSA 1P92A 1K7AA 1G4DA 4HV6A 1WSUA 1B9MA 5HDKA 4HZFA 5AIQA 2EV6A 2EA4A 5D5UB 3KEQA 2MD5A 2H09A 2O7GA 2F5EA 2VOPA 3LWFA 4I0AA 4KMUX 2IPQX 2VT3A 2DQRA 3DPTA 1EH6A 1Q0LA 1G5AA 5D6EA 4LJZF 3N4MA 4OOFA 4E70A 1RNLA 2Z99A 2EFQA 1MJBA 3DV8A 5D6FA 2GQQA 1UFMA 1HKTA 2QZ8A 5K1YA 4RB2C 1XCBA 4IPAA 2XAFA 4JK1X 3IKTA 3WQRA 2XASA 1ZRFA 3SQNA 3P7NA 4MQ9F 3V7RA 1R58A 1K78A 4Y15A 4OOIA 4R1HA 2ETHA 1XSVA 3BJAA 1YIOA 4FHTA 2NYXA 3LA7A 1ONOA 3GO5A 2EGHA 1U78A 2BBYA 2K7LA 3L09A 5F64A 3ULQB 1SFUA 4AWXB 2O03A 3V8LA 1T1RA 3U2RA 5FFZA 4R79A 2YX7A 1CGPA 3I64A 2XV4S 1GVJA 2V1XA 1RUNA 1BJAA 1HW1A 1XD7A 1RIOH 2XRNA 1IAWA 1YS7A 3F22A 4YFNF 4U7BA 1RZ4A 5L3BA 1OMIA 2WC2A 4CGZA 4N9IA 4RB1A 4AVPA 1ZG3A 2FU4A 3D5LA 2PG4A 1IF1A 3I59A 3ABUA 3CZGA 3C18A 3BJOA 5HDGA 4LGWA 2NAZA 1G3WA 5E20A 1FWZA 1KQ0A 1XDUA 1R23A 1O3SA 2YX4A 1XGSA 2KKOA 2MLGA 2W85A 3RIRA 2VBXA 4PDKA 3R0IA 4HAMA 4IJAA 1T98A 3WTSC 1ONNA 1LQ1A 4ON0A 1XB4A 1ZGAA 5J6XA 3T8TA 2YPRA 3BP8A 3DP7A 1BN5A 1H3LA 2JTVA 1S6LA 1O3RA 3FWEA 3CZLA 3TGNA 1RI7A 5JFRA 1FOKA 4Q48A 5EEHA 4MTEA 4Y6SA 3IKVA 1Z7UA 2QQ9A 1I6XA 2E7WA 2Z33A 2CGPA 1BIBA 2MC3A 1FBUA 1H9GA 1BC8C 1TQPA 5FLXZ 3EETA 4KMFA 2DT5A 3L9FA 2M1BA 3LA3A 2W25A 1TQIA 1I1SA 3TOBA 2PFBA 1OPCA 2KIFA 3ZQ7A 2YR2A 5D8LB 4EM0B 1WWXA 5BMZA 4IHTA 2EV5A 2IRFG 2WV0A 2NNNA 3F8CA 4IRIA 3MCZA 3KE2A 5CLSA 4S05A 1LDKB 2IVMA 4ASNA 1O3TA 3HSRA 4MTDA 2O0YA 1VTNC 2GWRA 5ED4A 3ANLA 2KIUA 3GEZA 4OINF 3L7WA 3ZP5A 2F5CA 2VE8A 5DEQA 4N0BA 1BI2A 4EV0A 1HKQA 5LHHA 3WTZA 1LVAA 3Q5FA 4WX9A 2G7HA 2R7DA 5CVRA 2Z9OA 5H6QA 3AU8A 4D0PA 2VBYA 2ZNZA 4B09A 4DNCA 4WWCA 2X0LA 3ZMTA 5BQTA 1ZLKA 5JBIA 1LEBA 1FT9A 3IHUA 2DK5A 3F3XA 1O7FA 3CLOA 2NS0A 3WE3A 2RGVA 2P7VB 2L01A 2K86A 5JMPA 3O6BB 2FEZA 3SFZA 3KP4A 1W4MA 5CVIA 1PDNC 3DPLC 1I5ZA 5ICEA 5DULA 3BJ6A 3E6MA 1XMKA 5D5XB 1J59A 1D5VA 3EUHA 3JAMK 1SD7A 1XSXA 4R8HA 3PQKA 2VE9A 4M74A 4UVCA 3R6SA 3AAFA 1H9TA 4HQMA 3EYYA 1Z6TA 4HX4A 1K79A 1FLIA 1Q0HA 2XAGA 3W6JB 1HSJA 4HV5A 2H6BA 3VFZA 3KCCA 2PBIA 3MWMA 1IRGA 3BPVA 4M6XA 3WGGA 4MEXF 4Q5SF 4RGRA 1FY7A 2OZUA 4KUMA 3J81Z 4LB6B 2PN6A 4LFUA 2J5PA 2IA1A 4PZJA 2VOOA 4LK0F 2OZ6A 5JHUA 5JR3A 3EQLF 4L9VA 4AD9A 4P5OA 4LLNA 5D4RA 1TNTA 2PI0A 5FGMA 1MJAA 5TJJA 4M73A 2L3DA 2P8TA 4AIJA 2CQKA 3MZYA 3WTTC 1KQ9A 1IRFA 1BI3A 1LNWA 5D8KB 3HHHA 3VOEA 2K4BA 4WCGA 3AUAA 3TO9A 2A3SA 3QP6A 2F5DA 3M8EA 2VBZA 3H3UA 4M9XA 4HYEA 1IN5A 4FLOA 1SFEA 1IXSB 3GZ5A 3M1EA 3CUOA 4RAZA 3HIFA 2ZMEB 3F6OA 2RQPA 3UERA 4TV7A 3BWGA 3RDIA 1JVSA 3ZPLA 3ZHZA 1SMYF 2Z5UA 1B59A 3JAMZ 5L3CA 4LUPA 4KYWA 4AICA 4EMSA 3JSOA 2ZXJA 1B6AA 1T0FA 4G6QA 3RI4A 3L2CA 2V6CA 2HKOA 3FM5A 4A0ZA 5HDNA 3CJNA 2LF8A 3PQJA 1IUYA 1ZRCA 1JG9A 2ZMEA 4ETSA 3NQOA 5IT9K 4HW0A 3FM3A 2ZKZA 1JXSA 1SD4A 3ZHXA 4UVAA 2C82A 4I02A 2FNAA 2V9VA 5L3EA 3MQ0A 3KZYA 4O6JA 3F23A 1S29A 4O5VA 4Z2YA 3JSPA 4EQQA 2DO7A 5DD8A 1U5TC 5DD4A 4Y6RA 5DCFA 3ZN0A 5CVJA 4EJVA 3HTUA 2VONA 4OMZA 3J80Z 3A14A 2ACJA 1F1ZA 3GFIA 1USTA 3H3ZA 6PAXA 3E3VA 4P9FA 2ZCWA 3R4KA 2XAJA 4Y6PA 1O3QA 1ODDA 1XGOA 2FBHA 4MQVA 3VB2A 2MLKA 3CUQC 5ILUA 3WTVC 4M6YA 1U8RA 2Y0MA 3KP3A 3ZMVA 3FMQA 1IW7F 2HYGD 2MAPA 5LGTA 3BY6A 4FLQA 3TKYA 2PJPA 1U3EM 4BH9A 3HTSB 5HVQC 2XUBA 1S46A 4HDUA 4UHTA 4KIGA 4MEYF 4P96A 4FX4A 2XIGA 4A12A 2DQLA 2W57A 4KFCA 4BQAA 1OYYA 2QLZA 2JT1A 3DKWA 2XGXA 4P55A 2GXGA 4WF2A 3U9GA 1S7AA 4ZYHA 3BZ6A 1B4AA 5KVRA 1KGSA 1Q0QA 4FLSA 5HLGA 5E1WA 4A6EA 3KP2A 3LAJA 3ECHA 1P6RA 3K9TA 4PGHA 1ON1A 2JD1A 5BPIA 5ILSA 3GFLA 1QBJA 2A5YB 4KN4X 1B9NA 2OAZA 1AOYA 4BNCA 3QU3A 2PLYA 2KIMA 1U6GA 4HOBA 3MEXA 4PGGA 3G3ZA 3JW4A 2GXBA 1SC5A 4ZYGA 1UHWA 1W5TA 4L18B 1ZGJA 1QNTA 5FD5A 1YFHA 1TQMA 1TW2A 1R1TA 3QRFF 3DEUA 4KN7X 3RKXA 1FNNA 1L3LA 2QQAA 5F1RA 5KK1A 4ZN6A 1HBXG 5K5OA 2CW0F 4EJUA 4GXOA 4RB3C 1J2XA 2DK8A 3E97A 2OBPA 3MAJA 3LAPA 3FXQA 5DV5A 1X3UA 1S3JA 2C6YA 1IN4A 5ICFA 2P4WA 2FE3A 3BOQA 4B8XA 1KYZA 2EJRA 3I58A 3CO7C 2M87A 1FPQA 3FXUA 2J5OA 2MBFA 4KIFA 3FXRA 1KU9A 4OIPF 3GYHX 1C0WA 3K69A 3TO7A 3F8MA 2VC0A 3F8BA 3OV8A 5A2QK 2P7CB 3FZVA 1T2KA 2MA3A 2D1VA 2FQ3A 3SZPA 4A5MA 4A5NA 2DBBA 2R3SA 5IT9Z 1JGIA 2DAOA 2KRFA 2JSCA 3M8FA 4L9NA 4XBFA 3W6KB 2V1UA 3IL2A 3IRRA
chains in the Genus database with same CATH superfamily
4XRSA 3BG9A 1FSHA 3OSFA 2EV0A 1A31A 2FNPA 2RJIA 2D2WA 2Q0OA 3PSFA 4A3DJ 2CSOA 5EEAA 3J7AO 2XAQA 5M5XJ 1OCZH 3BTLA 1ONVA 2VKVA 4U7DA 3K1MA 4C2TA 4DYQA 5F08A 4ESFA 1PVEA 4XORA 3DPUA 3QYEA 3ZN1A 1SMTA 3FMRA 2AXLA 2BXZA 2V1DA 3DXJF 3V4GA 5J8CA 1HW2A 2YS9A 1ZTRA 2QWWA 2R70A 1TLHB 3FUKA 2Y9ZA 4B43A 5HLHA 4Y17A 4Y7NJ 2EA2A 3RASA 1OCOH 1YRNB 4CZZA 2UXXA 4HX8A 2HYFA 2QJ1A 5ICCA 3GFJA 2DOFA 2HWVA 2Y69H 4A69C 2KLOA 2ZJRF 4HQEA 3CHOA 1R22A 2JSPA 3FXOA 3R61A 1HF0A 2ESHA 4ZYEA 3HSEA 1P2FA 1IZ1A 3F72A 2CJJA 3KEOA 1HLVA 2MAOA 2M0CA 4A03A 1LVKA 3I0TA 5AONA 5EJCA 2JA7J 2IS2A 3RC8A 1V3FA 3F0CA 2VXZA 2JUGA 1J09A 4II2A 2E35A 4L0ZB 4YG2F 2BYVE 1U5TB 5DDGA 3FUDA 5FFXA 2JJ7A 4BJTA 2JZYA 2P6TA 2CW7A 3LSPA 3S3OA 2A07F 1A6IA 3H9QA 3B34A 1GV5A 3U1DA 1BL0A 4ZW6A 5EZGA 2X1CA 2NRAC 4A6DA 2WZGA 2VKHA 3V8JA 3WGHA 1QRYA 3A1YA 1FYMA 4E7ZA 4XN5A 1X58A 1QZZA 1YS6A 1X1DA 1OQYA 1BOBA 2WAQN 3HOTA 2E5ZA 2RVCA 5K5QA 2Y48A 4U88A 3R0JA 1N77A 1XGMA 2Y1FA 4GGGA 2R7WA 4A0XA 3B7RL 2L7KA 3KYDB 2CG4A 4PJMA 1SAXA 1IRZA 1VNDA 5FD6A 2UXNA 2VQGA 4KT6A 3Q9SA 3CCQI 2ECCA 4UUSB 2Y1GA 2L7ZA 2IT0A 5CJ9A 2BGCA 4M9SA 3FHZA 2EFOA 3J80K 2W84A 4BXFA 4I99C 2JQ7A 2R7TA 4A93J 4LG3A 2K85A 2VXDA 5DYMA 3T1BA 1V5FA 3I54A 4S0HB 1T8IA 2Z16A 1FIAA 1DPUA 4G7ZF 1Q1HA 4CA0A 2GA2A 4WXHA 1T39A 1VQ9I 4Q4IA 2QBYB 5KNLA 3DEEA 2IGOA 3I53A 1VFCA 3VYSB 3GTQJ 2MW8A 2GTQA 2UV1A 3S93A 3NWTA 3CTAA 4B3XA 2A05A 2PEXA 1UJ8A 4BQOA 2FSWA 4YIRX 4NQWB 4PFPA 4N9HA 4B3AA 4FISA 2HOAA 1ZELA 1JHHA 4NUBA 5ICGA 4FCYA 1WJDA 2IAIA 5FJ8J 1H0MA 1ZREA 3FU3A 1IXRC 1RC9A 3QU6A 2RNJA 3ZI0A 1IN6A 1WQ2A 3OYFA 2OU2A 2VODA 2HYJA 4D5FA 1S72I 5IP9J 2EZIA 4RAFA 4DGWB 4KP7A 2R7ZJ 3TO6A 3F21A 1R1UA 1MD0A 1IGNA 5F0CA 1UB9A 4E7IA 5L3DA 1IV8A 2FA5A 3GBGA 2DJIA 2ESNA 3ANNA 3BTIA 5GAEJ 1WHUA 3V7CA 2KHMA 4NBQA 4AVZA 1TWHJ 3QAHA 1BOAA 2EH3A 4E7LA 2DW4A 4YFKF 3FX3A 3Q44A 2Z1DA 4BYYA 1MW2A 5IYDJ 4ZJZA 2OUMA 1FOXA 1A35A 4ZZDA 3ZQFA 4NQWA 1KA8A 3DLAA 1MIJA 5E18F 1H8AC 2WTEA 2ZSHB 3GTGJ 3PNYA 4K5LA 1E2XA 2GIVA 4RS8A 3AL0C 5CYVA 3RKWA 4EJWA 3ELKA 4XONA 3ROUA 5JVTA 1K4TA 2YSRA 3DEWA 3WGIA 4C3HJ 1TL8A 4F55A 1Z7LA 4GYGA 3C3WA 1QHHD 2D45A 1T08B 1I3AA 3KFWX 3P9CA 3R0AA 1LFBA 4OMYA 3K0LA 3ABTA 4L5EA 3HRUA 5C44J 3HW2A 4BBSJ 4BHPA 3OYMA 2X1DA 2PJRB 3VSLA 3LFKA 2HPTA 2IGMA 4CCMA 4PCQA 3TQNA 3FXKA 1BM9A 3GUDA 3Q0VA 2VKEA 3RYRA 3FMSA 3KP6A 2CO5A 3S2DJ 4Y3OA 2XKOA 1GXQA 4NNJA 5LD2C 2MC4A 3ECOA 3BG6A 2H1KA 2R7XA 1RR8C 4IXAA 5IYBJ 1ZRDA 3CC4I 2CU7A 3IRRA 3UEQA 4CO8A 1POGA 1TTYA 1WGXA 1MH3A 1Z1DA 1YHQI 2JCVA 2VC1A 4A2UA 2NOJB 4I98B 3J81K 1K5HA 2COMA 2XPVA 3GW2A 1T38A 1MDMA 4FETA 2WWYA 1H19A 3FHEA 2V26A 4IQJA 5JAZA 2HQNA 1VI0A 2M4GA 2M7AA 2VJ5A 2HPOA 1U5TA 3OL4A 2K4JA 3K70C 2AO9A 1HS6A 2M8EA 1HXDA 3CD6I 4LIVA 3J7YJ 4EJTA 3I9V2 3CP8A 3PJRA 2QVWA 3OYGA 3BDDA 5E8GA 2XAHA 1TW3A 3BQYA 5DM7F 1WJ5A 4ZDLA 3NRVA 3LSTA 2WAQA 5DCMB 3ZQCA 5ERIA 2R4GA 1Y0NA 2NXNB 3QQAA 1FYKA 2I10A 2L54A 4A3MJ 1SD5A 2W1OA 1EH8A 5LRRA 2XGCA 1IV6A 3CDHA 1AA7A 4LIUA 3G1OA 3WE2A 4CZCA 5M5YJ 3L1PA 3IC7A 3E6BA 3J7ZI 2O8XA 1V4RA 2B7EA 1PUEE 4ZH4F 1W7PB 4NDLA 2DMPA 2A6HF 2HDCA 4UUVA 4I01A 4YELA 4IHYA 2E2HJ 5BPPA 3I71A 4AYBN 4RAGA 3HGGA 4DBQA 4AIKA 3N97A 2O8KA 3H5NA 1WKMA 1K6OA 2XAUA 3M7GA 1X2NA 1QQIA 2KRHA 3DFGA 4IOCF 4IRGA 5E3LA 3W2VA 1FTTA 1JTXA 4EGZA 1NK2P 2ID3A 3DBRB 1R00A 2MYSA 2VQCA 1ZQ3P 4FT8A 4Q4EA 1OR7C 1XG1A 1Z21A 2STWA 3K4JA 4DQ2A 4AR8A 1HQCA 2WB1A 3HRTA 2PQ8A 3JTHA 2QM3A 4PUSA 3U9WA 2KJCA 3IIEA 3JRHA 1XGNA 1NHAA 5GPCA 4B44A 4RVBA 1F9NA 2JUCA 5HNHA 3SDGA 1Y0UA 1V54H 1U0JA 3HSFA 4Y52J 3RKYA 3BTJA 3M9AA 4M9ZA 4IZZA 4GFBA 5F6FA 4XLNF 2DFHA 1J7KA 5DCMA 2UWMA 5IT3A 2EIMH 2BV6A 5C4JJ 3FUMA 5HODA 4YIIA 2E1CA 1NH3A 1ETKA 5DUIA 4IHSA 2O5RA 3CDLA 1ZLJA 2VBWA 2A6EF 3BR2A 4PJNA 4LG0B 5AENA 2P5VA 4MHGA 2E7XA 2A68F 5HLIA 4ZQFA 2JVGA 4JX6A 4NC7A 3KLNA 3KPHA 3BG7A 1FEXA 3E7LA 4G8XA 1YYVA 4LMYA 3HRSA 3ZRGA 2V1NA 2ZO4A 5AIPA 1JKQC 1REPC 3HC7A 3GXOA 1W0UA 1A04A 2QSGX 1QPMA 1J0RA 4HX7A 4B48A 1W5SA 1FX7A 2QYOA 5D5WB 2XQ0A 4C2UA 1ZARA 4GCVA 1R36A 2R5ZB 4F92B 4Y13A 1MW3A 2F4IA 1VZ0A 1OKRA 3VDXA 3OYEA 5JNLA 3ANMA 1TNSA 3KP7A 3ZXSA 2QA4I 3IWFA 4C3JJ 4HLYA 3TEDA 1T6SA 3CMYA 1JJ8C 3WTXC 1FSEA 5JC1A 1HDPA 2RC4A 3BPXA 5LEJA 4XMZA 2Z2SB 1XSDA 1JGSA 3RJPA 3GWZA 1JTYA 4ZDPA 2YU3A 2HS5A 1MBHA 2BOLA 3WQSB 1ORKA 2BEOA 4L0YB 1BA5A 3M8JA 1QO0D 2IP2A 3GVAA 4RGXA 4DYRA 1EH7A 2PMZA 3K1NA 2ISYA 5TGTA 3E6CC 2E1NA 2AXTC 3ZHYA 5BS6A 4BJ6C 4KA4A 4ESBA 1IN7A 4Q47A 3LSJA 4XM3A 4DBRA 3FU6A 1MZBA 1ON2A 2KP6A 2P0WA 4JNDA 3E5XA 5JI6A 4XN2A 4ZX4A 1Y8QB 4XL9A 5EGOA 4OAZA 4UY8I 4OIQF 4BHBA 1TWCJ 5ILVA 5FROA 2LNBA 4BAYA 4FLRA 1XC5A 2V4JC 1F36A 2HXIA 3IRQA 1ZR2A 4HRIA 5CQEA 1K61A 1CQTA 4HF2A 3DBHB 4Q4ZF 4Z6YA 4LLGF 1J5YA 2FMLA 4ZW5A 3QYFA 3GFMA 2JPCA 3FK6A 3OYNA 1MNEA 5F27A 2WAEA 2JPBA 3FTSA 3KYCB 4KT5C 2FRHA 3CUQA 4FX0A 1DPRA 2QQ8A 4DIQA 3IAM2 2Y1CA 2HKXA 2R7OA 2HR3A 3DWLE 3QPSA 4XSZF 1ZG1A 4Y67A 2EWNA 4ITVA 2EINH 2DPUA 4XMXA 3I59B 1VQ7I 2NVTJ 3QODA 4HA8A 2DMQA 3WG9A 5CVVA 4BU2A 1W7PD 2B0LA 1QGPA 4IVNA 3SFIA 4GDFA 2O3FA 1D1CA 2E2IJ 2CH0A 4B4CA 4K5NA 4ARFA 3COAC 1MJ9A 3B7SA 3OIQA 5DS9A 2E1MB 1YTYA 4K5MA 1J75A 1WI3A 4HF0A 3BQZA 1B8IB 2CS3A 3HXLA 4QMEA 1XMAA 2ECBA 2KMUA 3A03A 5IOZA 2E34A 3TDZC 4X0GA 3B73A 2JRTA 2A61A 2KZGA 2WB1N 5KAIC 4XN7A 4CICA 3DTKA 4BE0A 1TBXA 2DFIA 3WU1B 5TRDA 1G3YA 1PJRA 3BG5A 3I55I 4AIHA 5LBQA 2GZWA 3NAUA 3OR1C 2DOAA 3KZIC 1I1GA 3MZ8A 3QPTA 2RV8A 4EVIA 1P4XA 1F4KA 1B1BA 4PFOA 1MSFC 2VI6A 3H9JA 2STTA 4R5TA 2LYCA 1BBYA 4OIOF 1OYWA 2M9HA 1MMAA 1Z0XA 1U2WA 2Q2EA 2VB6A 2Y1DA 5D5VB 3HEFA 3WHBA 1I27A 3WTUC 1VF9A 4GYIA 3LNQA 5M5WJ 4J19A 2HPMA 2HVRA 3ZMZA 1L0OC 4W97A 4BKXA 2FOKA 2DA1A 5FKLA 5IP6A 3CCUI 5BPDA 1M1EB 2G7UA 3IH4A 4BXXJ 5K5RA 2QBYA 3H92A 4WXDA 2KRCA 1LB2A 3KP5A 1UMQA 3D5SC 3GF2A 1S7OA 3F6VA 2K5CA 3DU5A 4LG0A 2ZFWA 3MFKA 2AS5F 1KQ8A 4UB8C 1E17A 4AYBA 3FTYA 2R7QA 5A2QZ 1ZR4A 4XLCA 1I3QJ 4E4HA 1UHMA 3MZHA 3H35A 1J9IA 2NOGA 5E1XA 1DP3A 4XSXF 2KL4A 2X6WA 1MVYA 3A02A 1VQPI 4KIBA 3C1DA 2A7OA 1YW8A 2K9NA 2DT7B 2MH2A 3WODF 5LRSA 1Y1WJ 2FXAA 3O3KA 3C7JA 5DTDA 2HTSA 1GLNA 1MMGA 1DP7P 1ZG5A 2O7OA 2QF7A 2E1OA 2VQHA 3VEPA 2V79A 4HLXA 5KAFC 4UV8A 4BE1A 4KNYA 4CH7A 1Z05A 1XPXA 1WJAA 3G73A 2WV1A 3OR2C 4UVBA 1D5YA 1R4NB 1RP3A 3V7SA 4G6DA 1O7LA 1X1PA 1UCRA 2VT2A 1UG0A 1W7PA 2E60A 2PMHA 4HDVA 4RMNA 4A3FJ 2LKPA 3BLYA 3N05A 3W2AA 2IA0A 4CHUA 4RBOA 4XN8A 4WK8F 3BROA 2EBIA 2RDPA 3CZEA 4EEFG 1GDTA 2HGCA 3KETA 1NG6A 2NNYA 1FMVA 1ZYRF 4ENMA 1USSA 4RGUA 3EDPA 3FUJA 5L3FA 2BE5F 1WZ2A 3CMEI 1DDNA 1HOMA 4ZQEA 4K5OA 1LUJB 1YG2A 3ZMSA 4YIFA 1KZHA 5KHDA 3GTJJ 1LJ9A 2CQ7A 1N25A 1GXPA 1TP4A 3QP5A 4ZTJA 2X4HA 2F2EA 2L2OA 3ASOH 2COBA 2IA2A 3LQRA 2BY1A 2EZHA 2DTRA 1RR7A 1ETOA 1UG2A 3QWLA 1JJ6C 3DF8A 2OPTA 5HS7A 2KT0A 4RAYA 3GLXA 2M45A 1OJLA 5J8FA 4UV9A 1IO2A 1JUMA 2AQEA 2FBKA 3REOA 3OYBA 3FUIA 4MFEA 3KYLA 2TDXA 2Y75A 2G0EA 1XMXA 1R0KA 2KPMA 2O61A 1JT0A 2DJNA 2EZLA 4H4KC 5J47A 1ONPA 2V6EA 4M3EA 4OOEA 3T8VA 5FLXK 1S8NA 2LSOA 2BXYA 4ENKA 2VQLA 4BQNA 3BC8A 3LQQA 3JREA 2PGGA 3D0SA 1BI1A 5DM6F 3B2PA 4R5VA 3M3YJ 1F5TA 2CMPA 3GX4X 4LD5A 1WFXA 2JD2A 1XN7A 1IC8A 4HF1A 2BW3B 1BIAA 4G9YA 1Y1VJ 1ZAOA 2LMDA 1T95A 3V8KA 4U0YA 3G1LA 5E1ZB 2UZKA 3SXYA 1R0LA 1LDDA 2DA2A 5B1BH 4BQQA 5LGUA 2XHKA 2LFBA 4DZPA 1IXCA 2VKDA 1D3YA 4XLAA 2K40A 1BC7C 1MW7A 4RCVA 4FE7A 3S16J 2EB7A 3P5JA 3ZR8X 4NHJA 4KJZA 2ZB9A 1YJWI 3HDDA 4X1EA 3GTKJ 4K5PA 2JD0A 2EFNA 2DTZA 1LFPA 4XICA 4EJOA 2Q8KA 3T5XA 2H6CA 4RLQA 5FKKA 1MH4A 2P5KA 2Q2EB 4Y4RA 5LLQA 4A3GJ 4FE4A 4G94A 3ZQIA 4I0BA 4CUGA 5J1RA 3RYPA 1VQKI 2IS6A 3WTWC 2CFOA 1SD6A 3BR0A 4BACA 1Z77A 2RN7A 2LDUA 1MW1A 1Q1VA 1KYWA 1I6HJ 3TDUC 1YW9A 3K2ZA 1W1WE 2DMTA 3SZTA 3IWZA 2CQXA 2W82A 3F8NA 3ONQA 5E3NA 4H0EA 3K4LA 3KLOA 1R9TJ 2K02A 4ZQHA 1P9QC 1HSTA 2PMUA 2E5NA 1AKHB 4PVBA 3TBIA 3OYAA 5J1UA 5FB2A 4UUSA 4GO1A 2X6YA 5E3OA 4J01A 4G7OF 5DUKA 1HKSA 2ZNYA 3ESWB 3RSNA 1R4MB 3QPHA 1DUXC 1FC3A 1O57A 5LGNA 4K2EA 4OU0A 1ZGWA 3FKJA 2OTLI 1H88C 3S2WA 1K78B 3OMYA 3RKQA 2M8GX 3CUQB 4RGSA 3AG2H 4XNFA 2K27A 2FQ4A 4I7HA 4O3MA 4RB0A 3E0JB 3GTOJ 4M71A 2L9VA 3JRAA 4RDUA 4RLFA 2RKHA 4XN1A 1VQ5I 4EATA 5EEGA 1YW7A 1R1VA 2HOSA 2DQ6A 3HM5A 2R93J 3IH3A 5B66C 4JX5A 2QENA 4KICA 3LOCA 4XRSG 4CDGA 2HEOA 2OCEA 3L00A 1BJZA 2HTJA 2ZXGA 1KU7A 3GMEA 2RQQA 2V9PA 4Y33A 2FMYA 4CXFA 4G7HF 4JYKA 2QQBA 1G3TA 2ZJ2A 4PU2A 3FH8A 2JA2A 1X1BA 3FKIJ 4ZZLA 1ERDA 2O6GE 1RUOA 3OL3A 4YFXF 3BCAA 4A0YA 3CCVI 2ZBKA 3I5UA 3VWBA 4U0VA 2VN2A 2CUZA 4U0WA 3TL4X 1GHCA 3ZMUA 1MBEA 3P9KA 2KISA 4M72A 3J7AY 2IEKA 4XLEA 4PJJA 1D8KA 5EG0B 1SVMA 1A36A 3HUGA 1FP1D 1QU3A 4ZW8A 4WXCA 3E6DA 3RQ4A 2DN0A 3SYTA 3B6AA 5F0FA 5H20A 1MGTA 3PIPF 5JVGF 4ESJA 1GT0C 2WPGA 4GAEA 1Y56A 3F8FA 3R60A 3T8RA 2DDAA 3HBLA 4S04A 4IO9F 2M30A 2LK2A 4L5JA 4BXUA 4X2UA 3PFIA 4L9TA 1K4SA 4D7NA 2K3FA 4R7LA 3VVMA 2OD5A 2DU9A 2L5QA 3RQIA 4AR9A 4RM3A 4UXNA 4MNUA 4XN0A 4L5IA 2E2JJ 1FBQA 5LEKA 2ADUA 4E7JA 1N75A 3HG9A 1RKWA 4OIRF 4QTRA 1CF7A 2CV1A 3A06A 3A0BC 3WQQA 5JO0A 3MN2A 2P5LC 2GM4A 3OOPA 3KX2A 4XRFA 3G6EI 4B1RA 3EYIA 4AYSA 4F91B 3HOSA 1TT5B 5JMWA 3NEUA 1MW0A 1QZYA 2VJ8A 2FJ1A 2ZMEC 2BY2A 1SEUA 3KZZA 4E6KG 2JCXA 4QLCU 2LBFB 2R7FA 4XQFA 1G3SA 3AG3H 3HUGB 3ZQGA 4CCJA 2IW5A 4CYCB 4JQFA 1MMDA 2P6SA 1UZCA 3CIAA 3S1QJ 1ZH5A 5L3GA 3GTMJ 2TCTA 2Q1ZB 1XCVA 2L9RA 1MDMB 2H27A 3WU0A 2JCYA 4I09A 1IUFA 3LA2A 4XLFA 3HYIA 1MBGA 3O2PE 3PFYA 4LK1F 4I2OA 3I4PA 1N78A 2GAUA 4CCNA 1B8IA 2LP0A 1FP2A 2WZFA 2XVCA 1T1SA 1Z9CA 4LLLA 1LEAA 3PSIA 1GV2A 3A2KA 2XGEA 1CF7B 1GW6A 1V5GA 1YRNA 2HQAA 2L9NA 2W24A 1MBKA 3VODA 3TW7A 3K1PA 3HRMA 5HOOA 3HPGA 3AFHA 4KISA 4JBAA 2RREA 1Z67A 4PJ0C 3RPUA 5E3MA 2IJLA 2L7FP 5BOXA 1MKMA 3DQVC 1VQLI 2CYYA 4D9JA 3E5UA 5KCMA 3VPRA 4HG2A 1P4AA 3IUOA 3ABKH 5LHGA 2L4AA 3BT9A 1G6NA 1U9NA 1WJBA 1FOYA 1IRXA 1ZHFA 2G9WA 4HNTA 3UCQA 3ISPA 3OYKA 1FIPA 2MABA 2OQGA 1XX5A 4JX4A 5HS9A 2DA5A 2K9SA 2YUSA 2YU9J 2KJBA 1UAAA 1ULYA 5GP9A 1R5GA 3BR5A 1VQNI 2BHYA 2VJIA 3ZQQA 1JHFA 1P4WA 5D4SA 3CZKA 4ZYDA 3QOEA 4KDPA 1YQAA 1STZA 4NB5A 2A69F 4EM1A 1S7EA 2OA4A 4IX7A 4UNOA 3GCMA 2MH9A 2XKPA 5J40A 5FLVA 1B72A 4BL0B 2FBIA 3H0GJ 3GZ6A 2X1EA 3K4MA 1ZS2A 4XKVA 2Y1EA 3G2BA 4XLPF 1APLC 2HZTA 5IPAA 3HHGA 3ZCOA 3MKZA 2FF4A 1PP8F 2TRTA 3GZNB 3JR9A 1OFCX 1FZPB 2HXOA 1FYLA 3E5QA 3I3LA 3ERMA 2VJJA 4J00A 5LHIA 4JP0A 1JE8A 1D8JA 2WA0A 4EM2A 1MBJA 3QOPA 4QWQA 4BEHA 3H36A 3RTRA 3SEQA 4IF4A 1BI0A 2EFWA 1ITYA 1HW5A 3EUHC 2QSHX 3CHRA 2ELHA 5EGOB 4DYCA 2XROA 5DYFA 2F5FA 2H94A 1ACIA 1D0YA 2HFHA 2D1HA 3CO6C 3MMYB 2DFEA 1Y8RB 3OWTA 2EIKH 1OISA 4HBLA 4PSXA 5CVUA 4P9UA 2LF7A 3TOAA 3V42A 5EF6A 4L9JA 3JTGA 2XPYA 2F4MB 2KDOA 2LC2A 3FF5A 5FO5A 3RPQA 4BHCA 2PL5A 4ZW3A 2L02A 3NARA 3H9GA 4ZDOA 2HQ5A 1IN8A 3OYIA 4ENJA 1ZN2A 3TMOA 2LD5A 3WTYC 1Y39A 2AHQA 3DU6A 3OY9A 5E17F 5IY5H 4E7SA 2DDBA 3FIWA 1WI9A 2Z3YA 3T0YA 2EIJH 2F4OB 3Q0WA 4LITA 5E8IA 4A3KJ 1AHDP 4XRMA 3PIOF 1KU2A 1Z91A 2L4MA 4XK4A 3P9IA 1QZEA 4ENNA 5CKTA 5HS8A 2EPFA 1R5HA 4IRHA 2EK5A 1YO5C 1HA8A 1EV7A 3K7AJ 3B02A 4M3DA 4ZW7A 2VJ4A 1A6QA 3PUUA 3JSZA 3FH7A 4CYDA 3AKZA 4EGYA 4X6AJ 4ZQGA 1Z6RA 2OC6A 3ERED 1SFXA 1TWAJ 1WCMJ 3HKZN 5HLTA 1OR7A 5H6RA 3ZMDA 4XN4A 4E7HA 1AWCA 1WJCA 1XDSA 3Q9VA 5C3EJ 2ISZA 4HNUA 5F1JA 2ZXHA 3G1MA 2QVOA 3CZ6A 3H5AA 1OYIA 4LB5A 2DPDA 1YLFA 2LY1A 1VQ8I 2M0MA 2ZFUA 1PP7U 3ML6A 2GBYA 2GIZA 3Q3SA 4CYCA 3D1NI 4BDYA 2Y0SA 3K10A 5J1YA 5BNGA 1KU3A 2EFPA 3WHCA 2W00A 2DI3A 4D7MA 5J4VA 3SHFA 3CJQB 2B63J 4MGRA 2ELJA 1G59A 2HQRA 2M5WA 1R7JA 2GA1A 3GTPJ 2OQRA 3S1RJ 2CFXA 2ELKA 3B37A 4F7ZA 4F52A 2DLLA 3PNVA 4ZX5A 1WRJA 2QUFA 3DKYA 2ZXWH 3AU9A 1A5JA 2HOEA 3LSHA 2M4KA 1LDJA 2CWEA 1FBSA 2QGUA 4CCKA 1P92A 3BG3A 5CPRB 1K7AA 1G4DA 4HV6A 3JRDA 1WSUA 1B9MA 5HDKA 4M3GA 2QCOA 1YX3A 3K4KA 4HZFA 2WBMA 5AIQA 2XF7A 2XF5A 4D1QA 1ZK8A 2EA4A 2EV6A 5D5UB 3FBIB 3KEQA 4PJLA 2MD5A 1SC7A 3CDIA 3B2XA 2H09A 2O7GA 2F5EA 2RNGA 3LSRA 2VOPA 3SEZA 3LWFA 4I0AA 4KMUX 2IPQX 3CMAI 2PJRA 2JK3A 4N4NB 2ZJQF 4IKFA 1WJEA 2VT3A 4A3CJ 1V55H 2DCEA 2A6TA 2DQRA 2OCCH 3DPTA 2W4SA 4QIRA 1EH6A 2K9LA 1NTCA 3D5RC 3OYLA 2DOEA 1S9HA 3DKXA 1Q0LA 1G5AA 3PO2J 5D6EA 2HI3A 4LJZF 3N4MA 4AC0A 4OOFA 1SVLA 2DA4A 4IHWA 2ICWG 4E70A 1RNLA 1RETA 2DT6A 2Z99A 2LH9A 1O4XA 5C4XJ 2EFQA 1MJBA 2R5YA 3DV8A 3EBGA 5D6FA 1P7IA 2GQQA 4BUPA 1AKHA 1MMSA 4MLOA 1UFMA 2CRGA 1JGGA 1HKTA 2QZ8A 5K1YA 5FWQA 4QIWN 3ABMH 4RB2C 1XCBA 1WH5A 4IPAA 2XAFA 2FFLA 4JK1X 3IKTA 3WQRA 2XASA 1W0TA 2HVSA 1ZRFA 2LLKA 3SQNA 2VPLA 2I5UA 3LL7A 4R5XA 3P7NA 3EBIA 4MQ9F 3V7RA 3L2UA 1R58A 3HL2A 1K78A 4Y15A 4V2FA 4OOIA 4R1HA 5FLMJ 2ETHA 3QJXA 2Y31A 4BY7J 1E3OC 2E71A 3FU5A 3RPUD 1XSVA 2V9KA 4RA2A 5FKMA 3BJAA 2GXAA 2VLAA 1YIOA 1HDDC 4XOPA 3H0DA 4FHTA 1ETYA 2BHZA 2HOTA 4XNBA 3CQZJ 2NYXA 3LA7A 1ONOA 3UKGA 3GO5A 2EGHA 1U78A 1U8BA 2BBYA 3C2HA 2K7LA 3L09A 5F64A 3CHPA 3ULQB 1SFUA 2ID6A 1SG7A 4AWXB 4QHPA 2O03A 2XF6A 2BY0A 4XKCA 3DCFA 3OYDA 2HU9A 3V8LA 2PUSA 2R0QC 2VUMJ 4YRVA 1T1RA 4KITB 3IP4B 3U2RA 1NG7A 2LVSA 3C2BA 5FFZA 4R79A 1T56A 2L0KA 3K2AA 2YX7A 2DYRH 1CGPA 1MNMC 2F6CA 3I64A 2E1MC 5JLXA 1OCCH 2XV4S 1GVJA 2V1XA 2BZTA 3EBHA 1RUNA 2XDVA 4L2LA 5EG0A 2LR8A 3CMMA 1BJAA 1HW1A 3VVLA 3HZJA 1XD7A 1RIOH 2XRNA 1IAWA 1YS7A 3F22A 4YFNF 3OS0A 2KQRA 4U7BA 1RZ4A 4ZX3A 5L3BA 3CCLI 1OMIA 4IHVA 3ZOBA 3DTIA 2WC2A 3BR1A 2XPZA 3FHNA 4N9IA 4CGZA 4RB1A 4AVPA 1ZG3A 3DLLF 2FU4A 3D5LA 2DYSH 3S2HJ 2PG4A 1IF1A 1S5LC 3S15J 3I59A 3ABUA 3CZGA 3C18A 2FUG2 1YE9A 2R92J 4QPQA 3BJOA 1G8XA 1X1AA 4BEHB 2M2EA 5HDGA 2HPIA 4FTHA 1TC3C 5E79C 4LGWA 4QUOA 1SFKA 3CF2A 4F93B 2NVQJ 2IGKA 2NAZA 1MBFA 1WVRA 5F0HA 4ZYAA 2XB5A 1G3WA 5E20A 1FWZA 2IXSA 1KQ0A 1XDUA 1R23A 2KIQA 1O3SA 1NK3P 4M3BA 4FCAA 5B1AH 2QKMB 1JUPA 1XGSA 2KKOA 2YX4A 2MLGA 4MKTA 2NVYJ 2W85A 3RIRA 2VBXA 4PDKA 3R0IA 4HAMA 4IJAA 4PSWA 3HOWJ 4BY1J 2FX0A 1T98A 2H8RA 3WTSC 1ONNA 4ZX6A 2V7FA 1LQ1A 2X48A 4ON0A 1PYVA 3BR6A 1XB4A 1ZGAA 1D0XA 5J6XA 1WPKA 2YPRA 4QPOA 3BP8A 3PUBA 3DP7A 5J4YA 5FRMA 4BGDA 5EDNA 4DPRA 1BN5A 1IJWC 5IYCJ 1XS9A 3S14J 1H3LA 3OS2A 2JTVA 1PUFB 4MS6A 1S6LA 1O3RA 1X3WB 2Y0SN 3FWEA 4BS9A 3CZLA 3TGNA 1RI7A 5JFRA 1FOKA 1JUSA 2M34A 4JOMA 1DU0A 1ETQA 4Q48A 5EEHA 4XMWA 4MTEA 4HSRA 3U1KA 4E7KA 4Y6SA 3IKVA 1Z7UA 2QQ9A 1I6XA 1DQUA 2E7WA 3MVPA 4IQ4A 2Z33A 2CGPA 1BIBA 2MC3A 1FBUA 1H9GA 1BC8C 3ZGKA 3HKZA 1TQPA 5FLXZ 3EETA 1QPIA 2XSDC 4KMFA 4PW4A 2XSJC 1GUUA 4A3EJ 2DT5A 1W36D 1TWGJ 4D5CA 2EQRA 2XPWA 4RSYA 2LY2A 1FMWA 2L7MP 1JKRC 4G12A 3L9FA 5GAHJ 2M1BA 3LA3A 3NWSA 2W25A 4AIDA 4BDZA 1TQIA 3PM1A 2X6XA 4XLHA 3B3BA 3SZGA 3S3MA 1EKEA 2IS1A 4ABZA 4XMUA 1I1SA 2LG4A 3TOBA 4II3A 1OLTA 2PFBA 1OPCA 2KIFA 2RAEA 3ZQ7A 2ZJPF 2YR2A 3L2WA 3M1CA 2QKLB 3WG7H 5D8LB 4EM0B 1WWXA 5K7HA 5BMZA 2ME0A 4IHTA 3QPLA 2BY3A 2EV5A 4XIDA 2IRFG 2WV0A 2NNNA 3F8CA 1QHGA 4IRIA 3MCZA 3KE2A 4IEJA 4NC8A 2JV7A 4XR6A 5CLSA 4S05A 3FTWA 1LDKB 3Q43A 2IVMA 4ASNA 1O3TA 5K7FA 4BBRJ 3HSRA 4MTDA 2O0YA 1VTNC 1RESA 1YX5A 2GWRA 3SDBA 3B6CA 4XO4A 5ED4A 3ANLA 3BZCA 2KIUA 4LOCA 5JLWA 5GPAA 3GEZA 1X4PA 3PL8A 4OINF 3L7WA 4HSTA 3ZP5A 1X3ZB 2XC7A 2F5CA 2VE8A 5DEQA 4N0BA 3RC3A 2JA8J 3UR3C 1BI2A 2MG4A 3CCMI 2GOXB 4ZC3A 2DXIA 3FUNA 4EV0A 2JRMA 3OYHA 1HKQA 5LHHA 1IDZA 3WTZA 4ZQTA 1LVAA 3Q5FA 3PUFA 4WX9A 2G7HA 2R7DA 1YITI 5CVRA 2Z9OA 4XNAA 5H6QA 4XKBA 3CESA 3AU8A 2ZC2A 2M7BA 4D0PA 2VBYA 2H1LA 2ZNZA 1VQOI 4B09A 4DNCA 4WWCA 2R59A 4J3BA 1W5CC 2X0LA 2MGQA 2HVQA 1E0EA 3ZMTA 4AU7A 4XN9A 5BQTA 1ZLKA 2DQMA 5JBIA 1LEBA 1FT9A 3IHUA 1IDYA 5IOYA 2DK5A 1LKXA 3F3XA 1O7FA 3CLOA 2NS0A 3WE3A 2RGVA 2P7VB 1LFUP 3FULA 2L01A 2K86A 2MD0A 3O6BB 5JMPA 3OYJA 3CC7I 2FEZA 4NC6A 3SFZA 3KP4A 1W4MA 5CVIA 4YEJA 1OCTC 1PDNC 2E19A 3K6GA 3DPLC 3L2VA 1K6YA 1I5ZA 5ICEA 3CF5F 3BJ6A 5DULA 2M3AA 1D0ZA 3E6MA 5B3SH 1XMKA 5D5XB 1J59A 1D5VA 3EUHA 3JAMK 1SD7A 1XSXA 2F48A 4R8HA 4AM3A 4M6VA 3PQKA 1AU7A 2HDWA 3I4MJ 2E36A 2VE9A 3M07A 4M74A 3CC2I 1D1AA 3CHSA 2DMNA 2NS7A 4UVCA 3R6SA 3AAFA 1H9TA 4HQMA 4IL6C 3EYYA 1X3ZA 1Z6TA 1X2MA 4HX4A 1YI2I 1K79A 1FLIA 1Q0HA 2XAGA 4C3IJ 3W6JB 1DGRM 1HSJA 1QVTA 4HV5A 2H6BA 1TWFJ 2QEXI 3PO3J 3AG4H 2LKSA 4XMTA 1YIJI 2CUJA 2OV7A 3VFZA 3KCCA 1LE8A 2PBIA 3MWMA 3Q0UA 1IRGA 1X3WA 1JKOC 3SJMA 1GVDA 1Y6IA 3BPVA 4M6XA 3WGGA 1YJ9I 3S1MJ 3OYCA 4MEXF 2OJED 4XN3A 4Q5SF 3K4CA 4RGRA 3KEDA 1FY7A 1MNDA 2OZUA 3H1CA 3JRFA 4KUMA 3J81Z 3FTUA 4LB6B 2PN6A 5GTHC 2LREA 3IV5A 4LFUA 2J5PA 2IA1A 1H89C 1YJNI 4PZJA 1SVOA 2VOOA 4LK0F 1FJLA 1ETWA 2OZ6A 3AL0B 5JHUA 5JR3A 2LY9A 2XRLA 2WY7Q 3EQLF 1EA3A 4L9VA 4AD9A 4FQGA 4P5OA 4XKWA 4LLNA 4DOZA 5D4RA 1TNTA 2VASA 2PI0A 2R7SA 5FGMA 1MJAA 5TJJA 4M73A 2L3DA 2P8TA 1BW6A 4AIJA 2CQKA 4UB6C 3MKWB 4A3BJ 2JWTA 4I76A 2B9SA 2N8GA 3MZYA 3WTTC 1ETXA 5DLLA 4V2GA 2CQQA 1BR4A 2CV2A 1KQ9A 1HCRA 1IRFA 1BI3A 1LNWA 1R6RA 2NVXJ 4GRIA 5D8KB 2X9DA 4C30A 3HHHA 5M3FJ 3S1NJ 3CCEI 3VOEA 1QA6A 2K4BA 4WCGA 1LE8B 1X4OA 3M4OJ 3AUAA 3TO9A 1JT6A 1FTZA 2A3SA 3QP6A 2F5DA 3EUAA 3M8EA 2VBZA 2R72A 3H3UA 4M9XA 5EZHA 2OTJI 2WAFA 1TT0A 4HYEA 1IN5A 3GTLJ 1SFEA 4CCLA 1OCPA 4FLOA 3EPZA 1IXSB 4UUTA 2R7UA 3GZ5A 3M1EA 3CUOA 1Z3XA 4RAZA 3HIFA 1IG7A 5LFAA 2ZMEB 3F6OA 2RQPA 3UERA 2D5VA 4TV7A 3BWGA 3RDIA 2K9MA 5H2FC 2BVMA 1JVSA 2CW8A 3ZPLA 3ZHZA 2W48A 1LPQA 1BR2A 1SMYF 4P1WA 2PMZN 5GTIC 3VYRB 2Z5UA 1B59A 2VL8A 3JAMZ 3L2QA 1E3HA 2X51A 1JKPC 5L3CA 3A01B 1BW5A 4LUPA 5FKNA 3VSKA 2CV0A 4KYWA 1PUFA 4AICA 4EMSA 3JSOA 2ZXJA 1B6AA 2H8WA 1T0FA 3QYBA 4G6QA 3RI4A 1F43A 3IH2A 3L2CA 2MSYA 3IAS2 3TP0A 2V6CA 5JHFA 1RRJA 2HKOA 3MD2A 2NS8A 1MSEC 3FM5A 4A0ZA 3CJTB 5HDNA 1EF4A 2IGNA 3CJNA 3HB9A 2R7VA 2LF8A 3TP3A 3PQJA 1IUYA 3S32A 1ZRCA 2HDDA 4A3LJ 2ZMEA 1JG9A 4ETSA 3NQOA 3W3CA 3LSKA 5IT9K 4HW0A 3CCRI 3FM3A 2ZKZA 2R7RA 1JXSA 1SD4A 3ZHXA 4UVAA 2C82A 4I02A 1BR1A 2FNAA 4F3QA 2V9VA 4GAAA 3HOVJ 3LFUA 5L3EA 3O8GA 3MQ0A 4CCOA 3KZYA 5FRNA 4O6JA 3F23A 3UNGC 1S29A 1E3PA 4O5VA 4Z2YA 1ZKGA 3FBNB 4N4OB 4C2MJ 3JSPA 1R49A 9ANTA 2DO7A 4EQQA 1U5TC 5DD8A 5DD4A 1WJFA 2KFDA 5B5EC 5DCFA 5M3MJ 3FUHA 3ZN0A 3OSGA 5CVJA 3CCSI 4EJVA 2DODA 3HTUA 2UUZA 2VONA 3CCJI 2WY8Q 4OMZA 2ME6A 3J80Z 2ACJA 1F1ZA 3A14A 3CCYA 1USTA 3H3ZA 3GFIA 6PAXA 3E3VA 4P9FA 2ZCWA 3R4KA 2K3PA 1RKTA 2XAJA 2LTPA 3X2QH 4Y6PA 1R71A 1O3QA 1ODDA 2CQNA 1XGOA 3A01A 1FOWA 3K70D 2C5ZA 5EV7A 2FBHA 3KIOA 4MQVA 2MLKA 3VB2A 3CUQC 5ILUA 3WTVC 2P81A 1DU6A 4M6YA 4RM2A 1U8RA 2Y0MA 3JRGA 3HOYJ 3FUEA 4I6ZA 1X1CA 3KP3A 3KEYA 3VYTB 4HEA2 3CJRB 3ZMVA 4ANJA 3FMQA 1IW7F 2HYGD 2MAPA 2JMWA 3JT1A 5LGTA 3FXLA 3C2GA 4DZJA 5IP7J 1G2HA 3BY6A 2XGDA 2K9QA 2FOWA 3RCOA 2GOMA 4FLQA 2IBDA 3PNTA 3TKYA 2PJPA 1U3EM 2CUEA 4BH9A 3HTSB 5HVQC 2Y30A 3S3NA 2XUBA 4XO5A 1S46A 4HDUA 2X85A 4DJAA 1TZLA 2LKXA 4UHTA 4KIGA 4MEYF 3MKLA 4P96A 4FX4A 2XIGA 3AG1H 4A12A 2DQLA 3HGYA 2W57A 1K83J 3FU0A 3JCUC 4KFCA 4BQAA 3A4CA 1OYYA 3OOUA 2QLZA 2JT1A 2DMUA 2DA3A 3DKWA 3JRCA 2VPRA 2XGXA 2GXGA 4P55A 4WF2A 4FASD 3U9GA 4CSWA 1OCRH 2A5WA 1SFOJ 1S7AA 3HPHA 2R5ZA 4ZYHA 3BZ6A 1B4AA 2HZDA 3FDYA 4HNVA 5FKOA 5KVRA 1KGSA 1Z3YA 1Q0QA 1X19A 3S17J 4FLSA 2L9SA 4AUXA 3BCBA 5HLGA 4W1UA 4IOAF 5E1WA 3B7UX 3E1SA 4A6EA 3KP2A 1VQMI 2EZKA 3LAJA 1W36C 3ECHA 1P6RA 3MKYB 1SANA 4XMYA 3RZDJ 3K9TA 1UHSA 4PGHA 1ON1A 1V5EA 2JD1A 5BPIA 2LOOA 4XO3A 5ILSA 2JA5J 3GFLA 1QBJA 3A0HC 2JA6J 1D1BA 3GLLA 2A5YB 4BE2A 4KN4X 3O8HA 3EUKL 3FH5A 1B9NA 4MFDA 2OAZA 4IHXA 1AOYA 4BNCA 3QU3A 1JI8A 2WADA 3FUFA 5K7ZA 2PLYA 1WH7A 1HC8A 2LBFA 1VQ6I 3S8PA 2KIMA 3LSIA 4C9YA 4A3JJ 4U87A 1U9OA 3CXBA 3CP2A 2CUFA 3OIOA 3HOZJ 1U6GA 4HOBA 3MEXA 4PGGA 3G3ZA 3JW4A 1VQ4I 2GXBA 2R5YB 2DA7A 4DW6A 1SC5A 3G71I 3W2WA 1KONA 4ZYGA 4A3IJ 1UHWA 3ZQLA 2DFFA 1W5TA 4L18B 1ZGJA 1QNTA 5FD5A 1YFHA 2I8DA 1TQMA 1TW2A 4Y6RA 1DGWY 1RPWA 2QSFX 1R1TA 1UELB 2DA6A 5EYRA 3QRFF 3ZQHA 3CLQA 3DEUA 4KN7X 1T33A 3RKXA 1FNNA 3BTCA 3FTVA 1I39A 1L3LA 3G4SI 2BW3A 3DTEA 2QQAA 5F1RA 2B61A 5KK1A 3U21A 4BJ5C 3K4NA 2JVHA 3ABLH 4OAYA 1HBXG 4ZN6A 1SAUA 2CW0F 3F9KA 4EJUA 3FXJA 4GXOA 5K5OA 4RB3C 1J2XA 2DK8A 3E97A 2OBPA 2ZXIA 3MAJA 4V19K 3B7TA 3CHQA 3LAPA 3FXQA 5DV5A 1X3UA 1S3JA 5GAGJ 1B72B 2C6YA 1EJ9A 1IN4A 5J3LA 3LMMA 2O9LA 5ICFA 2P4WA 2F5VA 2BVLA 2Y9YA 2Y2ZA 2FE3A 2GLOA 3BOQA 2W7NA 3VYUB 3K4BA 1MMNA 4B8XA 3I4NJ 2AQFA 1KYZA 4QSHA 3W6VA 1P7JA 3HOUJ 2EJRA 5HNFA 3DBLB 3I58A 3CO7C 4G6TB 3FK7A 3H5RA 2M87A 3OIPA 2HNHA 3WU2C 1FPQA 5CQGA 3HJEA 3FXUA 3FTZA 2J5OA 3BZKA 3I56I 2KDZA 2MBFA 3ASNH 3FISA 4KIFA 3FXRA 3LSMA 1KU9A 2ZSIB 4ZTFA 2PX9A 4OIPF 1ENHA 2XPUA 3BR3A 2MFZA 3GYHX 1C0WA 4MO7A 3K69A 2VIXA 1YOVB 4XNDA 3OS1A 2KZVA 1XTAA 3HOXJ 3RZOJ 3FTXA 2OF7A 3F8MA 2XB0X 2FD5A 5TISC 3TO7A 4MIMA 2VC0A 3F8BA 3OV8A 3H3VK 5A2QK 2P7CB 5GADJ 3FZVA 1T2KA 2JN6A 2MA3A 1QVUA 4XOTA 4PK4A 3FXMA 2D1VA 2FQ3A 2NVUB 3SZPA 4HPQA 4OWRB 1R5ID 1I50J 3TW6A 5F04A 4A5MA 4AR1A 1SQMA 4A5NA 1T0FC 2DBBA 2R3SA 3JRBA 2IS4A 4XMVA 3L2RA 5IT9Z 1JGIA 3JRIA 1ETVA 2DAOA 2KRFA 2JSCA 3LSGA 2LRDA 3M8FA 4L9NA 2EILH 4M3FA 4QPEA 4XBFA 3W6KB 2X6OA 2V1UA 3IL2A 3T8TA 4B47A
chains in the Genus database with same CATH topology
1FSHA 2EV0A 2FNPA 2RJIA 2D2WA 2Q0OA 2CSOA 3J7AO 2XAQA 1ONVA 4U7DA 3K1MA 4ESFA 3ZN1A 1SMTA 3FMRA 2AXLA 2V1DA 3DXJF 3V4GA 5J8CA 1HW2A 2QWWA 2R70A 1TLHB 3FUKA 5HLHA 4Y17A 2EA2A 3RASA 4CZZA 2UXXA 4HX8A 2HYFA 2QJ1A 5ICCA 3GFJA 2HWVA 4HQEA 3CHOA 1R22A 3R61A 2ESHA 4ZYEA 3HSEA 1P2FA 1IZ1A 3F72A 3KEOA 2MAOA 4A03A 3I0TA 5AONA 3RC8A 1V3FA 4L0ZB 2VXZA 4YG2F 2BYVE 1U5TB 5DDGA 3FUDA 5FFXA 2JZYA 2P6TA 2A07F 3B34A 3U1DA 4ZW6A 2NRAC 4A6DA 2WZGA 3V8JA 3WGHA 1FYMA 4XN5A 1QZZA 1YS6A 3HOTA 2RVCA 5K5QA 2Y48A 4U88A 3R0JA 1XGMA 2Y1FA 4GGGA 4A0XA 3B7RL 2CG4A 1SAXA 5FD6A 2UXNA 3Q9SA 2Y1GA 2IT0A 5CJ9A 2BGCA 4M9SA 3FHZA 2EFOA 3J80K 2W84A 5DYMA 3T1BA 3I54A 1DPUA 4G7ZF 1Q1HA 2GA2A 4WXHA 1T39A 4Q4IA 2QBYB 3I53A 2GTQA 3CTAA 2PEXA 2FSWA 4N9HA 1JHHA 5ICGA 1H0MA 1ZREA 3FU3A 1IXRC 3QU6A 2RNJA 3ZI0A 1IN6A 1WQ2A 2OU2A 2VODA 4KP7A 3TO6A 3F21A 1R1UA 1MD0A 1UB9A 5L3DA 2FA5A 2ESNA 3ANNA 3V7CA 3QAHA 1BOAA 2DW4A 4YFKF 3FX3A 3Q44A 4BYYA 1MW2A 4ZZDA 4NQWA 1KA8A 5E18F 2WTEA 4K5LA 1E2XA 2GIVA 4RS8A 5CYVA 3RKWA 4EJWA 3ELKA 5JVTA 3ROUA 2YSRA 3WGIA 4GYGA 3C3WA 2D45A 3KFWX 3P9CA 3R0AA 4OMYA 3K0LA 3ABTA 3HRUA 4BHPA 3LFKA 2HPTA 4PCQA 3TQNA 1BM9A 3GUDA 3RYRA 3FMSA 3KP6A 2CO5A 2XKOA 1GXQA 3ECOA 4IXAA 1ZRDA 3UEQA 4CO8A 1TTYA 1Z1DA 2JCVA 2VC1A 3J81K 4I98B 4A2UA 1K5HA 2COMA 3GW2A 1T38A 1MDMA 1H19A 2WWYA 3FHEA 5JAZA 2HQNA 2HPOA 1U5TA 2K4JA 1HS6A 2M8EA 1HXDA 4EJTA 2QVWA 3BDDA 5E8GA 2XAHA 1TW3A 3NRVA 3LSTA 5DCMB 5ERIA 1FYKA 2L54A 1SD5A 1EH8A 5LRRA 3CDHA 3WE2A 3IC7A 3E6BA 2O8XA 1V4RA 1PUEE 4ZH4F 1W7PB 2A6HF 2HDCA 4UUVA 4I01A 5BPPA 3I71A 4AIKA 3N97A 1WKMA 1K6OA 3M7GA 1QQIA 3DFGA 4IRGA 4EGZA 1R00A 4FT8A 4Q4EA 2STWA 4DQ2A 4AR8A 1HQCA 3HRTA 2PQ8A 3JTHA 2QM3A 3U9WA 2KJCA 3IIEA 1XGNA 1NHAA 4RVBA 1F9NA 5HNHA 1Y0UA 3HSFA 3RKYA 3M9AA 4M9ZA 5F6FA 4XLNF 5DCMA 1J7KA 2UWMA 5IT3A 2BV6A 3FUMA 4YIIA 2E1CA 5DUIA 4IHSA 1ZLJA 2VBWA 2A6EF 4LG0B 5AENA 2P5VA 4MHGA 2E7XA 2A68F 5HLIA 4ZQFA 3KLNA 4G8XA 1YYVA 4LMYA 3HRSA 2ZO4A 5AIPA 1REPC 3GXOA 1A04A 1QPMA 1J0RA 4HX7A 1W5SA 5D5WB 1FX7A 2QYOA 2XQ0A 1ZARA 4GCVA 1R36A 4Y13A 1MW3A 1OKRA 5JNLA 3ANMA 1TNSA 3KP7A 4HLYA 3IWFA 1T6SA 5JC1A 3WTXC 1FSEA 2RC4A 3BPXA 5LEJA 4XMZA 1XSDA 1JGSA 3RJPA 3GWZA 2YU3A 2HS5A 3WQSB 2BEOA 4L0YB 1QO0D 2IP2A 3GVAA 4RGXA 1EH7A 3K1NA 3E6CC 2ISYA 2E1NA 3ZHYA 5BS6A 4KA4A 4ESBA 1IN7A 4Q47A 3FU6A 1MZBA 1ON2A 4JNDA 3E5XA 5JI6A 4XN2A 4ZX4A 4OIQF 4BHBA 5ILVA 2LNBA 4BAYA 4FLRA 3IRQA 4HF2A 4Q4ZF 4LLGF 1J5YA 2FMLA 4ZW5A 3GFMA 2JPCA 2JPBA 3FTSA 4KT5C 2FRHA 3CUQA 4FX0A 1DPRA 2Y1CA 2HKXA 4XSZF 2HR3A 4Y67A 1ZG1A 2EWNA 2DPUA 4XMXA 3I59B 4HA8A 3WG9A 5CVVA 1W7PD 2B0LA 1QGPA 4IVNA 2O3FA 4K5NA 4ARFA 3COAC 1MJ9A 3B7SA 1YTYA 4K5MA 1J75A 4HF0A 4QMEA 1XMAA 3TDZC 3B73A 2JRTA 2A61A 4XN7A 4CICA 2DFIA 1TBXA 3WU1B 5TRDA 1G3YA 4AIHA 5LBQA 2GZWA 1I1GA 3QPTA 2RV8A 4EVIA 1P4XA 1F4KA 1B1BA 2STTA 4R5TA 1BBYA 4OIOF 1OYWA 1U2WA 2Q2EA 2Y1DA 5D5VB 1I27A 3WTUC 4GYIA 3ZMZA 1L0OC 4BKXA 2FOKA 5BPDA 2G7UA 5K5RA 2QBYA 3H92A 4WXDA 1LB2A 3KP5A 3GF2A 1S7OA 3F6VA 4LG0A 3MFKA 2ZFWA 2AS5F 1KQ8A 1E17A 3FTYA 5A2QZ 1UHMA 3MZHA 1J9IA 5E1XA 4XSXF 1MVYA 4KIBA 3C1DA 2A7OA 1YW8A 2MH2A 3WODF 5LRSA 2FXAA 3O3KA 3C7JA 2HTSA 1DP7P 1ZG5A 3VEPA 2V79A 4HLXA 4UV8A 4KNYA 1Z05A 3G73A 4UVBA 1RP3A 3V7SA 4G6DA 1O7LA 1UCRA 2VT2A 1W7PA 2PMHA 4HDVA 2LKPA 4CHUA 2IA0A 4XN8A 4WK8F 3BROA 2RDPA 3CZEA 2HGCA 3KETA 2NNYA 1ZYRF 4ENMA 1USSA 4RGUA 3EDPA 3FUJA 5L3FA 2BE5F 1DDNA 4ZQEA 4K5OA 1YG2A 3ZMSA 4YIFA 1LJ9A 1GXPA 3QP5A 2X4HA 2F2EA 2IA2A 3LQRA 2DTRA 3DF8A 5HS7A 4RAYA 3GLXA 2M45A 5J8FA 4UV9A 2FBKA 3REOA 3FUIA 2TDXA 2Y75A 1R0KA 2O61A 1ONPA 3T8VA 4OOEA 5FLXK 1S8NA 2LSOA 4ENKA 3LQQA 2PGGA 3D0SA 1BI1A 3B2PA 4R5VA 1F5TA 3GX4X 4LD5A 2JD2A 1XN7A 4HF1A 1BIAA 4G9YA 1ZAOA 4U0YA 3V8KA 5E1ZB 2UZKA 3SXYA 1R0LA 1LDDA 5LGUA 2XHKA 1IXCA 1D3YA 4RCVA 1BC7C 2EB7A 4NHJA 4K5PA 2JD0A 2EFNA 4EJOA 2Q8KA 3T5XA 2H6CA 2P5KA 5LLQA 4G94A 4I0BA 3RYPA 3WTWC 1SD6A 1MW1A 2RN7A 2LDUA 1KYWA 3TDUC 1YW9A 3K2ZA 3SZTA 3IWZA 3F8NA 4H0EA 3KLOA 2K02A 4ZQHA 1HSTA 2PMUA 4PVBA 5FB2A 4GO1A 4G7OF 5DUKA 1HKSA 2ZNYA 3QPHA 1DUXC 1FC3A 1O57A 5LGNA 4K2EA 4OU0A 3S2WA 1K78B 3CUQB 4RGSA 2K27A 4I7HA 4O3MA 4RB0A 4M71A 2RKHA 4XN1A 5EEGA 1YW7A 1R1VA 2DQ6A 4KICA 2QENA 2HEOA 4CDGA 3L00A 2HTJA 2ZXGA 1KU7A 2FMYA 4CXFA 4G7HF 2QQBA 1G3TA 2ZJ2A 4PU2A 3FH8A 4ZZLA 2O6GE 1RUOA 4YFXF 4A0YA 2ZBKA 3I5UA 4U0VA 2VN2A 4U0WA 1GHCA 3ZMUA 3P9KA 4M72A 1D8KA 3HUGA 1FP1D 4ZW8A 4WXCA 3E6DA 4ESJA 2WPGA 5H20A 1MGTA 4GAEA 3F8FA 3R60A 3T8RA 4S04A 2M30A 4L5JA 4BXUA 4X2UA 3PFIA 4L9TA 4R7LA 3VVMA 2OD5A 2DU9A 4AR9A 4UXNA 4MNUA 4L5IA 1FBQA 5LEKA 2ADUA 4OIRF 1CF7A 3A06A 3WQQA 5JO0A 2P5LC 3OOPA 4XRFA 4AYSA 3EYIA 5JMWA 3HOSA 3NEUA 1MW0A 1QZYA 2VJ8A 3KZZA 2JCXA 4QLCU 2R7FA 1G3SA 2IW5A 4JQFA 2P6SA 3CIAA 1ZH5A 5L3GA 1XCVA 1MDMB 2H27A 3WU0A 2JCYA 4I09A 3LA2A 3HYIA 3O2PE 4LK1F 4I2OA 3I4PA 2GAUA 1FP2A 2WZFA 2XVCA 1T1SA 1Z9CA 4LLLA 1LEAA 1CF7B 1GW6A 2W24A 3VODA 3K1PA 3HRMA 5HOOA 4JBAA 3RPUA 2IJLA 5BOXA 1MKMA 3DQVC 2CYYA 3E5UA 1P4AA 5LHGA 2L4AA 1G6NA 2G9WA 3UCQA 1ZHFA 3ISPA 2OQGA 5HS9A 2KJBA 1ULYA 1R5GA 5D4SA 1JHFA 1P4WA 3CZKA 4ZYDA 4KDPA 1YQAA 1STZA 4NB5A 2A69F 4EM1A 2OA4A 4UNOA 2MH9A 2XKPA 2FBIA 3GZ6A 1ZS2A 2Y1EA 4XLPF 2HZTA 3HHGA 2FF4A 1PP8F 1FZPB 1FYLA 3E5QA 5LHIA 1JE8A 1D8JA 4EM2A 3QOPA 4QWQA 3RTRA 4IF4A 1BI0A 2EFWA 1HW5A 3CHRA 2ELHA 2XROA 5DYFA 2F5FA 2H94A 2HFHA 2D1HA 3CO6C 5CVUA 4HBLA 4P9UA 2LF7A 3TOAA 3JTGA 4L9JA 2XPYA 5FO5A 3FF5A 4BHCA 2PL5A 3RPQA 4ZW3A 2L02A 1IN8A 4ENJA 1ZN2A 3WTYC 5E17F 1WI9A 2Z3YA 3T0YA 5E8IA 1KU2A 1Z91A 2L4MA 3P9IA 4ENNA 5HS8A 1R5HA 4IRHA 2EK5A 1YO5C 1EV7A 3B02A 4ZW7A 3PUUA 3JSZA 3FH7A 4CYDA 4EGYA 4ZQGA 1Z6RA 3ERED 1SFXA 5HLTA 1OR7A 5H6RA 3ZMDA 4XN4A 1AWCA 1XDSA 3Q9VA 2ISZA 2QVOA 1OYIA 4LB5A 2DPDA 1YLFA 1PP7U 3ML6A 1KU3A 2EFPA 2DI3A 3SHFA 4MGRA 2HQRA 2M5WA 1R7JA 2GA1A 2OQRA 2CFXA 3B37A 4F7ZA 2DLLA 4ZX5A 1WRJA 2QUFA 3AU9A 2HOEA 1LDJA 2CWEA 1FBSA 1P92A 1K7AA 1G4DA 4HV6A 1WSUA 1B9MA 5HDKA 4HZFA 5AIQA 2EV6A 2EA4A 5D5UB 3KEQA 2MD5A 3B2XA 2H09A 2O7GA 2F5EA 2VOPA 3LWFA 4I0AA 4KMUX 2IPQX 2VT3A 2DQRA 3DPTA 4QIRA 1EH6A 1Q0LA 1G5AA 5D6EA 4LJZF 3N4MA 4OOFA 4E70A 1RNLA 2Z99A 2EFQA 1MJBA 3DV8A 3EBGA 5D6FA 2GQQA 1UFMA 1HKTA 2QZ8A 5K1YA 5FWQA 4RB2C 1XCBA 4IPAA 2XAFA 2FFLA 4JK1X 3IKTA 3WQRA 2XASA 1ZRFA 3SQNA 4R5XA 3P7NA 3EBIA 4MQ9F 3V7RA 1R58A 1K78A 4Y15A 4OOIA 4R1HA 3QJXA 2ETHA 3FU5A 1XSVA 3BJAA 2VLAA 1YIOA 4FHTA 4XNBA 2NYXA 3LA7A 1ONOA 3GO5A 2EGHA 1U78A 2BBYA 2K7LA 3L09A 5F64A 3CHPA 3ULQB 1SFUA 1SG7A 4QHPA 4AWXB 2O03A 3V8LA 2PUSA 1T1RA 3U2RA 5FFZA 4R79A 2YX7A 1CGPA 3I64A 2XV4S 1GVJA 2V1XA 3EBHA 1RUNA 4L2LA 3VVLA 1BJAA 1HW1A 1XD7A 1RIOH 2XRNA 1IAWA 1YS7A 3F22A 4YFNF 4U7BA 1RZ4A 4ZX3A 5L3BA 1OMIA 2WC2A 2XPZA 4CGZA 4N9IA 4RB1A 4AVPA 1ZG3A 2FU4A 3D5LA 2PG4A 1IF1A 3I59A 3ABUA 3CZGA 3C18A 3BJOA 5HDGA 4LGWA 4QUOA 2NAZA 1G3WA 5E20A 1FWZA 1KQ0A 1XDUA 1R23A 1O3SA 4FCAA 2YX4A 1XGSA 2KKOA 2MLGA 4MKTA 2W85A 3RIRA 2VBXA 4PDKA 3R0IA 4HAMA 4IJAA 1T98A 3WTSC 1ONNA 4ZX6A 1LQ1A 4ON0A 1XB4A 1ZGAA 5J6XA 3T8TA 2YPRA 3BP8A 3DP7A 4DPRA 1BN5A 1H3LA 2JTVA 4MS6A 1S6LA 1O3RA 3FWEA 3CZLA 3TGNA 1RI7A 5JFRA 1FOKA 4Q48A 5EEHA 4XMWA 4MTEA 4Y6SA 3IKVA 1Z7UA 2QQ9A 1I6XA 2E7WA 2Z33A 2CGPA 1BIBA 2MC3A 1FBUA 1H9GA 1BC8C 1TQPA 5FLXZ 3EETA 4KMFA 4PW4A 2DT5A 4RSYA 3L9FA 2M1BA 3LA3A 2W25A 1TQIA 3B3BA 4XMUA 1I1SA 3TOBA 2PFBA 1OPCA 2KIFA 3ZQ7A 2YR2A 5D8LB 4EM0B 1WWXA 5BMZA 4IHTA 2EV5A 2IRFG 2WV0A 2NNNA 3F8CA 4IRIA 3MCZA 3KE2A 2JV7A 5CLSA 4S05A 3FTWA 1LDKB 3Q43A 2IVMA 4ASNA 1O3TA 3HSRA 4MTDA 2O0YA 1VTNC 2GWRA 4XO4A 5ED4A 3ANLA 2KIUA 3GEZA 4OINF 3L7WA 3ZP5A 2F5CA 2VE8A 5DEQA 4N0BA 3RC3A 1BI2A 3FUNA 4EV0A 1HKQA 5LHHA 3WTZA 4ZQTA 1LVAA 3Q5FA 4WX9A 2G7HA 2R7DA 5CVRA 2Z9OA 4XNAA 5H6QA 3AU8A 4D0PA 2VBYA 2ZNZA 4B09A 4DNCA 4WWCA 2R59A 4J3BA 2X0LA 3ZMTA 4XN9A 5BQTA 1ZLKA 2DQMA 5JBIA 1LEBA 1FT9A 3IHUA 2DK5A 3F3XA 1O7FA 3CLOA 2NS0A 3WE3A 2RGVA 2P7VB 3FULA 2L01A 2K86A 5JMPA 3O6BB 2FEZA 3SFZA 3KP4A 1W4MA 5CVIA 1PDNC 3DPLC 1I5ZA 5ICEA 5DULA 3BJ6A 3E6MA 1XMKA 5D5XB 1J59A 1D5VA 3EUHA 3JAMK 1SD7A 1XSXA 4R8HA 3PQKA 2VE9A 4M74A 3CHSA 4UVCA 3R6SA 3AAFA 1H9TA 4HQMA 3EYYA 1X3ZA 1Z6TA 4HX4A 1K79A 1FLIA 1Q0HA 2XAGA 3W6JB 1HSJA 4HV5A 2H6BA 4XMTA 3VFZA 3KCCA 2PBIA 3MWMA 1IRGA 1X3WA 3BPVA 4M6XA 3WGGA 4MEXF 4Q5SF 4RGRA 3KEDA 1FY7A 2OZUA 4KUMA 3J81Z 3FTUA 4LB6B 2PN6A 4LFUA 2J5PA 2IA1A 4PZJA 2VOOA 4LK0F 2OZ6A 5JHUA 5JR3A 3EQLF 4L9VA 4AD9A 4P5OA 4LLNA 5D4RA 1TNTA 2PI0A 5FGMA 1MJAA 5TJJA 4M73A 2L3DA 2P8TA 4AIJA 2CQKA 3MZYA 3WTTC 5DLLA 1KQ9A 1IRFA 1BI3A 1LNWA 5D8KB 3HHHA 3VOEA 2K4BA 4WCGA 3AUAA 3TO9A 2A3SA 3QP6A 2F5DA 3M8EA 2VBZA 2R72A 3H3UA 4M9XA 4HYEA 1IN5A 4FLOA 1SFEA 1IXSB 3GZ5A 3M1EA 3CUOA 4RAZA 3HIFA 2ZMEB 3F6OA 2RQPA 3UERA 4TV7A 3BWGA 3RDIA 1JVSA 3ZPLA 3ZHZA 1SMYF 2Z5UA 1B59A 3JAMZ 5L3CA 4LUPA 4KYWA 4AICA 4EMSA 3JSOA 2ZXJA 1B6AA 1T0FA 4G6QA 3RI4A 3L2CA 2V6CA 2HKOA 3FM5A 4A0ZA 5HDNA 3CJNA 2LF8A 3PQJA 1IUYA 1ZRCA 1JG9A 2ZMEA 4ETSA 3NQOA 5IT9K 4HW0A 3FM3A 2ZKZA 1JXSA 1SD4A 3ZHXA 4UVAA 2C82A 4I02A 2FNAA 2V9VA 4GAAA 5L3EA 3MQ0A 3KZYA 4O6JA 3F23A 1S29A 4O5VA 4Z2YA 3JSPA 4EQQA 2DO7A 5DD8A 1U5TC 5DD4A 3FUHA 4Y6RA 5DCFA 3ZN0A 5CVJA 4EJVA 3HTUA 2VONA 4OMZA 3J80Z 3A14A 2ACJA 1F1ZA 3GFIA 1USTA 3H3ZA 6PAXA 3E3VA 4P9FA 2ZCWA 3R4KA 2XAJA 4Y6PA 1O3QA 1ODDA 1XGOA 2C5ZA 5EV7A 2FBHA 4MQVA 3VB2A 2MLKA 3CUQC 5ILUA 3WTVC 4M6YA 1U8RA 2Y0MA 3FUEA 3KP3A 3ZMVA 3FMQA 1IW7F 2HYGD 2MAPA 3JT1A 5LGTA 3BY6A 4FLQA 3TKYA 2PJPA 1U3EM 4BH9A 3HTSB 5HVQC 2XUBA 4XO5A 1S46A 4HDUA 4UHTA 4KIGA 4MEYF 4P96A 4FX4A 2XIGA 4A12A 2DQLA 2W57A 3FU0A 4KFCA 4BQAA 1OYYA 2QLZA 2JT1A 3DKWA 2XGXA 4P55A 2GXGA 4WF2A 3U9GA 1S7AA 4ZYHA 3BZ6A 1B4AA 5KVRA 1KGSA 1Q0QA 4FLSA 5HLGA 5E1WA 3B7UX 4A6EA 3KP2A 3LAJA 3ECHA 1P6RA 3K9TA 4PGHA 1ON1A 2JD1A 5BPIA 4XO3A 5ILSA 3GFLA 1QBJA 2A5YB 4KN4X 3FH5A 1B9NA 2OAZA 1AOYA 4BNCA 3QU3A 3FUFA 2PLYA 2KIMA 1U6GA 4HOBA 3MEXA 4PGGA 3G3ZA 3JW4A 2GXBA 1SC5A 4ZYGA 1UHWA 1W5TA 4L18B