3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Transcription regulator/protein binding
molecule keywords Response regulator
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
3KEQA 3HRSA 4WX9A 3MCZA 2EV6A 3DF8A 3M9AA 1MDMA 2MAOA 3AU9A 2H6BA 4HDVA 4ZYGA 2ESNA 2HGCA 3KP4A 2EB7A 2NAZA 4EMSA 2KJCA 3GF2A 3E6DA 4GXOA 2M5WA 1PP7U 2A6HF 2L02A 4YFXF 2VOPA 3HUGA 2W24A 2M1BA 1RNLA 3BP8A 4A5MA 5FD6A 2Q2EA 1Z6TA 3L00A 5JC1A 5E18F 4OIPF 1RP3A 1YG2A 3WTXC 3KFWX 1S7AA 3FX3A 1R36A 1EV7A 1O7LA 2G7HA 2MLGA 1RUNA 5J6XA 3JSOA 2KIMA 3HSRA 1KU7A 4L0YB 2IPQX 1IUYA 2VE9A 1ZGAA 4G7OF 2FNPA 2BGCA 4OOIA 4BXUA 3QPTA 1ZRDA 3HHGA 1O3TA 4ZQEA 5E17F 4AYSA 2MD5A 2FEZA 1Z9CA 3DKWA 5DCMA 4ZQFA 1REPC 2Y1DA 1TQMA 1IF1A 3GFMA 2W25A 2LKPA 1AWCA 2A6EF 2KKOA 2HKXA 4P96A 1Z05A 3EQLF 5HLIA 5D6FA 1ONVA 4L0ZB 3SHFA 5BS6A 2DT5A 4M73A 2W85A 1P2FA 2MAPA 3WQRA 4YFKF 2K02A 4ENJA 5BMZA 1FX7A 4OIQF 1XGMA 3MEXA 5K5RA 2PFBA 1W7PA 5LLQA 4CYDA 2H09A 2FRHA 3T1BA 2LF8A 5LGNA 1O3SA 3UEQA 3K1MA 2A61A 3R4KA 3RPQA 2RV8A 2PQ8A 4I98B 2CQKA 3V7RA 4KT5C 5TRDA 2P5VA 3WTUC 1XDSA 4MTEA 4A2UA 1MW2A 3NEUA 4ZN6A 1MJ9A 2DPUA 4OMZA 3EYIA 4RS8A 2GXGA 2KIFA 4KIGA 5D8KB 3FMSA 1XSDA 4N9HA 3HTUA 4M9XA 3DEUA 4P9UA 1YYVA 3FMQA 3V7CA 4IRGA 1A04A 2EA4A 1LDJA 4L18B 4H0EA 3F22A 2ZMEA 3VODA 5E1XA 1S29A 1U2WA 1TTYA 2Z99A 2RQPA 3F23A 2HTJA 3PQJA 3JTGA 1T1SA 1BC8C 4CGZA 4YG2F 3CTAA 3G3ZA 1K6OA 4HYEA 2XASA 1STZA 1EH8A 1HKQA 5ILUA 2HTSA 3GZ5A 3K69A 2FQ3A 3P7NA 3DQVC 4XSXF 3BJAA 1H3LA 3L09A 2JTVA 4OOFA 3EUHA 5CVUA 3LSTA 3P9IA 1PUEE 2VBZA 4IXAA 4I0AA 5ILVA 4IPAA 2FXAA 2O61A 3N4MA 5BPIA 2QQAA 1MW3A 2NYXA 5E8IA 2STWA 2EA2A 4LB5A 1QQIA 4RB0A 3WTVC 2RKHA 2ZCWA 1FNNA 1SD7A 4FLOA 3F72A 1O7FA 5F1RA 1U5TC 3F21A 3I71A 3MAJA 1G6NA 4UXNA 4KNYA 4M6XA 3HRTA 4MNUA 3P9CA 3ANLA 3RKWA 1LEBA 1FLIA 3KP5A 2ZMEB 4E70A 1U8RA 3Q5FA 3L7WA 4M71A 1GVJA 1YFHA 4HF2A 3I58A 3QP6A 4KN4X 1O3QA 3WODF 3C18A 1IAWA 1YS6A 4MQVA 3IL2A 4UVCA 3Q9VA 1ONOA 1G3TA 2VT2A 2BE5F 2L01A 3GVAA 3CZEA 4U0WA 2YSRA 3WE2A 4LMYA 3KETA 5HVQC 4GO1A 5FGMA 1TQPA 5H20A 3PFIA 5KK1A 2JCYA 1IN8A 3JSPA 3P9KA 5DDGA 4Y67A 1XSXA 5DYMA 3M7GA 1ZRCA 4EGYA 4LLNA 1ZAOA 4IF4A 2DU9A 3I4PA 1TLHB 3EETA 2HZTA 3IWFA 2L3DA 5D4RA 3K9TA 4P9FA 2B0LA 1I6XA 4CXFA 4G7ZF 4Y17A 1FOKA 2LSOA 1LDKB 2FA5A 1F1ZA 2J5OA 4RGRA 3FHZA 4LD5A 5CYVA 1IXSB 2BBYA 2WPGA 3A06A 3ZN0A 3RDIA 2PJPA 4RB2C 4M9ZA 1UB9A 1U3EM 4WXDA 1SFEA 4GYGA 2K7LA 4G7HF 4L9NA 4GGGA 3CJNA 3KLOA 2MC3A 1D8JA 1FBUA 3C3WA 4ZYHA 1R1UA 3GXOA 3F8FA 1R5HA 2PLYA 1IRGA 4ZQHA 3OOPA 2HYFA 4EVIA 4RB1A 2EV0A 4FLSA 4HQMA 4Y6PA 1H9GA 2OBPA 2O03A 3LWFA 1SD4A 3BZ6A 5IT9Z 1KA8A 1FT9A 2DPDA 3O3KA 4LLLA 1P4WA 4KP7A 1G5AA 3GUDA 5HLHA 3KCCA 4EQQA 3J80K 2QZ8A 3F8CA 3HOSA 3FM5A 1B4AA 4PDKA 2ZXJA 3WU0A 3GFJA 3RYRA 2E1NA 5HLGA 2EFOA 4A6DA 4HF1A 3VB2A 4ESJA 2OA4A 2XUBA 3IHUA 1UHWA 2CFXA 4U7DA 1P6RA 4LG0A 4ESFA 1JXSA 4NB5A 3BOQA 2WWYA 1OR7A 4K2EA 4R1HA 2JD2A 2P5LC 1GHCA 3ZMTA 5K5QA 4L9JA 4M72A 3IC7A 2VT3A 2Q8KA 1J75A 1K5HA 2ISYA 1U6GA 3R61A 2C82A 3GX4X 1T1RA 5F6FA 1LEAA 1IRFA 3DPTA 5JI6A 2CWEA 3ABUA 3FZVA 2WV0A 5L3CA 3V4GA 5JR3A 2RNJA 3F6VA 1FYLA 3WTTC 2MLKA 5HOOA 4Y15A 3WE3A 3ZMZA 1G4DA 1LVAA 2HDCA 5D5VB 1I1GA 3TQNA 2VC1A 2IT0A 1R58A 2YR2A 2QM3A 2D1HA 2JPCA 1V4RA 3FMRA 2HWVA 2HR3A 2VONA 3K1NA 5L3EA 4PGHA 4BYYA 1USTA 3BJ6A 1KYZA 3C7JA 2JCVA 1FBQA 1B6AA 2MH9A 1FZPB 1T2KA 5L3FA 1W4MA 5TJJA 1P4XA 5ICEA 2K86A 4S04A 4WWCA 2V1UA 4Y6SA 1OKRA 2DK8A 3RTRA 3ZHXA 1VTNC 5E8GA 2HQRA 4UV8A 3LA3A 3O6BB 1Z1DA 5J8FA 1GXPA 4YIIA 2VXZA 5CVVA 3E5UA 2GIVA 2HOEA 2M30A 3ISPA 1U78A 3JAMK 2XAJA 5LGUA 1HKSA 1P92A 2IVMA 3WGIA 1YIOA 5A2QK 2VE8A 3CUOA 2FMLA 3FXRA 2OZUA 3ZHZA 4LFUA 5CLSA 3LA7A 2QQBA 5D4SA 4ZYDA 3ZHYA 4HA8A 1I1SA 5LRRA 1FSHA 3IIEA 2Z3YA 3KP3A 2YX7A 2OZ6A 2Y1CA 1ONNA 3E3VA 1FWZA 4P5OA 2VC0A 4FX4A 1JGSA 3D5LA 3VFZA 3AUAA 4L9TA 4G94A 1D5VA 2HKOA 3M8EA 1C0WA 3E6BA 1OPCA 3I54A 5JVTA 3UCQA 2XGXA 3AAFA 3LAPA 4OIOF 1FSEA 2QWWA 5FFZA 3QP5A 2Y48A 3TGNA 2YPRA 5ED4A 1U5TB 3WU1B 3ECHA 2Z33A 4ZYEA 4IHSA 1MW1A 1BI3A 3I53A 4FLQA 1XSVA 4PCQA 2EK5A 2H94A 3R0JA 1QZYA 5FLXZ 1MGTA 2Y0MA 2L4MA 3HYIA 2F5EA 4ENNA 1Z6RA 5FLXK 1FBSA 1ZLKA 3M8FA 2CO5A 3B73A 5D5WB 1WI9A 3J7AO 4Q48A 3R0AA 5HDNA 3QAHA 2F5FA 3RKYA 2A5YB 3ECOA 4M9SA 4RAYA 1SD6A 3BDDA 2FBIA 2CSOA 2EFPA 4MGRA 4IVNA 1OYIA 5E1WA 4GCVA 4MEXF 1WKMA 1MD0A 5JFRA 2PBIA 3GWZA 4WK8F 1U5TA 1EH6A 5DD8A 1ZGJA 4A6EA 1YO5C 2F5DA 4I0BA 1EH7A 2Z9OA 3RIRA 3FWEA 1CF7B 5BQTA 2DW4A 4HX4A 4F7ZA 2M87A 1OMIA 4ENKA 3V8KA 2DI3A 2OAZA 4HDUA 4EGZA 2FE3A 5FFXA 1HBXG 2XAFA 2EFWA 3I5UA 2C6YA 2P7CB 1PP8F 4L9VA 5JBIA 3L9FA 1QNTA 2Z5UA 2HFHA 2O6GE 4KFCA 1ON1A 2IW5A 1R0LA 1R23A 1KYWA 2PN6A 3SFZA 4BHBA 4Q47A 3NQOA 3WTZA 2IRFG 2WC2A 4AIKA 3ZMDA 4EM2A 4L5JA 3RPUA 2Y1FA 1FPQA 4O6JA 2Y75A 1YW9A 3GLXA 4EJOA 1LQ1A 5D8LB 4G8XA 5DUKA 3E6CC 1XMAA 2WTEA 2GA2A 3CLOA 2QVOA 1L0OC 6PAXA 5JNLA 1WRJA 2IP2A 3ZP5A 1WQ2A 3BWGA 4BAYA 3R6SA 4AIHA 3KP2A 2EFNA 3GW2A 4A5NA 4KIBA 1MJAA 3ZMVA 4GAEA 5LEKA 4YIFA 3KP6A 1IN7A 1JGIA 5K1YA 1TNTA 1S46A 2DFIA 4RGSA 2LDUA 1ZLJA 1Q0QA 1J2XA 1MJBA 5E1ZB 3DXJF 3OV8A 3NRVA 2JD0A 1R0KA 2R7FA 3RJPA 1T0FA 5DULA 2DLLA 1ZG5A 1FP2A 1TW2A 3V7SA 1O3RA 5DV5A 1Q0HA 4CICA 2XV4S 4HW0A 4LB6B 2BV6A 5AONA 5HS9A 2UXXA 3LQRA 2MH2A 3IWZA 4KICA 2R7DA 3SQNA 1K78B 3HIFA 2X4HA 2VBWA 5LEJA 4MEYF 5HDGA 3TO6A 3ML6A 4WCGA 3KLNA 3MQ0A 4DQ2A 5LGTA 3TKYA 1HXDA 2P5KA 2E7WA 5CJ9A 5ICFA 3ANMA 1OYWA 4NQWA 5ILSA 3HRMA 2NNYA 3HTSB 4N9IA 1ULYA 2V1XA 2D1VA 4IJAA 4KUMA 1BIAA 1ZHFA 2DTRA 3HHHA 4CDGA 1BOAA 5DUIA 2P6SA 2A07F 1G3WA 3ROUA 2VBYA 3IKTA 4DNCA 5J8CA 2W57A 4LK1F 4BNCA 3IRRA 1USSA 2RC4A 2V9VA 4KA4A 4IHTA 3LQQA 4A0XA 3REOA 1TBXA 1S8NA 3BPXA 1R7JA 4KN7X 5JAZA 4U0YA 4NHJA 5LHIA 3HOTA 3SZTA 5AIQA 3F8NA 2KRFA 1YS7A 2JPBA 4Y13A 2OU2A 1SFXA 1R00A 4RGUA 1DPRA 2ACJA 2EJRA 3ELKA 4HZFA 3RI4A 3TOAA 4EJWA 1YW8A 3AU8A 2VBXA 4CO8A 1YTYA 1Q1HA 2D45A 3ZPLA 1HSJA 1IN5A 1HW1A 4I09A 2GA1A 2IA0A 4Y6RA 2V6CA 4FT8A 2L4AA 1UHMA 1B59A 1SD5A 3F8MA 3I0TA 3KZZA 3RASA 2Y1GA 2XKPA 3MZHA 4AWXB 2LF7A 3QU3A 4UV9A 2FBKA 4EM1A 3K1PA 1LJ9A 3MZYA 2ADUA 1MW0A 1ZYRF 1OYYA 2XAHA 2F2EA 5E20A 1BI2A 1ZG3A 1CGPA 3Q9SA 3DPLC 5FD5A 2UWMA 4G9YA 4XBFA 3WTSC 3ERED 2COMA 1LNWA 5JO0A 4A0YA 1XCBA 3BPVA 4MHGA 3ABTA 4KDPA 3SXYA 3VEPA 4R8HA 1Q0LA 2L54A 2K4BA 4G6DA 2O8XA 2PMHA 5AIPA 1KQ0A 5ICGA 4XLNF 3LFKA 3ZMSA 2ISZA 4A03A 3V8JA 2FMYA 1WWXA 4AD9A 4UUVA 3VOEA 2QYOA 2DAOA 2LNBA 2MBFA 1FC3A 3D0SA 4A12A 2QBYB 1IW7F 4EJUA 3T0YA 4FHTA 1QGPA 2A69F 1G3YA 5H6QA 1B9MA 4RGXA 1V3FA 5L3GA 5HS8A 2CYYA 1K79A 3ZN1A 2GXBA 2UXNA 1MVYA 5LHHA 2ZFWA 2DK5A 1ODDA 4ON0A 1ZS2A 3J81K 1S3JA 3BY6A 1SMTA 3CUQB 4HV5A 1RIOH 1BBYA 1S7OA 5D5XB 3I59A 3MWMA 2STTA 4ZH4F 4JQFA 3GFLA 4KYWA 1HW5A 2G9WA 2K27A 2PEXA 2W84A 2XKOA 4L5IA 1IXRC 2QQ9A 4WXCA 1DPUA 3W6KB 2ZNZA 5FO5A 2BEOA 3GYHX 3H3UA 4FX0A 3QRFF 1SAXA 4Q5SF 3K0LA 2DBBA 2O7GA 5CVRA 4EM0B 4RB3C 1ZG1A 3ZMUA 1PDNC 5BPDA 5H6RA 4HX8A 4LK0F 2ZNYA 1MKMA 2QUFA 4N0BA 2HYGD 3GFIA 2VOOA 1XN7A 2FBHA 1NHAA 1BM9A 2PMUA 3G73A 1L3LA 2PI0A 4UNOA 4M6YA 1AOYA 2HQNA 4XLPF 5LBQA 1SC5A 4QLCU 3S2WA 3WG9A 3UERA 3CZLA 5HDKA 4XSZF 2BYVE 2ZKZA 3T8TA 2EV5A 2Y1EA 4HF0A 1JHFA 1JVSA 2A3SA 4HX7A 5IT9K 1TQIA 3LA2A 4I2OA 4BH9A 1J59A 2ZBKA 2QBYA 4A0ZA 2VN2A 1B1BA 2K4JA 5L3DA 4TV7A 1UFMA 1Z91A 2A68F 1LDDA 2FU4A 4GYIA 5FB2A 2DO7A 4BHPA 2AS5F 3ANNA 2EFQA 5HS7A 1G3SA 1QZZA 3DFGA 2JZYA 1BN5A 2XAGA 5DD4A 1KU3A 2DQLA 2XRNA 2KJBA 1QPMA 4BQAA 1TW3A 1E17A 1T38A 1ZRFA 4MQ9F 3ULQB 1WSUA 1JE8A 4R79A 4MTDA 2DQRA 3I59B 3R60A 1B9NA 4LUPA 3L2CA 3WGGA 1XGNA 4ZZLA 1GXQA 3KZYA 1IXCA 2FOKA 5EEGA 2HEOA 1D8KA 5KVRA 1BIBA 4ETSA 1YW7A 3B02A 2CGPA 2YX4A 3HSFA 4IRIA 4WF2A 2ESHA 3WTWC 3J81Z 2E1CA 3BJOA 1KQ8A 3TOBA 2Q0OA 4O5VA 3F8BA 4I01A 5CVJA 1E2XA 5DEQA 4EV0A 1RZ4A 1HKTA 3SZPA 1DDNA 2O0YA 1MDMB 5D5UB 1J0RA 1KU9A 3RYPA 3CZKA 5LRSA 1X3UA 4U88A 2OD5A 4KMFA 2QENA 3JTHA 1KGSA 2NNNA 4CZZA 4JK1X 2RVCA 3WGHA 1BC7C 1YLFA 3U1DA 1IN4A 3ZQ7A 1XD7A 1F4KA 3IRQA 1ZREA 2XROA 1ONPA 4UVAA 2XHKA 1BI1A 5JMWA 4HOBA 3E5QA 2JT1A 1JHHA 3QOPA 1QBJA 3CZGA 2AXLA 3HRUA 4O3MA 2IA2A 1P4AA 2FF4A 1LB2A 2M8EA 4FLRA 3EDPA 1S6LA 1IZ1A 1DUXC 1ON2A 1XDUA 3E6MA 1J5YA 4BHCA 5D6EA 3DV8A 3ZI0A 2P8TA 1IN6A 4RAZA 3QU6A 3F6OA 4Z2YA 3U2RA 3GZ6A 2JD1A 2TDXA 4ESBA 4G6QA 3H92A 3TDZC 3CO6C 2NRAC 2ELHA 1CF7A 2IA1A 2M45A 1FYMA 1XGSA 3TO9A 4OIRF 4S05A 1T6SA 3BROA 3FF5A 3N97A 2NS0A 2ZO4A 2CW0F 4I02A 1J7KA 3PQKA 2JRTA 1SMYF 2GQQA 5L3BA 3FXUA 4ZQGA 5BOXA 3V8LA 2P7VB 4RCVA 4ASNA 4YFNF 4AIJA 1MZBA 2IJLA 4OU0A 1HW2A 4LGWA 5DCFA 5LHGA 2V79A 1H9TA 3WTYC 1W7PD 4OMYA 4ZZDA 4KMUX 3CUQC 4OOEA 3CO7C 3U9GA 4OINF 1W5SA 1R5GA 2FNAA 4I7HA 4LLGF 1XB4A 2OQRA 1ZN2A 2P6TA 5CVIA 4KIFA 5ERIA 4WXHA 2V1DA 1I5ZA 3GEZA 3E5XA 5IT3A 2JSCA 2FSWA 3F3XA 2P4WA 3M1EA 2G7UA 2XVCA 4PGGA 1KQ9A 4ENMA 2XAQA 4HBLA 4AVPA 2JCXA 4EJTA 5A2QZ 3TO7A 2VODA 3KEOA 4Q4ZF 3I64A 2E7XA 2GWRA 3IKVA 4XRFA 2ETHA 4HLYA 4UVBA 2KIUA 3QPHA 3R0IA 1R1VA 4M74A 4P55A 3COAC 1ZARA 5ICCA 1QO0D 3GO5A 2RN7A 1R1TA 4IRHA 2H27A 3WQQA 3KP7A 2EWNA 1K7AA 2YU3A 1FP1D 2GAUA 2O3FA 1YQAA 3A14A 2RDPA 3K2ZA 4QWQA 1F9NA 3JW4A 1W5TA 2D2WA 2ZJ2A 3H3ZA 4U0VA 3CDHA 3T8RA 4PZJA 4LG0B 2EGHA 1ZH5A 3WQSB 2OQGA 4UHTA 4HLXA 5DCMB 3EYYA 1XCVA 1FY7A 2RGVA 2H6CA 1K78A 4HAMA 1SFUA 1O57A 2MA3A 4AICA 3O2PE 1D3YA 1R22A 2GZWA 2HS5A 1KU2A 1XGOA 1FYKA 1XMKA 3E97A 3C1DA 1F5TA 1BJAA 1J9IA 3HSEA 4HV6A 2PG4A 1H0MA 3W6JB 3KE2A 2J5PA 3CUQA 4B8XA 1T39A 3MFKA 1JG9A 1T98A 1TNSA 3J80Z 4JBAA 4D0PA 1Z7UA 2R3SA 1I27A 1Y0UA 4CHUA 2QLZA 3FXQA 1DP7P 5F64A 3T5XA 1RUOA 5JHUA 2XIGA 3DP7A 3TDUC 1W7PB 3FM3A 3RKXA 1UCRA 4EJVA 1HQCA 4HQEA 5JMPA 4B09A 1HSTA 5K5OA 2CG4A 3JAMZ 1BI0A 2F5CA 2UZKA 5EEHA 1RI7A 2X0LA 4LJZF 4U7BA 3LAJA
chains in the Genus database with same CATH superfamily
3KEQA 4ZX6A 3HRSA 4WX9A 3JRIA 3BQZA 3MCZA 2EV6A 3DF8A 1SVLA 3M9AA 1MDMA 2MAOA 1HOMA 3AU9A 2H6BA 4HDVA 4ZYGA 2ESNA 3AL0B 2HGCA 2HNHA 3KP4A 3OS1A 3NARA 1UHSA 2EB7A 2VIXA 2IS6A 3VYUB 2NAZA 2BOLA 2JJ7A 4PVBA 4EMSA 4RMNA 2KJCA 1R71A 5BPPA 3BR6A 3GF2A 3GTMJ 4X1EA 1Y39A 3E6DA 4GXOA 2M5WA 2OCEA 3FXKA 1NG6A 2A6HF 4CA0A 1PP7U 2L02A 2MW8A 2LR8A 4YFXF 2VOPA 2HXIA 4B48A 3HUGA 2W24A 1MH3A 2M1BA 2ZJQF 2ID6A 1IV8A 1RNLA 3BP8A 3ERMA 4A5MA 1HF0A 2DA1A 5FD6A 3C2BA 2Q2EA 1Z6TA 3L00A 5JC1A 5E18F 2VASA 5E3NA 4OIPF 2BHZA 1RP3A 1YG2A 1XTAA 3WTXC 3CC4I 3Q44A 1X1AA 3KFWX 1S7AA 3FX3A 1ZGWA 2AQFA 3IAS2 1IV6A 1R36A 1EV7A 1ACIA 1O7LA 2G7HA 2Y0SN 4RDUA 2ID3A 2MLGA 1RUNA 3S32A 5J6XA 1DQUA 3JSOA 2ECBA 1OQYA 2KIMA 4U87A 4FETA 4AVZA 3HSRA 3ZRGA 4AIDA 3HDDA 1KU7A 4L0YB 2IPQX 4F52A 3HOYJ 1IUYA 2VE9A 1ZQ3P 1ZGAA 1FMWA 4G7OF 2FNPA 2BGCA 4OOIA 2AHQA 4BXUA 3QPTA 1ITYA 1ZRDA 4ZW8A 3HHGA 1O3TA 1X4OA 4J19A 2W82A 2FOWA 2CW8A 4ZQEA 2JV7A 3M3YJ 4XNFA 5JLWA 5E17F 2VJ4A 4XO5A 4AYSA 4ZW6A 2MD5A 5E3MA 2NVXJ 2FEZA 1Z9CA 2G0EA 3DKWA 1MBKA 2L9NA 4H4KC 5DCMA 2F6CA 2AQEA 4IHYA 4ZQFA 1REPC 4I99C 4PSWA 5J3LA 2VKHA 2Y1DA 1TQMA 3B6AA 1IF1A 3GFMA 5GAHJ 2W25A 3GBGA 2LKPA 1AWCA 2A6EF 5FROA 2KKOA 1FOXA 2HKXA 3FUMA 3KYLA 3FHEA 4P96A 4CYCA 1Z05A 3EQLF 2MABA 5HLIA 5D6FA 1ONVA 4L0ZB 3SHFA 1WH5A 5BS6A 2DT5A 4M73A 2GXAA 4A3EJ 2W85A 3CLQA 5JLXA 2LH9A 1U0JA 4C30A 1G59A 2K5CA 3K7AJ 1P2FA 3DCFA 3MD2A 2EZIA 2MAPA 3HOXJ 3WQRA 3ZHXA 2BVLA 1LFPA 2DA5A 4YFKF 2VUMJ 4KITB 1ENHA 4RBOA 2K02A 4ENJA 5BMZA 2KPMA 1FX7A 4OIQF 1XGMA 3MEXA 5K5RA 2PFBA 2DQ6A 1N77A 1W7PA 5LLQA 3FU6A 2ZB9A 4CYDA 2H09A 3FXLA 4BY7J 5IP9J 3JRAA 2FRHA 3T1BA 2LF8A 5LGNA 4DZJA 5DTDA 5HLTA 2KDZA 1O3SA 3UEQA 3K1MA 3MKZA 2CUZA 3MKWB 2A61A 3R4KA 3OS2A 3RPQA 1V5EA 1MNDA 2RV8A 1YJ9I 4GDFA 1VQ8I 2PQ8A 4I98B 2CQKA 3OIOA 3MKLA 3V7RA 4KT5C 5TRDA 1W36D 4R7LA 2P5VA 3WTUC 2NVTJ 1XDSA 4MTEA 4A2UA 1MW2A 5FRNA 9ANTA 1EKEA 2V4JC 5C44J 2OTLI 3NEUA 1FOYA 4ZN6A 1MJ9A 2DPUA 3FTUA 4OMZA 3EYIA 4RS8A 2GXGA 2KIFA 4KIGA 2BY1A 2H1LA 5K7HA 5D8KB 2IS2A 4A3LJ 3FMSA 4ZX5A 2V7FA 1XSDA 4N9HA 3KYCB 3A03A 2L5QA 4E7JA 3HTUA 4M9XA 2NVUB 3V42A 2XQ0A 2W48A 3DEUA 4P9UA 1YYVA 3FMQA 3V7CA 1S72I 4IRGA 4PFOA 4HSRA 1A04A 1B72A 5J1UA 4ZYAA 2EA4A 5C4JJ 1BL0A 4ZDLA 1LDJA 4L18B 4J01A 4H0EA 3G2BA 3F22A 1V5GA 2ZMEA 3VDXA 3VODA 1ETOA 2KISA 5E1XA 1S29A 2BXYA 2XPZA 1U2WA 1TTYA 2NXNB 2DA4A 2EZHA 2QSFX 2Z99A 2RQPA 3TP3A 3F23A 2HTJA 3PQJA 3JTGA 1T1SA 1JKRC 3OMYA 1BC8C 4CGZA 4YG2F 1VQ5I 3CTAA 5E3OA 3G3ZA 1K6OA 2E2JJ 4HYEA 2XASA 1STZA 1EH8A 2PMZN 1HKQA 3FXMA 2QCOA 3DPUA 2R7TA 5ILUA 2HTSA 3BR3A 3BR0A 3HC7A 3ZQIA 4JYKA 3GZ5A 2VQGA 3ZGKA 3K69A 2FQ3A 3P7NA 1SFKA 1VNDA 5FJ8J 1IDYA 1GV5A 4FTHA 3DQVC 4XSXF 3S2HJ 2F4MB 3BJAA 5DM6F 3CCQI 1GLNA 3TW6A 1H3LA 3CIAA 3L09A 2JTVA 4OOFA 1TWGJ 3G71I 3EUHA 2AXTC 2KZGA 5CVUA 4A3FJ 3CHPA 3LSTA 3P9IA 4ZC3A 4XMTA 1BR2A 3Q0VA 4XN8A 1PUEE 4ZQTA 2XF6A 3CHRA 2VBZA 4IXAA 4I0AA 5ILVA 2L7FP 1T8IA 3OL3A 4IPAA 2FXAA 2O61A 1UZCA 3N4MA 5BPIA 1RRJA 3H5AA 2QQAA 4AC0A 1MW3A 2QVWA 2X1EA 2NYXA 2K9MA 2MSYA 5E8IA 2STWA 2EIKH 3W2WA 2EA2A 5B5EC 3U9WA 4LB5A 3BG5A 4XN0A 1QQIA 4EEFG 2KLOA 4RB0A 2V26A 3WTVC 1ZR4A 1SG7A 1FTZA 3WHBA 2RKHA 2ZCWA 1FNNA 1SD7A 4FLOA 2M4GA 3F72A 1O7FA 3OIPA 5F1RA 1U5TC 2O8KA 3MKYB 3F21A 2DA3A 3I71A 4A93J 3MAJA 1G6NA 2V9KA 2WY8Q 4UXNA 4KNYA 4M6XA 3S93A 3OOUA 3HRTA 4MNUA 4AM3A 3B37A 4PSXA 5M5YJ 3P9CA 3HZJA 3RKWA 3ANLA 1LEBA 2CRGA 2NS7A 1FLIA 4A3DJ 3VSLA 3KP5A 1X2MA 2ZMEB 4E70A 3KX2A 3I9V2 1U8RA 1X1DA 4XICA 3Q5FA 3L7WA 4M71A 5TISC 2W1OA 1XC5A 1GVJA 1YFHA 2RJIA 4ZW3A 4XRSA 4E4HA 4HF2A 3I58A 3QP6A 4JP0A 4KN4X 4GAAA 3Q0UA 1U9OA 1O3QA 3WODF 3C18A 1IAWA 1D0YA 1YS6A 4MQVA 3IL2A 4UVCA 1U8BA 3S1NJ 3Q9VA 2B9SA 1ONOA 1G3TA 4XMWA 1MMDA 2VT2A 2BE5F 2JA2A 4NQWB 1NTCA 3MN2A 2L01A 4UUTA 3GVAA 3B7SA 3CZEA 4U0WA 2GTQA 2YSRA 1AKHA 1GV2A 3WE2A 4LMYA 3KETA 5HVQC 4GO1A 4XLAA 1ZR2A 5FGMA 1TQPA 1NK2P 5H20A 3RZOJ 3PFIA 3S1QJ 5J1YA 3EPZA 1OCPA 1ORKA 5KK1A 2DYSH 2JCYA 1K4SA 1IN8A 2L7MP 2M0MA 3JSPA 2R7ZJ 2WV1A 5B66C 1RPWA 4ITVA 2HXOA 4KISA 1Z21A 3P9KA 2L9SA 5DDGA 4Y67A 2OPTA 1XSXA 5DYMA 3M7GA 1JKQC 2ZXHA 3FKJA 4EGYA 1ZRCA 1OCTC 1ZAOA 4IF4A 4LLNA 2DU9A 3I4PA 3HPGA 3IAM2 3K4LA 1VQOI 1TLHB 3EETA 4NC6A 1QVUA 1ZKGA 4NUBA 2HZTA 3IWFA 5M5WJ 4FE4A 3QOEA 2L3DA 5D4RA 2LY1A 1MBFA 3K9TA 4P9FA 2FFLA 1OLTA 2B0LA 1D1AA 1BW5A 3LL7A 2W4SA 5J40A 1I6XA 1XX5A 1JUMA 2BVMA 2DMQA 4CXFA 4G7ZF 3S8PA 5EEAA 4Y17A 4BKXA 3FTVA 1FOKA 2F5VA 4PJNA 4XKWA 5C3EJ 2BY2A 2LSOA 4K5LA 1LDKB 2FA5A 2BXZA 1F1ZA 2J5OA 4RGRA 3A4CA 4A3MJ 2W00A 4FCAA 2VKEA 3FHZA 4LD5A 2QEXI 5CYVA 4NBQA 1QA6A 3JREA 1CQTA 1IXSB 1UJ8A 2BBYA 2WPGA 3A06A 3ZN0A 3RDIA 2PJPA 1Z67A 3TW7A 4RB2C 1JKOC 4M9ZA 1UB9A 2QA4I 2ZXWH 5CQGA 1W5CC 1U3EM 4WXDA 1SFEA 2ME0A 4GYGA 2K7LA 4G7HF 4L2LA 4L9NA 3HOWJ 4GGGA 3CJNA 4BS9A 3KLOA 2MC3A 1R4MB 1Z3XA 3JRCA 2H8RA 1D8JA 1FBUA 4IQ4A 3PSIA 2XPVA 3C3WA 4ZYHA 1R1UA 5J47A 3GXOA 3F8FA 1R5HA 2VJIA 1MBJA 3RQ4A 2PLYA 1IRGA 4ZQHA 2M7BA 4BQOA 2R4GA 3OOPA 1MMNA 2EINH 2R59A 3HGYA 1DGWY 2HYFA 5CPRB 4ZTFA 4EVIA 1S9HA 1EJ9A 4RB1A 2GBYA 4RAGA 2EV0A 1GDTA 4FLSA 3CP2A 4HQMA 2PJRB 2VB6A 4Y6PA 1H9GA 2OBPA 2O03A 4UUSA 3LWFA 1SD4A 3BZ6A 5IT9Z 1KA8A 1FT9A 4XLCA 3O3KA 2DPDA 4LLLA 1P4WA 3LSPA 4AR9A 2WADA 3CQZJ 4KP7A 1JGGA 1G5AA 3GUDA 4IHXA 3I3LA 5HLHA 5K7ZA 1W0UA 4QMEA 3CJQB 3KCCA 4EQQA 1RKWA 3J80K 4XN3A 2QZ8A 2D5VA 1S5LC 3F8CA 3HOSA 2LG4A 4R5TA 4DYQA 3FM5A 1B4AA 4PDKA 2P81A 3FHNA 4MFDA 5DYFA 2ZXJA 3IH3A 2A5WA 2WB1N 3WU0A 3GFJA 2WY7Q 3RYRA 2E1NA 4XMUA 5HLGA 2BY0A 2EFOA 4A6DA 5F0HA 4HF1A 3FUFA 3VB2A 4ESJA 2OA4A 2XUBA 3IHUA 4YELA 3QPSA 1UHWA 2X6WA 2CFXA 1OCOH 4U7DA 1P6RA 4LG0A 2JK3A 4ESFA 5IYCJ 3DTEA 1MSFC 1JXSA 4NB5A 3BOQA 2WWYA 2ECCA 1OR7A 4K2EA 4R1HA 2JD2A 2P5LC 1GHCA 4XN1A 2MD0A 3ZMTA 3QYFA 3S3NA 3OYAA 5K5QA 3K4BA 3TBIA 4L9JA 4M72A 3IC7A 3A0HC 2VT3A 4LOCA 2Q8KA 1J75A 3HOUJ 1K5HA 1J59A 1JJ6C 2ISYA 4ZW5A 4II3A 1U6GA 4IEJA 1H89C 2X6XA 3R61A 5H2FC 2LVSA 3S17J 3GX4X 2C82A 4MKTA 1T1RA 3IH4A 5F6FA 1LEAA 5E3LA 1IRFA 3DPTA 5JI6A 4E7LA 2KQRA 2CWEA 3ABUA 3FZVA 2WV0A 4M3FA 3V4GA 4A69C 2RNJA 3F6VA 5JR3A 5GPCA 2MLKA 5HOOA 1FYLA 4ZDOA 4Y15A 4IHWA 2MG4A 2VPRA 3WE3A 2W7NA 3ZMZA 2MFZA 5TGTA 1G4DA 1LVAA 2HDCA 3RC8A 1UAAA 5D5VB 4CCLA 2FUG2 4II2A 4Z6YA 1I1GA 1B8IA 3TQNA 2VC1A 2KP6A 4E6KG 2IT0A 1R58A 3OYBA 1W0TA 2YR2A 2QM3A 3ASNH 1ZK8A 2GIZA 3VWBA 1VQ7I 3QYBA 3JRGA 4MIMA 1LPQA 2DOFA 2D1HA 2JPCA 1V4RA 3JSZA 3FMRA 3CHQA 1JUPA 2H8WA 2HWVA 3OYLA 1YITI 4A3BJ 4ZX3A 1WPKA 2HR3A 2VONA 3B7UX 1I6HJ 3K1NA 3FH7A 2VJ5A 4PGHA 5L3EA 2O7OA 4BYYA 2R7RA 4XQFA 1USTA 3BJ6A 1KYZA 3CCVI 3LOCA 2EBIA 3C7JA 1VQ4I 3S15J 1EF4A 2EH3A 2JCVA 2DA2A 2I10A 1FBQA 1B6AA 2MH9A 1FZPB 2EILH 1T2KA 4N4NB 2HPMA 1SVMA 1H19A 5L3FA 1W4MA 2E36A 2GOXB 5TJJA 2R5YA 4RVBA 1P4XA 5ICEA 5GP9A 2K86A 1S7EA 3PNYA 4S04A 4WWCA 1PUFB 2V1UA 4Y6SA 1OKRA 2DK8A 3H36A 3PNVA 5EZHA 3RTRA 5E8GA 1VTNC 3BG7A 4IHVA 2HQRA 5E79C 2JA5J 4UV8A 1E3HA 1I39A 1FTTA 4AU7A 4D5FA 1IG7A 3LA3A 2DMTA 3O6BB 1Z1DA 2A05A 3KPHA 3LSHA 4YIIA 2VXZA 4FQGA 1Z0XA 3E5UA 5CVVA 1F43A 2GIVA 2HOEA 1RKTA 4ANJA 2M30A 3H5RA 3ISPA 3JAMK 1U78A 5F08A 5GPAA 1B8IB 4XN9A 4XL9A 5J1RA 2XAJA 3SYTA 3BR2A 5LGUA 1HKSA 1P92A 2KRHA 3EUAA 4LIVA 3K70D 2IVMA 3WGIA 1YIOA 3B7TA 3DTIA 1FIAA 5A2QK 2VE8A 4FE7A 3CUOA 1OFCX 2FMLA 3FXRA 2HDWA 5EGOA 2OZUA 3ZHZA 4LFUA 2RAEA 1BR1A 3H9GA 5CLSA 1WJ5A 3LA7A 2EIMH 2QQBA 2I5UA 2CH0A 5B3SH 5D4SA 3PUUA 4ZYDA 1Y56A 3ZHYA 1P7JA 4HA8A 1I1SA 5LRRA 5LFAA 1FSHA 3IIEA 2Z3YA 3K70C 3KP3A 2YX7A 4LIUA 1POGA 2OZ6A 2VJJA 2Q2EB 5JHFA 2Y1CA 3OY9A 3W6VA 1ONNA 5FKKA 3E3VA 2KL4A 1FWZA 3DU5A 2CUFA 2R7SA 4P5OA 3M1CA 2VC0A 4FX4A 4A3GJ 1JGSA 3D5LA 3VFZA 3AUAA 2DT6A 3H9QA 4L9TA 4G94A 5J4VA 1AHDP 1D5VA 5IOYA 2HKOA 1N75A 4BL0B 3H0DA 3M8EA 5FLVA 3RCOA 1C0WA 3E6BA 2YU9J 1OPCA 3I54A 5JVTA 3UCQA 2XGXA 3AAFA 1A6QA 2UUZA 3LAPA 4OIOF 1FSEA 2QWWA 5FFZA 2TRTA 4M3EA 3QP5A 1TZLA 1X1PA 3FUKA 2Y48A 2HZDA 3SEQA 3TGNA 2YPRA 5ED4A 1U5TB 3WU1B 3ECHA 3LSRA 2Z33A 4ZYEA 4IHSA 2MGQA 1MW1A 1BI3A 3HJEA 3L1PA 3I53A 4BE1A 2B7EA 1IJWC 4FLQA 4BE2A 1XSVA 4PCQA 2EK5A 2H94A 3R0JA 1ETXA 4Y4RA 2N8GA 1SVOA 5F1JA 1QZYA 5FLXZ 1MGTA 2Y0MA 3HUGB 3B34A 4ZJZA 1T95A 2L4MA 3HYIA 3I4NJ 3L2WA 4OAZA 2F5EA 4ENNA 1Z6RA 5FLXK 1FBSA 2HYJA 3E0JB 1ZLKA 3M8FA 2CO5A 3B73A 5D5WB 2OC6A 1WI9A 3J7AO 4Q48A 3R0AA 5HDNA 3QAHA 2DMNA 3FUEA 3JRFA 2F5FA 3RKYA 1OISA 2A5YB 2DDAA 3ECOA 4M9SA 4RAYA 1SD6A 3B2PA 2DOEA 2FBIA 2LYCA 3BDDA 2CSOA 2EFPA 3U1KA 4MGRA 4IVNA 4M3BA 3Q3SA 1OYIA 4JX4A 5E1WA 1YRNA 4GCVA 4MEXF 3OS0A 2V9PA 3DBRB 3SEZA 3LNQA 5EZGA 1WKMA 1OCRH 1MD0A 2QSHX 3M8JA 4PJ0C 5JFRA 2PBIA 3B2XA 3GWZA 2DMPA 4WK8F 1U5TA 3AG3H 1EH6A 3IH2A 2HQ5A 2LP0A 5KHDA 5DD8A 1ZGJA 4A6EA 1YO5C 2F5DA 4I0BA 2QSGX 1EH7A 2Z9OA 4BDYA 3RIRA 3FWEA 1CF7B 3S14J 5EF6A 5BQTA 2DW4A 4HX4A 4F7ZA 5AENA 3P5JA 2M87A 3TP0A 1OMIA 2ZC2A 1E3PA 3NWTA 4ENKA 2FX0A 2JUCA 3V8KA 2DI3A 1G2HA 1X3WB 2OAZA 4HDUA 2WBMA 3BTJA 4EGZA 4IOAF 2FE3A 3CCYA 2R7OA 5FFXA 2VKDA 1MH4A 1HBXG 1B72B 4XORA 2XAFA 2EFWA 3I5UA 2C6YA 1RC9A 3OYIA 1KONA 2P7CB 3ZCOA 4AR8A 1PP8F 4L9VA 2M4KA 3T8VA 4GFBA 5F27A 5JBIA 5IP6A 3L9FA 3L2VA 4A3KJ 1QNTA 2Z5UA 3ABKH 1VQ9I 2HFHA 2O6GE 1T0FC 4KFCA 3BQYA 1ON1A 2CQ7A 2IW5A 4V19K 1R0LA 2LRDA 4QIRA 1R23A 4QHPA 2M3AA 1KYWA 2VL8A 2PN6A 4ZW7A 5FKOA 2VQCA 3SFZA 4BHBA 4Q47A 3NQOA 2K9LA 4Y52J 2LBFA 3ZXSA 3PL8A 3WTZA 4CCMA 2IRFG 2WC2A 3DU6A 4AIKA 3FULA 3ZMDA 4EM2A 4L5JA 3RPUA 1VI0A 2FJ1A 2Y1FA 1FPQA 3FIWA 3ZQFA 1SQMA 3H1CA 2HVQA 4O6JA 2QQ8A 3ASOH 1DP3A 4B3AA 2Y75A 1YW9A 1I50J 3GLXA 3LSIA 4EJOA 1LQ1A 3FU3A 5D8LB 3X2QH 2DN0A 4G8XA 3CHOA 4QPOA 5DUKA 3RC3A 3E6CC 1XMAA 1IRZA 1LFBA 3S1RJ 4Q4IA 2X48A 3LSJA 2WTEA 2GA2A 3CLOA 2QVOA 1L0OC 3GLLA 6PAXA 3G1OA 4ABZA 5JNLA 1WI3A 2X9DA 3M07A 3PO2J 1WRJA 2IP2A 3IP4B 3OYNA 3ZP5A 1LE8A 1WQ2A 2PJRA 1JTYA 3BWGA 2CMPA 3IV5A 4BAYA 2R92J 3R6SA 4XM3A 4W97A 2YUSA 1KZHA 4AIHA 3KP2A 3ZQGA 3EUKL 2EFNA 3OYCA 1JUSA 1N78A 5EJCA 3HKZA 3GW2A 4XMVA 4A5NA 2IGMA 4KIBA 1MJAA 1H8AC 2CW7A 3ZMVA 4GAEA 5LEKA 3DKYA 3PIOF 3VSKA 4BACA 4IZZA 1V5FA 3JRHA 3CCMI 4UY8I 4YIFA 4RAFA 3KP6A 1IN7A 1JGIA 2Y2ZA 5K1YA 2E1MC 4PJLA 1TNTA 1A5JA 1S46A 2DFIA 4RGSA 5FKNA 2QGUA 2VXDA 2KFDA 2LDUA 3VVLA 1D0ZA 1ZLJA 1Q0QA 1UMQA 1J2XA 1MJBA 4QSHA 5E1ZB 1WFXA 1LVKA 2L0KA 3SFIA 3DXJF 3OV8A 4G12A 2JWTA 1YHQI 3HOVJ 2DODA 3NRVA 3BC8A 1MSEC 2JD0A 1R0KA 2R7FA 3RJPA 5EG0B 1T0FA 1LFUP 5DULA 2DLLA 2EZLA 1ZG5A 1E3OC 5F0CA 4XNAA 2LK2A 1FP2A 1TW2A 3V7SA 1O3RA 2LMDA 5DV5A 3FUNA 1Q0HA 4CICA 2R7VA 2XV4S 1MBEA 4HW0A 2RREA 4LB6B 2BV6A 4XR6A 1TWAJ 1OR7C 5EGOB 1BA5A 4DW6A 2Z16A 3HL2A 5AONA 5HS9A 2IXSA 2UXXA 4B3XA 3LQRA 4BE0A 3GTOJ 2MH2A 2X6OA 3IWZA 4KICA 2R7DA 2ZJRF 3SQNA 1WZ2A 2NVQJ 1K78B 1JJ8C 2M8GX 1I3AA 3BR5A 2X4HA 3HIFA 1FMVA 4XMYA 3CDLA 4GRIA 2VBWA 1U9NA 5LEJA 4MEYF 2WAFA 3A1YA 3IUOA 3K10A 5HDGA 2XGDA 3TO6A 3ML6A 4WCGA 2B63J 1DGRM 4D7MA 3BG9A 3KLNA 3MQ0A 1XS9A 3H35A 3K4MA 2PX9A 3K4CA 1SEUA 2KDOA 1AA7A 4DQ2A 5LGTA 3B7RL 2GM4A 1MMAA 3TKYA 1HXDA 2P5KA 2XAUA 5F04A 1GVDA 4XMZA 3QODA 3PO3J 2E7WA 4XO4A 4CCOA 5CJ9A 4I6ZA 1YX5A 2BY3A 1WCMJ 3KYDB 5ICFA 3ANMA 1OYWA 4PJJA 1VQMI 4NQWA 2R7XA 5ILSA 4BXXJ 1QVTA 3FK6A 2Y69H 3RKQA 2P0WA 2DFFA 1AKHB 3ESWB 2HI3A 3EBHA 1MW7A 3HRMA 2NNYA 3HTSB 3C2HA 2M9HA 4N9IA 1ULYA 3BTCA 2V1XA 1PJRA 2D1VA 2L9RA 3C2GA 2FQ4A 4IJAA 3FUDA 1Y8QB 2EZKA 4KUMA 1MIJA 1BIAA 4HSTA 1ZHFA 2DTRA 3Q43A 3BG6A 4XKBA 3HHHA 3KZIC 4CDGA 1BOAA 2K40A 5DUIA 1FIPA 2OUMA 4FASD 4MO7A 3FTZA 3DTKA 3OYEA 1J09A 3G4SI 2P6SA 2A07F 1G3WA 3ROUA 3OYMA 3DBLB 2VBYA 3IKTA 1PUFA 1QZEA 2R7WA 4DNCA 5J8CA 2W57A 2JVHA 4LK1F 2K9SA 2WAQN 4BNCA 1TL8A 3IRRA 1X4PA 3B6CA 1YJNI 4C2TA 1USSA 3CXBA 1VQNI 2RC4A 1QRYA 2V9VA 5HNFA 4QTRA 4KA4A 2DA7A 3GZNB 4YEJA 4IHTA 3LQQA 1UG0A 3SDGA 3WG7H 4A0XA 3CMEI 1VFCA 3GTPJ 3REOA 4JX5A 1TBXA 1S8NA 2DTZA 3BPXA 3CESA 1RETA 1R7JA 4KN7X 5JAZA 4U0YA 1D5YA 4NHJA 5LHIA 2KT0A 2FD5A 4UUSB 3SZTA 3HOTA 3D1NI 2HOTA 2JSPA 2XB0X 5AIQA 4IOCF 2JA8J 3F8NA 2KRFA 2OF7A 4XMXA 1IUFA 2ELJA 3PUBA 1YS7A 2JPBA 3KEYA 4DGWB 3H3VK 3WU2C 4Y13A 4D7NA 1N25A 3JRDA 2OU2A 1SFXA 1R00A 4RGUA 2H1KA 1MMSA 2COBA 1DPRA 2E2IJ 2ACJA 2EJRA 2ZMEC 4HRIA 3ELKA 4HZFA 3RI4A 3TOAA 4V2FA 2Z1DA 4IQJA 2R7QA 4EJWA 3FUIA 3CD6I 1YW8A 3JCUC 3AU8A 4JX6A 2CUJA 2VBXA 4AYBN 4DBQA 2CV1A 4CO8A 4B1RA 2XSJC 1YTYA 2HQAA 1Q1HA 2D45A 3ZPLA 1HSJA 1IN5A 1HW1A 2Y9YA 1T08B 4CZCA 2Q1ZB 4DBRA 4I09A 2GA1A 2WB1A 2IA0A 2X1CA 2Z2SB 1Y8RB 3OSGA 4Y6RA 3CF2A 4XOTA 2PL5A 2V6CA 4FT8A 2L4AA 3SZGA 1Q1VA 4E7HA 5LD2C 1JKPC 1UHMA 1R4NB 4ZDPA 2LY2A 1B59A 4PUSA 1SD5A 3F8MA 3I0TA 3KZZA 4K5MA 2Y30A 3RASA 2Y1GA 4XLFA 2DCEA 2R0QC 2XKPA 2NOGA 4OAYA 4XRMA 1A31A 3OR2C 1MNMC 4XN5A 2XPYA 3JRBA 3MZHA 4AWXB 4B47A 2LF7A 3QU3A 3SJMA 4UV9A 2B61A 5EV7A 1XPXA 2FBKA 4EM1A 3K1PA 3ZQCA 1LJ9A 2JUGA 3MZYA 5B1BH 3VPRA 4K5NA 2HDDA 1WJAA 5FLMJ 2ADUA 1Y0NA 1ZYRF 3HPHA 1IGNA 1MW0A 1OYYA 2XAHA 2F2EA 5E20A 1BI2A 1W1WE 1ZG3A 2NOJB 2VJ8A 3OR1C 4BXFA 3Q9SA 1WJFA 1CGPA 3DPLC 3HOZJ 2BW3B 2DMUA 1UG2A 2ZFUA 5FD5A 2UWMA 4X6AJ 3ONQA 2X85A 4G9YA 4F93B 2LD5A 4PU2A 4XBFA 4CCJA 4R5VA 3WTSC 3ERED 5M3FJ 3M4OJ 2COMA 3H0GJ 1LNWA 5JO0A 4A0YA 1XCBA 1JTXA 3BPVA 4MHGA 4DYRA 3ABTA 4KDPA 3TEDA 2LOOA 4DJAA 3SXYA 2DJIA 3VEPA 4D5CA 3VYSB 2XB5A 4E7ZA 4D9JA 2LBFB 4ZX4A 4R8HA 2ME6A 3K6GA 4QIWN 3EUHC 1Q0LA 2L54A 2M2EA 4XNBA 1TT0A 2K4BA 4G6DA 4Y33A 3QPLA 1LKXA 2O8XA 2PMHA 3I55I 2IBDA 5AIPA 1KQ0A 5ICGA 4XLNF 1A6IA 3S2DJ 3LFKA 3ZMSA 2TCTA 5EYRA 2ISZA 4HPQA 3FTYA 4A03A 3V8JA 2E5NA 3I56I 5EDNA 1HCRA 4JNDA 2Y31A 3PJRA 2OV7A 2FMYA 4B43A 1WWXA 1R49A 4AD9A 5IP7J 4UUVA 4IO9F 5KNLA 3VOEA 4PK4A 1HDPA 2QYOA 2DAOA 2LNBA 1SC7A 2E2HJ 4XKVA 4CUGA 4X2UA 2MBFA 1FC3A 1YX3A 3D0SA 4A12A 2QBYB 4XOPA 2JVGA 1IW7F 4EJUA 4R5XA 1ETVA 3T0YA 4BGDA 4FHTA 2LLKA 1QGPA 4PFPA 1K6YA 2A69F 1G3YA 3DEEA 5H6QA 3KIOA 1B9MA 4RGXA 1V3FA 5L3GA 5HS8A 2CYYA 4EATA 1ZELA 2F48A 1K79A 3TL4X 3ZN1A 2GXBA 2UXNA 1MVYA 4I76A 1W36C 2L7KA 4BUPA 3GTLJ 4XK4A 5LHHA 2ZFWA 2DK5A 3GCMA 1ODDA 2AO9A 4ON0A 4A3IJ 4DIQA 4MLOA 1ZS2A 2JRMA 3J81K 1S3JA 3HGGA 2A7OA 4M3GA 4CCNA 4IKFA 3FXOA 3BY6A 2E34A 4C3IJ 1LUJB 1MNEA 1SMTA 3W3CA 3CUQB 3RSNA 3OYHA 4HV5A 1RIOH 3AFHA 1BBYA 3CHSA 1S7OA 3K4JA 5D5XB 5HODA 3I59A 3CF5F 3MWMA 2STTA 3LSGA 3L2QA 5IYBJ 4UB6C 4JQFA 4ZH4F 1O4XA 1YRNB 2OCCH 4C3JJ 3GFLA 2CV2A 4KYWA 3K4KA 1HW5A 3HW2A 2IEKA 1RESA 2G9WA 1BJZA 2K27A 3PNTA 2PEXA 2W84A 2K85A 2XKOA 3QWLA 1IXRC 4L5IA 4QPQA 1Z77A 2YS9A 3BLYA 2QQ9A 4WXCA 3OYKA 3CCLI 4K5OA 3AG2H 1SFOJ 4DOZA 1DPUA 3HM5A 3W6KB 3OL4A 4DZPA 3OSFA 2ZNZA 2QKMB 5FO5A 1TP4A 2BEOA 3AKZA 3GYHX 3BZKA 2E1MB 3H3UA 3JT1A 4FX0A 2VPLA 3QRFF 1X19A 1FOWA 1WJCA 1QHHD 2K3FA 4XLHA 2E19A 1SAXA 4Q5SF 3CZ6A 3K0LA 2DBBA 2WAEA 4B4CA 1P7IA 3L2RA 2R5YB 1YOVB 2O7GA 5CVRA 2CU7A 4EM0B 3ABMH 4RB3C 5IYDJ 3B3BA 1ZG1A 3ZMUA 1PDNC 5H6RA 5BPDA 2ZXGA 4HX8A 2R70A 4NDLA 4LK0F 2ZNYA 1MKMA 2XSDC 2QUFA 4N0BA 5M3MJ 5F0FA 2HYGD 2XGCA 3GFIA 4C2UA 2OJED 4HNVA 2CUEA 3CC2I 2VOOA 3QJXA 3FDYA 3FH8A 1XN7A 2E35A 2FBHA 4C9YA 2LKSA 4BJ6C 1NHAA 1BM9A 2PMUA 3G73A 4RSYA 1L3LA 2PI0A 4UNOA 1Y1WJ 1PYVA 4M6YA 3K2AA 1AOYA 2HQNA 1EA3A 4V2GA 4XLPF 5LBQA 1SC5A 1D1BA 1BR4A 3Q0WA 2DXIA 3GTGJ 4CH7A 4QLCU 1D1CA 3S2WA 3WG9A 3UERA 1YI2I 1QHGA 3LMMA 1IRXA 3CCEI 3CZLA 5HDKA 4XSZF 3H5NA 2BYVE 2ZKZA 3T8TA 1A35A 2DFHA 2EV5A 2Y0SA 2Y1EA 2GLOA 4HF0A 3WHCA 1JHFA 1QPIA 1JVSA 4XN4A 2A3SA 4HX7A 5IT9K 1TQIA 2EPFA 3LA2A 3CC7I 3G1MA 4AR1A 4I2OA 5GAEJ 4BH9A 3N05A 2ZBKA 4IL6C 2VN2A 4A0ZA 3W2VA 1B1BA 1D0XA 1F36A 1GT0C 2QBYA 2K4JA 3J7ZI 1RR8C 4XN7A 5L3DA 4DYCA 2CQQA 4TV7A 1UFMA 3DKXA 1HDDC 4FISA 1WVRA 3CP8A 1Z91A 2HOAA 4PW4A 1FJLA 2A68F 2XPUA 4F55A 1MBGA 1R5ID 3G1LA 1LDDA 4L5EA 2FU4A 4GYIA 2QKLB 4IX7A 2JQ7A 5FB2A 1MMGA 2DO7A 4BHPA 2AS5F 3ANNA 4C3HJ 2EFQA 2WZGA 1X58A 1XMXA 1BW6A 3HG9A 1X3ZB 1K61A 3MVPA 1IC8A 1H88C 4J3BA 5HS7A 4JOMA 1G3SA 1QZZA 3DFGA 2R5ZA 3ZQLA 2JZYA 1BN5A 3FUJA 2XAGA 5DD4A 3O8GA 3HKZN 1KU3A 3BCBA 4YIRX 2DQLA 2XRNA 1VZ0A 1QPMA 2KJBA 2A6TA 2F4OB 3GMEA 1TW3A 4BQAA 1K4TA 4CSWA 2HPTA 3PUFA 1E17A 1T38A 1ZRFA 2XGEA 4MQ9F 1ETQA 3ULQB 3FTWA 1WJBA 1WSUA 5IOZA 2F4IA 3S3OA 4Y3OA 1JE8A 4R79A 4MTDA 1G8XA 3G6EI 3F0CA 2PGGA 1DU6A 2HPOA 1ZTRA 2DQRA 3ABLH 3I59B 5FRMA 4BY1J 3CCRI 3R60A 3ZR8X 3QYEA 1B9NA 4LUPA 3L2CA 3WGGA 3O8HA 1OCCH 1XGNA 3GTQJ 2QJ1A 3EBIA 4ZZLA 1GXQA 3KZYA 1IXCA 3PSFA 2FOKA 5EEGA 2HEOA 4HNUA 1D8KA 2VQLA 5KVRA 2EIJH 1SAUA 1DU0A 1BIBA 2WA0A 1IDZA 2GOMA 3DEWA 4ETSA 4XKCA 1VQLI 1YW7A 3D5RC 3I4MJ 2WZFA 3B02A 2CGPA 2YX4A 3HSFA 3CDIA 4IRIA 1GW6A 4WF2A 2ESHA 3WTWC 1TC3C 1HS6A 2DJNA 3J81Z 2E1CA 4XRSG 3BJOA 4E7IA 1KQ8A 3TOBA 3EBGA 2Q0OA 4O5VA 3F8BA 1WHUA 4QUOA 4I01A 5CVJA 1TT5B 4B44A 1ETWA 1E2XA 5DEQA 4RM2A 1Z3YA 1ETKA 4EV0A 1RZ4A 5IY5H 1HKTA 1JT6A 3SZPA 1DDNA 2O0YA 1MDMB 1R6RA 2V6EA 1ERDA 3AG4H 5D5UB 4BDZA 1FEXA 2DQMA 1J0RA 2K3PA 1KU9A 4OWRB 4W1UA 3RYPA 4BEHB 5M5XJ 3CZKA 5LRSA 1X3UA 4HEA2 2OD5A 4U88A 4KMFA 3OYJA 4ZTJA 2DOAA 1OJLA 2KHMA 4PJMA 3GTKJ 2QENA 3JTHA 5KCMA 3ZQQA 2XF5A 2ICWG 2OTJI 2KRCA 3CCJI 1VQKI 5DM7F 1KGSA 2NNNA 4CZZA 3DBHB 4JK1X 2RVCA 1UELB 3S16J 2XDVA 4D1QA 3WGHA 1BC7C 4BJ5C 5DLLA 4NC8A 4F91B 1YLFA 3U1DA 1IN4A 3CMAI 3E1SA 5C4XJ 3ZQ7A 2O9LA 1XD7A 1F4KA 3IRQA 1ZREA 3BCAA 3FISA 2RQQA 4P1WA 3PM1A 2XROA 3UKGA 3FTXA 1ONPA 4E7SA 3S1MJ 3A0BC 4A3JJ 1M1EB 1WJEA 4UVAA 4J00A 2XHKA 2L2OA 2LTPA 5K7FA 3RZDJ 1BI1A 2LFBA 3A2KA 4RLFA 5JMWA 4HOBA 3E5QA 2JT1A 2PMZA 1JHHA 3QOPA 2DDBA 1QBJA 3HBLA 2AXLA 2X51A 1JT0A 3CZGA 1Z7LA 3HRUA 4O3MA 2IA2A 1P4AA 2DA6A 2FF4A 1LB2A 2M8EA 4FLRA 2M0CA 5J4YA 3EDPA 1S6LA 2O5RA 3A01B 1IZ1A 3KEDA 2XF7A 3S3MA 1DUXC 1ON2A 1NK3P 1YJWI 4XN2A 1XDUA 3E6MA 4F92B 3FUHA 1J5YA 1V55H 4BHCA 4MFEA 2EQRA 1R9TJ 5D6EA 3DV8A 4NC7A 2WAQA 4M3DA 1K83J 3ZI0A 4E7KA 1IO2A 2P8TA 1IN6A 3RPUD 2DT7B 2M7AA 4RAZA 3QU6A 3MMYB 4HG2A 2CFOA 3F6OA 1Y1VJ 2BHYA 4Z2YA 4AUXA 3U2RA 2M34A 3GZ6A 2JD1A 4XNDA 2TDXA 2NVYJ 4G6QA 4ESBA 3FTSA 4NNJA 3H92A 3HXLA 3TDZC 3CO6C 5FKLA 2NRAC 2ELHA 2ZXIA 1CF7A 2IA1A 3E7LA 2R5ZB 2M45A 3FXJA 1FYMA 3F9KA 1XGSA 4G6TB 3TO9A 2E5ZA 1YE9A 2KMUA 4OIRF 1QU3A 4RA2A 4RM3A 4S05A 1T6SA 3BROA 3FF5A 3N97A 3DLAA 2NS0A 2ZO4A 2CW0F 5BNGA 4MS6A 4I02A 4A3CJ 3CMMA 1J7KA 3PQKA 2JRTA 3HB9A 1SMYF 2GQQA 4AYBA 4XONA 5L3BA 3FXUA 4ZQGA 2HVSA 5BOXA 1T33A 3DWLE 3V8LA 2XRLA 2P7VB 3FBIB 3OWTA 1WH7A 3CJTB 4RCVA 1NG7A 5DS9A 3BG3A 3GTJJ 2ZSIB 4ASNA 2IAIA 4YFNF 1E0EA 4AIJA 4XIDA 2XC7A 1MZBA 3TMOA 2IJLA 3FK7A 4OU0A 1HW2A 4LGWA 5CKTA 5DCFA 1RR7A 2LY9A 5LHGA 2V79A 1H9TA 3DLLF 3WTYC 1W7PD 4OMYA 4X0GA 1BOBA 1X3ZA 5GADJ 4ZZDA 4KMUX 3CUQC 3JR9A 3FBNB 4OOEA 4K5PA 3CO7C 2VI6A 3U9GA 4XO3A 4OINF 1W5SA 4UB8C 2RNGA 2X6YA 1R5GA 1Y6IA 2VLAA 2FNAA 2JMWA 2KZVA 4I7HA 2NS8A 3LSKA 4LLGF 2I8DA 2HPIA 2P6TA 1XB4A 1ZN2A 2OQRA 5CVIA 3OIQA 1VQPI 1X1BA 4KIFA 4BBRJ 2BW3A 3LSMA 2XPWA 5ERIA 5KAIC 4WXHA 2V1DA 3WTTC 1LE8B 3MZ8A 3A01A 1I5ZA 2BZTA 2R93J 1OCZH 3GEZA 3OYGA 1HA8A 3E5XA 5IT3A 2JSCA 2CS3A 2FSWA 3F3XA 2CQNA 2P4WA 3CCSI 1MBHA 4LITA 3NAUA 2MC4A 2LC2A 3M1EA 3OYDA 2G7UA 4BJTA 2XVCA 3VYTB 2V1NA 2E60A 3BT9A 4PGGA 1KQ9A 1WGXA 2KIQA 2IS1A 4ENMA 4Q4EA 4XLEA 2XAQA 4HBLA 4AVPA 2K9NA 2JCXA 2IS4A 4EJTA 5A2QZ 3TO7A 2VODA 5JVGF 3KEOA 1I3QJ 3I64A 2E7XA 2GWRA 3IKVA 5B1AH 4Q4ZF 4XRFA 5GTHC 2ETHA 4HLYA 4UVBA 2X1DA 2KIUA 3QPHA 3R0IA 1R1VA 2E1OA 4M74A 4P55A 3RQIA 3COAC 2ZSHB 1ZARA 2DYRH 5ICCA 1QO0D 1HLVA 3GO5A 2RN7A 3CCUI 1YIJI 2R7UA 2ZJPF 1R1TA 5FKMA 4IRHA 3NWSA 3SDBA 2H27A 3WQQA 2CQXA 2JA7J 3KP7A 3J7YJ 5KAFC 2IGKA 2EWNA 2L9VA 1K7AA 4BEHA 2YU3A 3J7AY 1TWFJ 5L3CA 1FP1D 2K9QA 2GAUA 2O3FA 1YQAA 5EG0A 1T56A 3FU5A 3BZCA 2JA6J 2R72A 3A14A 1TWHJ 4BBSJ 4LG3A 2RDPA 2IGNA 3K2ZA 4QWQA 2CV0A 1F9NA 3JW4A 1W5TA 3H3ZA 2D2WA 2VKVA 2ZJ2A 4U0VA 3U21A 2VQHA 3CDHA 3T8RA 4PZJA 1APLC 4LG0B 2PUSA 2JN6A 2EGHA 1X2NA 1P9QC 4KJZA 1ZH5A 3WQSB 2OQGA 1X1CA 4UHTA 4HLXA 4QPEA 5DCMB 4KT6A 3FKIJ 3EYYA 1XCVA 1WJDA 2UV1A 3CMYA 3K4NA 1FY7A 2CJJA 3CJRB 2RGVA 2H6CA 2HVRA 1K78A 4HAMA 2DFEA 1SFUA 3BR1A 3AL0C 1O57A 2MA3A 1AU7A 2E71A 4AICA 2HOSA 3VVMA 1HC8A 4ARFA 1NH3A 3O2PE 1D3YA 4CYCB 1ETYA 3AG1H 1R22A 2GZWA 2L7ZA 2HS5A 3W2AA 4DPRA 1KU2A 1XGOA 1FYKA 4N4OB 1XMKA 3D5SC 1JI8A 4BQNA 4BQQA 3L2UA 3E97A 4C2MJ 3C1DA 1F5TA 1BJAA 1J9IA 3HSEA 4HV6A 1SANA 3UNGC 2PG4A 1H0MA 3W6JB 3KE2A 2J5PA 3CUQA 4B8XA 1T39A 3H9JA 1TWCJ 5IPAA 3UR3C 4HNTA 3MFKA 1JG9A 3FU0A 2MYSA 1T98A 1TNSA 5J8FA 1GXPA 3J80Z 4Y7NJ 4JBAA 3BTIA 3HEFA 4D0PA 1X3WA 1Z7UA 2R3SA 1VQ6I 1I27A 1Y0UA 2QLZA 3FXQA 4CHUA 1DP7P 5F64A 3BTLA 4BU2A 5HNHA 3A02A 3T5XA 3ZQHA 2C5ZA 3FH5A 5CQEA 1GUUA 3PFYA 4YRVA 3OYFA 3QQAA 4RLQA 1RUOA 5JHUA 2XIGA 1XG1A 3DP7A 3TDUC 1W7PB 3FM3A 3LFUA 3RKXA 3PIPF 4M6VA 5GAGJ 1UCRA 4EJVA 1HQCA 4HQEA 5JMPA 4B09A 4S0HB 4CCKA 5FWQA 1HSTA 2HU9A 3ZOBA 5K5OA 2Y9ZA 2CG4A 3JAMZ 4F3QA 1BI0A 2F5CA 2QF7A 2UZKA 1A36A 3VYRB 5EEHA 1RI7A 2LREA 2X0LA 4LJZF 1V54H 2LKXA 1PVEA 2IGOA 1VF9A 5GTIC 4U7BA 4FCYA 3LAJA 2ELKA
chains in the Genus database with same CATH topology
3KEQA 4ZX6A 3HRSA 4WX9A 3MCZA 2EV6A 3DF8A 3M9AA 1MDMA 2MAOA 3AU9A 2H6BA 4HDVA 4ZYGA 2ESNA 2HGCA 3KP4A 2EB7A 2NAZA 4PVBA 4EMSA 2KJCA 5BPPA 3GF2A 3E6DA 4GXOA 2M5WA 1PP7U 2A6HF 2L02A 4YFXF 2VOPA 3HUGA 2W24A 2M1BA 1RNLA 3BP8A 4A5MA 5FD6A 2Q2EA 1Z6TA 3L00A 5JC1A 5E18F 4OIPF 1RP3A 1YG2A 3WTXC 3Q44A 3KFWX 1S7AA 3FX3A 1R36A 1EV7A 1O7LA 2G7HA 2MLGA 1RUNA 5J6XA 3JSOA 2KIMA 3HSRA 1KU7A 4L0YB 2IPQX 1IUYA 2VE9A 1ZGAA 4G7OF 2FNPA 2BGCA 4OOIA 4BXUA 3QPTA 1ZRDA 4ZW8A 3HHGA 1O3TA 4ZQEA 2JV7A 5E17F 4XO5A 4AYSA 4ZW6A 2MD5A 2FEZA 1Z9CA 3DKWA 5DCMA 4ZQFA 1REPC 2Y1DA 1TQMA 1IF1A 3GFMA 2W25A 2LKPA 1AWCA 2A6EF 2KKOA 2HKXA 3FUMA 3FHEA 4P96A 1Z05A 3EQLF 5HLIA 5D6FA 1ONVA 4L0ZB 3SHFA 5BS6A 2DT5A 4M73A 2W85A 1P2FA 2MAPA 3WQRA 4YFKF 2K02A 4ENJA 5BMZA 1FX7A 4OIQF 1XGMA 3MEXA 5K5RA 2PFBA 2DQ6A 1W7PA 5LLQA 3FU6A 4CYDA 2H09A 2FRHA 3T1BA 2LF8A 5LGNA 1O3SA 5HLTA 3UEQA 3K1MA 2A61A 3R4KA 3RPQA 2RV8A 2PQ8A 4I98B 2CQKA 3V7RA 4KT5C 5TRDA 4R7LA 2P5VA 3WTUC 1XDSA 4MTEA 4A2UA 1MW2A 3NEUA 4ZN6A 1MJ9A 2DPUA 3FTUA 4OMZA 3EYIA 4RS8A 2GXGA 2KIFA 4KIGA 5D8KB 3FMSA 4ZX5A 1XSDA 4N9HA 3HTUA 4M9XA 2XQ0A 3DEUA 4P9UA 1YYVA 3FMQA 3V7CA 4IRGA 1A04A 2EA4A 1LDJA 4L18B 4H0EA 3F22A 2ZMEA 3VODA 5E1XA 1S29A 2XPZA 1U2WA 1TTYA 2Z99A 2RQPA 3F23A 2HTJA 3PQJA 3JTGA 1T1SA 1BC8C 4CGZA 4YG2F 3CTAA 3G3ZA 1K6OA 4HYEA 2XASA 1STZA 1EH8A 1HKQA 5ILUA 2HTSA 3GZ5A 3K69A 2FQ3A 3P7NA 3DQVC 4XSXF 3BJAA 1H3LA 3CIAA 3L09A 2JTVA 4OOFA 3EUHA 5CVUA 3CHPA 3LSTA 3P9IA 4XMTA 4XN8A 1PUEE 4ZQTA 3CHRA 2VBZA 4IXAA 4I0AA 5ILVA 4IPAA 2FXAA 2O61A 3N4MA 5BPIA 2QQAA 2QVWA 1MW3A 2NYXA 5E8IA 2STWA 2EA2A 3U9WA 4LB5A 1QQIA 4RB0A 3WTVC 1SG7A 2RKHA 2ZCWA 1FNNA 1SD7A 4FLOA 3F72A 1O7FA 5F1RA 1U5TC 3F21A 3I71A 3MAJA 1G6NA 4UXNA 4KNYA 4M6XA 3HRTA 4MNUA 3B37A 3P9CA 3ANLA 3RKWA 1LEBA 1FLIA 3KP5A 2ZMEB 4E70A 1U8RA 3Q5FA 3L7WA 4M71A 1GVJA 1YFHA 2RJIA 4ZW3A 4HF2A 3I58A 3QP6A 4KN4X 4GAAA 1O3QA 3WODF 3C18A 1IAWA 1YS6A 4MQVA 3IL2A 4UVCA 3Q9VA 1ONOA 1G3TA 4XMWA 2VT2A 2BE5F 2L01A 3GVAA 3B7SA 3CZEA 4U0WA 2GTQA 2YSRA 3WE2A 4LMYA 3KETA 5HVQC 4GO1A 5FGMA 1TQPA 5H20A 3PFIA 5KK1A 2JCYA 1IN8A 3JSPA 3P9KA 5DDGA 4Y67A 1XSXA 5DYMA 3M7GA 1ZRCA 4EGYA 4LLNA 1ZAOA 4IF4A 2DU9A 3I4PA 1TLHB 3EETA 2HZTA 3IWFA 2L3DA 5D4RA 3K9TA 4P9FA 2FFLA 2B0LA 1I6XA 4CXFA 4G7ZF 4Y17A 4BKXA 3FTVA 1FOKA 2LSOA 4K5LA 1LDKB 2FA5A 1F1ZA 2J5OA 4RGRA 4FCAA 3FHZA 4LD5A 5CYVA 1IXSB 2BBYA 2WPGA 3A06A 3ZN0A 3RDIA 2PJPA 4RB2C 4M9ZA 1UB9A 1U3EM 4WXDA 1SFEA 4GYGA 2K7LA 4G7HF 4L2LA 4L9NA 4GGGA 3CJNA 3KLOA 2MC3A 1D8JA 1FBUA 3C3WA 4ZYHA 1R1UA 3GXOA 3F8FA 1R5HA 2PLYA 1IRGA 4ZQHA 3OOPA 2R59A 2HYFA 4EVIA 4RB1A 2EV0A 4FLSA 4HQMA 4Y6PA 1H9GA 2OBPA 2O03A 3LWFA 1SD4A 3BZ6A 5IT9Z 1KA8A 1FT9A 2DPDA 3O3KA 4LLLA 1P4WA 4AR9A 4KP7A 1G5AA 3GUDA 5HLHA 4QMEA 3KCCA 4EQQA 3J80K 2QZ8A 3F8CA 3HOSA 4R5TA 3FM5A 1B4AA 4PDKA 5DYFA 2ZXJA 3WU0A 3GFJA 3RYRA 2E1NA 4XMUA 5HLGA 2EFOA 4A6DA 4HF1A 3FUFA 3VB2A 4ESJA 2OA4A 2XUBA 3IHUA 1UHWA 2CFXA 4U7DA 1P6RA 4LG0A 4ESFA 1JXSA 4NB5A 3BOQA 2WWYA 1OR7A 4K2EA 4R1HA 2JD2A 2P5LC 1GHCA 4XN1A 3ZMTA 5K5QA 4L9JA 4M72A 3IC7A 2VT3A 2Q8KA 1J75A 1K5HA 2ISYA 4ZW5A 1U6GA 3R61A 2C82A 3GX4X 4MKTA 1T1RA 5F6FA 1LEAA 1IRFA 3DPTA 5JI6A 2PL5A 2CWEA 3ABUA 3FZVA 2WV0A 5L3CA 3V4GA 5JR3A 2RNJA 3F6VA 1FYLA 3WTTC 2MLKA 5HOOA 4Y15A 3WE3A 3ZMZA 1G4DA 1LVAA 2HDCA 3RC8A 5D5VB 1I1GA 3TQNA 2VC1A 2IT0A 1R58A 2YR2A 2QM3A 2D1HA 2JPCA 1V4RA 3JSZA 3FMRA 3CHQA 2HWVA 4ZX3A 2HR3A 2VONA 3B7UX 3K1NA 3FH7A 5L3EA 4PGHA 4BYYA 1USTA 3BJ6A 1KYZA 3C7JA 2JCVA 1FBQA 1B6AA 2MH9A 1FZPB 1T2KA 1H19A 5L3FA 1W4MA 5TJJA 4RVBA 1P4XA 5ICEA 2K86A 4S04A 4WWCA 2V1UA 4Y6SA 1OKRA 2DK8A 3RTRA 3ZHXA 1VTNC 5E8GA 2HQRA 4UV8A 3LA3A 3O6BB 1Z1DA 5J8FA 1GXPA 4YIIA 2VXZA 5CVVA 3E5UA 2GIVA 2HOEA 2M30A 3ISPA 1U78A 3JAMK 4XN9A 2XAJA 5LGUA 1HKSA 1P92A 2IVMA 3WGIA 1YIOA 3B7TA 5A2QK 2VE8A 3CUOA 2FMLA 3FXRA 2OZUA 3ZHZA 4LFUA 5CLSA 3LA7A 2QQBA 5D4SA 3PUUA 4ZYDA 3ZHYA 4HA8A 1I1SA 5LRRA 1FSHA 3IIEA 2Z3YA 3KP3A 2YX7A 2OZ6A 2Y1CA 1ONNA 3E3VA 1FWZA 4P5OA 2VC0A 4FX4A 1JGSA 3D5LA 3VFZA 3AUAA 4L9TA 4G94A 1D5VA 2HKOA 3M8EA 1C0WA 3E6BA 1OPCA 3I54A 5JVTA 3UCQA 2XGXA 3AAFA 3LAPA 4OIOF 1FSEA 2QWWA 5FFZA 3QP5A 3FUKA 2Y48A 3TGNA 2YPRA 5ED4A 1U5TB 3WU1B 3ECHA 2Z33A 4ZYEA 4IHSA 1MW1A 1BI3A 3I53A 4FLQA 1XSVA 4PCQA 2EK5A 2H94A 3R0JA 1QZYA 5FLXZ 1MGTA 2Y0MA 3B34A 2L4MA 3HYIA 2F5EA 4ENNA 1Z6RA 5FLXK 1FBSA 1ZLKA 3M8FA 2CO5A 3B73A 5D5WB 1WI9A 3J7AO 4Q48A 3R0AA 5HDNA 3QAHA 3FUEA 2F5FA 3RKYA 2A5YB 3ECOA 4M9SA 4RAYA 1SD6A 3B2PA 3BDDA 2FBIA 2CSOA 2EFPA 4MGRA 4IVNA 1OYIA 5E1WA 4GCVA 4MEXF 1WKMA 1MD0A 5JFRA 2PBIA 3B2XA 3GWZA 4WK8F 1U5TA 1EH6A 5DD8A 1ZGJA 4A6EA 1YO5C 2F5DA 4I0BA 1EH7A 2Z9OA 3RIRA 3FWEA 1CF7B 5BQTA 2DW4A 4HX4A 4F7ZA 5AENA 2M87A 1OMIA 4ENKA 3V8KA 2DI3A 2OAZA 4HDUA 4EGZA 2FE3A 5FFXA 1HBXG 2XAFA 2EFWA 3I5UA 2C6YA 2P7CB 4AR8A 1PP8F 4L9VA 3T8VA 5JBIA 3L9FA 1QNTA 2Z5UA 2HFHA 2O6GE 4KFCA 1ON1A 2IW5A 1R0LA 4QIRA 1R23A 4QHPA 1KYWA 2PN6A 4ZW7A 3SFZA 4BHBA 4Q47A 3NQOA 3WTZA 2IRFG 2WC2A 4AIKA 3FULA 3ZMDA 4EM2A 4L5JA 3RPUA 2Y1FA 1FPQA 1SQMA 4O6JA 2Y75A 1YW9A 3GLXA 4EJOA 1LQ1A 3FU3A 5D8LB 4G8XA 3CHOA 5DUKA 3RC3A 3E6CC 1XMAA 4Q4IA 2WTEA 2GA2A 3CLOA 2QVOA 1L0OC 6PAXA 5JNLA 1WRJA 2IP2A 3ZP5A 1WQ2A 3BWGA 4BAYA 3R6SA 4AIHA 3KP2A 2EFNA 3GW2A 4XMVA 4A5NA 4KIBA 1MJAA 3ZMVA 4GAEA 5LEKA 4YIFA 3KP6A 1IN7A 1JGIA 5K1YA 1TNTA 1S46A 2DFIA 4RGSA 2LDUA 3VVLA 1ZLJA 1Q0QA 1J2XA 1MJBA 5E1ZB 3DXJF 3OV8A 3NRVA 2JD0A 1R0KA 2R7FA 3RJPA 1T0FA 5DULA 2DLLA 1ZG5A 4XNAA 1FP2A 1TW2A 3V7SA 1O3RA 5DV5A 3FUNA 1Q0HA 4CICA 2XV4S 4HW0A 4LB6B 2BV6A 5AONA 5HS9A 2UXXA 3LQRA 2MH2A 3IWZA 4KICA 2R7DA 3SQNA 1K78B 3HIFA 2X4HA 2VBWA 5LEJA 4MEYF 5HDGA 3TO6A 3ML6A 4WCGA 3KLNA 3MQ0A 4DQ2A 5LGTA 3B7RL 3TKYA 1HXDA 2P5KA 4XMZA 2E7WA 4XO4A 5CJ9A 5ICFA 3ANMA 1OYWA 4NQWA 5ILSA 3EBHA 3HRMA 2NNYA 3HTSB 4N9IA 1ULYA 2V1XA 2D1VA 4IJAA 3FUDA 4KUMA 1BIAA 1ZHFA 2DTRA 3Q43A 3HHHA 4CDGA 1BOAA 5DUIA 3FTZA 2P6SA 2A07F 1G3WA 3ROUA 2VBYA 3IKTA 4DNCA 5J8CA 2W57A 4LK1F 4BNCA 3IRRA 1USSA 2RC4A 2V9VA 5HNFA 4KA4A 4IHTA 3LQQA 4A0XA 3REOA 1TBXA 1S8NA 3BPXA 1R7JA 4KN7X 5JAZA 4U0YA 4NHJA 5LHIA 3HOTA 3SZTA 5AIQA 3F8NA 2KRFA 4XMXA 1YS7A 2JPBA 4Y13A 2OU2A 1SFXA 1R00A 4RGUA 1DPRA 2ACJA 2EJRA 3ELKA 4HZFA 3RI4A 3TOAA 4EJWA 3FUIA 1YW8A 3AU8A 2VBXA 4CO8A 1YTYA 1Q1HA 2D45A 3ZPLA 1HSJA 1IN5A 1HW1A 4I09A 2GA1A 2IA0A 4Y6RA 2V6CA 4FT8A 2L4AA 1UHMA 1B59A 1SD5A 3F8MA 3I0TA 3KZZA 4K5MA 3RASA 2Y1GA 2XKPA 4XN5A 2XPYA 3MZHA 4AWXB 2LF7A 3QU3A 4UV9A 2B61A 5EV7A 2FBKA 4EM1A 3K1PA 1LJ9A 3MZYA 4K5NA 2ADUA 1MW0A 1ZYRF 1OYYA 2XAHA 2F2EA 5E20A 1BI2A 1ZG3A 2VJ8A 1CGPA 3Q9SA 3DPLC 5FD5A 2UWMA 4G9YA 4PU2A 4XBFA 4R5VA 3WTSC 3ERED 2COMA 1LNWA 5JO0A 4A0YA 1XCBA 3BPVA 4MHGA 3ABTA 4KDPA 3SXYA 3VEPA 4ZX4A 4R8HA 1Q0LA 2L54A 4XNBA 2K4BA 4G6DA 2O8XA 2PMHA 5AIPA 1KQ0A 5ICGA 4XLNF 3LFKA 3ZMSA 2ISZA 3FTYA 4A03A 3V8JA 4JNDA 2FMYA 1WWXA 4AD9A 4UUVA 3VOEA 2QYOA 2DAOA 2LNBA 4X2UA 2MBFA 1FC3A 3D0SA 4A12A 2QBYB 1IW7F 4EJUA 4R5XA 3T0YA 4FHTA 1QGPA 2A69F 1G3YA 5H6QA 1B9MA 4RGXA 1V3FA 5L3GA 5HS8A 2CYYA 1K79A 3ZN1A 2GXBA 2UXNA 1MVYA 5LHHA 2ZFWA 2DK5A 1ODDA 4ON0A 1ZS2A 3J81K 1S3JA 2A7OA 3BY6A 1SMTA 3CUQB 4HV5A 1RIOH 1BBYA 3CHSA 1S7OA 5D5XB 3I59A 3MWMA 2STTA 4ZH4F 4JQFA 3GFLA 4KYWA 1HW5A 2G9WA 2K27A 2PEXA 2W84A 2XKOA 4L5IA 1IXRC 2QQ9A 4WXCA 4K5OA 1DPUA 3W6KB 2ZNZA 5FO5A 2BEOA 3GYHX 3H3UA 3JT1A 4FX0A 3QRFF 1SAXA 4Q5SF 3K0LA 2DBBA 2O7GA 5CVRA 4EM0B 4RB3C 3B3BA 1ZG1A 3ZMUA 1PDNC 5BPDA 5H6RA 2ZXGA 4HX8A 2R70A 4LK0F 2ZNYA 1MKMA 2QUFA 4N0BA 2HYGD 3GFIA 3QJXA 2VOOA 3FH8A 1XN7A 2FBHA 1NHAA 1BM9A 2PMUA 3G73A 4RSYA 1L3LA 2PI0A 4UNOA 4M6YA 1AOYA 2HQNA 4XLPF 5LBQA 1SC5A 4QLCU 3S2WA 3WG9A 3UERA 3CZLA 5HDKA 4XSZF 2BYVE 2ZKZA 3T8TA 2EV5A 2Y1EA 4HF0A 1JHFA 1JVSA 4XN4A 2A3SA 4HX7A 5IT9K 1TQIA 3LA2A 4AR1A 4I2OA 4BH9A 1J59A 2ZBKA 2QBYA 4A0ZA 2VN2A 1B1BA 2K4JA 4XN7A 5L3DA 4TV7A 1UFMA 1Z91A 4PW4A 2A68F 1LDDA 2FU4A 4GYIA 5FB2A 2DO7A 4BHPA 2AS5F 3ANNA 2EFQA 2WZGA 4J3BA 5HS7A 1G3SA 1QZZA 3DFGA 2JZYA 1BN5A 3FUJA 2XAGA 5DD4A 1KU3A 2DQLA 2XRNA 2KJBA 1QPMA 4BQAA 1TW3A 2HPTA 1E17A 1T38A 1ZRFA 4MQ9F 3ULQB 3FTWA 1WSUA 1JE8A 4R79A 4MTDA 2PGGA 2HPOA 2DQRA 3I59B 3R60A 1B9NA 4LUPA 3L2CA 3WGGA 1XGNA 2QJ1A 3EBIA 4ZZLA 1GXQA 3KZYA 1IXCA 2FOKA 5EEGA 2HEOA 1D8KA 5KVRA 1BIBA 4ETSA 1YW7A 2WZFA 3B02A 2CGPA 2YX4A 3HSFA 4IRIA 1GW6A 4WF2A 2ESHA 3WTWC 1HS6A 3J81Z 2E1CA 3BJOA 1KQ8A 3TOBA 3EBGA 2Q0OA 4O5VA 3F8BA 4QUOA 4I01A 5CVJA 1E2XA 5DEQA 4EV0A 1RZ4A 1HKTA 3SZPA 1DDNA 2O0YA 1MDMB 2DQMA 5D5UB 1J0RA 1KU9A 3RYPA 3CZKA 5LRSA 1X3UA 4U88A 2OD5A 4KMFA 2QENA 3JTHA 1KGSA 2NNNA 4CZZA 4JK1X 2RVCA 3WGHA 1BC7C 5DLLA 1YLFA 3U1DA 1IN4A 3ZQ7A 1XD7A 1F4KA 3IRQA 1ZREA 3FTXA 2XROA 1ONPA 4UVAA 2XHKA 1BI1A 5JMWA 4HOBA 3E5QA 2JT1A 1JHHA 3QOPA 1QBJA 3CZGA 2AXLA 3HRUA 4O3MA 2IA2A 1P4AA 2FF4A 1LB2A 2M8EA 4FLRA 3EDPA 1S6LA 1IZ1A 3KEDA 1DUXC 1ON2A 4XN2A 1XDUA 3E6MA 3FUHA 1J5YA 4BHCA 5D6EA 3DV8A 3ZI0A 2P8TA 1IN6A 4RAZA 3QU6A 3F6OA 4Z2YA 3U2RA 3GZ6A 2JD1A 4XNDA 2TDXA 4ESBA 4G6QA 3FTSA 3H92A 3TDZC 3CO6C 2NRAC 2ELHA 1CF7A 2IA1A 2M45A 1FYMA 1XGSA 3TO9A 4OIRF 4S05A 1T6SA 3BROA 3FF5A 3N97A 2NS0A 2ZO4A 2CW0F 4MS6A 4I02A 1J7KA 3PQKA 2JRTA 1SMYF 2GQQA 5L3BA 3FXUA 4ZQGA 5BOXA 3V8LA 2P7VB 4RCVA 4ASNA 4YFNF 4AIJA 1MZBA 2IJLA 4OU0A 1HW2A 4LGWA 5DCFA 5LHGA 2V79A 1H9TA 3WTYC 1W7PD 4OMYA 1X3ZA 4ZZDA 4KMUX 3CUQC 4OOEA 4K5PA 3CO7C 3U9GA 4XO3A 4OINF 1W5SA 1R5GA 2VLAA 2FNAA 4I7HA 4LLGF 1XB4A 2OQRA 1ZN2A 2P6TA 5CVIA 4KIFA 5ERIA 4WXHA 2V1DA 1I5ZA 3GEZA 3E5XA 5IT3A 2JSCA 2FSWA 3F3XA 2P4WA 3M1EA 2G7UA 2XVCA 4PGGA 1KQ9A 4ENMA 4Q4EA 2XAQA 4HBLA 4AVPA 2JCXA 4EJTA 5A2QZ 3TO7A 2VODA 3KEOA 4Q4ZF 3I64A 2E7XA 2GWRA 3IKVA 4XRFA 2ETHA 4HLYA 4UVBA 2KIUA 3QPHA 3R0IA 1R1VA 4M74A 4P55A 3COAC 1ZARA 5ICCA 1QO0D 3GO5A 2RN7A 1R1TA 4IRHA 2H27A 3WQQA 3KP7A 2EWNA 1K7AA 2YU3A 1FP1D 2GAUA 2O3FA 1YQAA 3FU5A 2R72A 3A14A 2RDPA 3K2ZA 4QWQA 1F9NA 3JW4A 1W5TA 2D2WA 2ZJ2A 3H3ZA 4U0VA 3CDHA 3T8RA 4PZJA 4LG0B