3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/protein binding
molecule keywords Response regulator
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
1STZA 2H27A 2HZTA 1I6XA 2QBYB 5D6FA 1F4KA 1TNSA 4KP7A 1KYZA 2PMUA 1FC3A 2PG4A 4HZFA 4GAEA 4AVPA 3M7GA 1GXQA 3UCQA 3FX3A 4HAMA 4G94A 3FHZA 5E8GA 4EM2A 3Q9VA 2Q8KA 4O5VA 3V4GA 4OIPF 3HRUA 4L9NA 2C82A 4Y17A 2GXGA 2H09A 3TQNA 3TKYA 1OYIA 1B6AA 1FZPB 4HF2A 1U2WA 4U88A 4MNUA 2KIFA 2F2EA 3HYIA 3GZ6A 4JK1X 5E8IA 1P4AA 4YIIA 4LD5A 4G7HF 4ASNA 3JTHA 2HEOA 2STTA 2EGHA 1Y0UA 3MAJA 2GQQA 5HDGA 6PAXA 2MAPA 5FB2A 1W7PD 4KT5C 4Y6SA 2EFWA 3C3WA 5HDKA 3GFMA 1SC5A 1MKMA 2ETHA 5K1YA 1UHMA 4XSXF 3T5XA 4PGHA 1FYKA 2ISZA 4GYIA 2OBPA 3OV8A 3HRMA 1KA8A 3FF5A 1XGOA 1EV7A 2K02A 3Q5FA 1IXSB 3LAPA 3GW2A 2DK8A 3VFZA 3CZEA 2HWVA 1HW5A 3H3ZA 1DPRA 5E1WA 2Q0OA 2XKPA 1FOKA 1JE8A 3WGIA 1YS7A 2Y1EA 2ZFWA 4CZZA 1WSUA 3V7CA 3E97A 1MVYA 2P6TA 1XN7A 2HR3A 2QUFA 4IVNA 4ZYHA 5ILUA 3GFIA 3P9KA 3MZHA 1P6RA 3L7WA 3R0JA 1ZYRF 2FBHA 3U9GA 1USSA 2FNAA 1FYMA 3FZVA 3GUDA 1Q1HA 2FOKA 3E6MA 1EH7A 3E3VA 5JMWA 3KEOA 5L3CA 2P5VA 2D2WA 5KK1A 1YFHA 1Z9CA 3KETA 4HX8A 5LHIA 3RASA 4OOFA 3WE3A 2DU9A 3IWZA 3MZYA 3DEUA 5HLIA 4Z2YA 4TV7A 1E2XA 2R3SA 4I09A 1FYLA 3BPVA 2EFPA 3TOBA 3E5XA 1J5YA 4GXOA 2KIMA 2XKOA 4AWXB 1R1VA 4CICA 1IN4A 1XCBA 2EB7A 3JSPA 5E18F 1G3SA 4IHTA 2P8TA 5LRRA 2EV5A 3LSTA 1D8JA 4ZQGA 1XSVA 4YIFA 2A68F 1QZYA 1LDJA 4L9VA 4EMSA 4Q4ZF 2P6SA 1LQ1A 1IF1A 2Y1DA 3M9AA 1BOAA 4RGRA 1A04A 1B9NA 1G5AA 3ECOA 5DD4A 4LG0A 4OMYA 4FLRA 5CVIA 3SZPA 1TQIA 3BPXA 1Z7UA 4G6DA 3ZN1A 5K5QA 2GXBA 5DCFA 1SMYF 4O3MA 3FXQA 3ABUA 1R22A 1HKQA 2VONA 1FLIA 2AS5F 1HW1A 4L5JA 4Q5SF 2ZMEA 1TLHB 3IKVA 2VE8A 3I59B 3GVAA 3RKYA 4Y13A 2KJBA 4KICA 3RPUA 1XDUA 3T8TA 2DW4A 4YFNF 2BEOA 5CYVA 1XGSA 2ESNA 2E7WA 4BHBA 5L3FA 3GXOA 1IN6A 4HQMA 1BN5A 4LUPA 3QAHA 2M8EA 2FE3A 3SHFA 2IT0A 3EQLF 3DF8A 1ZN2A 2X0LA 4LJZF 2TDXA 2CGPA 2JT1A 2M45A 3RDIA 2IA0A 4M9SA 5HOOA 1HSTA 2F5EA 2ACJA 2JPCA 2A07F 2R7FA 3M8FA 2GA1A 5DV5A 1W7PA 2W57A 1XCVA 2NYXA 1ZLKA 2L54A 4F7ZA 1SFXA 1SD6A 1RUNA 4EJVA 3VODA 2FNPA 4UUVA 1ULYA 3FMRA 1MDMB 2VXZA 1S29A 3GLXA 1PP7U 1HSJA 1GHCA 2ELHA 2CW0F 2V1XA 1P4WA 3WGHA 4U0YA 2NAZA 2QQAA 3O3KA 2Y75A 3AAFA 2PFBA 4OIQF 3TO9A 3G73A 3WQSB 1MJAA 3FM5A 4YFKF 2WPGA 3KZYA 1WRJA 2VOPA 2G7HA 4DNCA 4HBLA 2P4WA 1P4XA 5HVQC 4RCVA 2NS0A 5TRDA 4KYWA 1R58A 2Q2EA 3BJOA 4BHPA 1W5SA 1XDSA 4RGXA 4M71A 3OOPA 3TGNA 1JG9A 1K78B 1Q0HA 1ZARA 2RQPA 1ON1A 2OU2A 2Z33A 2MLGA 4UV8A 3F23A 3ZP5A 2W85A 5EEHA 2H94A 2VT2A 4G9YA 5BMZA 4ZH4F 4HX7A 4U7DA 3DPLC 4IRHA 4Q48A 2K27A 1QZZA 3WTXC 4AICA 1OYYA 4HDVA 3CZLA 3R60A 1FBSA 4KN7X 5H20A 2V79A 1ZREA 2QVOA 5DCMB 4ZYGA 1FSEA 4S04A 2D45A 5AIQA 4JBAA 2FSWA 3ANNA 3P7NA 3GYHX 2IW5A 3HSRA 5FFZA 1BC7C 1XGNA 4Y6PA 2YPRA 1KQ8A 2IVMA 4N0BA 3L09A 3NRVA 3K69A 1WKMA 3WTVC 3FXUA 4M74A 5ILVA 2ZCWA 1SD4A 2D1HA 2O03A 2MA3A 1DUXC 4CO8A 4A5NA 2UXNA 3KP5A 2HTJA 3FM3A 4KMUX 4EJOA 4BYYA 3ZN0A 3BP8A 3R0AA 1R1TA 2K86A 3N97A 1PDNC 2XIGA 1BI1A 1IUYA 4A0ZA 2IP2A 1SD7A 5L3GA 4B8XA 3E6DA 3HSEA 4ZQEA 1WI9A 3VOEA 3TDZC 3V8KA 3SQNA 1O3RA 1CF7B 3HTSB 3PFIA 5F64A 3RIRA 1YO5C 1T1RA 1OPCA 4E70A 1I5ZA 1P92A 3WTYC 1RUOA 3E5UA 4HDUA 4LB5A 1O7LA 3V7SA 2QQBA 3ISPA 4UVBA 3KLOA 1DPUA 2P5LC 3KE2A 1J59A 1Z05A 4I2OA 4P96A 1XB4A 4A5MA 4OMZA 3F8FA 3I0TA 1PUEE 3JSOA 2A3SA 3ECHA 1G3WA 3N4MA 2O3FA 3F21A 1YS6A 5JBIA 1JXSA 1D5VA 4WXDA 1R5HA 2LNBA 3GO5A 5AONA 3R4KA 1ZGAA 4ESBA 2ZXJA 1K6OA 3R0IA 1ZRCA 3DXJF 1DP7P 2Z99A 3H3UA 2VOOA 1B9MA 4HLYA 1OYWA 5D8LB 1O3SA 2FBKA 1U5TA 3BZ6A 1QBJA 3O6BB 1IXRC 5L3BA 3GZ5A 4IXAA 3P9CA 1MW3A 5LBQA 2JCYA 3ZMTA 5DULA 2WV0A 1H0MA 2L3DA 2VN2A 1Z6TA 5DUIA 2GAUA 4Q47A 1KQ9A 1TW3A 5HLGA 4R8HA 4EGZA 3L9FA 1ZGJA 1BJAA 4U0VA 2Z5UA 2M30A 4L0YB 2LSOA 2YSRA 4EQQA 2O7GA 3KCCA 3ANMA 2D1VA 3HHHA 2FRHA 5BQTA 3DP7A 5FO5A 2HQNA 4GCVA 2XAHA 5DUKA 1MJ9A 4FX4A 3TO7A 3BWGA 4YG2F 4ZN6A 1TBXA 2J5PA 5J8FA 2L4AA 1QO0D 4PGGA 4UXNA 5FLXZ 3V7RA 5D4SA 2G9WA 2MH2A 1S7AA 3MWMA 3LA3A 1ONOA 3ML6A 3IRQA 4CDGA 1FNNA 1BIBA 2PLYA 5CJ9A 5DD8A 3ZMZA 3WTTC 3IC7A 4KNYA 3W6JB 2COMA 3H92A 2XAJA 4FX0A 1YW9A 4XRFA 1ZG5A 4IPAA 2IA1A 1IN5A 2K7LA 5IT3A 3KP3A 1MZBA 2KRFA 3A06A 1D8KA 4MEXF 4ZQFA 5FD5A 5IT9Z 2VBXA 2F5DA 3K1PA 2EFOA 1JGSA 4HA8A 2DT5A 4N9HA 4G6QA 3F22A 1D3YA 2HOEA 4CGZA 3EETA 4G7ZF 2OA4A 3KP6A 3EUHA 2VE9A 2QZ8A 1FBQA 5HLHA 1KU9A 2P5KA 2ADUA 5L3EA 4LK0F 3F8CA 5LGNA 2DBBA 5JC1A 1ODDA 2O0YA 3QPTA 4G8XA 5LGTA 3WQRA 3KZZA 2PMHA 4KIFA 2UWMA 2ZBKA 4XLPF 2HKOA 1LNWA 1K5HA 4HV6A 2MLKA 2VT3A 5CVUA 1ZHFA 3WU0A 3DV8A 2OD5A 3A14A 3RKWA 4MTDA 5DYMA 3KP4A 1MGTA 3CZKA 4A6EA 4UVCA 5FD6A 3DFGA 5LEJA 3HOTA 1S7OA 2FEZA 1AOYA 3J80Z 4M6YA 1B4AA 1Z1DA 3Q9SA 3BJ6A 4DQ2A 2ZNYA 2JPBA 2NRAC 3RYRA 1ONNA 1G6NA 1WWXA 4FT8A 2B0LA 2RVCA 1DDNA 2Z9OA 2JRTA 5K5OA 4EM0B 1U8RA 1QGPA 1KU7A 3SFZA 4LFUA 4WX9A 2CSOA 4RS8A 1Z91A 2LF7A 4AIHA 2OAZA 2BYVE 2OQRA 1SAXA 2L02A 1REPC 4AYSA 3F8NA 3GFJA 3CTAA 3SZTA 1YG2A 2ZNZA 2NNYA 2A69F 4G7OF 3LFKA 4MQVA 4NHJA 2HS5A 5HDNA 4LG0B 4FHTA 4KN4X 2BBYA 3WU1B 4XBFA 3KLNA 2DAOA 3F6VA 5H6QA 4UHTA 4S05A 4L9TA 2DI3A 1CGPA 1YIOA 1LJ9A 4GO1A 5JHUA 4JQFA 3C18A 5D8KB 5A2QZ 1Q0QA 1AWCA 3RPQA 3WGGA 5E1XA 4I7HA 3T0YA 1T6SA 3W6KB 2ZMEB 1R00A 4WK8F 4GYGA 2CYYA 3BROA 3IL2A 3FMSA 3P9IA 4PDKA 3I5UA 4I02A 1HQCA 1I1SA 1QPMA 2FBIA 2GZWA 4ESJA 1K78A 4EJTA 3L2CA 3R6SA 3IRRA 3V8LA 5FLXK 3COAC 3ZI0A 2VC0A 1B1BA 1R23A 4ON0A 1ZAOA 3CUOA 3HTUA 3REOA 2M1BA 1WQ2A 2F5FA 5DEQA 2V1DA 4RB3C 4ESFA 4IRGA 4U0WA 3WG9A 5JFRA 4FLSA 3K9TA 5E20A 1ONPA 4Y6RA 3K0LA 4BHCA 3QP6A 1R36A 3AU9A 4UVAA 2Z3YA 3K1NA 5HS9A 5DCMA 2RKHA 4QWQA 3CUQC 4RGUA 3TO6A 5IT9K 4P5OA 1FPQA 3L00A 1SFEA 3QRFF 4AIKA 3PQKA 4ZQHA 4O6JA 3WTSC 4HOBA 1T39A 4EV0A 4RB2C 3HIFA 2EFQA 5J8CA 3CUQA 4P55A 5HS8A 2KKOA 1FT9A 1R7JA 1ON2A 3UERA 3MFKA 2XAFA 4IF4A 3GWZA 5LLQA 1JGIA 1P2FA 3BY6A 2RGVA 2CO5A 5L3DA 4IHSA 4OOEA 2YR2A 2MC3A 2IA2A 4R79A 1G4DA 2LKPA 1Z6RA 2HQRA 1UFMA 4HF1A 3ZHZA 2YX4A 2XGXA 5CVVA 1U78A 1CF7A 1L3LA 1LB2A 1KGSA 2MAOA 3ZHXA 5EEGA 1YTYA 1TQPA 2WWYA 4M9ZA 2QYOA 3E6CC 3GEZA 4ZYDA 2ZO4A 4A6DA 3J80K 2STWA 3HSFA 1ZRFA 1FWZA 3LQQA 2QBYA 2FF4A 3QU3A 2RDPA 2QM3A 2MD5A 2HKXA 3FWEA 4M9XA 3CJNA 3T1BA 2X4HA 3QPHA 2AXLA 1R5GA 4ENNA 2XHKA 2JCVA 2W84A 2DTRA 1S3JA 4CHUA 1EH6A 3B73A 1HKTA 3I71A 1LEAA 1T0FA 1LEBA 3G3ZA 5ICEA 1USTA 2EV6A 4HQEA 4ZZLA 5JO0A 3RJPA 4BXUA 1BI3A 3HOSA 1F5TA 2E1NA 4A2UA 2L01A 2E7XA 4LMYA 3IIEA 1J9IA 5D6EA 1BIAA 3I53A 5FFXA 4WF2A 1U5TC 1L0OC 4WWCA 4CXFA 4ENJA 3J7AO 3WODF 1KYWA 4HYEA 2A61A 2QQ9A 5A2QK 4HF0A 2XAGA 1QQIA 2EV0A 3RKXA 3LA2A 3DPTA 3GX4X 2QWWA 3CO7C 5LHGA 2GA2A 1G3YA 2DFIA 1LDKB 1F9NA 2J5OA 2RN7A 3QU6A 5D5WB 3LAJA 4HLXA 2L4MA 1H9TA 5E17F 3WE2A 1X3UA 2KJCA 1TW2A 3KFWX 1LDDA 3ROUA 2ISYA 1SD5A 1G3TA 5KVRA 2CQKA 4KA4A 1XGMA 2FU4A 3J81Z 3HRTA 2CG4A 1IZ1A 2FMLA 3RYPA 1Q0LA 1UCRA 2PN6A 3BJAA 2IJLA 3C1DA 2JTVA 1H3LA 1FBUA 1T1SA 4OINF 1MW2A 1K7AA 3BOQA 1O57A 1U5TB 4WCGA 5JVTA 2FXAA 3KP7A 2M5WA 5F6FA 4BAYA 1PP8F 4AD9A 4PZJA 5D5VB 1IAWA 1R0LA 2WC2A 4Y67A 1V3FA 4MQ9F 2MH9A 4P9UA 3IWFA 1W5TA 2PEXA 4KIBA 1IN7A 1FSHA 1ZS2A 3LQRA 1YYVA 2XASA 2QLZA 5ICGA 1FY7A 1JHFA 2WTEA 2RV8A 2BV6A 3RTRA 1C0WA 1ZLJA 5LRSA 3ZMUA 3I58A 1OMIA 4WXHA 3R61A 3F3XA 2IPQX 3JAMZ 2DPDA 2HFHA 2EK5A 4RB1A 2KIUA 4MTEA 2DPUA 1EH8A 3IKTA 2P7CB 4UV9A 2F5CA 4A03A 3VB2A 1S8NA 4CYDA 2JD1A 1J7KA 3WTWC 3CLOA 4XSZF 1KQ0A 2HGCA 4I0BA 4LLLA 2XAQA 2H6CA 2Y1GA 2E1CA 2V9VA 3K1MA 1RNLA 3ZMDA 1OR7A 5JR3A 1BM9A 1RP3A 3HHGA 5BPIA 2HYGD 4KMFA 3DQVC 4MGRA 5D5XB 1K79A 1XMKA 3CDHA 1UHWA 4LK1F 4B09A 1J0RA 3I59A 4I01A 4KDPA 4A0YA 3F6OA 3MCZA 3TOAA 1FX7A 1T98A 1J75A 3ZMSA 1BI2A 3HRSA 2VC1A 1NHAA 2Y48A 3F8BA 1BBYA 1GXPA 2V1UA 4ZYEA 4L5IA 4ENKA 5HS7A 4U7BA 3E6BA 2OQGA 2UZKA 3O2PE 5D4RA 1E17A 5ICCA 1YLFA 4OOIA 1I27A 2A5YB 3FMQA 4EGYA 1O3QA 5JAZA 1U6GA 3F8MA 3CO6C 4UNOA 1O7FA 3C7JA 3JW4A 2JD0A 2XVCA 3ULQB 3D0SA 4I98B 3ANLA 4HV5A 5CVJA 4LGWA 4LLNA 1S46A 3WTZA 1H9GA 2V6CA 4RGSA 2PBIA 4LB6B 1ZRDA 4NQWA 5JNLA 2XRNA 1MDMA 3ZMVA 5ICFA 3F72A 2PI0A 1T2KA 4M73A 1TNTA 1RI7A 3ABTA 2XROA 5CVRA 4QLCU 5TJJA 4XLNF 3I64A 4GGGA 4L18B 3E5QA 4FLOA 1KU3A 3AU8A 1IW7F 3J81K 1S6LA 1O3TA 3U2RA 2O6GE 2O61A 1IRGA 2Y1CA 2PQ8A 2YU3A 3EYYA 1MW0A 4AIJA 4PCQA 3T8RA 2HYFA 1R0KA 3FXRA 1RZ4A 2XV4S 1FP2A 3I4PA 1T38A 2EWNA 3MEXA 1HBXG 2ESHA 1ZH5A 2G7UA 2EJRA 5ILSA 4RAZA 1QNTA 4KFCA 2DK5A 5J6XA 2W25A 1XSDA 5ED4A 2R7DA 2VBYA 4YFXF 2FA5A 2YX7A 4HW0A 5BOXA 3M8EA 2K4JA 1OKRA 1ZG3A 2DQLA 4OU0A 4IRIA 4EJUA 1LVAA 4BQAA 4N9IA 2CFXA 4L9JA 3RI4A 5CLSA 2K4BA 3QOPA 2EFNA 3HUGA 4EJWA 2VODA 3KP2A 1I1GA 2DO7A 4I0AA 1YW8A 4Y15A 2EA2A 4P9FA 3TDUC 3UEQA 3IHUA 3CZGA 2O8XA 1R1UA 1ONVA 1TTYA 2JD2A 1XMAA 1ZG1A 2GWRA 3QP5A 2XUBA 2VBZA 1XD7A 1W7PB 2Y0MA 3JAMK 1B59A 4L0ZB 3LA7A 1V4RA 5JMPA 2A6HF 5D5UB 3ZHYA 1MD0A 2DQRA 4KIGA 5BPDA 5H6RA 2HTSA 4R1HA 2M87A 4K2EA 4ETSA 4HX4A 4M72A 2NNNA 2H6BA 5K5RA 2IRFG 1SMTA 3VEPA 2HDCA 2OZUA 3EYIA 2RC4A 4NB5A 4BH9A 3MQ0A 1JVSA 5BS6A 1IRFA 4M6XA 5AIPA 1HKSA 1IXCA 4KUMA 1JHHA 2JCXA 1IN8A 4WXCA 4RB0A 2EA4A 5JI6A 2A6EF 2RNJA 1HXDA 1BC8C 3ZPLA 1FP1D 4RAYA 2FQ3A 2FMYA 1XSXA 4LLGF 4A0XA 1YW7A 3GF2A 1KU2A 2PJPA 2LF8A 2CWEA 3SXYA 3ERED 2ZJ2A 5ERIA 3D5LA 1UB9A 2GIVA 2P7VB 4H0EA 2UXXA 5LGUA 2BGCA 3I54A 4IJAA 2JZYA 2JSCA 3K2ZA 3DKWA 3M1EA 1GVJA 4FLQA 2OZ6A 3CUQB 3PQJA 1MW1A 3NEUA 3AUAA 1TQMA 4MEYF 4OIOF 1YQAA 1MJBA 4A12A 2W24A 4MHGA 3NQOA 3ZQ7A 3WQQA 1J2XA 2DLLA 4EVIA 2LDUA 4OIRF 3LWFA 5LHHA 1VTNC 4ZZDA 5LEKA 1RIOH 3S2WA 2ZKZA 3U1DA 3KEQA 1F1ZA 1BI0A 3JTGA 1HW2A 3GFLA 5F1RA 2Y1FA 3B02A 1U3EM 3V8JA 2BE5F 2MBFA 3EDPA 4D0PA 5DDGA 2C6YA 2QENA 4ENMA 4EM1A 1SFUA 3WTUC 4BNCA 3BDDA 5FGMA 5E1ZB 2VBWA 1W4MA 3ELKA
chains in the Genus database with same CATH superfamily
1STZA 4BJ6C 2H27A 2HZTA 4F93B 3KEDA 1I6XA 2QBYB 5D6FA 3P5JA 1F4KA 1TNSA 5DLLA 3PM1A 1KYZA 5EYRA 1LPQA 2PMUA 4KP7A 3CQZJ 5HODA 1FC3A 3RZDJ 1YIJI 4IOAF 3HDDA 4D1QA 2PG4A 4ZX4A 4HZFA 4GAEA 3ABLH 4AVPA 2IS6A 1GDTA 1TWHJ 4JX5A 3BG9A 3TMOA 4A3MJ 1LFPA 2RNGA 1FMVA 4II3A 3M7GA 3RPUD 3JRIA 1GXQA 4FQGA 4MFEA 2PMZN 1IRZA 3UCQA 3FX3A 4HAMA 4G94A 3K7AJ 3RQ4A 3FHZA 1R4NB 5E8GA 4EM2A 3Q9VA 2Q8KA 5J1UA 1LFBA 4O5VA 3V4GA 4OIPF 3HRUA 4HG2A 4L9NA 2KPMA 1OCTC 4V2FA 1SFOJ 2C82A 4Y17A 2VJIA 2GXGA 5F08A 2H09A 2Z2SB 3TQNA 3TKYA 3S3MA 1OYIA 1Y39A 1B6AA 4BU2A 1FZPB 1A6QA 4HF2A 1U2WA 4U88A 3D5SC 1FOYA 4MNUA 1MH4A 2F2EA 2E35A 2KIFA 2QGUA 2BY0A 3CCEI 4ZTJA 1AA7A 2O8KA 3HYIA 3BZKA 2NVUB 3GZ6A 5C4XJ 4JK1X 5E8IA 3HG9A 1P4AA 4YIIA 1WPKA 2OV7A 4LD5A 4G7HF 3S2HJ 4ASNA 3JTHA 3ZQCA 5DTDA 2V26A 3WU2C 3Q0VA 2HEOA 2STTA 1NK2P 2EGHA 1Y0UA 3BQZA 4XNBA 3VYSB 1G2HA 2ZSIB 2GQQA 3MAJA 5HDGA 4BJ5C 3B7SA 2DMNA 6PAXA 4J19A 2MAPA 5FB2A 1W7PD 4KT5C 4Y6SA 2EFWA 2DODA 1D0YA 3C3WA 5HDKA 3GFMA 1YX3A 1SC5A 1MKMA 2X6YA 3OYIA 1IG7A 2ETHA 5K1YA 2R7WA 1DQUA 4ZW7A 1UHMA 5EV7A 4XSXF 3T5XA 2BY2A 3RCOA 4PGHA 1FYKA 3WHCA 2ISZA 4GYIA 2OBPA 1QU3A 1GUUA 3OV8A 4JOMA 2AQFA 4M3FA 5KHDA 1W0UA 4Z6YA 3HRMA 3W6VA 1X4OA 1KA8A 3HPHA 3FF5A 2GLOA 1JTXA 2JWTA 3CJTB 2XSJC 1XGOA 1EV7A 2K02A 3Q5FA 1IXSB 2IGMA 3WHBA 1WJAA 3LAPA 3AG2H 3GW2A 2DK8A 2R7TA 2VQHA 4NBQA 3VFZA 3FUKA 1UMQA 3DTIA 3CZEA 3I9V2 2HWVA 1HW5A 4C3HJ 2KQRA 4BBRJ 4BQOA 3B7RL 1VQPI 5FLMJ 3PIPF 3H3ZA 1VQ7I 2MC4A 3OYFA 1W36C 1DPRA 5E1WA 2Q0OA 1AKHB 4V2GA 3TW7A 2XKPA 4X2UA 1FOKA 1JE8A 3FULA 3WGIA 1YS7A 2Y1EA 2ZFWA 4CZZA 1WSUA 3K4BA 4E7ZA 3PSIA 3V7CA 4K5PA 5FWQA 3E97A 1MVYA 2P6TA 2YU9J 1TWGJ 1XN7A 4A3EJ 2DDBA 2HR3A 3JSZA 3BTLA 4B44A 2QUFA 4IVNA 1X1BA 4ZYHA 5ILUA 3OYGA 3FK6A 5DS9A 3GFIA 3P9KA 3K4LA 3MZHA 4BY1J 2IS4A 1P6RA 2ME6A 3QYBA 3L7WA 3R0JA 4R5XA 1ZYRF 3ZR8X 3E7LA 3U1KA 2FBHA 3OYCA 3U9GA 1USSA 3OS0A 1R49A 2FNAA 4RSYA 1FYMA 3BZCA 3DU6A 1XX5A 2Z16A 2BY3A 3FZVA 3GUDA 1Q1HA 3GTMJ 2FOKA 2FX0A 3E6MA 1EH7A 2F5VA 3CP8A 3E3VA 4LIUA 3B6CA 5JMWA 3KEOA 5L3CA 2P5VA 2D2WA 1YOVB 5KK1A 1YFHA 4A3JJ 1WJFA 2DA7A 1Z9CA 1OR7C 3KETA 3Q0UA 4M6VA 4ARFA 4HX8A 4A3CJ 2XAUA 4FTHA 5LHIA 4J00A 5J3LA 3OYAA 2CU7A 1BA5A 3RASA 4OOFA 3WE3A 2DU9A 5J1YA 2NVYJ 3IWZA 3MZYA 1FOXA 2EH3A 3DEUA 5HLIA 4Z2YA 2CQQA 3HGYA 3PNYA 4TV7A 2X1DA 1E2XA 1U0JA 2R3SA 4I09A 2XC7A 1FYLA 4CCOA 2AO9A 3BPVA 2EFPA 3TOBA 1PUFB 1DP3A 3E5XA 5HLTA 2W1OA 2WY7Q 2CV1A 9ANTA 2K9NA 1J5YA 3VDXA 2WY8Q 4GXOA 2KIMA 2XKOA 3Q3SA 4AWXB 5EGOA 2PUSA 4Y7NJ 2L7MP 2HZDA 2LKXA 1HS6A 1R1VA 2HXOA 4CICA 1IN4A 1X1PA 1XCBA 3H5RA 1JKPC 3S2DJ 3CHSA 2EB7A 2V9KA 3JCUC 2XPWA 3JSPA 5E18F 1G3SA 5AENA 3ASOH 1ENHA 2KRCA 4IHTA 2P8TA 2LG4A 5LRRA 2EV5A 3LSTA 1D8JA 1RKTA 4ZQGA 1XSVA 4YIFA 1N25A 1RKWA 5FKMA 3LSRA 2A68F 1QZYA 1LDJA 4L9VA 4EMSA 4Q4ZF 2K9QA 2P6SA 5CKTA 2BXZA 1LQ1A 3OL3A 1DU0A 1IF1A 2Y1DA 5E79C 1ZR2A 1AU7A 2K5CA 3M9AA 3RQIA 1BOAA 1I3AA 2ECCA 1A04A 4RGRA 3OYEA 2HPOA 1B9NA 1IC8A 1G5AA 3ECOA 4BUPA 1N77A 5DD4A 3DEWA 4LG0A 3UR3C 2VJ5A 4OMYA 5DYFA 1XTAA 2JSPA 2MD0A 3H0DA 4FLRA 1D0ZA 5CVIA 3SZPA 3SDBA 1TQIA 5KAFC 2R72A 3JRAA 4FCAA 3BPXA 4XKWA 1Z7UA 2V1NA 4G6DA 2ZMEC 4BY7J 3ZN1A 5K5QA 3WG7H 2GXBA 5DCFA 1SMYF 4M3DA 4O3MA 2E2JJ 2M2EA 3FXQA 3ABUA 4AVZA 1R22A 2CFOA 2X48A 1ITYA 1HKQA 1LKXA 2LC2A 1YJNI 2VONA 1FLIA 2OUMA 1B8IA 2AS5F 1HW1A 1OCZH 1GW6A 1D5YA 1RPWA 1K4SA 2MGQA 4L5JA 3Q0WA 1ETKA 5EG0A 1EJ9A 1WH5A 3B37A 1T95A 4Q5SF 4BGDA 2ZMEA 1TLHB 2L7ZA 3HKZN 3IKVA 1Y6IA 3H9JA 3A0BC 3IH2A 2VE8A 3I59B 1YJ9I 3GVAA 2FQ4A 1S9HA 4C9YA 1A6IA 4IL6C 3RKYA 1VQOI 4Y13A 2KJBA 4KICA 2M34A 3B2PA 3RPUA 4BE0A 2DOAA 3RSNA 2P0WA 1XDUA 4RM3A 3T8TA 2DW4A 4DGWB 4YFNF 2M3AA 2BEOA 3FBNB 5CYVA 1JT0A 1XGSA 5CQGA 2ESNA 2GM4A 2E7WA 4BHBA 1MIJA 5L3FA 3JRHA 4PSXA 3GXOA 3K4JA 4CZCA 3OYJA 1IN6A 2H8RA 3BTIA 2PJRB 4XN3A 2DMPA 4HQMA 3HOVJ 1BN5A 1RESA 3NAUA 3J7ZI 4LUPA 3QAHA 1S72I 2M8EA 1SG7A 2A05A 2FE3A 2K3PA 4GDFA 3SHFA 2XQ0A 2IT0A 3EQLF 3DF8A 3BR1A 5LD2C 2ID3A 2QSFX 3DLAA 1ZN2A 3H9GA 5M5WJ 1VQMI 1R6RA 2X0LA 2QA4I 1VQKI 2KP6A 3FUFA 3DTEA 4LJZF 1IUFA 3FU5A 2TDXA 4RM2A 2JT1A 3FK7A 2CGPA 2M45A 3LSMA 3RDIA 2IA0A 4M9SA 2LY2A 2K9LA 5HOOA 1HSTA 2F5EA 2ACJA 2L9SA 2JPCA 2A07F 2KMUA 4OAZA 2R7FA 3M8FA 2GA1A 2OPTA 4DIQA 4W1UA 1TWFJ 4RMNA 5DV5A 3FTZA 2DJIA 4ZJZA 1W7PA 1UJ8A 1XCVA 2W57A 2NYXA 3HEFA 3CCSI 2JQ7A 1ZLKA 1A31A 1YE9A 2L54A 4F7ZA 2I5UA 1SFXA 1T33A 1SD6A 4E7IA 1RUNA 3X2QH 2Q1ZB 2CUEA 4EJVA 3VODA 2FNPA 2MG4A 3CCQI 1UELB 5B66C 4UUVA 1ULYA 4CCLA 2LTPA 3FMRA 1MDMB 2VXZA 1D0XA 2CUJA 1S29A 3S15J 2NVTJ 3GLXA 3DCFA 1HSJA 3OYHA 1PP7U 2WADA 1GHCA 2ELHA 2CW0F 2V1XA 1P4WA 3H1CA 4ITVA 3WGHA 4U0YA 2NAZA 2QQAA 3KPHA 3O3KA 4AM3A 2Y75A 3AAFA 2PFBA 5GADJ 5K7FA 4OIQF 3TO9A 5GAEJ 3G73A 3WQSB 1MJAA 1AHDP 4XKBA 3FM5A 2ME0A 4ZYAA 1JGGA 3QPSA 4YFKF 2KT0A 2WPGA 1E3HA 3KZYA 3A02A 1ZTRA 5K7ZA 1WRJA 2VOPA 3PO2J 2G7HA 4DNCA 2Y69H 4HBLA 2P4WA 1P4XA 2OC6A 5HVQC 4RAGA 4RCVA 2NS0A 5TRDA 4KYWA 2DA6A 2R7VA 1R58A 2D5VA 2Q2EA 3BJOA 4BHPA 4BJTA 2XGDA 1W5SA 4GRIA 1XDSA 4E7JA 4RGXA 4M71A 3I3LA 3OOPA 1Y1WJ 1YRNA 3TGNA 2HQ5A 1MNEA 2DXIA 1JG9A 1K78B 1Q0HA 3CCRI 3J7AY 2DT7B 4RAFA 1ZARA 2RQPA 3GTPJ 3EUAA 1FEXA 1ON1A 3CCVI 2OU2A 2Z33A 2MLGA 4ZDLA 4UV8A 3A2KA 3F23A 3ZP5A 2W85A 5EEHA 4IHXA 2H94A 2VT2A 4G9YA 2BOLA 1VZ0A 5BMZA 5FKKA 2VPRA 4C2MJ 4ZH4F 3SDGA 4NC7A 3FKJA 4HX7A 1JUMA 1S7EA 4U7DA 3KIOA 4BEHA 3PJRA 3DPLC 4IRHA 1MMDA 4Q48A 2K27A 1QZZA 3WTXC 4XN1A 4U87A 1OFCX 1X3ZA 4AICA 1OYYA 4HDVA 3CZLA 3R60A 4XK4A 3HOWJ 1FBSA 4KN7X 5H20A 2V79A 1UAAA 5J47A 2AXTC 5LFAA 1ZREA 3IP4B 2QVOA 5DCMB 4ZYGA 1FSEA 4S04A 2D45A 4IQJA 5AIQA 4N4OB 4JBAA 2FSWA 3ANNA 3P7NA 4UB6C 3GYHX 1X58A 2IW5A 3HSRA 5FFZA 1BC7C 1XGNA 4Y6PA 2YPRA 1KQ8A 2IVMA 4N0BA 3L09A 3NRVA 4MO7A 3K69A 4KJZA 1WKMA 3WTVC 3FXOA 3FXUA 4M74A 2JRMA 5ILVA 2ZCWA 1SD4A 2IGOA 2D1HA 4AC0A 2HQAA 2O03A 2Y31A 1MSFC 2MYSA 2MA3A 3ASNH 1DUXC 2FFLA 4CO8A 4A5NA 2UXNA 2HI3A 2P81A 3KP5A 4K5NA 2O5RA 2HTJA 3FM3A 4KMUX 4EJOA 4PJJA 2R5YA 4BYYA 3L2VA 4QPOA 3ZN0A 4XLFA 3BCAA 3BP8A 5IP6A 3R0AA 1R1TA 2BY1A 2K86A 3N97A 2XIGA 2OCCH 1PDNC 1VQ9I 3A01B 3K10A 1BI1A 2KDOA 1IUYA 3PUUA 3FTWA 3GMEA 1WGXA 1WCMJ 3GTGJ 4A0ZA 4W97A 2IP2A 4UUSB 1SD7A 3QQAA 5L3GA 4H4KC 5EZHA 1V54H 3E6DA 4B8XA 3HSEA 2E60A 4ZQEA 3L2UA 3DKYA 2E2HJ 2LRDA 1X1CA 1WI9A 3VOEA 3DLLF 3TDZC 3V8KA 3SQNA 3ZXSA 3KEYA 1O3RA 1CF7B 2HOTA 3HTSB 3PFIA 5F64A 4D5FA 4MS6A 3AG4H 3RIRA 5JLXA 1YO5C 4ZW6A 1BR1A 1OPCA 1T1RA 4E70A 1I5ZA 2BXYA 2F6CA 1P92A 3WTYC 2DOEA 2QSHX 2H1LA 1RUOA 4GFBA 3E5UA 1NTCA 2RAEA 3GTQJ 4HDUA 2XB0X 3E0JB 4LB5A 1O7LA 3V7SA 5J4YA 2LD5A 2QQBA 3ISPA 2HPTA 4UVBA 3KLOA 1DPUA 2PGGA 4C3JJ 4JNDA 2P5LC 1SEUA 3KE2A 4JX4A 4QIWN 4E4HA 3U9WA 2EZKA 1J59A 1UZCA 1Z05A 4I2OA 4P96A 1XB4A 4HSRA 4A5MA 1QZEA 1WFXA 3BG7A 4G6TB 4KT6A 3F8FA 3I0TA 4OMZA 1PUEE 4MLOA 3LSPA 3JSOA 3OYDA 2A3SA 3ECHA 4XO3A 2WB1A 2KHMA 1G3WA 3N4MA 1JKQC 1SC7A 4ZQTA 2O3FA 3OIOA 2JUGA 5F04A 3F21A 3VVLA 1YS6A 3CDIA 5JBIA 1JXSA 2X1EA 1D5VA 4X1EA 4WXDA 2JV7A 1ZELA 3GTOJ 1R5HA 2ZJRF 2LNBA 2VUMJ 2WZFA 3S14J 4LIVA 1EF4A 3GO5A 5AONA 5E3MA 3R4KA 3IAM2 5IYCJ 1ZGAA 4ESBA 2ZXJA 1K6OA 3R0IA 2E19A 3FISA 3VYRB 1ZRCA 3OR2C 4F55A 1B72A 2LYCA 3DXJF 1DP7P 2Z99A 3H3UA 4NC6A 2VOOA 3Q44A 1G59A 1B9MA 4HLYA 4PJNA 1OYWA 1JTYA 2X6WA 3CC4I 5D8LB 1O3SA 2FBKA 1U5TA 4C2UA 2DOFA 3BZ6A 3W3CA 1QBJA 3NWTA 3O6BB 4M3BA 1IXRC 1TC3C 5L3BA 3GZ5A 4IXAA 3NARA 4DZPA 5IY5H 2KL4A 3P9CA 1MW3A 1HDPA 5LBQA 4XNFA 2JCYA 4PUSA 2F4IA 4L2LA 2VXDA 1XPXA 3ZMTA 1GV5A 5DULA 2WV0A 2XF7A 4Q4EA 1H0MA 2XB5A 5TISC 1MBHA 2L3DA 2VN2A 1Z6TA 2IGNA 2GAUA 5DUIA 1BJZA 4Q47A 2LFBA 1KQ9A 3ZQHA 4AUXA 1TW3A 5HLGA 1K61A 4R8HA 4C3IJ 4EGZA 3FU0A 4AR8A 2RQQA 3L9FA 2XRLA 1ZGJA 2BW3A 1IRXA 1BJAA 2B63J 4U0VA 1RC9A 4ZDPA 2MABA 2Z5UA 2M30A 4L0YB 2L9RA 2LSOA 4XOPA 3B3BA 4DBQA 2YSRA 4HRIA 3FHEA 3SFIA 2IAIA 2MSYA 4EQQA 4A3BJ 2BHZA 2O7GA 3KCCA 3ANMA 2D1VA 2DDAA 1GT0C 4FETA 3QYFA 2HXIA 2FRHA 3HHHA 5C44J 1ACIA 4PJMA 5BQTA 3DP7A 4BKXA 3OYBA 3IV5A 5FO5A 1ZGWA 2HQNA 4X0GA 2C5ZA 3MD2A 4GCVA 5BNGA 2XAHA 4KITB 1WHUA 5DUKA 1MJ9A 4FX4A 3TO7A 2M7BA 4NC8A 3BWGA 4YG2F 4QPEA 5FKNA 4ZN6A 1TBXA 2CMPA 2J5PA 5J8FA 2L4AA 1QO0D 4PGGA 4UXNA 4L5EA 5FLXZ 3V7RA 4FASD 3LNQA 5CPRB 2LVSA 1F43A 3GTJJ 5D4SA 2VJ4A 3S3NA 2G9WA 3QOEA 2DFFA 2DQ6A 2MH2A 1S7AA 2L9VA 3EPZA 3MWMA 4B47A 4R5TA 1Z21A 2DYRH 3BTCA 3LA3A 4NDLA 3ML6A 1ONOA 3IRQA 4CDGA 2V6EA 1FNNA 1PUFA 1BIBA 2PLYA 4AR9A 5CJ9A 5DD8A 3ZMZA 3WTTC 3IC7A 4KNYA 3W6JB 3FTXA 2COMA 2F48A 4PJLA 2VKEA 2F4OB 3H92A 3FTVA 2XAJA 3C2BA 4FX0A 5E3OA 3DU5A 4NNJA 1VQ8I 1YW9A 4XRFA 1ZG5A 5BPPA 4IPAA 1ETVA 5B1AH 2IA1A 1WJBA 1IN5A 2K7LA 4RDUA 3H35A 3CHQA 4XKVA 5IT3A 3U21A 1BR4A 3S16J 3KP3A 1MZBA 1Q1VA 2KRFA 3M8JA 3A06A 1VQ6I 4CCJA 1WI3A 3VSKA 1D8KA 4MEXF 4CH7A 3EUHC 5FD5A 4ZQFA 4S0HB 4DYQA 1X3WA 5IT9Z 2VBXA 2GOXB 1MBEA 2F5DA 3K1PA 2LY1A 2EFOA 4ZW8A 4XNAA 1JGSA 4HA8A 2DT6A 3FH5A 2Y9YA 2DT5A 2ZB9A 4N9HA 2R0QC 2K85A 4G6QA 3F22A 1D3YA 2JN6A 2HOEA 4CGZA 3FH7A 2W00A 3EETA 4RLQA 2OA4A 3KP6A 3K4MA 4G7ZF 4UY8I 3EUHA 4E7SA 2QZ8A 3OIQA 2VE9A 1FBQA 5HLHA 1KU9A 2P5KA 2ADUA 2XF6A 5L3EA 3UNGC 3QYEA 4XRSA 3TBIA 1TL8A 4JP0A 4LK0F 1HDDC 2Y2ZA 1K6YA 1MMSA 3L2WA 3F8CA 5LGNA 1TP4A 4XL9A 4ZC3A 2IS1A 2DBBA 3CESA 4IOCF 2E1OA 5JC1A 1ODDA 2O0YA 3QPTA 4G8XA 1XMXA 5LGTA 2V4JC 2NOGA 3WQRA 3KZZA 1QVUA 2PMHA 4KIFA 2UWMA 2ZBKA 4XLPF 2HKOA 2XDVA 3FIWA 1LNWA 1NG7A 3K70D 3ZQGA 4HV6A 2MLKA 1K5HA 2HOAA 2VT3A 4HPQA 5CVUA 1ZHFA 1MMAA 2EZLA 3FTSA 3WU0A 1SVOA 3DV8A 4LG3A 2OD5A 3A14A 3RKWA 4BQQA 4MTDA 2VI6A 4XMWA 2DJNA 5DYMA 3V42A 3GLLA 3OWTA 3KP4A 4J3BA 5C3EJ 1MGTA 3CZKA 1JKRC 2R5ZB 2KZGA 3S93A 4A6EA 1JT6A 4UVCA 4D7NA 3A4CA 5FD6A 2BHYA 1LVKA 3DFGA 5LEJA 3JREA 2DTZA 3HOTA 1S7OA 2WAQN 2FEZA 3OL4A 4XLEA 3LSHA 1AOYA 5B5EC 1N78A 4FISA 2ZJPF 1MH3A 3J80Z 4M6YA 1B4AA 1Z1DA 2CJJA 5EDNA 3Q9SA 4HNTA 4ZDOA 1OISA 5F0FA 3BJ6A 4DQ2A 2ZNYA 2W7NA 2EZHA 5KNLA 2JPBA 3OMYA 3BR6A 2WV1A 5E3LA 3OYLA 2NRAC 3PNVA 2VQCA 3RYRA 3O8HA 1ONNA 3A1YA 3IH3A 1G6NA 2M7AA 1WWXA 3DBHB 4FT8A 4PFPA 3HGGA 1LUJB 3FXJA 4CYCB 2B0LA 2RVCA 3G6EI 1DDNA 2Z9OA 2JRTA 2R7QA 5K5OA 5EGOB 1DU6A 4KISA 2B7EA 4EM0B 1U8RA 4IRIA 2DMUA 1QGPA 1KU7A 3JT1A 2L7FP 3SFZA 4LFUA 4WX9A 2KRHA 2CSOA 2W82A 4RS8A 1Z91A 2LF7A 2QVWA 5J40A 4AIHA 1Y56A 2OAZA 2BYVE 4XOTA 2OQRA 5FKOA 1SAXA 2L02A 1REPC 2EIJH 4AYSA 1Y0NA 3F8NA 1NH3A 3GFJA 3CTAA 3SZTA 1IJWC 5FRMA 4X6AJ 2HNHA 1YG2A 2ZNZA 4XMYA 1QHGA 2NNYA 2M0MA 3CCJI 2A69F 4A3GJ 3EBGA 4G7OF 1P7IA 2I10A 3LFKA 4MQVA 1IDZA 2LMDA 4HNUA 5F0HA 2VJ8A 4NHJA 1YITI 2L0KA 1WJDA 2HS5A 2Y0SN 5HDNA 3B2XA 3O8GA 4LG0B 4FHTA 4KN4X 1SVMA 2BBYA 3WU1B 4XBFA 1VFCA 4BDZA 3KLNA 2KLOA 3FUEA 4ZX5A 2DA2A 4A3KJ 5C4JJ 2DAOA 4YELA 3F6VA 5H6QA 1H89C 3FU6A 1R9TJ 4UHTA 4B48A 4S05A 4L9TA 2DI3A 1CGPA 2JVGA 3BR2A 1WJCA 1YIOA 3W2VA 1LJ9A 1Y8QB 4GO1A 5JHUA 4JQFA 1FIAA 5HNHA 3C18A 4RA2A 5D8KB 1N75A 5A2QZ 1QA6A 1Q0QA 4B4CA 1FJLA 3HZJA 1AWCA 4II2A 1B8IB 3CZ6A 3RPQA 3WGGA 1H19A 4V19K 1VQ5I 5E1XA 3MKWB 4I7HA 1E3PA 5EG0B 5EJCA 3T0YA 1T6SA 3W6KB 2ZMEB 4B43A 1R00A 4Y33A 4WK8F 4GYGA 1IV8A 2CYYA 3BROA 3IL2A 2OCEA 4AYBN 3B7TA 4NQWB 1ETYA 3FMSA 3PNTA 3P9IA 4C2TA 4PDKA 3I5UA 4I02A 3DBLB 4ZW5A 3OY9A 1X2NA 3G71I 2KDZA 3G2BA 1HQCA 1HCRA 1I1SA 3GTLJ 1QPMA 4DBRA 2XPZA 2FBIA 2CQ7A 2GZWA 4ESJA 1JUSA 1K78A 3OSGA 4EJTA 2VQLA 4XLHA 3L2CA 2X6OA 3R6SA 2LOOA 3TEDA 2N8GA 1NK3P 3IRRA 3V8LA 3K2AA 3OYMA 5FJ8J 3COAC 5FLXK 4K5LA 4QIRA 4XMZA 3ZI0A 2VC0A 1P9QC 1B1BA 4PU2A 1NG6A 1R23A 5EZGA 2X9DA 4ON0A 1ZAOA 4XRSG 2VJJA 3CUOA 4Q4IA 3HTUA 3REOA 2M1BA 3FUNA 1WQ2A 2JMWA 4IZZA 2F5FA 5DEQA 1D1AA 1TWCJ 5KAIC 2V1DA 4RB3C 4ESFA 4IRGA 4U0WA 3WG9A 3HKZA 5JFRA 3S8PA 4FLSA 3K9TA 5E20A 3SEQA 2XGCA 3W2WA 1ONPA 3K0LA 4BHCA 4Y6RA 3QP6A 2Z1DA 2GXAA 2GOMA 1R36A 1I39A 1X1DA 2AHQA 4HEA2 3AU9A 4UVAA 2B9SA 1FMWA 2Z3YA 3K1NA 4XKCA 4ZX6A 5HS9A 1ZR4A 5DCMA 5EEAA 1LE8B 2RKHA 4QWQA 2KISA 4PW4A 3CUQC 4RGUA 3TO6A 5M5XJ 2CS3A 3F0CA 5IT9K 4P5OA 2VLAA 3FH8A 1HF0A 1FPQA 3L00A 1SFEA 3QRFF 2OTJI 3Q43A 3S1QJ 2OJED 4AIKA 3PQKA 4ZQHA 2E1MC 2MFZA 4O6JA 1V5GA 3ZGKA 4HOBA 3WTSC 3G4SI 1U9OA 4DYCA 3ZQQA 1T39A 3CC2I 4EV0A 4RB2C 3CLQA 2M9HA 3HIFA 3TL4X 2EFQA 3H5NA 4JYKA 3CUQA 5J8CA 3AFHA 4P55A 5HS8A 3DKXA 1IO2A 1Z0XA 2E5NA 3QJXA 2VKDA 1BL0A 2KKOA 1FT9A 1R7JA 1W36D 1ON2A 1G8XA 2IXSA 3MFKA 2XAFA 3UERA 4PK4A 4IF4A 3HUGB 3GWZA 4XN9A 5LLQA 2CV2A 1JGIA 3RC8A 1P2FA 3BY6A 3PIOF 4XMTA 2RGVA 2CO5A 5L3DA 2PL5A 1IDYA 1LFUP 1HLVA 4N4NB 4IHSA 3SZGA 4OOEA 3HC7A 3J7YJ 4MKTA 2ZJQF 2YR2A 5JLWA 2MC3A 4BXXJ 2IA2A 4R79A 1G4DA 2LKPA 1Z6RA 1A36A 3HW2A 1SVLA 3JR9A 2LBFB 2JA5J 2HQRA 1UFMA 3CF2A 4HF1A 3HOZJ 3ZHZA 2YX4A 2XGXA 5CVVA 1U78A 1V5FA 3H5AA 1CF7A 2FD5A 1L3LA 2L2OA 4Y4RA 4CUGA 1LB2A 1KGSA 4F3QA 4M3EA 4FE7A 2MAOA 3ZHXA 2Q2EB 5EEGA 1YTYA 1TQPA 4XN7A 2M0CA 2CH0A 3CMMA 2WWYA 1QRYA 4M9ZA 2QYOA 3G1LA 3E6CC 4QUOA 3BG3A 2AQEA 1BW6A 2WAFA 3GEZA 2VPLA 4QHPA 4ZYDA 2ZO4A 1BOBA 4RBOA 4A6DA 3J80K 4BS9A 2STWA 3HSFA 1ZRFA 4IHYA 1FWZA 3LQQA 1JI8A 1XC5A 1MBFA 4P1WA 2QBYA 2NS7A 2DA3A 2FF4A 3QU3A 4DZJA 3JRDA 2HPMA 4CCNA 3LMMA 5HNFA 2CQXA 1WJ5A 2DA5A 2RDPA 4YEJA 4BEHB 2HOSA 4BBSJ 4IO9F 2QM3A 2VKHA 1DGRM 4I99C 2MD5A 4E7HA 2JA7J 2HKXA 2Y9ZA 2E1MB 3CMEI 2L5QA 3FWEA 1W1WE 2TCTA 3FTUA 1D1BA 1GVDA 2HVQA 3S17J 2A6TA 3CJNA 4M9XA 2CQNA 3T1BA 2X4HA 3OYNA 4C30A 3ONQA 3QPHA 2AXLA 3H3VK 1R5GA 3HXLA 4ENNA 4AIDA 4BXFA 4QTRA 3HOXJ 3FUJA 2XHKA 2EZIA 2JCVA 1T08B 2RREA 2W84A 3CP2A 2DTRA 3OS2A 3BG5A 1S3JA 4CHUA 1EH6A 3KYDB 3B73A 1P7JA 1OCRH 1HKTA 3I71A 1LEAA 2BVMA 4IEJA 1T0FA 3AG1H 4XLCA 3H0GJ 1LEBA 3G3ZA 5ICEA 1USTA 3F9KA 2EV6A 3CMAI 4ZZLA 4HQEA 4A3DJ 2L9NA 3M3YJ 5JO0A 2H8WA 4DOZA 2BZTA 2ZFUA 1OQYA 3RJPA 4BXUA 2A5WA 2CRGA 1BI3A 3M1CA 3HOSA 2DA4A 1F5TA 4FCYA 2E1NA 4A2UA 2L01A 3VYTB 2X6XA 2E7XA 3MKZA 1Y8RB 1QVTA 3S1RJ 4LMYA 3G1MA 3N05A 5K7HA 3IIEA 1A35A 1E0EA 3D5RC 1J9IA 2XF5A 3B34A 5D6EA 1FIPA 1BIAA 2CW8A 3I53A 3OOUA 5FFXA 4WF2A 1U5TC 1L0OC 4WWCA 1IGNA 3CJQB 2QJ1A 2LP0A 4CXFA 4ENJA 3J7AO 1H8AC 4GAAA 2IBDA 4LOCA 3WODF 2FUG2 5GAGJ 4LITA 1KYWA 1JJ6C 3EBIA 2EQRA 1R71A 4HYEA 4E7KA 2A61A 2QQ9A 1I3QJ 4DJAA 5A2QK 4HF0A 2XAGA 3HB9A 1QQIA 2EV0A 3RKXA 3LA2A 3DPTA 3GX4X 1I6HJ 3RZOJ 3PSFA 4PSWA 2QCOA 2QWWA 3CO7C 5LHGA 2GA2A 4OWRB 3QWLA 1G3YA 3HPGA 3HL2A 3CCLI 2DFIA 1LDKB 1F9NA 2L7KA 4HSTA 4FE4A 2R7XA 2J5OA 1M1EB 2RN7A 2XPUA 4DYRA 3QU6A 5D5WB 2ZSHB 3TP3A 3LAJA 3L2QA 1VQ4I 4HLXA 4RVBA 2UUZA 2L4MA 1H9TA 5E17F 4MIMA 3WE2A 3I55I 2JA2A 2ELKA 1X3UA 1AKHA 4XMXA 2CV0A 2KJCA 2GIZA 1TW2A 3ZQIA 3KFWX 4F92B 1LDDA 3ROUA 5FKLA 2R4GA 3DBRB 1I50J 2ISYA 3BQYA 1SD5A 1G3TA 2E34A 5KVRA 3OIPA 2CQKA 4KA4A 1XGMA 2FU4A 1W0TA 3J81Z 3HRTA 3ERMA 1IZ1A 2CG4A 2EINH 2ZXIA 3IH4A 2R7RA 3BG6A 2CW7A 2ZXHA 2FMLA 1RR8C 2YS9A 3RYPA 2H1KA 4BL0B 1PJRA 1JJ8C 1Q0LA 2E71A 4XN4A 1UCRA 2PN6A 3BJAA 2Y30A 2IJLA 1YJWI 3C1DA 2JTVA 1H3LA 1FBUA 2DFEA 4A93J 1B72B 4BE2A 1T1SA 4OINF 5IP7J 2ZXGA 3FBIB 3HOYJ 1MW2A 1K7AA 1MMNA 2ECBA 3BOQA 4XM3A 5GTIC 1O57A 1U5TB 4WCGA 4BACA 2HVRA 5JVTA 2FXAA 3KP7A 2M5WA 4PFOA 5F6FA 4BAYA 5M3FJ 1PP8F 3DEEA 1RETA 4AD9A 2DQMA 3MMYB 4PZJA 1MMGA 4AU7A 5D5VB 4Y3OA 4UB8C 1IAWA 1R0LA 2WC2A 1QHHD 4Y67A 3FKIJ 1V3FA 3S1NJ 2KZVA 4MQ9F 2MH9A 5E3NA 2WBMA 4YRVA 4CCKA 4P9UA 3B7UX 3LSIA 3IWFA 2DYSH 5GPCA 1W5TA 3ABKH 2IEKA 3KYCB 2PEXA 4KIBA 3CDLA 1IN7A 1FSHA 4EATA 3S3OA 1ZS2A 2CUFA 2DFHA 3LQRA 4CA0A 1YYVA 2PMZA 2XASA 2QLZA 5ICGA 1FY7A 3M4OJ 1JHFA 2WTEA 2RV8A 1K83J 2BV6A 2KFDA 3VYUB 3SEZA 2QSGX 2M8GX 3RTRA 2COBA 2E36A 1ZLJA 1C0WA 5LRSA 2BW3B 3BTJA 4B1RA 3CCMI 4JX6A 3RKQA 2GTQA 1Y1VJ 3ZMUA 3BR5A 1OMIA 3I58A 3MN2A 2R7ZJ 4WXHA 3R61A 1X1AA 3F3XA 3VVMA 2IPQX 2HYJA 4B3XA 3CIAA 3FUHA 2JA8J 2LREA 1HC8A 3FXLA 3JAMZ 3QPLA 4DPRA 2DPDA 4BQNA 1VQNI 1Z67A 1ETOA 2HFHA 2E5ZA 3JRFA 2EK5A 4RB1A 2KIUA 3S32A 4MTEA 2DPUA 5IOYA 5B1BH 1EH8A 1SAUA 3IKTA 3KYLA 2P7CB 3GBGA 3HBLA 2R5ZA 4J01A 4UV9A 2F5CA 4A03A 1X4PA 3VB2A 1S8NA 4CYDA 2DMQA 3ZOBA 2JD1A 1J7KA 2K9MA 3WTWC 3CLOA 4XSZF 5EF6A 1MNMC 1KQ0A 4XO5A 4QPQA 2EILH 5F1JA 3JRCA 3AG3H 2R92J 5GTHC 1FTZA 2HGCA 4I0BA 4LLLA 4XN8A 2XAQA 3VPRA 3MZ8A 1MBKA 2H6CA 3GTKJ 3ZCOA 3GCMA 5CQEA 2Y1GA 2HVSA 3A0HC 2E1CA 3FU3A 2K9SA 4PVBA 2V9VA 3K1MA 1RNLA 3ZMDA 1OR7A 5JR3A 1BM9A 1RP3A 4CYCA 3HHGA 5BPIA 5M5YJ 2HYGD 4KMFA 3OS1A 3DQVC 3H36A 5IPAA 1OCPA 1BW5A 4MGRA 2GBYA 3I56I 5D5XB 1K79A 1XMKA 3CC7I 3CDHA 5FRNA 2JK3A 3LFUA 1UHWA 4LK1F 4IKFA 2RJIA 4B09A 3OSFA 1J0RA 3I59A 3FXMA 4I01A 3CCYA 4KDPA 4A0YA 3F6OA 3I4MJ 2IS2A 3MCZA 3FUIA 3TOAA 1FX7A 1T98A 3FUMA 1J75A 3KX2A 1D1CA 3ZMSA 3BLYA 1BI2A 1X3WB 4MFDA 5GPAA 3HRSA 2VC1A 1X19A 1NHAA 3TP0A 1F36A 2Y48A 3F8BA 4K5MA 3CHPA 1BBYA 4Y52J 1GXPA 1UG0A 4HNVA 3OR1C 2V1UA 4IQ4A 1E3OC 3BC8A 4ZYEA 2DCEA 2W4SA 4L5IA 4ENKA 1K4TA 4XN2A 2PJRA 2FJ1A 2XPVA 2R59A 1BR2A 5H2FC 5HS7A 3CCUI 4A3IJ 4U7BA 4E7LA 2M4KA 1HA8A 2I8DA 3PUBA 2JA6J 3E6BA 4ANJA 4YIRX 2EPFA 2OQGA 2UZKA 3O2PE 2CUZA 1XG1A 5D4RA 1E17A 3E1SA 4XONA 5ICCA 3VWBA 1T56A 5DM7F 1YLFA 1WH7A 2LK2A 2A7OA 4I76A 3AKZA 4XMVA 4XN5A 3NWSA 4OOIA 1I27A 2A5YB 1ZQ3P 1OJLA 3FMQA 4D7MA 4EGYA 2OTLI 1O3QA 5JAZA 1U6GA 2DN0A 2QKMB 3F8MA 4AR1A 1J09A 3CO6C 3DPUA 1O7FA 3K6GA 4UNOA 2PX9A 1OLTA 3C7JA 3JW4A 3M07A 2JD0A 2XVCA 4XICA 3ULQB 4UUTA 2B61A 1TT5B 3D0SA 1MNDA 3FHNA 2HPIA 1WZ2A 4I98B 3ANLA 3PO3J 4HV5A 4BDYA 1H88C 5CVJA 4LGWA 4LLNA 3K4CA 1S46A 3WTZA 3PUFA 1H9GA 2V6CA 4RGSA 2PBIA 4LB6B 3BR0A 2BVLA 1HOMA 1ZRDA 1MSEC 4NQWA 5JNLA 3ZQLA 4R5VA 2VL8A 2XRNA 1MDMA 3ZMVA 5ICFA 3F72A 2PI0A 4ZX3A 2QF7A 1T2KA 1ERDA 3K4KA 2ICWG 4M73A 1TNTA 1RI7A 3KZIC 2VQGA 3CD6I 3C2GA 4CCMA 3ABTA 4A3FJ 2XROA 2NXNB 3LSGA 5CVRA 2TRTA 4F52A 4QLCU 5TJJA 2UV1A 4XLNF 3I64A 4GGGA 4L18B 5B3SH 2VIXA 3I4NJ 3E5QA 4FLOA 4M3GA 1KU3A 3AU8A 1IW7F 1SFKA 3J81K 1S6LA 2XGEA 5DM6F 1O3TA 4XR6A 3U2RA 1O4XA 1U8BA 2EIKH 3CHRA 2O6GE 2LLKA 2O61A 1IRGA 2Y1CA 2EBIA 2KIQA 2PQ8A 2YU3A 4XN0A 3EYYA 3FTYA 1POGA 1MW0A 4AIJA 4PCQA 3T8RA 4CSWA 2HYFA 1R0KA 3FXRA 3LSJA 1RZ4A 2XV4S 2HDDA 1FP2A 3I4PA 1R5ID 2V9PA 2DMTA 2EWNA 3MEXA 2WAQA 2X51A 1T38A 2ESHA 3EUKL 1HBXG 1ETXA 1LE8A 2G7UA 3JRBA 1ZH5A 2EJRA 5ILSA 2O9LA 4RAZA 2R7OA 3S1MJ 3CHOA 1ETWA 3OYKA 4ZTFA 1QNTA 4KFCA 1Z3XA 2DK5A 1U9NA 5J6XA 3PL8A 2W25A 1XSDA 3FXKA 5ED4A 3L1PA 3D1NI 4RLFA 3FUDA 2R7DA 2VBYA 1FTTA 1T8IA 3DTKA 3B6AA 4YFXF 2FA5A 2YX7A 4HW0A 4ZW3A 5BOXA 5F27A 3M8EA 1APLC 5FROA 1DGWY 2K4JA 1OKRA 1ZG3A 2DQLA 4OU0A 5GP9A 4DW6A 4EJUA 5M3MJ 1CQTA 1LVAA 4BQAA 1S5LC 4N9IA 2CFXA 4L9JA 3ZRGA 1GLNA 3RI4A 4XRMA 3JRGA 5CLSA 2ID6A 3UKGA 2K4BA 3QOPA 2JUCA 4XMUA 4QMEA 1X2MA 2EFNA 2HU9A 3HUGA 4EJWA 2VODA 3KP2A 2NOJB 1I1GA 2DO7A 4I0AA 3LSKA 1YW8A 4Y15A 2NS8A 5F0CA 2EA2A 4P9FA 1MBGA 3TDUC 1JKOC 3UEQA 3IHUA 4BE1A 2O8XA 1IV6A 3CZGA 1R1UA 1ONVA 1TTYA 2JJ7A 1PYVA 3ZQFA 4NUBA 1XMAA 1KONA 1ZG1A 2JD2A 3LOCA 2GWRA 2E2IJ 5IOZA 3CXBA 3QP5A 3K4NA 2WZGA 2XUBA 2LBFA 2VBZA 1Z3YA 1XD7A 1W7PB 2DA1A 2Y0MA 2R7SA 5IYDJ 1W5CC 3JAMK 2XSDC 1QPIA 1RR7A 4XQFA 1ZK8A 1B59A 3ESWB 4L0ZB 3LA7A 1V4RA 2MW8A 5JMPA 2A6HF 5D5UB 1PVEA 3CF5F 3ZHYA 1MD0A 2JVHA 2DQRA 4KIGA 5BPDA 2NVQJ 2Y0SA 3C2HA 1MW7A 5H6RA 5J4VA 2HTSA 2IGKA 4R1HA 2M87A 5JVGF 4K2EA 1V55H 2QKLB 4ETSA 1YI2I 4HX4A 4M72A 4D5CA 1SQMA 3MKYB 3CJRB 5GAHJ 2FOWA 2H6BA 2NNNA 5K5RA 3TW6A 2IRFG 2ELJA 3LL7A 2R70A 1SMTA 3AL0C 3VEPA 3GZNB 2HDCA 2WAEA 1WJEA 2OZUA 3EYIA 2F4MB 2RC4A 4NB5A 4BH9A 3MQ0A 1JVSA 4K5OA 5BS6A 1IRFA 4M6XA 3A01A 5AIPA 1HKSA 1IXCA 1VI0A 4KUMA 1JHHA 4B3AA 2JCXA 3W2AA 2LR8A 1IN8A 2VASA 3HJEA 4RB0A 4WXCA 4UUSA 2ZXWH 2EA4A 2OF7A 5JI6A 3CMYA 2A6EF 3SJMA 2RNJA 1HXDA 3MKLA 4IX7A 1BC8C 3ZPLA 2WB1N 1FP1D 4E6KG 4EEFG 1ETQA 3K70C 4RAYA 2FQ3A 2FMYA 2X1CA 1XSXA 1Z77A 4LLGF 4AYBA 5J1RA 2R93J 4A0XA 1YW7A 3GF2A 2V7FA 1KU2A 2PJPA 2LF8A 2CWEA 3SXYA 2HDWA 4XORA 3ERED 1VNDA 4A69C 3BR3A 1RRJA 2ZJ2A 5ERIA 3SYTA 3D5LA 3HM5A 1Z7LA 2VB6A 1A5JA 4OAYA 1YRNB 2LKSA 1UB9A 3IUOA 3ABMH 2GIVA 2WA0A 2P7VB 4H0EA 2UXXA 5LGUA 2BGCA 3I54A 4D9JA 4IJAA 4ABZA 1V5EA 2JZYA 2JSCA 3FDYA 1JUPA 3A03A 1UG2A 4A3LJ 1EA3A 3BT9A 3K2ZA 1ORKA 3RC3A 3DKWA 3QODA 3BCBA 1YX5A 2EIMH 3M1EA 1GVJA 1OCOH 1UHSA 4FLQA 4PJ0C 1XS9A 3PFYA 2OZ6A 3CUQB 1WVRA 1ZKGA 2LY9A 2R7UA 3PQJA 5TGTA 3VSLA 4QSHA 1MW1A 3IAS2 3HOUJ 3NEUA 3AUAA 2VKVA 1TQMA 4IHWA 4MEYF 4OIOF 1X3ZB 4XIDA 1YQAA 2XPYA 5IYBJ 2YUSA 1MJBA 2K3FA 1T0FC 4A12A 2W24A 1VQLI 4MHGA 1MBJA 3NQOA 4XLAA 4XO4A 3ZQ7A 3WQQA 1J2XA 1FOWA 2DLLA 3H9QA 2LDUA 4OIRF 2K40A 4EVIA 3LWFA 5LHHA 5IP9J 2G0EA 3L2RA 1VTNC 3DWLE 4G12A 4ZZDA 1TZLA 5LEKA 3S2WA 1RIOH 4XNDA 3AL0B 2ZKZA 3U1DA 4F91B 3KEQA 1F1ZA 1BI0A 1GV2A 3JTGA 1HW2A 2X85A 3G1OA 3GFLA 5F1RA 1SANA 2Y1FA 1KZHA 1TT0A 3EBHA 1R4MB 1OCCH 3B02A 3MVPA 2W48A 2O7OA 2NVXJ 4R7LA 3T8VA 1VF9A 5JHFA 1U3EM 3V8JA 2ZC2A 4I6ZA 2BE5F 2MBFA 3EDPA 4D0PA 5KCMA 5DDGA 2C6YA 2QENA 4ENMA 2M4GA 4EM1A 2QQ8A 1YHQI 1SFUA 3WTUC 5FLVA 2QEXI 4BNCA 2R5YB 4IHVA 3BDDA 5FGMA 5E1ZB 2VBWA 2LH9A 1EKEA 1W4MA 3ELKA 1TWAJ
chains in the Genus database with same CATH topology
1STZA 2H27A 2HZTA 3KEDA 1I6XA 2QBYB 5D6FA 1F4KA 1TNSA 5DLLA 4KP7A 1KYZA 2PMUA 1FC3A 2PG4A 4ZX4A 4HZFA 4GAEA 4AVPA 3M7GA 1GXQA 3UCQA 3FX3A 4HAMA 4G94A 3FHZA 5E8GA 4EM2A 3Q9VA 2Q8KA 4O5VA 3V4GA 4OIPF 3HRUA 4L9NA 2C82A 4Y17A 2GXGA 2H09A 3TQNA 3TKYA 1OYIA 1B6AA 1FZPB 4HF2A 1U2WA 4U88A 4MNUA 2KIFA 2F2EA 3HYIA 3GZ6A 4JK1X 5E8IA 1P4AA 4YIIA 4LD5A 4G7HF 4ASNA 3JTHA 2HEOA 2STTA 2EGHA 4XNBA 1Y0UA 3MAJA 2GQQA 5HDGA 3B7SA 6PAXA 2MAPA 5FB2A 1W7PD 4KT5C 4Y6SA 2EFWA 3C3WA 5HDKA 3GFMA 1SC5A 1MKMA 2ETHA 5K1YA 4ZW7A 1UHMA 5EV7A 4XSXF 3T5XA 4PGHA 1FYKA 2ISZA 4GYIA 2OBPA 3OV8A 3HRMA 1KA8A 3FF5A 1XGOA 1EV7A 2K02A 3Q5FA 1IXSB 3LAPA 3GW2A 2DK8A 3FUKA 3VFZA 3CZEA 2HWVA 1HW5A 3B7RL 3H3ZA 1DPRA 5E1WA 2Q0OA 2XKPA 4X2UA 1FOKA 1JE8A 3FULA 3WGIA 1YS7A 2Y1EA 2ZFWA 4CZZA 1WSUA 4K5PA 3V7CA 5FWQA 3E97A 1MVYA 2P6TA 1XN7A 2HR3A 3JSZA 2QUFA 4IVNA 4ZYHA 5ILUA 3GFIA 3P9KA 3MZHA 1P6RA 3L7WA 3R0JA 4R5XA 1ZYRF 2FBHA 3U9GA 1USSA 2FNAA 4RSYA 1FYMA 3FZVA 3GUDA 1Q1HA 2FOKA 3E6MA 1EH7A 3E3VA 5JMWA 3KEOA 5L3CA 2P5VA 2D2WA 5KK1A 1YFHA 1Z9CA 3KETA 4ARFA 4HX8A 5LHIA 3RASA 4OOFA 3WE3A 2DU9A 3IWZA 3MZYA 3DEUA 5HLIA 4Z2YA 4TV7A 1E2XA 2R3SA 4I09A 1FYLA 3BPVA 2EFPA 3TOBA 3E5XA 5HLTA 1J5YA 4GXOA 2KIMA 2XKOA 4AWXB 2PUSA 1HS6A 1R1VA 4CICA 1IN4A 3CHSA 1XCBA 2EB7A 3JSPA 5E18F 1G3SA 5AENA 4IHTA 2P8TA 5LRRA 2EV5A 3LSTA 1D8JA 4ZQGA 1XSVA 4YIFA 2A68F 1QZYA 1LDJA 4L9VA 4EMSA 4Q4ZF 2P6SA 1LQ1A 1IF1A 2Y1DA 3M9AA 1BOAA 4RGRA 1A04A 2HPOA 1B9NA 1G5AA 3ECOA 5DD4A 4LG0A 4OMYA 5DYFA 4FLRA 5CVIA 3SZPA 1TQIA 2R72A 4FCAA 3BPXA 1Z7UA 4G6DA 3ZN1A 5K5QA 2GXBA 5DCFA 1SMYF 4O3MA 3FXQA 3ABUA 1R22A 1HKQA 2VONA 1FLIA 2AS5F 1HW1A 1GW6A 4L5JA 3B37A 4Q5SF 2ZMEA 1TLHB 3IKVA 2VE8A 3I59B 3GVAA 3RKYA 4Y13A 2KJBA 4KICA 3B2PA 3RPUA 1XDUA 3T8TA 2DW4A 4YFNF 2BEOA 5CYVA 1XGSA 2ESNA 2E7WA 4BHBA 5L3FA 3GXOA 1IN6A 4HQMA 1BN5A 4LUPA 3QAHA 2M8EA 1SG7A 2FE3A 3SHFA 2XQ0A 2IT0A 3EQLF 3DF8A 1ZN2A 2X0LA 3FUFA 4LJZF 3FU5A 2TDXA 2CGPA 2JT1A 2M45A 3RDIA 2IA0A 4M9SA 5HOOA 1HSTA 2F5EA 2ACJA 2JPCA 2A07F 2R7FA 3M8FA 2GA1A 5DV5A 3FTZA 1W7PA 2W57A 1XCVA 2NYXA 1ZLKA 2L54A 4F7ZA 1SFXA 1SD6A 1RUNA 4EJVA 3VODA 2FNPA 4UUVA 1ULYA 3FMRA 1MDMB 2VXZA 1S29A 3GLXA 1PP7U 1HSJA 1GHCA 2ELHA 2CW0F 2V1XA 1P4WA 3WGHA 4U0YA 2NAZA 2QQAA 3O3KA 2Y75A 3AAFA 2PFBA 4OIQF 3TO9A 3G73A 3WQSB 1MJAA 3FM5A 4YFKF 2WPGA 3KZYA 1WRJA 2VOPA 2G7HA 4DNCA 4HBLA 2P4WA 1P4XA 5HVQC 4RCVA 2NS0A 5TRDA 4KYWA 1R58A 2Q2EA 3BJOA 4BHPA 1W5SA 1XDSA 4RGXA 4M71A 3OOPA 3TGNA 1JG9A 1K78B 1Q0HA 1ZARA 2RQPA 1ON1A 2OU2A 2Z33A 2MLGA 4UV8A 3F23A 3ZP5A 2W85A 5EEHA 2H94A 2VT2A 4G9YA 5BMZA 4ZH4F 4HX7A 4U7DA 3DPLC 4IRHA 4Q48A 2K27A 1QZZA 3WTXC 4XN1A 4AICA 1X3ZA 1OYYA 4HDVA 3CZLA 3R60A 1FBSA 4KN7X 5H20A 2V79A 1ZREA 2QVOA 5DCMB 4ZYGA 1FSEA 4S04A 2D45A 5AIQA 4JBAA 2FSWA 3ANNA 3P7NA 3GYHX 2IW5A 3HSRA 5FFZA 1BC7C 1XGNA 4Y6PA 2YPRA 1KQ8A 2IVMA 4N0BA 3L09A 3NRVA 3K69A 1WKMA 3WTVC 3FXUA 4M74A 5ILVA 2ZCWA 1SD4A 2D1HA 2O03A 2MA3A 1DUXC 2FFLA 4CO8A 4A5NA 2UXNA 3KP5A 4K5NA 2HTJA 3FM3A 4KMUX 4EJOA 4BYYA 3ZN0A 3BP8A 3R0AA 1R1TA 2K86A 3N97A 1PDNC 2XIGA 1BI1A 1IUYA 3PUUA 3FTWA 4A0ZA 2IP2A 1SD7A 5L3GA 4B8XA 3E6DA 3HSEA 4ZQEA 1WI9A 3VOEA 3TDZC 3V8KA 3SQNA 1O3RA 1CF7B 3HTSB 3PFIA 5F64A 4MS6A 3RIRA 1YO5C 4ZW6A 1T1RA 1OPCA 4E70A 1I5ZA 1P92A 3WTYC 1RUOA 3E5UA 4HDUA 4LB5A 1O7LA 3V7SA 2QQBA 3ISPA 2HPTA 4UVBA 3KLOA 1DPUA 2PGGA 4JNDA 2P5LC 3KE2A 3U9WA 1J59A 1Z05A 4I2OA 4P96A 1XB4A 4A5MA 4OMZA 3F8FA 3I0TA 1PUEE 3JSOA 2A3SA 3ECHA 4XO3A 1G3WA 3N4MA 4ZQTA 2O3FA 3F21A 3VVLA 1YS6A 5JBIA 1JXSA 1D5VA 4WXDA 2JV7A 1R5HA 2LNBA 2WZFA 3GO5A 5AONA 3R4KA 1ZGAA 4ESBA 2ZXJA 1K6OA 3R0IA 1ZRCA 3DXJF 1DP7P 2Z99A 3H3UA 2VOOA 3Q44A 1B9MA 4HLYA 1OYWA 5D8LB 1O3SA 2FBKA 1U5TA 3BZ6A 1QBJA 3O6BB 1IXRC 5L3BA 3GZ5A 4IXAA 3P9CA 1MW3A 5LBQA 2JCYA 4L2LA 3ZMTA 5DULA 2WV0A 4Q4EA 1H0MA 2L3DA 2VN2A 1Z6TA 5DUIA 2GAUA 4Q47A 1KQ9A 1TW3A 5HLGA 4R8HA 4EGZA 3FU0A 4AR8A 3L9FA 1ZGJA 1BJAA 4U0VA 2Z5UA 2M30A 4L0YB 2LSOA 3B3BA 2YSRA 3FHEA 4EQQA 2O7GA 3KCCA 3ANMA 2D1VA 3HHHA 2FRHA 5BQTA 3DP7A 4BKXA 5FO5A 2HQNA 2C5ZA 4GCVA 2XAHA 5DUKA 1MJ9A 4FX4A 3TO7A 3BWGA 4YG2F 4QPEA 4ZN6A 1TBXA 2J5PA 5J8FA 2L4AA 1QO0D 4PGGA 4UXNA 5FLXZ 3V7RA 5D4SA 2G9WA 2DQ6A 2MH2A 1S7AA 3MWMA 4R5TA 3LA3A 1ONOA 3ML6A 3IRQA 4CDGA 1FNNA 1BIBA 2PLYA 4AR9A 5CJ9A 5DD8A 3ZMZA 3WTTC 3IC7A 4KNYA 3W6JB 3FTXA 2COMA 3H92A 3FTVA 2XAJA 4FX0A 1YW9A 4XRFA 1ZG5A 4IPAA 2IA1A 1IN5A 2K7LA 3CHQA 5IT3A 3KP3A 1MZBA 2KRFA 3A06A 1D8KA 4MEXF 4ZQFA 5FD5A 1X3WA 5IT9Z 2VBXA 2F5DA 3K1PA 2EFOA 4ZW8A 4XNAA 1JGSA 4HA8A 3FH5A 2DT5A 4N9HA 4G6QA 3F22A 1D3YA 2HOEA 4CGZA 3FH7A 3EETA 4G7ZF 2OA4A 3KP6A 3EUHA 2VE9A 2QZ8A 1FBQA 5HLHA 1KU9A 2P5KA 2ADUA 5L3EA 4LK0F 3F8CA 5LGNA 2DBBA 5JC1A 1ODDA 2O0YA 3QPTA 4G8XA 5LGTA 3WQRA 3KZZA 2PMHA 4KIFA 2UWMA 2ZBKA 4XLPF 2HKOA 1LNWA 1K5HA 4HV6A 2MLKA 2VT3A 5CVUA 1ZHFA 3FTSA 3WU0A 3DV8A 2OD5A 3A14A 3RKWA 4MTDA 4XMWA 5DYMA 4J3BA 3KP4A 1MGTA 3CZKA 4A6EA 4UVCA 5FD6A 3DFGA 5LEJA 3HOTA 1S7OA 2FEZA 1AOYA 3J80Z 4M6YA 1B4AA 1Z1DA 3Q9SA 3BJ6A 4DQ2A 2ZNYA 2JPBA 2NRAC 3RYRA 1ONNA 1G6NA 1WWXA 4FT8A 2B0LA 2RVCA 1DDNA 2Z9OA 2JRTA 5K5OA 4EM0B 1U8RA 1QGPA 1KU7A 3JT1A 3SFZA 4LFUA 4WX9A 2CSOA 4RS8A 1Z91A 2LF7A 2QVWA 4AIHA 2OAZA 2BYVE 2OQRA 1SAXA 2L02A 1REPC 4AYSA 3F8NA 3GFJA 3CTAA 3SZTA 1YG2A 2ZNZA 2NNYA 3EBGA 2A69F 4G7OF 3LFKA 4MQVA 2VJ8A 4NHJA 3B2XA 2HS5A 5HDNA 4LG0B 4FHTA 4KN4X 2BBYA 3WU1B 4XBFA 3KLNA 3FUEA 4ZX5A 2DAOA 3F6VA 5H6QA 3FU6A 4UHTA 4S05A 4L9TA 2DI3A 1CGPA 1YIOA 1LJ9A 4GO1A 5JHUA 4JQFA 5HNHA 3C18A 5D8KB 5A2QZ 1Q0QA 1AWCA 3RPQA 3WGGA 1H19A 5E1XA 4I7HA 3T0YA 1T6SA 3W6KB 2ZMEB 1R00A 4WK8F 4GYGA 2CYYA 3BROA 3IL2A 3B7TA 3FMSA 3P9IA 4PDKA 3I5UA 4I02A 4ZW5A 1HQCA 1I1SA 1QPMA 2XPZA 2FBIA 2GZWA 4ESJA 1K78A 4EJTA 3L2CA 3R6SA 3IRRA 3V8LA 5FLXK 4K5LA 3COAC 4QIRA 4XMZA 3ZI0A 2VC0A 1B1BA 4PU2A 1R23A 4ON0A 1ZAOA 3CUOA 4Q4IA 3HTUA 3REOA 2M1BA 3FUNA 1WQ2A 2F5FA 5DEQA 2V1DA 4RB3C 4ESFA 4IRGA 4U0WA 3WG9A 5JFRA 4FLSA 3K9TA 5E20A 1ONPA 4Y6RA 3K0LA 4BHCA 3QP6A 1R36A 3AU9A 4UVAA 2Z3YA 3K1NA 4ZX6A 5HS9A 5DCMA 2RKHA 4QWQA 4PW4A 3CUQC 4RGUA 3TO6A 5IT9K 4P5OA 2VLAA 3FH8A 1FPQA 3L00A 1SFEA 3QRFF 3Q43A 4AIKA 3PQKA 4ZQHA 4O6JA 3WTSC 4HOBA 1T39A 4EV0A 4RB2C 3HIFA 2EFQA 5J8CA 3CUQA 4P55A 5HS8A 3QJXA 2KKOA 1FT9A 1R7JA 1ON2A 3UERA 3MFKA 2XAFA 4IF4A 3GWZA 4XN9A 5LLQA 1JGIA 3RC8A 1P2FA 3BY6A 4XMTA 2RGVA 2CO5A 5L3DA 2PL5A 4IHSA 4OOEA 4MKTA 2YR2A 2MC3A 2IA2A 4R79A 1G4DA 2LKPA 1Z6RA 2HQRA 1UFMA 4HF1A 3ZHZA 2YX4A 2XGXA 5CVVA 1U78A 1CF7A 1L3LA 1LB2A 1KGSA 2MAOA 3ZHXA 5EEGA 1YTYA 1TQPA 4XN7A 2WWYA 4M9ZA 2QYOA 3E6CC 4QUOA 3GEZA 4QHPA 4ZYDA 2ZO4A 4A6DA 3J80K 2STWA 3HSFA 1ZRFA 1FWZA 3LQQA 2QBYA 2FF4A 3QU3A 5HNFA 2RDPA 2QM3A 2MD5A 2HKXA 3FWEA 3FTUA 4M9XA 3CJNA 3T1BA 2X4HA 3QPHA 2AXLA 1R5GA 4ENNA 3FUJA 2XHKA 2JCVA 2W84A 2DTRA 1S3JA 4CHUA 1EH6A 3B73A 1HKTA 3I71A 1LEAA 1T0FA 1LEBA 3G3ZA 5ICEA 1USTA 2EV6A 4HQEA 4ZZLA 5JO0A 3RJPA 4BXUA 1BI3A 3HOSA 1F5TA 2E1NA 4A2UA 2L01A 2E7XA 4LMYA 3IIEA 1J9IA 3B34A 5D6EA 1BIAA 3I53A 5FFXA 4WF2A 1U5TC 1L0OC 4WWCA 2QJ1A 4CXFA 4ENJA 3J7AO 4GAAA 3WODF 1KYWA 3EBIA 4HYEA 2A61A 2QQ9A 5A2QK 4HF0A 2XAGA 1QQIA 2EV0A 3RKXA 3LA2A 3DPTA 3GX4X 2QWWA 3CO7C 5LHGA 2GA2A 1G3YA 2DFIA 1LDKB 1F9NA 2J5OA 2RN7A 3QU6A 5D5WB 3LAJA 4HLXA 4RVBA 2L4MA 1H9TA 5E17F 3WE2A 1X3UA 4XMXA 2KJCA 1TW2A 3KFWX 1LDDA 3ROUA 2ISYA 1SD5A 1G3TA 5KVRA 2CQKA 4KA4A 1XGMA 2FU4A 3J81Z 3HRTA 2CG4A 1IZ1A 2FMLA 3RYPA 1Q0LA 4XN4A 1UCRA 2PN6A 3BJAA 2IJLA 3C1DA 2JTVA 1H3LA 1FBUA 1T1SA 4OINF 2ZXGA 1MW2A 1K7AA 3BOQA 1O57A 1U5TB 4WCGA 5JVTA 2FXAA 3KP7A 2M5WA 5F6FA 4BAYA 1PP8F 4AD9A 2DQMA 4PZJA 5D5VB 1IAWA 1R0LA 2WC2A 4Y67A 1V3FA 4MQ9F 2MH9A 4P9UA 3B7UX 3IWFA 1W5TA 2PEXA 4KIBA 1IN7A 1FSHA 1ZS2A 3LQRA 1YYVA 2XASA 2QLZA 5ICGA 1FY7A 1JHFA 2WTEA 2RV8A 2BV6A 3RTRA 1C0WA 1ZLJA 5LRSA 2GTQA 3ZMUA 3I58A 1OMIA 4WXHA 3R61A 3F3XA 3VVMA 2IPQX 3CIAA 3FUHA 3JAMZ 4DPRA 2DPDA 2HFHA 2EK5A 4RB1A 2KIUA 4MTEA 2DPUA 1EH8A 3IKTA 2P7CB 4UV9A 2F5CA 4A03A 3VB2A 1S8NA 4CYDA 2JD1A 1J7KA 3WTWC 3CLOA 4XSZF 1KQ0A 4XO5A 2HGCA 4I0BA 4LLLA 4XN8A 2XAQA 2H6CA 2Y1GA 2E1CA 3FU3A 4PVBA 2V9VA 3K1MA 1RNLA 3ZMDA 1OR7A 5JR3A 1BM9A 1RP3A 3HHGA 5BPIA 2HYGD 4KMFA 3DQVC 4MGRA 5D5XB 1K79A 1XMKA 3CDHA 1UHWA 4LK1F 2RJIA 4B09A 1J0RA 3I59A 4I01A 4KDPA 4A0YA 3F6OA 3MCZA 3FUIA 3TOAA 1FX7A 1T98A 3FUMA 1J75A 3ZMSA 1BI2A 3HRSA 2VC1A 1NHAA 2Y48A 3F8BA 4K5MA 3CHPA 1BBYA 1GXPA 2V1UA 4ZYEA 4L5IA 4ENKA 4XN2A 2R59A 5HS7A 4U7BA 3E6BA 2OQGA 2UZKA 3O2PE 5D4RA 1E17A 5ICCA 1YLFA 2A7OA 4XMVA 4XN5A 4OOIA 1I27A 2A5YB 3FMQA 4EGYA 1O3QA 5JAZA 1U6GA 3F8MA 4AR1A 3CO6C 4UNOA 1O7FA 3C7JA 3JW4A 2JD0A 2XVCA 3ULQB 2B61A 3D0SA 4I98B 3ANLA 4HV5A 5CVJA 4LGWA 4LLNA 1S46A 3WTZA 1H9GA 2V6CA 4RGSA 2PBIA 4LB6B 1ZRDA 4NQWA 5JNLA 4R5VA 2XRNA 1MDMA 3ZMVA 5ICFA 3F72A 2PI0A 4ZX3A 1T2KA 4M73A 1TNTA 1RI7A 3ABTA 2XROA 5CVRA 4QLCU 5TJJA 4XLNF 3I64A 4GGGA 4L18B 3E5QA 4FLOA 1KU3A 3AU8A 1IW7F 3J81K 1S6LA 1O3TA 3U2RA 3CHRA 2O6GE 2O61A 1IRGA 2Y1CA 2PQ8A 2YU3A 3EYYA 3FTYA 1MW0A 4AIJA 4PCQA 3T8RA 2HYFA 1R0KA 3FXRA 1RZ4A 2XV4S 5BPPA 1FP2A 3I4PA 1T38A 2EWNA 3MEXA 1HBXG 2ESHA 1ZH5A 2G7UA 2EJRA 5ILSA 4RAZA 3CHOA 1QNTA 4KFCA 2DK5A 5J6XA 2W25A 1XSDA 5ED4A 3FUDA 2R7DA 2VBYA 4YFXF 2FA5A 2YX7A 4HW0A 4ZW3A 5BOXA 3M8EA 2K4JA 1OKRA 1ZG3A 2DQLA 4OU0A 4IRIA 4EJUA 1LVAA 4BQAA 4N9IA 2CFXA 4L9JA 3RI4A 5CLSA 2K4BA 3QOPA 4XMUA 4QMEA 2EFNA 3HUGA 4EJWA 2VODA 3KP2A 1I1GA 2DO7A 4I0AA 1YW8A 4Y15A 2EA2A 4P9FA 3TDUC 3UEQA 3IHUA 3CZGA 2O8XA 1R1UA 1ONVA 1TTYA 2JD2A 1XMAA 1ZG1A 2GWRA 3QP5A 2WZGA 2XUBA 2VBZA 1XD7A 1W7PB 2Y0MA 3JAMK 1B59A 4L0ZB 3LA7A 1V4RA 5JMPA 2A6HF 5D5UB 3ZHYA 1MD0A 2DQRA 4KIGA 5BPDA 5H6RA 2HTSA 4R1HA 2M87A 4K2EA 4ETSA 4HX4A 4M72A 1SQMA 2NNNA 2H6BA 5K5RA 2IRFG 2R70A 1SMTA 3VEPA 2HDCA 2OZUA 3EYIA 2RC4A 4NB5A 4BH9A 3MQ0A 1JVSA 4K5OA 5BS6A 1IRFA 4M6XA 5AIPA 1HKSA 1IXCA 4KUMA 1JHHA 2JCXA 1IN8A 4WXCA 4RB0A 2EA4A 5JI6A 2A6EF 2RNJA 1HXDA 1BC8C 3ZPLA 1FP1D 4RAYA 2FQ3A 2FMYA