4ZQHA

Crystal structure of dox-p reductoisomerase in complex with nadph, fosmidomycin and magnesium
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
408
structure length
408
Chain Sequence
b'LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
total genus 149
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqhA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqhA01
1XLTA 4PLHA 1V3VA 2IRWA 5CPBA 3TPCA 2JD1A 1Y81A 3Q6IA 4TQGA 1ZNQO 4U0JA 3GR6A 2E6UX 4WUVA 2NUAA 5CHEA 3QVXA 4ZU3A 1WVGA 2GLXA 3DBRB 4JK3A 1GFSA 3LF2A 1HE5A 1T24A 4FFLA 3ORFA 4KQXA 4MVJM 1ZMTA 3QVSA 1JVBA 1O95A 2VZ9A 3H6KA 2X23A 1YB5A 3GNQA 4NI5A 4E2WA 1UXKA 5K6AA 2DKNA 1KS9A 2DAPA 1RWBA 4W7IA 3HFSA 4J6FA 5DCYA 3QVWA 1YRLA 2VHVA 4A2CA 1XGKA 3UCXA 1LLDA 4CPDA 3KXDA 4WPGA 3ZU4A 4Q39A 1KYQA 3DFUA 2C07A 1NHGA 2VUUA 1W6UA 1CF2O 1PZHA 4IY1A 4XD2A 5A06A 3SLGA 3BZUA 3FPCA 2WJPA 1HDCA 5IZCC 1LQUA 1EVIA 4YJGA 1T26A 1RYEA 1XSEA 1HSOA 3UEQA 2GF2A 5G4KB 1VJTA 3ABIA 3I52A 4Z0PA 2AXQA 3UVEA 4WLVA 2XXJA 3R6DA 3UW3A 4WEQA 3OJ0A 3JQ9C 1Y9EA 2PWZA 4FJ1A 1UP7A 5EL0A 4OL9A 3ICPA 4PG5A 4R1SA 2HJSA 4YTEA 3I1JA 2X1HA 2R00C 4HBGA 3RC7A 3F1KA 3RU7A 4E2ZA 3C24A 1NQOA 1N5DA 2HK8A 3C1TA 3WNVA 1Z73A 5L95A 1DOHA 5IXSA 4QUKA 4DIOA 1E3IA 1RM0A 2HMWA 3WS7A 2IZ1A 4KWHA 4YPOA 4HV4A 3WOHA 1Q2XA 1P1KA 1NQTA 5MDHA 3QRWA 4XQEA 5CG2A 1BXGB 5CAEA 4XIJA 3SC4A 3DZFA 1IY8A 3JYLA 3PEFA 1HZZA 5F5LA 4BKOA 2GRAA 3OM9A 3NAQA 1KVRA 1RJWA 1WDKA 3VPXA 4L75A 2YZ7A 3UKOA 4DMLA 4YXFA 2DBVO 2IZZA 3C1AA 3SEFA 3WSWA 1S6YA 1U1IA 4ITUA 4XEHA 2O23A 2X9VA 1XU9A 4FFRA 4OYRA 1I01A 4U5QA 3FHLA 4ALNA 4M8SA 3GLQA 5ER9A 3CEAA 2VUTA 1YBMA 3GA0A 3R1IA 3ZHBA 3GVHA 1GADO 4AJ4A 3GK3A 4NMHA 1H9AA 4XRGA 3BIOA 7MDHA 1MC4A 1K0UA 5A4DA 5KCZA 1YL5A 5L7TA 4UEOA 3DBRA 2PGJA 4RVHA 3AOEA 1GUZA 2DVMA 3H3FA 2W2KB 4UULA 4K26A 1DRUA 1PGNA 2VRCA 4JJGA 2ZYDA 4CMAA 3MJEA 3E8XA 1YB4A 4HWKA 5CFZA 2OORA 4M86A 3TZQA 1HE2A 1BG6A 1V35A 1NFFA 4CMHA 5B4TA 4Y9DA 4JLWA 4Y6RA 2W2LA 5DNAA 1I0ZA 1LJ8A 4XX0A 3JD4A 1XELA 4I9HA 4XR4A 3HDJA 1PJQA 2HU2A 1PS8A 1GV0A 3NJ4A 3DZIA 1LDNA 5DCUA 3Q0EA 5KKAA 2I3AA 1P1RA 5G4KA 4EI2A 3U0BA 3G17A 4MP6A 3OECA 1WXDA 1WDLA 1QYDA 2EGHA 2I99A 3A9WA 1JTVA 3GDGA 4YB8A 3WYEA 1QYWA 1AE1A 2O2SA 4GGPA 4PG6A 1R12A 3V5NA 3FCOA 1CETA 4NBWA 3Q1LA 2AMFA 2E37A 4MKXA 3JQAA 1Q7CA 1DC3A 4PLFA 3VOSA 4YAKA 2NVBA 1H6AA 1YQGA 3ZH2A 4E5KA 2GN9A 4B4OA 1E6EA 4FBGA 9LDTA 4Q3CA 4O63O 1FDWA 1UAYA 1WW8A 2GN6A 1B0AA 4PZCA 5JY6A 2VYND 4I5FA 4R01A 4TSKA 2D8AA 3EDMA 5G0UA 3BMNB 4W9NC 2X0IA 2G1UA 5TF4A 4CM8B 3E5MA 3EUWA 3K2EA 3PFWO 5A9TA 3ZW9A 4O1MA 1B3BA 2POQX 4FD3A 1JLLA 2WWRA 4OJNA 4NFHA 4BNFA 5K9ZA 2BI8A 1CQIA 2X5OA 5TIIA 4ALIA 3INRA 4J0FA 5LDGA 4CQLA 5IDYA 2G17A 4GX2A 4R4JA 1KVSA 5I9MA 3L9WA 4S3MA 2DFVA 2OL4A 3M6IA 4L73A 1HDZA 4WASA 3U09A 1E1NA 2D1YA 4RF4A 1YBVA 4YYZA 4BOYA 3CZKA 2ZQYA 1E5QA 2YYYA 3LC1O 4A5OA 4CL3A 4XB2A 3JQDA 4F6LA 1E3WB 1GPDG 3ZI0A 3U4HA 5EERA 1DHTA 2DTEA 1NX6A 2W2KA 5FI5A 1T1RA 3HE3A 2H1SA 4CLRA 1SBYA 3LDHA 5IFLA 1F14A 2JHGA 1FJHA 1SEPA 2VRBA 1E5LA 3E9MA 3EHEA 2Y1GA 1DFGA 3RASA 2Z1MA 3IOYA 4J2OA 3UH1A 1B8VA 3CINA 2PD6A 2R6JA 3DBLA 5KVCA 2WD7B 1NPTO 3MCVA 3SVTA 3WFIA 5EJ2A 1GYRA 1D1TA 2IEBA 4R3WA 4E2YA 1HZJA 3ZNNA 2QW8A 3ENKA 3E6AA 3JYQA 3GZNB 3H9EO 1H3LA 4Y6PA 1GZ4A 2DU8A 1LSOA 2H9IA 1A71A 4HADA 4UUMA 4ZQHA 1IULA 3V1UA 2GSDA 5CPFA 1IZ0A 1VJ1A 1GL3A 1I10A 2Y66A 4CM9D 4D44A 3ZHZA 4CMIB 1FDVA 1BWSA 1TB4A 3CXRA 1ISJA 4JBGA 3ROMA 2A94A 3IKVA 1Z7EA 1JU9A 1V9LA 1C1DA 4INAA 3DTYA 3OJOA 3TZKA 1E6WA 3Q11A 1Q0LA 1U7HA 3AWDA 3DZKA 3FD8A 3QWIA 1T1SA 3CIFA 2QX7A 3IKTA 1FF9A 1R4MB 1WDMA 3EVNA 4UAGA 1YWGO 5TRTA 1WLYA 2PR2A 4OQYA 3KSDO 3DZBA 4G81A 4A27A 2JCXA 4DTIA 3JD1A 4BIIA 2PV7A 4ZVVA 3RC2A 4CM6A 4QTZA 4DL9A 1R15A 4O6VA 4BNMA 5DOZA 5IDQA 3K9QO 4MP3A 3VZQA 5U4QA 1DIHA 4DUPA 2DFDA 1RM5A 1DHRA 2O3QA 4BO2A 2JFFA 3B1JA 4PZDA 4YWJA 4YAEA 4R41A 1VLLA 1HRDA 3SX2A 4PLWA 1LEHA 2ZCVA 4ZRNA 4MVJP 3GT0A 5JPIA 2X58A 5ITWA 2G76A 4I1IA 1XIVA 4E33A 4D42A 1Y8QA 4I8XA 1DIRA 4ZQGA 3TF5A 3JQ6A 6LDHA 4CM5A 1E3WA 2JL1A 5IZCA 2Y93A 3KVOA 1JGIA 4PN3A 1UP6A 3O9ZA 3P19A 1F17A 2VHWA 5TLSA 2CZCA 1JKFA 2AEMA 3EC7A 2FPIA 1DLJA 1Y6JA 3V2GA 3IP3A 1U9JA 3JQ9A 4TRJA 4DBZA 4HP8A 1T25A 4CM4A 3H2ZA 3IC5A 4YA6A 4IMRA 1TT5A 4TZKA 2EGGA 2NU7A 3IIEA 1HKUA 2R00A 1KETA 1E92A 2YV2A 2IXBA 3VVBA 5K6AC 2DC1A 1E7RA 1ZEJA 2JFHA 1BXKA 4JIGA 5L3ZA 4M54A 3LZ6A 1D8AA 3IAHA 5FFFA 2WDZA 5JAQA 3L6DA 4J90A 2JHFA 4PLYA 4GGOA 4RVUA 1D3AA 4CMBA 3WSVA 2V7PA 2X0JA 4UEKA 3C1OA 2DUUA 3LC7O 1EZ4A 4KUGA 1EVZA 3ZU2A 1PTJA 4NK4A 5JS6A 2E48A 4TKLA 3MJCA 1KC3A 5TGDA 2W98A 2Y68A 1X15A 2X22A 3AFNA 3EZYA 2DPGA 4R3NA 2YHIB 2GYYA 4IXTA 1NM5A 3DBVO 4BKQA 4CUJA 5I7FA 3OICA 1YBAA 3FBTA 3OEWA 3UICA 4D3SA 3CMMA 3HDYA 3QA9A 1TXGA 3GVPA 4Q3EA 1MC5A 1R4MA 3NKLA 4GSLA 2BFMA 4EJMA 3NYWA 8ADHA 1NVGA 4GWGA 2BD0A 4N7RA 2O3SA 4NQZA 3KBOA 3GVIA 1OC2A 2FRDA 1UDCA 3B1FA 3RJ5A 3GDOA 4YRAA 2P5YA 2X0NA 4BV8A 1E7QA 1MW2A 3I9MA 4OH1A 4H3VA 3W8DA 3D3WA 1SC5A 3LT0A 4Z9FA 1AN9A 4CLHA 3W4KA 5L4SA 1E77A 4E5MA 4G65A 4CMKA 3JQGB 2Q4EA 1E7YA 2NTJA 3PWSA 4LRSB 1XCBA 1YB1A 4BNLA 3T7CA 2CNBA 2CDBA 5J23A 3ROKA 3S2FA 3PJGA 2NNLD 1AGNA 3DL2A 5JC8A 1QSGA 3HUDA 1FDTA 3V8BA 2EIHA 4K1LA 3JQEA 3C85A 3GAFA 1GZ3A 1U5CA 2VNSA 3O8QA 3QY9A 1EFLA 1G0OA 2EP5A 3PHHA 4J1NA 4TWRA 3T0YA 3L6EA 3W6UA 1WMBA 2OFPA 4FOOA 2ZYGA 4CMJA 1GD1O 1J49A 3H9UA 5G0SA 2BHLA 4B79A 3ZV5A 1ZSYA 4CQMA 1PJSA 4LN1A 2I76A 5JSFA 1E7SA 2WMDA 2PH3A 3IUPA 4BL5A 1UZMA 1FMCA 2IXAA 1KERA 4QFCA 3OBBA 4ND2A 3TZ6A 1XKQA 3GNTA 3WLFA 1RM4A 3LU1A 1Y7TA 1A4UA 2J3JA 4ND3A 4PVCA 4IDAA 5COAA 1OR7A 3ETGA 2NADA 1B8PA 2NU8A 4BNJA 3SJUA 4CLOA 5JAMA 3UN1A 3QWFA 5A9RA 3FRJA 5JCXA 3GFGA 2X8LA 3TJRA 4AG3A 1OI7A 2EERA 4NH4A 1XDWA 2P2SA 4W9NA 4CR6A 4NPCA 2YUTA 4KTTE 4E30A 4BNZA 3JSAA 2G82A 3VH4A 2CSUA 1IHXA 4AICA 2I3GA 3PYMA 1LRJA 3QW2A 4QX6A 3UCFA 3U3XA 3H4VA 1ORRA 2Y1CA 2ZATA 4FGWA 3AU9A 4WCDA 3ANNA 4R1UA 3TZCA 3TNLA 3PGXA 4BO5A 1PJ4A 4YR9A 4O0LA 5JBIA 2VN8A 1MP0A 3WG9A 5DZSA 1MG5A 1PJ3A 3R0IA 3GG2A 5JAZA 4EUFA 1UZNA 1VL8A 3Q3CA 4B7CA 4XYLA 1U3WA 1MXFA 4F6CA 5KVQA 1X13A 1K5HA 2YQ5A 4AJKA 4B7UA 1ZSNA 3KYCA 1XWFA 2QYSA 1SPXA 3DR3A 3OETA 1I8TA 1DXYA 4XYMA 3ASVA 2UVDA 5IN5A 3VAZA 1PJ2A 2HMTA 5T8KC 3LT4A 4JBIA 4MVJD 2QRLA 3JQGA 3K96A 2B5VA 3H2SA 3KEQA 4IJVA 4J0EA 2J3KA 4GL4A 3VTFA 4Z9YA 3TQHA 4XR9A 4DXHA 5KJ1A 1AUPA 4K6CA 4D41A 1GYQA 2VWPA 4J3FA 3L9XA 2PZMA 5H83A 4EW6A 1NAHA 5B4UA 3D4NA 3E03A 3QWHA 1IB6A 4JBHA 4YJFB 3PHGA 4FSHA 4BVAA 3RU9A 5K0ZA 3P2OA 3VHRA 4Q3NA 3Q9NA 4XQCA 3GUYA 2AQKA 1WZEA 3TFQA 1G1AA 3EY4A 3JV7A 1U3TA 3KOUA 5TT0A 5L4NA 3WXBA 1HLPA 1ENZA 3KYDB 3N7UA 4GPD1 3PLRA 1Q0QA 4FB5A 1DC6A 1PGPA 3VZRA 1PS0A 4R1NA 4DLBA 2GPTA 4LCEA 5IXYA 4KQWA 1HDXA 2HKIA 5LDHA 1LDYA 1XR3A 2HDHA 3CZRA 4ALJA 4RCVA 1X1TA 1LSUA 1F8GA 1H6CA 5C7LO 4LRTB 4NBRA 4CXFA 1PR9A 1YQDA 4PFJA 1NVMB 3WGIA 2HRZA 3G1UA 2TMDA 4Q9NA 1IHYA 5THQA 3AM3A 3AUSA 1U8FO 1PGOA 1PX0A 4JN6B 3K8ZA 4J4BA 5L7WA 1P1IA 1J5PA 1BW9B 4NDNE 2IE0A 3K2BA 4HX5A 1X7HA 1P1FA 1QYVA 5JO0A 1YKFA 4ALKA 5IF3A 2OUIA 4KDEA 1EUCA 2PLAA 1DSSG 1E7MA 3WTCA 4IDEA 4X54A 3DEYX 1EDZA 5B37A 4N18A 1ADCA 1CIVA 1HLDA 3AJRA 3DHEA 3FNGA 2UYYA 1DIBA 3DB2A 3INGA 1E3SA 1DB3A 3V1TC 3QQPA 2I9PA 4IIVA 3E1KA 4KDFA 4JP2A 4NG5A 3S1LA 1B14A 1EVYA 3G3EA 3I83A 1A7AA 3DXFA 3ZWNA 2CUKA 3I9LA 3H5RA 4R16A 3DBHA 5DP2A 4AJIA 4XKJA 5JCJD 3OA0A 5BR7A 1KVQA 3ZNQA 1FDUA 3CSDA 3ZN2A 2C20A 2YFQA 3CTMA 1M67A 3QV1A 2RHRA 2IZ0A 4RO0A 5TT1A 3RSHA 3TZHA 2B4RO 4BKUA 2JFGA 1GUFA 5G0WA 1U3VA 1ZMOA 1I3MA 2VYVA 3HZZA 1V8BA 4YJFA 4BUCA 2YQ4A 4DIFA 2ET6A 5FI3A 4MKRA 5JMWA 3AI2A 4RPHA 2MAPA 3T7EA 3OEYA 4OGWA 5GY7A 4RJTA 3RUIA 1W0CA 4BNXA 1KVUA 1XEAA 3TOXA 2NM0A 4QEDA 1T2FA 4BKRA 3M2TA 5JMPA 4MVJH 5EQDA 3PGJA 4ZD6A 3KYBA 3W6ZA 2DTDA 2JAHA 1HT0A 4XYEA 4QECA 3RKRA 5FWNA 1UAGA 4BNTA 1IL0A 2D4AA 4OAQA 3FPLA 4OO3A 3PZRA 5A1TA 4ZJUA 3WJ7A 3RUEA 2RAFA 5DBFA 3TFOA 1R4NA 1ZIDA 2Q2VA 3K92A 3NT5A 2EKLA 5I7SA 1X7DA 1SEVA 2B83A 2F1KA 2PFGA 4CM3A 1LU9A 2DTXA 2ZB8A 1O0SA 4RLHA 3WICA 1R0KA 4IZHA 1YVEI 4JQCA 1CERA 4PRLA 1E3LA 3OJEA 4DPLA 1OAAA 3A14A 1E3JA 2AG5A 4NJOA 2FZEA 5FF9A 1QXSA 1YGYA 1DAPA 1LDEA 1DC4A 3DOJA 3EMKA 1MUUA 3DDNA 4I08A 4J4TA 3AUTA 4RF5A 4AJ2A 5IDWA 5L4LA 4FDAA 2BFPA 2Y1OA 5L9AA 1HE3A 4TKMA 5AYVA 1DRWA 1PJTA 2O7QA 5AXDA 1Z75A 5JXWA 3L0DA 2AG8A 4E21A 4HY3A 3AU8A 1N7GA 3KB6A 4W4TA 4Y8VA 4CJXA 2A92A 4BO0A 2Y1FA 3WJAA 1QP8A 1Y8RA 2IYOA 4HKTA 1NBOA 2YW9A 4RZHA 4OIMA 1H9BA 4H16A 2X9GA 4CL8A 2J5KA 5CDTA 4DRYA 2BMAA 3QSGA 3OSUA 4PLVA 1Z45A 1Z7BA 3NDRA 4IDFA 3FWZA 1NFQA 5BNIA 4RVDA 3KSZO 2PD4A 3OJLA 4WK6A 2BI7A 2Q1WA 1NQAO 2QRKA 3FNFA 2NTNA 2O3UA 4FLSA 1I2BA 2RH8A 4RDIA 3QVTA 1G0NA 4OXYA 2C5EA 5KJEA 1ADGA 3ZNOA 3ROQA 3RFTA 3VKUA 4MVJE 3PJEA 3MJ4A 3GN2A 5JO9A 4MVJG 4A73A 3S2EA 4BO7A 4KOAA 1D4FA 3S55A 2BGKA 2TMGA 4JJFA 2HO5A 1SO8A 1LDMA 3D5QA 3HJAA 1ZSVA 1K89A 3TWOA 3ZWAA 2XPCA 4RQTA 4XQGA 4FFPA 1ISIA 2B69A 3OP4A 4XRRA 3KTDA 5B1YA 1I3KA 3WNQA 1PQPA 3JQBC 3HDQA 4TMFA 3KV3O 3GPDG 4WCFB 4P4NA 1AXGA 3WIDA 1D1SA 3E5RA 4LUPA 4OKNA 2VCYA 5ER6A 4ALMA 2NQ8A 3ZWBA 1DO8A 1KY5A 4YT4A 3GGPA 5CDSA 2PZJA 1Z82A 3C7AA 2VHYA 4CMGA 4EJ6A 3BHIA 1KBZA 4AJHA 4D0SA 1YOVB 3CKYA 1FK8A 5T8KA 1C1XB 4DC0A 4QT0A 4KWIA 1PS9A 4H15A 2FN7A 2B0JA 4XGNA 1BXGA 4XZ3A 2D5AA 1P77A 4IDGA 1PJCA 1WWKA 2HMUA 3ANLA 2Y1DA 3PXXA 4MIEA 1P3DA 5B4VA 4WGGA 4PGFA 2OOSA 2J6IA 1Q1NA 4WLUA 1OZAA 3FNEA 2I5PO 2JD0A 1B15A 1P0FA 3ZHYA 4JROA 2A35A 2VTDA 4L8VA 2NQTA 5HWSA 5I7EA 3EVTA 4IDCA 2VWQA 3BAZA 2D2IA 4BNHA 1LI4A 4FR5A 1PIWA 5EIOA 3H9QA 3MOGA 1MLDA 2AQIA 2Y05A 4QXMA 5L45A 4MJLA 2EHDA 4XDZA 1XYGA 3CZGA 3HSKA 4U6SA 5ES3A 1F06A 2PA3A 2P68A 2NVUB 4CMEC 4CV0A 3GPIA 3WBFA 4IINA 4OQZA 3AY3A 4UVHA 3CZEA 1XU7A 1EQ2A 2Q46A 2XF8A 1P1HA 3WDSA 1VKNA 4PLTA 3FBGA 4R69A 1PZFA 3VPFA 5G2OA 3ZU3A 3KHUA 2C2YA 4ZQEA 3BMCB 3RCBA 1ZS2A 5LC1A 5ENVA 5GMOA 4Q3BA 3RQSA 1VJ0A 3CPSA 1EEHA 1T4DA 5CDUA 2PZKA 4GKBA 3Q2IA 3MTGA 2ILTA 3GH3A 5C7IO 4TVOA 2PNFA 3ZWYA 5BSEA 3OFSA 5A03A 4D45A 5IDXA 2BELA 3ZWXA 1O9BA 1SOVA 1U2DA 5ITVA 5U1PA 3JQCA 2HK9A 3L4BC 3ICCA 3JQ8B 1A5ZA 1HDYA 3DMYA 1N9GB 2J8ZA 4FPXA 4LVUA 1E1MA 2E49A 4IUYA 4RORA 1LBEA 1SB9A 4Z3DA 1AXEA 1JAYA 1NWCA 1ZVMA 2FZWA 2EJVA 3ZV6A 1V3TA 3GEGA 4FGSA 1HYGA 4BB5A 1X0XA 4XJSA 5DBIA 4EBFA 2XXBA 1UP4A 2GNAA 1OFGA 4JNKA 2EKQA 1JKJA 4LSWA 3U9LA 1IYZA 4FCCA 4OSPA 1YDEA 2JCYA 4NU5A 2GERA 4CLXA 2VOEA 3GMSA 1MB4A 2ZIZA 4AVYA 4DLLA 5BSFA 4E12A 2PKRA 1UXGA 3BMNA 3BTVA 5KJCA 5AXBA 4CM8A 1BGVA 4RZIA 3QLJA 3RC9A 3K31A 4KZPA 3IUSA 2VTEA 3O03A 2V6FA 2H63A 1GDHA 2C2XA 1JWAB 2H6EA 4FS3A 1NNUA 1I3NA 4AJ1A 4D0RA 2JCVA 1K6IA 4CV3A 3JCZA 1X7GA 4UREA 1ZBQA 3MOIA 1ONPA 3AM5A 2C0CA 2DT5A 1P31A 1LXCA 1VRWA 1B7GO 4CLEA 5BQFA 4RQUA 4YDRA 4YJHB 1RPNA 3INTA 3W1VA 2Q3EA 1MW1A 2FR1A 2VZ0A 3KO8A 3DO5A 1QG6A 3IMFA 4J43A 2C82A 2VRCD 3O38A 3RBVA 1A72A 4YT8A 1P1JA 1GQYA 4P22A 5JYDA 1Z6ZA 4MINA 1GPJA 1EK5A 2V6GA 4DQVA 3D4OA 5MGBA 2YJZA 4B3HA 3EGOA 3HADA 3A4VA 3NGLA 1Q0HA 3WMWA 4ZICA 1HDGO 4EEZA 2O50A 3I4CA 5BT9A 1ENPA 4BNIA 4KUEA 1IPFA 5A9SB 1R66A 5TJHA 1ENYA 1WMAA 2W2LD 3PWKA 3RUAA 3T4XA 4DREA 2WD7A 2X9NA 4I5EA 3D5TA 3N58A 2AHRA 3KRTA 3WGGA 3WTBA 2JAPA 4BMSA 3GZNA 1BDMA 1NASA 3EYWA 2RH4A 2NSDA 3F3SA 3JQ8A 1DFHA 2QIOA 3RWBA 1CYDA 3ASUA 3I6IA 3OA2A 4WOJA 4CMIA 1ML3A 4E5PA 4NJMB 3H5NA 2QZ9A 3JQAD 1M76A 4IQGA 2PD3A 3L77A 4DMMA 1HSZA 5AXAA 4J7XA 4L0QA 4P38A 1NPYA 3E9QA 4R54A 2PTGA 2V65A 3NV9A 1DDOA 1WP4A 4BO3A 1C0IA 4ROSA 4PG8A 4GX1A 5KVSA 1GR0A 1P45A 3ONEA 1C0LA 2HMVA 3BHJA 3D7LA 1I33A 4FJ2A 1BHSA 3I9OA 3H65A 1GAEO 1BVRA 2VT3A 2B5WA 4E31A 1GQ2A 1ZH8A 4BNWA 1LRLA 4FC7A 2WEKA 3QE3A 1UJMA 5F21A 3VH2A 3D4PA 3AUAA 4LSMA 4GMGA 3K30A 1ONNA 5A02A 1GV1A 4N54A 4OKIA 4RVFA 1A9YA 3VZPA 1DJNA 1A9ZA 4JP3A 2P4QA 4J2HA 3F5SA 4N5NA 5C37A 4B4UA 3PPIA 1LC0A 1PJLA 1BSVA 3VPGA 3NJ8A 4JXKA 1MW3A 3SXPA 2D0IA 2UV8A 2AEJA 2CVZA 1PWZA 3H9JA 1P0CA 3JQFC 1K6JA 1W73A 3ZHXA 1HXHA 1BVUA 1U4SA 1J4AA 1L1FA 4ZQFA 4UUOA 3PQFA 4R9RA 4YJHA 2W4QA 5F1OA 1UH5A 5CEJA 3CMCO 2ZQZA 4YAGA 4YRBA 1R16A 2DPHA 1X0VA 4M55A 4UVEA 1CQJA 3WGOA 4DQXA 1I32A 3LVFO 3UAGA 3PJDA 4BNUA 5A3VA 1VSVA 4MIOA 1EE2A 4IM7A 4J91A 3W4IA 4B8ZA 4BO6A 4FLRA 4I5DA 2R2GA 2J3IA 1BTOA 3ZV4A 1NP3A 2IODA 3JQBA 2EWMA 2QRJA 3W4JA 4TROA 4OXNA 5U9CA 3OMLA 3MEQA 2OZPA 2VNAA 1PGQA 3NGXA 2ZCUA 5EN4A 4ND5A 1UXHA 4A10A 4BNKA 3AI3A 3DZJA 3GDFA 4TVBA 1TT7A 3DHYA 5TX7A 3WX0A 1I2CA 3BMQB 3U49A 2CF6A 1E1LA 1S7CA 3FTNA 3V2HA 3TL2A 3G49A 3OIGA 2GN8A 3WYBA 3STHA 1PSDA 1EUDA 2NTVA 5CDGA 3DMTC 4OOEA 1M6HA 1P33A 4IS3A 1P44A 5TS3A 3U62A 5BSGA 2EJWA 1CJCA 1T4BA 4O59O 4WLFA 3BMOB 5KKCA 3ETEA 3BTOA 4Z6KA 4EUHA 2YHIA 2CF5A 1E7WA 2RBEA 2NVWA 1VM6A 4IJWA 4W6ZA 3RUFA 4GWKA 3VVCA 4B4VA 1N2SA 3WR5A 2FWMX 4BHTA 3ON5A 3PYXA 3I9KA 3VH3A 2E82A 4CUKA 3P7MA 1EBFA 4BV9A 4BNGA 2CD9A 1C0KA 1SMKA 3BTSA 1L7EA 3HN7A 4YVFA 5CEEA 3I23A 1X14A 3WGTA 3V1YA 4P8RA 3AK4A 3NTQA 2H5LA 4ZHSA 5CEFA 1JVSA 4UVGA 4EJ0A 2Y0DA 4RLSA 5TNXA 4CMEA 4BGEA 2AE2A 3DFZA 4EEXA 2O48X 1HDOA 5DBGA 1PL7A 5TC4A 4IS2A 3NUGA 4DWVA 5T57A 3QHAA 4HNHA 2Y1EA 1QLHA 2B4TO 4R5HA 4Q3AA 5JYEA 4UVIA 2WE7A 3AFMA 5JAIA 5AOVA 2XOXA 3ZWOA 3OIDA 4D3DA 5A5EA 1ZCJA 2QHXA 2A4KA 2GDZA 5A04A 3AOGA 2FSVA 1TEHA 3CH6A 2FHSA 3F4BA 4J4HA 3ZU5A 4OM8A 1JAXA 3PDUA 4M89A 1DPGA 2YV1A 4OXKA 1GCOA 4BO4A 2GZ1A 1R0SA 1QYXA 1ADBA 2BFOA 2HMSA 3AY6A 4XYGA 5FYDA 3GN1A 1MV8A 3HHPA 3L4BA 1DFIA 1UZLA 5DCWA 2ZJ0A 1NYTA 3KUXA 3VDRA 3IS3A 2FMUA 4B4WA 5CP8A 2UAGA 1SC6A 2Y67A 5C7OO 2B36A 3ZNPA 2LDBA 1HF3A 3DONA 4ALLA 4MPDA 2ZB7A 3EAGA 1GY8A 1V0JA 1AHIA 4QO7A 5JDCC 3EW7A 3VC7A 4UEJA 5IZ4A 2QQ5A 3PI7A 1OOEA 1W4ZA 4GAEA 4BQRA 4XYBA 1GZ6A 5KOIA 3HNPA 2RCYA 2CFCA 1QRRA 3NX4A 4J9UE 3LT2A 4WE3A 1J0XO 5ICMA 2I66A 2ZYAA 4NFYA 4UVDA 4ONEA 1E6UA 4XDYA 2X86A 4BNVA 1QV6A 5COQA 1PJBA 3ENNA 4YJGB 3TDKA 2FPPA 3ZWWA 2VWGA 1O94A 4NU6A 1O5IA 1WAMA 5JY1A 1OMOA 2DBZA 2ZK7A 3QWAA 2OXIA 3WGHA 5IG2A 2E4AA 2V6BA 2I67A 3I3OA 4DYVA 5HTOA 4WCFC 2O4CA 3MJVA 4ND1A 4II2A 1U2GA 5ILGA 5HRUA 1T2DA 1YJQA 1IPEA 3I9NA 4BMVA 4HFNA 4YQYA 4D46A 4C4OA 4NZ9A 1GYPA 3IQDB 1I2ZA 1ZK3A 4J1QA 3ZWVA 3UGKA 1NAIA 4I9NA 2RHCA 3VKVA 4D79A 4JGBA 4M49A 5DT9A 1U4OA 4RPLA 5DDIP 4BGVA 4FIZA 4CLDA 2BFAA 3U4DA 1F8FA 3VH1A 4BQPA 3CUKA 1R37A 4E0BA 2VYNA 2ZTVA 4BKPA 4A03A 3BYZA 5DOVA 3GF4A 2EEZA 4CUZA 2YHUA 4D7AA 3Q2KA 2P91A 1E0DA 2Q50A 1LX6A 1ARZA 2X7HA 3GGGA 1U7TA 3LLVA 1EVJA 3ONDA 1I36A 4O5OA 4QO8A 1N92A 4WECA 1YJ8A 2DQ4A 1X1EA 5F5NA 3L4SO 1VE9A 2NACA 2VHXA 3RFVA 3ADPA 3EZLA 1CEQA 1R0LA 3VPHA 4CQMD 1YL6A 2GO1A 2O4UX 1PQWA 2BGMA 1H94A 3GZ4A 1YDWA 1NPDA 3FN4A 2ZTUA 4KP7A 3KYDA 1I3LA 4BNYA 1UXJA 2PKQO 2C59A 3N74A 1ULUA 1NTOA 1A4IA 1UDBA 5T67A 4NHEA 2OMEA 1UR5A 2O2YA 1B26A 4IMPA 1GU7A 3GHHA 3IDSA 3P2YA 3I9JA 3WWZA 2X0RA 5HS6A 4KUHA 3HWRA 4YQZA 4GSKA 1LUAA 4DBVO 1ZO8A 1LDBA 3PQEA 2OGUA 4NK5A 3HG7A 1LNQA 5AVOA 1A27A 3LC2O 2WPGA 4J1TA 2PH5A 2ZB3A 1I5RA 3QP9A 1W8DA 4BGIA 1UUFA 2UUPA 4RVGA 3HN2A 1IZ9A 1TI7A 1BW9A 2Z5LA 1MA0A 1ULSA 1DAOA 2JJYA 3MJTA 4MDHA 3GEDA 1ISMA 2G0TA 1HL3A 1ADFA 3GQVA 4IBOA 2O3RA 3MTJA 4PZEA 4PIVA 3P5SA 4CM9A 6ADHA 1KEUA 2QYTA 3ST7A 3QIVA 4B7XA 1P74A 4PLPA 4YAIA 3JQFA 3JQAB 3PFFA 3ZZNA 1ZXBA 5T6BA 1ISHA 2AQ8A 1RM3A 1EBUA 1ISFA 4XA8A 4AJLA 4J7UA 1KEWA 1XG5A 1PL6A 1U8XX 4IDBA 2BF7A 3D1LA 3IP1A 2ZKLA 1YONA 3OQ1A 1U3UA 4OMUA 2LDXA 5JNLA 2GN4A 2I65A 1KVTA 1PZGA 1M6WA 1J6UA 4DPMA 2WE8A 1MFPA 3MWDB 7ADHA 1OC4A 4AJEA 1BXZA 3GOHA 3DC2A 3GHYA 1YL7A 3TN7A 4E32A 3ONFA 4W7HA 2VOJA 2P5UA 4Z0TA 5BNFA 1SB8A 2EF1A 2GASA 3F1LA 2DBRA 3VDQA 1ONOA 1DRVA 4CQLB 4BNNA 4DGSA 3ITDA 5I9LA 2HJRA 3JYOA 3RBZA 4ID9A 2CDCA 1Q7GA 3UOGA 4K6FA 1HTBA 1ZXLA 1HETA 1HE4A 2FY8A 1EUZA 3LT1A 4YCAA 3DMTA 3D3EA 1PEDA 3KM0A 5T5QA 3RFXA 3ZDFA 3TOZA 3WGYA 2Y0EA 4FLQA 4WJZA 4MKZA 3LSYA 1JG9A 1IUKA 1BRMA 2BRUA 3O26A 4M87A 4TZTA 3E18A 4MP8A 5CDYA 4S1VA 5G4LA 4B3IA 4CLRB 4B8WA 2VHZA 1LC3A 4CM7A 3G0OA 4WLNA 1A7KA 4NBTA 1PR3A 3DZGA 4YT2A 2GZ2A 1LRKA 4D43A 3F4LA 3DBLB 4FOSA 3SBOA 1HWYA 4P4LA 2ZB4A 3G1TA 4XGKA 1S46A 4IJKA 4R1TA 4Z9XA 3G79A 1ZK4A 4Q3DA 5BSHA 3KLMX 3PDJA 4XB1A 3IL2A 2Q4BA 3A28A 3HB5X 3MJSA 2VQ3A 2WTBA 4EYEA 4BB6A 2Q49A 3RC1A 1H93A 3FNHA 3VZSA 1MGOA 3D0OA 4R9SA 5HA5A 5TJ9A 3RD5A 1YO6A 2VT2A 1T2EA 3U4CA 1WZIA 1LLCA 2YDYA 3NT4A 2FP4A 5DN9A 3HB4X 4RL6A 1NQ5A 1C1DB 1I30A 4YACA 3L6OO 4H7PA 2P9EA 3LYLA 4K9DA 2F00A 3RI3A 1VSUA 3B6ZA 4GVXA 2Y0CA 2Z95A 4R68A 3ZWMA 5JDIC 2AA3A 1CDOA 1NXQA 1EE9A 3FTPA 3B20A 5IN4A 2Q1UA 4FJ0A 3B1KA 4LISA 4U6QA 3H9GA 1T2CA 1B2LA 1EMDA 2UDPA 3ZWCA 1ISGA 2YV3A 3RROA 1DJQA 1CWUA 4K28A 4FW8A 4QSMA 3PZBA 5I9NA 1Q7BA 1KIFA 2EV9A 4L4SA 4EGFA 1ZEMA 3ROPA 1BMDA 1EK6A 1NWHA 3AW9A 5LCXA 1N7HA 1U28A 1LDGA 2VYVD 1K2WA 1C0PA 4DIBA 4EDFA 5JDCA 1PGJA 4YEDA 3W8FA 4ZN6A 4QFDA 4AJOA 5KTKA 4A26A 1O89A 2HUNA 2NLOA 2BKAA 3TL3A 2A9FA 4RVSA 2V6MA 1HDRA 4J7CA 1YS4A 3Q9UA 3NDJA 1Y8QB 1HYEA 1H6BA 4GMFA 1M66A 5KIAA 2FSSA 4RPGA 2C5AA 1Y5MA 5EPOA 1NHWA 4UUNA 3K73O 4JCOA 2IDZA 5G0TA 2C54A 3BHMA 3NDIA 5GZ6A 3LK7A 4HFMA 1E3EA 3PHIA 4A0SA 4IQ8A 4XJTA 1N1EA 1O6ZA 5DP1A 4WCFA 4CM4B 5IAAA 3ZW8A 2O3TA 8LDHA 1TT5B 3TSCA 2Q99A 2X5JO 3PIDA 3JYNA 4HFRA 2Q2QA 5F1PA 1MFZA 2WSBA 1YE3A 2WYUA 3IJPA 1C14A 3WQSB 1V6AA 5THKA 3RUHA 3R3SA 3O4RA 5TQVA 1V3UA 5F3RA 2O3JA 3MWEB 4CR7A 1NR7A 5A3JA 4IZIA 1JKIA 4B3JA 3WGZA 3FI9A 1YOVA 2OP0A 4GQAA 3NTRA 2GGSA 1C1XA 4Y98A 3S2GA 2NU9A 4FN4A 4I5GA 3FSRA 3WQQA 2PGLA 1SNYA 4DVJA 2HQ1A 4R5MA 2Q1TA 4KTVE 4EZBA 2AE1A 2BGLA 3GUCA 4NQWA 2CY0A 2GUGA 1I24A 2RIRA 2EKPA 4GBJA 4E5NA 1DIGA 3V2UA 4E5YA 2EW8A 3I5MA 1VI2A 4R51A 2GZ3A 1TVEA 1VC2A 4E2XA 2OBYA 4GX5A 3OHSX 1F12A 1UDAA 5KVVA 5KWEA 5GZ1A 2NU6A 4G5HA 4L4XA 4RF3A 1PU2A 4ZRMA 1VKOA 5C5IA 3H3JA 4J16A 4G2NA 4MVJF 3RUDA 2HAEA 1KY4A 3D3WB 3GY0A 1VL6A 2NVUA 3FR8A 2HLPA 4XWYA 2Q2WA 1ZW1A 2ZTLA 1JN0A 1H5QA 5DULA 1C3VA 1HYHA 1F0YA 2QG4A 4DQUA 3WWYA 2ZJ1A 4Z3KA 4D3FA 2WM3A 1K3TA 2Y99A 2O7GA 2HSDA 4E6PA 3RKUA 1D7OA 4OHUA 4IGFA 4MVJA 3KLPX 1LSSA 4WEOA 3SJ7A 3BMCA 3M1LA 5JW6A 4PLGA 4MVJI 4ESOA 3GMDA 3KSUA 4IJUA 1LQTA 1P9LA 4E4YA 2D59A 4IQ0A 9LDBA 5C3MA 4EITA 3O8QB 5EINA 3BTUA 3DAFA 3FWNA 2WYVA 3GGOA 2C7VA 4AYSA 3JD2A 4WKGA 1QORA 2IYPA 3HQ4O 3QVOA 4PCVA 3S8MA 1MXHA 2J5QA 3T4EA 3WGQA 3VTZA 3WIEA 2NV6A 3AI1A 1LA2A 5H81A 3JD3A 4CQMB 1EFKA 2FPGA 4YT5A 1N9GA 4PVDA 5TSDA 5L7YA 1H2BA 2EP7A 4URFA 1BDBA 3UFXA 2UUOA 2DUWA 3FR7A 3SLKA 3PLNA 4MIYA 1Y1PA 2EG9A 2HCTA 4RV9A 2C7GA 4LK3A 2X4GA 3C8MA 3KZVA 2HRBA 5EMHA 4WNIA 4PG7A 4YBZA 4CLOB 3PHJA 4HNGA 2GCGA 2P4HX 1LLUA 4L4RA 1M2WA 1AHHA 1VL0A 3ZGYA 2FOIA 3OJFA 3TRIA 4RF2A 4CR8A 1MG0A 1RP3A 2Z1NA 3M2PA 4ZGWA 1SOWA 3GEMA 3UERA 4W82A 5JE8A 4FFOA 5G0VA 1JW9B 1Y5RA 2GD1O 1XA0A 5HM8A 1OBFO 1R6DA 3AY7A 5L53A 1JA9A 3GVCA 2OBNA 3HDHA 1H2HA 3DWFA 3GFBA 4J9VA 3VPSA 1MX3A 5AXCA 3UF0A 3OF2A 1B3RA 4CM1A 3C7DB 5EESA 1H0KA 4J49A 1NFRA 3H5AA 4C7KA 2B37A 4AJNA 5COBA 1Y9AA 2I6TA 2EW2A 1FXSA 1LTHR 1PZEA 4BGUA 1EQUA 3HFGA 1GTMA 5B12A 3KEOA 5ADHA 1FDSA 2Q45A 1NR1A 2WD8A 4UUPA 3AUUA 4GLOA 1WPQA 3GRKA 4NBVA 3RUCA 3GVXA 2DBQA 3U4IA 3KYCB 2W90A 2J5RA 5A5FA 4DC1A 4KMSA 2B4QA 1UXIA 1QMGA 1KEPA 4GVLA 2OO5A 4DLAA 1ZJYA 2AEFA 4NNJA 1JQBA 4M1QA 4N5MA 3RJ9A 2FR8A 3ZWPA 4P4GA 1YH3A 3C7CB 2CDAA 3PJFA 4FQ8A 3BA1A 5JCJA 2X6TA 3PWZA 4LMPA 3E9NA 4FC6A 5L40A 3CZLA 1GUYA 4IXWA 3PHLA 3SC6A 4CODB 2JKVA 3DOOA 4GI2A 4RPJA 5A9SA 4AL4A 3H8VA 3GRPA 4NBUA 3EK2A 2VWHA 5CG1A 3S2IA 2PY6A 4ND4A 5AQ1A 3DQPA 4MO2A 5ICSA 3WB9A 5JC1A 1B8UA 3K5PA 1TLTA 3A1NA 3JQ7B 3OIFA 2AQHA 4XQ9A 1DEHA 5I7VA 4TRRA 4HFJA 1HEUA 1JWBB 1VPDA 4IIUA 1DBVO 3GC6A 4F46A 4WOKA 2SCUA 3UXYA 3NT2A 4II3A 1RYDA 3PP8A 2IEDA 5HS4A 1MVYA 1QYCA 1XQ1A 3WYCA 4F45A 4HXYA 4CMCA 3COSA 5EQFA 4NJMA 3K6JA 1PWXA 2QZZA 1YXMA 1ZK0A 4E3ZA 3LLSA 3ANMA 3AOEC 5H82A 3MZ0A 1GEEA 4JX8A 4NFSA 1SAYA 4LW8A 4GX0A 4F3YA 3D64A 3PRJA 1G5AA 4WLEA 1M75A 3NTOA 4U0KA 3ADOA 1XQ6A 5JDIA 1JDJA 3FF4A 5HBRA 1ZJZA 4L9RA 3LQFA 3PTZA 1RKXA 3WLEA 3R3JA 3UUWA 4BO1A 4BO9A 4WLOA 3X2FA 4JJIA 4NIMA 2FR0A 1KC1A 4RPKA 5I8WA 4RGBA 3L07A 3DHNA 4IGEA 3JYPA 4ZA2A 3UHAA 2BH9A 2PZLA 3PK0A 4XCVA 4HUJA 5KNLA 1WNTA 3DZHA 4IPTA 3WFJA 2CMDA 4Y6SA 4ILKA 4C7JA 1K6XA 4L74A 3CE6A 4TRNA 3OQBA 4XIYA 2PKQP 5ILOA 3W8EA 4Z0HO 4GH5A 1B16A 5DF1A 2D5CA 4TRMA 1DLIA 4E13A 3KETA 3DOCA 2NWQA 1ZKMA 4DYDA 2OHXA 1KOLA 5A05A 3DBHB 4BO8A 1KEVA 1YQXA 4Y67A 3DTTA 4LGVA 4NR0A 4OSOA 4W99A 1EDOA 5F1KA 1ZZEA 3I6QA 4PRKA 4IDDA 3F9IA 1GEGA 4U8GA 3B70A 3RIHA 3WQRA 3E82A 4U7WA 5JLAA 1SZJG 5JFOA 3DAGA 4CV1A 4GLLA 3UCEA 5KJ6A 1GQQA 3JD0A 4L76A 3UCQA 5ENDA 3BXXA 4LMRA 4AFNA 2MAOA 1NVTA 2BLLA 3RAJA 1GCUA 1IOLA 3JQ7A 1ZK2A 2AW5A 4OOFA 3BMQA 4J1SA 1N8KA 1Z74A 4YJDA 2O7SA 1QKIA 3ZV3A 2P9CA 3PYLA 1L7DA 3QJ5A 4EUEA 3PVZA 4DA9A 4DPKA 2EXXA 4BS9A 3E48A 4FFMA 5I8ZA 4LVCA 3IJRA 3ETDA 3RBXA 4N5LA 4MOWA 3QWBA 1DC5A 1ID1A 2YY7A 3BMOA 1XHLA 3GG9A 3PIIA 4I9UA 5KJFA 1LSJA 3WMXA 1TA4A 3CZMA 1ZUD1 3NEPX 4FLOA 1R4NB 3F46A 2ZTMA 4XGIA 1ZK1A 3GNSA 1SCUA 4CV2A 3OQ6A 1U5AA 3ULKA 1N1GA 2C29D 3JTMA 4PLCA 2B35A 2HK7A 3M1AA 4BMNA 3F47A 1PQUA 4AJJA 3F5QA 4AJPA 4FFNA 4RDHA 4YAJA 5BNTA 2VZ8A 3C3XA 2WYWA 3ITKA 2J3HA 1ENOA 3OH8A 3AM4A 1G6KA 3U5TA 2Q1SA 1CRWG 4WNCA 1PL8A 1T2AA 1E1KA 3PQDA 2JD2A 2X5KO 5IJZA 1QLJA 2DLDA 2D3TA 5FEUA 1IE3A 3H7AA 3GAZA 2VUSA 1QV7A 3X2EA 2W8ZA 2YDXA 4A7PA 5L51A 2PGDA 1QR6A 2OP1A 4QQRA 4GKVA 5T64A 2G5CA 1H6DA 4PG4A 3DAPA 2GR9A 4YRDA 4ZQBA 2PK3A 5GZ3A 2CVOA 3ZCXA 1Y8RB 1DIAA 1O8CA 2DM6A 4PLZA 1LLQA 2YFHA 2XAAA 3LF1A 2CVQA 1ZFNA 3I4FA 3NRCA 3A06A 2P9GA 4LCJA 3WBBA 3RVDA 3F6YA 1MW0A
chains in the Genus database with same CATH superfamily
2GM9A 1DCKA 2A5GA 2Z2IA 4EHKA 5A2GA 5C1PA 4MGHA 3IT3A 5FR2A 2NP6A 2QZJA 1JQDA 2J9RA 1OIWA 3OPNA 5HHTA 1ZNQO 1UK6A 3FYSA 1WVMA 4R8RA 4H60A 1YF3A 1EX9A 2H7VA 3UQYS 1WVGA 2PGXA 2C5SA 2YJ6A 4MUXA 5LQRA 1BCRB 2RAVA 3ORFA 4KQXA 1F7UA 5I4KA 1UK7A 2W2MA 1EX1A 2PBLA 2JW5A 2OGWA 1H1LA 3BGDA 2CFTA 3DEFA 3GNQA 2PU7A 5B1IA 1L4FA 4DNPA 4J75A 1UBNA 2JHCA 2BUAA 1KH2A 1RWQA 3FHEA 1IATA 4HZUB 1YRLA 4X0EA 1XZNA 1SXJE 1OBCA 5CU7A 2BBWA 1NKVA 5LA6B 1U1FA 5JBNA 4GQIA 3QNMA 5H3LA 3C6XA 3ZU4A 2QR5A 3DFUA 3SHQA 5CH5A 2GHTA 1ZD5A 1FIUA 2IPAB 3R0QA 2X2EA 4MUNA 2WOJA 3AI7A 2R9VA 4ZARA 5BWCA 2Q5EA 3KJNA 3BZUA 3QPBA 3ZD8A 1U7WA 1HUQA 2BZ0A 3HFRA 1EVIA 2B7LA 4GYKA 4NS4A 4HLDA 3UAVA 5J4HA 4TYPA 4Z0PA 1CHDA 3I01A 1WA5A 3UW3A 4WEQA 4C14A 1XZAA 2RB4A 1BMQA 1GKUB 4YJ3B 2AKEA 2BW0A 3LCRA 2PWZA 4FJ1A 4F0JA 1RXEA 4OL9A 4PG5A 5I3CA 2HJSA 2C9OA 5K0NA 2C0QA 1E9SA 5CK5A 3WDKA 1CEXA 2PMFA 2WMNB 2VF7A 1Q44A 2VT6A 3B9BA 1S0UA 4I8DA 3V8NA 1NQOA 2VK1A 2CNWA 1OY1A 1WHTA 3KQQA 1N5DA 5K45A 3DE5X 1GCGA 3PNSA 3WNVA 3UK1A 3AJDA 3JQPA 3WMEA 4UTPA 3KU4A 5L95A 3FCSB 4DIOA 2OGTA 2HMWA 3G5TA 3LYHA 4I6GA 2PX4A 1E9CA 3OT5A 4US1R 3HJCA 3WS7A 3FTYA 2JBAB 1VE6A 2FEKA 3EIEA 4DMRA 5C1DA 3WOHA 1Q2XA 1VBFA 4HAXA 4HRAA 4HAYA 3WGNA 4XQEA 5CG2A 1QCZA 2YOGA 4XIJA 3SC4A 3PEFA 1HZZA 4AF6A 4ZYXA 1P2SA 3OM9A 1VBNA 4M1MA 3NAQA 2W2VA 1NM5C 4YUAA 1OH8A 4NG4A 4L75A 1OWOA 1K7SN 2I2BA 3UKOA 4XPIB 3WSWA 2IZZA 4FNMA 3VISA 5GJBA 1G7SA 1WUTA 1S6YA 2ODNA 5CXXA 2UKDA 2R0QC 1KU0A 1TRKA 2O23A 4FCWA 1XZFA 3HBFA 2Z3ZA 2HHAA 1I01A 5C34B 3FHLA 2IUSA 1SHKA 3FTVA 3L4KA 3LI2A 4KXUA 4DCTA 3GLQA 3UOWA 3NANA 5BRJA 5KNDH 4PWZA 1E1RA 4ND6A 5E7MA 2QP9X 1MA3A 2OAEA 3GA0A 3GVHA 1GADO 3KTFA 1Z4IA 3ORRA 2ZULA 4HAVA 1GNQA 1OX4B 2CN1A 2HH9A 4QXPA 2XUOA 3AJAA 2ACKA 3M6FA 2PCJA 3DS8A 1PCXA 3MUNA 5A4DA 1OXMA 1YL5A 5B2FA 4IOLA 3KHTA 4UEOA 3DBRA 5JV5A 5CX4A 4KK3A 1YDFA 4UPEA 2EFGA 4AW9A 4EHHA 4UULA 3JW8A 4K26A 1DRUA 2PVCA 3ZHOA 1XA3A 1XYVA 2DFKB 4AY5A 3P9QA 4E3WA 3KPYA 3MJEA 3E8XA 1HGXA 4DUYB 3BFXA 1XTTA 3PD1A 4V24A 3TZQA 5HSGA 3OPYB 1DXHA 4OUKX 3G9UA 1Z2CA 2IU4A 2XQJA 4B40A 4WXPA 3IIKA 4CMHA 4CTOA 3N2IA 3ITEA 3CG4A 4BXOB 1I0ZA 1POWA 2EZ4A 5K99A 3JD4A 4TS3A 1P7PA 4XR4A 1KYXA 3EH2A 3KOZA 4X8LA 4E03A 4ENVA 3STVA 3A3YA 3U48A 2AV6A 4EG4A 5CB6A 2HR1A 3FUJA 4GBGA 1PS8A 4M88A 2HLHA 2QF7A 3NJ4A 3H18A 2ORVA 3QVMA 4LRXA 2A0UA 5KKAA 2I3AA 2RK4A 5G4KA 3WKDA 4E09A 3FU0A 3KX2A 3JALA 3OECA 4MP6A 5CCBA 2DEUA 1SVOA 3UNXA 2I99A 1N75A 3QLEA 2Y1LA 1HFJA 4CL0A 4E15A 1JTVA 3GDGA 3FVTA 4H7DA 1LS6A 2DHCA 1AE1A 4YB8A 5SYAA 1NBME 1CUWA 1T3HA 4BVBA 4X1YA 4MKXA 5DM0A 1RRGA 1J8DA 3N2GA 2K87A 4MV0A 1Y33E 3MPUA 4DG9A 4YAKA 4PZZA 4C7MA 3ZH2A 4DR7B 1RFLA 1VPWA 4EA7A 1XTSA 3IKLA 4E5KA 1JKJB 4KWEA 4W5TA 1Y6RA 2W9XA 3E58A 1T34A 4B4OA 3U1TA 1W46A 1XZPA 4O63O 4YUYA 1M1ZA 1UAYA 1ZIOA 3G9TA 1B0AA 3K1YA 1I94B 1MJ5A 2EZTA 1TA9A 1HI9A 4R01A 4UEWA 1IPHA 5G0UA 3MBKA 1Z8NA 1V16A 2FZGA 1M2HA 2W4IA 4FBLA 5DHRA 3M6AA 1NG9A 2X0IA 3ZBTA 3WXMA 1CLEA 1YUMA 2I1LA 5DN6A 3UAYA 1G8AA 4PNHA 4O1MA 1B3BA 2JIQA 3LG2A 3LKVA 3QLUA 1KAHA 4FD3A 2W6JD 3UJDA 1JLLA 3AVYA 2WWRA 3ROFA 3FROA 3R6GA 4JBLA 2A5YB 2BI8A 3T54A 1SCKA 2X5OA 2XBUA 1DEXA 1FSZA 2LW7A 4LQLA 3ELUA 4QUEA 2WYIA 2Y9PB 2ZS7A 5F77A 4AULA 3U39A 4ABTA 5REQA 2L42A 2R8OA 3DBOB 1I3CA 4R4JA 4EG1A 1KVSA 4O0MA 5I9MA 2WQ7A 3EGWA 1H4SA 2A7QA 2FWIA 3MCZA 4S3MA 1QGAA 4I1VA 1XRRA 2DFVA 3PQ6A 3X3HA 2O8FA 3HCFA 2OL4A 2QVCA 5K5EA 1U7UA 4WASA 3TSYA 2V6JA 3U09A 4TV9A 4EJSC 2Q4DA 4WBXC 2VAXA 1KTIA 1FW6A 1G20A 1WCV1 4PBTA 3CZKA 1O58A 1E5QA 1KRHA 1Y3CE 3F67A 3LC1O 5FNVF 1ZNZA 2H5EA 4XB2A 1PLLA 3JQDA 2XRMA 5EKTA 3VGJA 1GPDG 2GCEA 1L5ZA 1E8MA 4K1XA 1DHTA 1GARA 1NX6A 2DTEA 3B1YA 4KLZA 4WNAB 5FI5A 3UJNA 3HE3A 2GPNA 3PEYA 4CLRA 3IX7A 1A5SB 5FOUA 1F14A 3HXKA 2VRBA 2DQMA 1LPNA 3CUWA 2WMOB 3DPIA 2Y1GA 3E9MA 2GZAA 2ZSAA 2ZVPX 4G1FA 1KDPA 3RASA 1GN9A 4M3NA 4P98A 3W06A 4J3BA 2GETA 2Z1MA 3ZPXA 1W4AA 1I7PA 3OPYI 3A1FA 1UPXA 2R6JA 1XVLA 2WD7B 4B46A 4BC1A 2GPWA 2VHTA 4HDRA 1WQ3A 3MCVA 4UM9D 2F48A 5B1EA 2EZUA 3N0RA 1KEEB 4ARFA 1GYRA 3G6KA 3OPQA 4R3WA 4E2YA 4NCJA 2QW8A 1OASA 4L15A 5TE9A 4REQA 2DR0A 1P8JA 3GZNB 3VR4A 1H3LA 4Y6PA 5EJ5A 4MNTA 3SXUB 2J31A 1NI4A 2X0FA 4GE3A 4DOMA 1YASA 3BRSA 3V1UA 4CQJA 2GSDA 3CX8A 4MITA 4R8SA 1FVXA 4D44A 4E13A 1FDVA 3VPAA 2LUOA 3H97A 3AQIA 3NPAA 2F59A 4AJ9A 1ZH6A 3IKVA 1UKEA 4HGOA 1C1DA 1Z4JA 2CFSA 5AM2A 3DTYA 4WZAE 1N78A 2WQZA 3BRCA 1VYHA 4J0IA 2BMVA 2LGJA 3T3DA 4DY6A 4I66A 4N5DA 1N57A 4G37A 2BR4A 4U63A 5AKEA 3U17A 3VR0A 2VJQA 2W8BA 4HO1X 2X6RA 2EBWA 4Q93A 1YMUA 3PPXA 1T1SA 3KKZA 4J07A 4XVHA 3SIRA 2QUHA 4J4TA 4AKTA 1XCMA 3DNPA 1P7WA 5JXJA 4EH1A 1ZDMA 1XHEA 2YICA 1WDMA 4L9WA 4UAGA 5TRTA 3R8CA 4D9FA 4OQYA 1BH2A 1Z8DA 3KSDO 4BFSA 1EKXA 4IHJF 1YMVA 2LKDA 4X9XA 4PGMA 1O4WA 1Z68A 3EXG2 2PCLA 1O6BA 1HYBA 4RYDA 3O9MA 2JIPA 1R15A 5FBVB 4WKNA 3R7BA 5M34A 2OO7A 3LQ2A 3U9SA 3K9QO 3VKWA 4ZFNA 3I2KA 1L9KA 5JS1A 1RVDA 4X84A 2ECFA 4L0MA 1OTYA 3L8EA 3QEAZ 5KC8A 3B1JA 2FTKE 3NYIA 4PZDA 4YAEA 2WSSD 4LX8A 2I03A 5H8WA 2IBSA 4MPJA 5C31A 1RXWA 2V3CC 1ZM9A 4YS6A 1PFKA 5C0OE 4KE6A 4E31A 1CUIA 3WLJA 4EGAA 5HUQA 2ZCVA 4BRWA 4ZRNA 1JWLA 2EQ5A 4Y18A 4MKHA 3CVXA 1YZVA 1AB5A 5LZ5A 2X58A 3T1YB 3A9CA 2HA3A 2JGIA 2J6HA 3M4NA 4RIEA 4LHSA 4E33A 1PJ8A 4IIJA 1Y8QA 2FE4A 4N3GA 3N9IA 3IVCA 1ZHHA 1TK2A 1CR0A 1EWQA 2D2FA 2CXQA 2EBUA 1M2VB 2QI9C 5EE9A 4D6PA 5EPUA 3OM0A 3TMAA 4HRYA 1E3WA 3I5AA 1E4EB 3EHDA 3KR9A 1DGQA 1T36B 4PQFA 5FRDA 1EXVA 3I28A 3IDFA 2J5BA 4JYBA 5DX1A 3K2IA 1JGIA 4BYMA 1M2FA 2H8GA 3O9ZA 5D01A 3KKLA 1GQOA 2VHWA 4Q15A 1RCTE 3NH6A 1JKFA 1TF5A 2AEMA 2KX7A 4AK9A 2AI1A 1KAOA 3JQ9A 4RS4A 3H2ZA 2HJVA 3TKYA 1RIIA 1U9IC 4IMRA 3QEMB 4LRQA 2EGGA 1JEDA 2NO5A 1HKUA 1L5HB 2NU7A 3OU2A 3PHCA 4LJ8A 4H7EA 3UMFA 1E92A 1K8RA 2D5LA 3V3KA 3LCVB 4LHEA 3SJZA 3FTDA 5K6AC 2DC1A 2IEAA 3FM9A 4TMXA 5KCMA 2ZT6A 4EB6A 1H8ED 4HWPA 1C7RA 3HWWA 5LB2A 2CYBA 1EJ6A 4LPKA 4ETIA 1GPKA 1G8KA 5EYPA 1NRIA 2PXHA 3BK2A 3VFDA 2BJWA 4AMBA 1QU3A 4H77A 4ZOLF 2ZIVB 1NV8A 1T29A 1RAGA 1Z0JA 2PKXA 3SYKA 4CXMA 1ZRNA 3QUCA 1XBTA 4EJ2A 3ZU2A 3DUFA 1PSWA 5JS6A 2E48A 5CVVA 4Y2SA 4NE9A 2Y68A 4Q66C 2X22A 3EZYA 3I01M 1S89A 1D8TA 4G8BA 2QN2A 1I6KA 3K71B 3OICA 3USES 1FXUA 1FS5A 3MYYA 3MA0A 3QA9A 2Q3FA 4H9GA 1TXGA 5G40A 4B1FA 2ISSD 5BNWA 2YXNA 1RP7A 1TAUA 1K98A 4MRRA 3HP4A 1TUGA 2N1BA 1GITA 2YJ4A 3IE0A 3KZ1E 3OO1A 3TRKA 4GSLA 5KBYA 1XMOB 3T8YA 3EB9A 1EZ1A 4BY9E 4N7RA 4EFNA 2RHJA 3Q7TA 3GJQA 3KBOA 1OC2A 1UDCA 3B1FA 3I8XA 1F6BA 2AOUA 2P1ZA 2VP0A 3RU3A 4YRAA 4P4SA 4DR3B 2A4MA 2DQYA 3Q40A 4OH1A 3N28A 4KBGA 1KJQA 4UBJA 3OC0A 4JI2B 2D74A 2ZTHA 1AN9A 4Z9FA 2EJUA 1SRRA 4HWGA 1TM2A 4JLUA 4CLHA 5IJWA 1SCBA 2D2EA 4QBGB 1RYHA 4Y1GA 2C8KA 16PKA 1SQ0A 1VCHA 3EZXA 4JBNA 4AZ0A 3NIGB 3SFTA 4G65A 1Y6FA 4CMKA 2Q4EA 2NTJA 4LRSB 2IOQA 3P0EA 1YB1A 3ZIDA 4CKCA 1O6CA 2X19A 3T7CA 1D2HA 1NC1A 2Z6VA 2CDBA 1NXOA 4KQGA 3ABZA 3VKHA 1Z38A 2HFKA 1TCBA 1I1NA 4BJ3A 3L02A 2R11A 2VSNA 3DL2A 5L3QB 1JF8A 3HUDA 1J0DA 4K1LA 1RIFA 3C85A 2JNWA 3SI7A 4N7JA 5F12A 1G0OA 3DP9A 5F2OA 2IT1A 4TWRA 1FRNA 2B98A 3W6UA 2FQWA 2QL9A 4TQAA 4BX0A 2FQYA 4CMJA 2PT7A 3HUUA 3OE1A 2PS1A 4D8YA 4W7SA 4JR0A 1KHHA 4BFVA 4GRAA 5E3JA 4XUCA 1SBQA 2OXEA 2V9ZA 1W5FA 4KQMA 5JSFA 1ZL2A 2P69A 3M33A 4MH0R 5B7NA 3L01A 1ZVQA 4TPKA 4GYWA 4S35A 1CY7A 3IQXA 3WK7A 4M83A 3A6GA 1RM4A 1Y1LA 3ZE0B 1A4UA 1AHPA 4M1SA 1FP7A 3U4AA 5CVEA 2GZDA 3NCHA 1JT9A 1Z34A 1IRXA 3A6FA 3GLTA 5COAA 3AUKA 1AK1A 3ZY2A 1C80A 5IASA 2CL0X 3CW8X 2PZFA 1XD2A 2YWCA 5FORA 2GEKA 1NOJA 3FRJA 3JSZA 3EG9A 2ZWOA 2QRMA 4YDSA 1RKBA 1SVKA 1Z7YA 3MN1A 4AG3A 3TEMA 2QJFA 3TFWA 2XQKA 2EERA 1VP3A 2I6GA 1KEKA 2D3WA 2H57A 3PQ7A 4KTTE 4QUOA 2I4MA 2V9PA 4TUYF 4PFQA 4UBKA 3JSAA 4BNZA 3LBYA 2CK3A 3V4LA 1SURA 2CSUA 3DMDA 1G18A 3L7YA 5C1IA 3PYMA 1TK9A 3E1SA 3F9CA 2FPPB 3QF4B 4OV6B 3ZS9A 3U3XA 4D4JA 5D5QA 1IDN1 2Y1CA 1XEXB 2ZATA 5D85A 4NSNA 2N9UA 3PJRA 3TH5A 3ZCSA 4HDNB 4R1UA 2IPXA 4FFWA 1P17A 3PFCA 1NI5A 4J0KA 3WGJA 4LJRA 3AVUA 4NONA 2D5IA 5CA1B 3WKEA 2G07A 3UWKA 1W1IA 4YHBA 2H9AA 3F98A 4ZI7B 4CF5A 3WG9A 3A1CA 4LXXA 1NL3A 1PJ3A 2Z5FA 5KYYB 1A9XA 5JAZA 1QIIA 4NFLA 5LZ4A 5MFZA 3WIBA 2JBHA 1G42A 4MAAA 4ZW8A 1D6MA 4JOQA 5JMTA 3GPLA 1CZKA 4X91A 1K66A 3P4UA 2NO1A 1I8TA 1DXYA 4YPFA 5CLFA 4MI1A 4GIBA 4V0MA 2WUWE 4OI2A 1PJ2A 1ZITA 4B87A 4CKWA 1XT6A 4HQFA 1T6ZA 5D1NA 4MVJD 2GZMA 3K96A 3OP1A 2E4VA 3V4SA 5LN1A 1I6WA 4HH1A 4WKCA 5FBHA 1NUPA 4DY4A 3ZZUA 1AKMA 1NYRA 3H2SA 3ZIUA 4W1QA 2Q6LA 1NQWA 2ZIGA 1UMKA 2HSWA 4Z9YA 3KZNA 3V1NA 3TQHA 4E08A 4MQ6A 4XR9A 3W7VA 4KNVA 4DXHA 5HR5A 4XLTA 5B30A 4W1PA 2VK2A 1GYQA 4R2MA 5THXA 1DC7A 1JHQA 3DM5A 3K5WA 3L8GA 5B4UA 3NATA 2W6OA 1J33A 1IB6A 5JIBA 4M9ZA 4YJFB 4UU7A 1TQ8A 1Q6ZA 3H0CA 3VHRA 1JKMA 1QVWA 1RHKA 4BQNA 2ZRAA 1Y48E 2DQSA 1RDFA 3C5VA 3Q9NA 4UQOA 4DDUA 5JZ9A 2X7XA 2B2CA 4RULA 4I1SA 4CKXA 1WZEA 4PW4A 5AUNB 3O8NA 2HW8A 3U37A 1AURA 1I4OA 3D2AA 3EY4A 1G3IA 3H05A 3RIMA 3LBFA 3HLYA 3Q41A 3QX7A 2B3DA 2OLJA 3UHJA 4WJKB 1ZMXA 2C96A 2GPBA 3PLRA 4R81A 1DC6A 2QRVB 1ZGHA 3D2LA 3PQ2A 4GE0A 3PTAA 2ZM6B 3QJGA 2CJWA 3IT1A 2HY7A 4L57A 3E0XA 2FZ4A 3LPNA 4LCEA 1HDXA 2ZBEA 1P1CA 1SXJC 3Q10A 2Y0BA 3VNQA 1Y3IA 5MN5A 2Y6VA 3FETA 4PYMA 3G9ZA 4KQHA 3I2HA 1UL1X 4N8EA 1T5LA 3ZYZA 4LRYA 1RXYA 4DUZB 3GJ0A 3QKSB 1PR9A 2GX6A 2W6NA 1U0JA 2XDWA 4WV3A 3RAEC 2TMDA 3I72A 4LI3X 4Q9NA 3OT1A 2ODBA 2ZITA 2XNKA 3C3KA 3N2NA 5THQA 4Y2UA 3AUSA 1URPA 1PGOA 1XFDA 4JN6B 4Y9TA 4CL2A 1NBAA 1ZUIA 2BM8A 3PF8A 1J5PA 1YJXA 4C0LA 2IE0A 4CN9A 1U2DC 3K2BA 2QLMA 2VBIA 3NO4A 2GILA 3Q6NA 4HX5A 5IAKA 1QYVA 1YKFA 5JO0A 5IBPA 5IF3A 2ZJ3A 3O74A 3EMVA 4KDEA 2GAOA 3CN9A 1DSSG 4GRIA 4BX3A 2RHBA 3MVEA 4BEVA 3TOCA 5CB4A 2HOQA 2YXBA 2VZLA 8GPBA 1F20A 1LJUA 2WUFA 1G21B 2Q9BA 4JSTA 1CIVA 1D5CA 1HLDA 2BFBA 2ES4A 3DHEA 4NMXB 3DB2A 2GCOA 3SZUA 5JSUA 4XASA 2E4ZA 2AVNA 3LZCA 3V1TC 3NP9A 4GR5A 4M1YA 2YOFA 2I9PA 5FOTA 3DG9A 4RBNA 2J0SA 2DPMA 4H6VA 1ZUWA 2HI0A 1F3LA 4NG5A 3HR8A 2VFAA 3DXFA 4YP6A 5HJ7A 2QTCA 3LPLA 2BCJQ 2O57A 3HKCA 4ICIA 1XYYA 4FGUA 4XKJA 5DP2A 5TEWA 1BCSA 3VR5A 4L07A 1AQJA 1EB9A 3P45A 1Y7PA 4MW0A 3CZ4A 2ADOA 5BR7A 3ZDAA 4S04A 2QP3A 2FXIA 4UHJA 2C3MA 5CTAA 3ILYA 2GKSA 2QXYA 2I3ZA 4I6EA 4DRXB 5KYXB 1W0KA 3CTMA 1BJRE 2OILA 3ESYA 1E5XA 1M67A 1E1CB 4KGXA 1BFDA 3O8CA 4IX9A 4K88A 5KOJA 2M9MA 2OV2A 1NVUQ 2JFGA 2VPPA 4FLFA 5FWXB 2F7SA 1M6VB 2R8EA 4L28A 1TYCA 3V6MA 4JVMA 3HZZA 4DIFA 4MB6A 3VVLA 3K20A 3I6ZA 5CNMA 2NTEA 4AF7A 1P9NA 2D7JA 1Z12A 3RUIA 1G5RA 4RJTA 1DARA 1WUJS 1KI1A 1TPZA 4QEDA 1T2FA 5BN3B 5AVRA 2ZI7A 5BOVA 3PGJA 4C2UA 1SOMA 4K8OA 4FOPA 4HWRA 1NLYA 1IL0A 1CEEA 1CUBA 4EG5A 3VR6D 4CYMA 1U5BB 1UBKS 3BGIA 3P0RA 4ZJUA 5FUYA 2RAFA 1HL7A 1IN8A 1I7DA 2Q2VA 1NP7A 3NT5A 5IK2A 4NY1A 4B76A 2YHBA 5I7SA 2B83A 2H4YA 4AD8A 4CM3A 1FJGB 1B1AA 1HLFA 1LU9A 1VHDA 2ZB8A 4FWIB 4MUEA 2G88A 1Z3IX 3QLVA 5TVKA 1GOTA 2QPTA 3VYWA 1LVHA 3VSAA 3YASA 3AR6A 3SIXA 5DNWA 1TRHA 2QENA 4JJKA 1PR4A 2ZE5A 3FDJA 1C4WA 1YS1X 2FSPA 1PK8A 3FTEA 2B3TA 4BN0A 1E89A 1DC4A 1V11A 2ZI5A 1MUUA 1T15A 3EISA 4RF5A 3AUTA 2JGDB 5IDWA 3CLSD 4JYZA 4DARA 1C9KA 4FDAA 4LWOA 1MAAA 1TYEB 2JG3A 4CEIB 4HR7A 5FKJA 5IU6A 3V4RA 1T4GA 1QF6A 4MTCA 1QIEA 2EKZA 4Q6WA 5KOHB 5JXWA 4XM0A 3VZBA 4HY3A 3FAZA 5IBRA 2BHNA 4NOKA 4BASA 5JNVA 3EQ2A 2YWJA 1YJAA 1YZKA 1G5QA 3SC2B 3ZGVA 1ABEA 4X2UA 4UZFA 3TW8B 4CJXA 3AERB 4BO0A 4KDCA 2WILA 5BQOA 3UHFA 1QP8A 1Y8RA 2CL7X 2IYOA 4G24A 4HKTA 4Q5IA 2RAUA 5CLGA 2FGKA 4Z1MA 1OU4A 1XVVA 4ZQTA 3WLRA 4FYIA 5A0FA 3SSOA 4A0RA 1Y3DE 1FRZA 4H16A 1FTNA 4V1CB 4CL8A 4OFXA 4ZK2A 4MKGA 4EAAA 4BVEA 4R40A 3ZV3A 4C76A 3PC6A 2YIJA 4ZT7A 1RC0A 1PRYA 1W4RA 1KNQA 1Z45A 3K0AA 3KL4A 5EMJA 1IZ8A 1XFAA 7MHTA 3LRTA 2Q8PA 1FQJA 1RJGA 4BX2A 3SDZA 4KIWA 3KSZO 1GPAA 4HGPA 2F1OA 2HB6A 3CF4G 3L7KA 1ZU5A 1VI5A 1RRVA 3PUKA 5C5DA 5ITZA 3MPOA 2O7RA 3OE7A 1OFTA 2NTNA 1ODTC 2YN0A 4FLSA 2O19A 3FPSA 4RDIA 2EFJA 2H31A 2R4TA 1DEAA 3LKZA 1SXJB 3U7QA 1G5PA 5AOCA 4DNOA 4ZW7A 3ZNOA 2ISCA 2NSJA 4UOEA 3QNUA 3TQRA 1G6Q1 4IJ5A 2KMLA 2M6SA 2PKYX 4L3OA 3UAXA 2WAYA 3MJ4A 4JEMA 3O4HA 1WPRA 3GN2A 1LK0A 1TE2A 4UHFA 1KFKB 4A73A 3S2EA 4ATNA 4FMDF 3AR9A 3TW0A 5KX5B 2H7YA 5CNJA 3VV3A 1OGIA 2BGKA 3FE2A 3C98A 1E0SA 3D5QA 2FFQA 3HJAA 1K89A 3I53A 3GD5A 3TWOA 3N0WA 2EZ9A 1PVDA 1RBYA 4Y1EA 4RY8A 1JTEA 2QMHA 1DL5A 5E4FA 1QFSA 3HYCA 1ZNXA 1KO8A 3KAJA 3PI6A 4JVNA 1AG9A 1RYFA 2AG0A 3IOBA 3ZWQA 1U98A 2PZ8A 3X1ZA 4HX9A 2P3SA 3IXQA 3HDQA 3LHKA 4YMWA 2XUIA 4EI8A 3KV3O 2RGNC 4RMHA 2KB0A 4OK5A 4HTFB 3VVMA 1AXGA 4UQLA 3KQUA 1S2MA 3BWDD 1RWVA 2AJDA 4OHVA 3DTVD 4K46A 4OKNA 1DS6A 2Z3WA 5DNEA 5ER6A 2OZKA 3QPWA 4IFIA 5HG0A 3S70A 2NQ8A 3OWOA 3KOWA 3KXPA 4LJSA 4KW7A 1HT2E 2ZRQA 1LK5A 3ZXSA 3K16A 1NQUA 1S96A 2VHYA 3EEOA 2ZT8A 3BHIA 3UMGA 3H99A 1W47A 1SBTA 1AT1A 3B53X 3H2KA 2ONKA 3BBPA 3EEQA 1YOVB 3CKYA 4ZT5A 5JADA 4Z7QB 3HXPA 2IHTA 4EABA 3HXMA 2NU9B 4P84A 3VU0A 4H15A 2FW9A 2H5JA 2V7QD 1BXGA 3CEMA 2GBFA 1XXHA 3HSYA 3IESA 3IQFA 4JB3A 4KN5A 4O4JA 3HGQA 4B09A 1HT3A 1WWKA 2QTWB 2I54A 2IPOA 4PYJA 4QOSA 4PS0A 2F67A 4PGFA 1TEVA 2ZW9A 1Q1NA 1ABFA 1OZAA 1XTBA 1NN5A 2AN1A 4QXOA 4WLUA 3FNEA 2BGWA 2ZGVA 1WXXA 4U9UA 4ZTBA 1P0FA 1BU8A 4BMYA 2MYTA 2VTDA 3CPHA 3ZCRA 5ELXA 1CZUA 2RGUA 4IH4A 4NCBA 5LUAA 3MRVA 3TLCA 5HWSA 4F7WA 3B1WA 3EVTA 3KB2A 2VWQA 3BAZA 2D2IA 3W3AH 1PIWA 4L7QA 2NXEA 2R65A 2VSXA 5EZ6B 1YFKA 4IIHA 4YMHA 3GLGA 4QXMA 4V1CI 3NHZA 2KBEA 3KTAB 5L45A 4MJLA 1Q5PA 2EHDA 2W48A 1AY0A 1XYGA 3CZGA 3H13A 1DCMA 3EWIA 3HSKA 4Y9SA 3UMBA 3R8FA 1Z5OA 4NATA 5EE5B 5BYKA 3NNSA 2DE0X 3R3YA 5K0SA 4P0PB 3WBFA 4UVHA 1EJBA 3AY3A 4HDKB 4JYAB 3CZEA 1FXWA 2GFQA 2NO7A 4C07A 3S44A 5A6SA 2REXB 3B60A 4RE6A 2Q46A 5HF8A 1P1HA 5C4IA 3TR0A 3KQOA 3LX6A 2F6RA 3O0TA 1F2TA 4EMSA 1TUIA 1ZOPA 3BWXA 1F5SA 1XMIA 4B3FX 3SZLA 2WJHA 1O96A 3HJNA 5EWJB 4Y1RA 3OMWA 2OZEA 3VPFA 5F7OA 4JXZA 4M37A 4NYJR 1ZS2A 2DQKA 4PBRA 5GMOA 3RQSA 1R8XA 3SQMA 2IOYA 1KI2A 1QPGA 1VJ0A 3W5IA 1DWQA 1JZQA 1II0A 4RFLA 1H4VB 4DBLE 1TJPB 4MYDA 1TZMA 4L85A 2EL9A 2ILTA 2BBOA 3CLUD 1Y1QA 3D8BA 3GH3A 4OHZA 5ICGA 1S4MA 1VRCA 4Q9JA 2MCFA 1VCOA 1ZIPA 2FP3A 2PNFA 4PC3A 3JRWA 1YACA 2V55B 4Q4JA 4EFKA 4O3FA 4D45A 2JRCA 2HRRA 1IWOA 2BELA 3OEHA 4JEIA 2FYTA 4B6GA 1O9BA 2P8JA 1SD2A 3BL5A 3AEUA 4J6EA 2GTHA 3HM2A 3JQCA 4N0QA 3JZFA 1G9XA 1SVWA 3L4BC 5LBIA 4JMPA 3STUA 4DW8A 1XRMA 2C4HA 2H2DA 3CSUA 2J8ZA 5EV7A 1GRQA 3HR7A 1E1MA 3NAGA 4LVUA 4DJ5X 3VBEA 1MW8X 2WDPA 3ZDRA 1RBMA 3Q7EA 4JYMA 3CJQA 3GLUA 4FGSA 3SICE 2ZIXA 2C84A 3A4NA 3I6YA 4UUNA 3DSRA 4OJTA 2ZRBA 4Z4CA 5LPNA 2C97A 1X0XA 3GBSA 421PA 5C1OA 4Q4AA 5ADWA 4L0CA 5DBIA 1EWTA 4XNDA 4G0NA 5GV8A 4ER7A 2O1XA 4JR1A 1UP4A 2C3UA 4JJ8A 1OFGA 2WU8A 1L9XA 1G98A 1OXBB 2XDQA 3U31A 4OSPA 1QS0B 2XTJA 1CUZA 5F5XA 4K2HA 3ECCA 3LA6A 3GMSA 5H02A 5EIFA 5CYFA 3TNYA 1MB4A 1WCYA 4V0KA 3K7EA 4AVYA 1PP4A 3HUEA 2OT3B 3C6YA 2IOFA 4E12A 2PNJA 1THGA 3DNMA 4UMEA 4X95A 4XVCA 4RSYA 4NP6A 4WL0A 3VSCA 4F96A 4FMCB 1MJNA 5JH7B 1S8OA 1VP9A 2C2BA 4RZIA 3T1VA 4DM3A 4JU9A 2PBZA 2CNDA 4C6TB 1CK4A 3K31A 1YQ9A 1O97C 4OHKA 2MMCA 3MMNA 4E7PA 3IUSA 1QHHB 5A4KA 2NUTA 1O94C 1IIBA 2QTVB 2V6FA 1SU8A 3NGMA 4HDSB 1Z5PA 2H63A 1GDHA 1TTPB 1JR3D 3TG8A 2WWFA 5DHPA 2XA2A 1H85A 2I78A 4AJ1A 5JJIA 2E4UA 4ZVPA 1MJHA 3LIIA 1K6IA 4IVRA 3PU6A 2CLLB 1Q6YA 1VDMA 1YIOA 3ZXXA 3JCZA 4UREA 1TTTA 5HQ3B 2GVDC 3EPJA 3EZ6A 2DT5A 3ND7A 2Z43A 5HMMA 2IPMA 4EFLA 3DEKA 1B7GO 2XTZA 1HDEA 1PV4A 4RQUA 1DQNA 3IHTA 4ON9A 2BEJA 4F2PA 4KYTA 4NJEA 1UMBB 2OV8A 2Q3EA 3HDVA 5LUBA 4BV2A 1J2TA 2B4YA 2VZ0A 3DFKA 1SIOA 1XV5A 1J24A 1MQAA 1GT91 1QG6A 4IOJA 4PNZA 4ZODA 5K05A 2OBXA 1Q0RA 2VRCD 1IIRA 3O38A 2C8LA 1ZVVA 4YT8A 2C00A 4R6XA 3SJAA 1Z6ZA 4I99A 3OX2A 1CX9B 5BRNA 1SD5A 3D4OA 2YJZA 1XRLA 4B3HA 1Q0HA 1X7ZB 4D3ZA 3ORHA 4ZDKA 1RPTA 1RS0A 5B6JA 5BT9A 3ODGA 2G0AA 1ENPA 3PVCA 2W2XA 1W1WA 1WDTA 1TM3E 5AHKA 3N0VA 1II8A 1RZRA 1U8ZA 3SJCA 3DAOA 1WMAA 2PMEA 2W2LD 1CXZA 1KFBB 3GYBA 2QY9A 5ALJA 2VA9A 2X9NA 4I5EA 4JHLA 3OZTA 5KSPA 4R2HA 3RHTA 3G59A 1FMFA 3A6EA 2BJHA 2VJNA 3PSAA 4MX8A 2O2IA 2KLBA 1LW6E 3HHEA 3TLKA 3WTBA 4BMSA 1UJ5A 3C8ZA 4QYIB 2YC4C 1BDMA 4C89A 3UGQA 4F4CA 5CD9A 1NNEA 3JQ8A 4Q9IA 1RMYA 1DFHA 3RWBA 3FVWA 5I48A 1KWKA 1NGSA 3QXHA 4FSXA 2G1KA 3BDVA 4WZAB 2PRIA 3I6IA 5F98A 3UB4A 1JNXX 4FONA 1H2ZA 4KI7A 3T7DA 3PXUA 2X3FA 1D09A 3KKKA 3LSTA 1Z35A 3CO5A 2P35A 5J5CA 5I7HA 3CZQA 2Q29A 3AEKB 2NZ2A 3E9QA 4R54A 2BSXA 5LBUA 4MS6A 2EU8A 3AO0B 2F9FA 3NV9A 4L5CA 4NV3A 1ZMRA 3I76A 1NR5A 4E4TA 4BO3A 3Q87B 3SX4A 4ROSA 1TJ3A 1KXZA 4GX1A 4B74A 1UEJA 3BPSA 1GR0A 4Q1CA 1CQPA 4I3HA 1S2OA 2IITA 2Q3JA 2ZVDA 4DDMA 3BHJA 1XD9A 3FUUA 4FJ2A 1BHSA 3CFYA 3KFXA 1L8OA 4OA5A 5KMGA 4NCNA 3H65A 4F4JA 4JUIA 3BICA 3HL4A 3RS7A 3AH8A 4BNWA 4OFWA 1QOPB 1PDOA 4BE4A 3KQMA 5L6LB 1GUDA 3L1HA 5EHQA 5KQSA 5HIKA 2GJSA 1GV1A 4N54A 3V7WA 2UZ1A 3AGPA 4RVFA 3ER6A 1A9ZA 2HNKA 1F60A 4Q4DA 1KL7A 2QYOA 4AIRA 5AVSA 4N5NA 2MMGA 4B6SA 3ADBA 1BSVA 1MW3A 1XDZA 2AFHB 4G5SA 1R0ZA 1WG8A 4DLXA 4DLZA 4F06A 3HVRA 1ZBDA 1JB1A 1RC1A 3DFIA 3WA6A 3JQFC 1CTQA 1PWZA 2CVZA 2QLBA 3LXMA 4Q34A 4MWTA 1NVEA 1G7RA 3GJ4A 2J32A 4WZBA 2HGSA 5KVSA 2BGGA 4E1BA 1U4SA 1J4AA 2Q0XA 1FX0A 1RLTA 4K9RA 2G3YA 4YJHA 4D6YA 2W4QA 5F1OA 1M0WA 3D81A 1SULA 1K06A 4YCDA 4YAGA 1NI3A 4ZPXA 5JD4A 3I04A 1R6VA 2PL9A 4NZMA 2A9JA 4L72A 4TXJA 4UVEA 1Q14A 1IJFA 3NWOA 4NL4H 4BNUA 3TGLA 1SC9A 2QAGB 3NEYA 1VSVA 5K6RA 2J85A 3PRYA 4FGKA 4KAAA 4IM7A 5EVCA 5CT6A 2P9HA 4PR0A 2R2GA 4NMMA 3RVOA 2KW5A 2J3IA 3BBLA 2A3RA 3NRBA 3UH0A 3ZVNA 3W4JA 3TLGB 3VBCA 4OXNA 5U9CA 3OMLA 4K3UA 2R85A 1FTGA 4OMCA 4BFYA 4FYHA 5JAPA 1EVEA 2Z5VA 3GFOA 3P2IA 1YRAA 3MFQA 4A10A 4EY7A 2PX3A 1SXHA 4YGYA 3GDFA 3PG5A 1TT7A 1YJBA 2P41A 3AZOA 3O1LA 2Q1XA 4C1NA 2ROQA 1I2CA 1NMQA 5EE1A 3U49A 1D1QA 1KI9A 3D7MA 2DFPA 3OCJA 5IJ9B 4MIKA 5KNCH 2GN8A 5HZHA 4KE9A 3ND9A 3RVKA 2IH2A 2EBFX 3KT0A 3GCZA 1K8YB 3F73A 4KN9S 2NTVA 2XT0A 1GKKA 1QIMA 2WJWA 4QL3A 4ZO9A 3ZI4A 4DR5B 4IDPA 3MGCA 2V1UA 2EJWA 1Q50A 1T4BA 3BJMA 4O59O 4ZU1X 3TD9A 3ETEA 4E5UA 5KKCA 4QGFA 2ZROA 2VJOA 3T4PA 3H16A 4EUHA 2YHIA 1VKHA 3CX7A 4GPZA 2RBEA 5ALQA 1MABB 1YA4A 1O87A 2NVWA 3OZWA 3TQQA 4BE7B 4LHYA 1VMIA 1E2HA 4AR1A 1P6QA 3E4CA 1KBOA 4IJWA 4W6ZA 1YA8A 1JG1A 4RCZA 3VVCA 2NZVG 3GEPA 2B92A 4P32A 5MN6A 2FWMX 3B2XA 2R6AA 3KQKA 1ZWLA 2I9KA 3ORSA 2E82A 4G4IA 3P7MA 3LWBA 3FFTA 1OBVA 1RZUA 1YHZA 3CCFA 1FCJA 1L7EA 1G4UR 3HN7A 3OQNA 3I23A 4HEHA 4ARZA 1W49A 4WVFA 1N2GA 5ESRA 2YN4A 1AUQA 4Q1VA 3UKJA 2Y0DA 4YUWA 5HDBB 5TNXA 1T1GA 4N65A 4K6HA 4RMIA 4EEXA 3DMHA 4F2GA 1OWLA 1WB4A 1PL7A 1QQ7A 2WWGA 3LGSA 3FTUA 4ANFA 3JPYA 4TL6A 1FX1A 2WBLC 5T57A 2OLEA 1CDEA 3SCZA 3GB9A 1RQNA 4R2JA 4XMVA 2PUWA 3O21A 1ESEA 3O5AA 2WM8A 1TUBA 2FEOA 5AOVA 4A2PA 3TCKA 4ZEXA 2XD9A 3FMIA 1QGUB 2RB5A 3KG2A 3OBIA 4J8PA 1E62A 1WXQA 5HIMA 2W0SA 3A3NA 3BK1A 2GDZA 5AUOB 3AOGA 1W5TA 3CU5A 3E7PA 3MHTA 1X19A 2Z83A 3CNQS 3O8DA 4K9SA 4MTLA 2KHZA 1X9HA 1NN3A 1PV1A 3TS1A 5AW1A 2P9YA 3RJMA 4B7ZA 1DPGA 2YV1A 4RY0A 1GCOA 1N6KA 2V1XA 1O57A 1QYXA 3TAHA 3AY6A 1ZHOA 2XQFA 5FYDA 1QTIA 1BMTA 2ECOA 3RGGA 5JZVA 1SCJA 1MHTA 3A3KA 4TSFD 2VJPA 2GN1A 3KUXA 5HZMA 3RO7A 3IXLA 4Q4HA 4UBOA 4KJXA 2NUAB 4ZYVA 5GWXA 4OXIA 4JBWA