4ZQHA

Crystal structure of dox-p reductoisomerase in complex with nadph, fosmidomycin and magnesium
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
total genus 149
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqhA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqhA01
3W6UA 3E03A 3Q9UA 1ZZEA 2CDCA 4ALKA 3GZ4A 5KTKA 2EKQA 1J4AA 3DBLA 5IN4A 4B3HA 2G17A 3HDJA 4PG4A 1WW8A 3E5RA 3RJ9A 1MA0A 2WD7A 5EIOA 3EAGA 1CETA 1LDNA 4WOJA 3GHYA 2CF5A 4UVHA 5LCXA 1Y5MA 4XD2A 3UUWA 1JGIA 4LW8A 3GMDA 4CLRA 5FWNA 3UHAA 2BLLA 4HX5A 4JJIA 4MKZA 1ISGA 2O4CA 4PVCA 1U3TA 3MOIA 4RLSA 2NNLD 3F47A 4UUPA 1G1AA 5HM8A 1VLLA 3A4VA 1U3VA 1GDHA 5JS6A 2BH9A 2VQ3A 4ZA2A 3KOUA 1CERA 3I5MA 2NQTA 4BO8A 4RZIA 1B2LA 4BNTA 1NTOA 3BA1A 3MWEB 1E7WA 3SXPA 3DBLB 1E3SA 3L4BC 1LDYA 3RUFA 1EQ2A 1Y7TA 3BMNA 1KERA 2C0CA 1D1TA 2WD7B 3INRA 2C29D 3Q2KA 3UKOA 2FZWA 2GNAA 4GKVA 1DLIA 5T8KA 4BGVA 4NPCA 4RF2A 4EZBA 2E6UX 4CM4A 3N7UA 4W99A 1E3LA 1SCUA 2AG8A 2J3JA 2J3HA 3DAFA 3VDQA 4CLRB 4I5FA 4TRRA 5IF3A 4H7PA 4JLWA 1EBUA 2XPCA 4GGOA 2X23A 1VJ1A 4NK4A 3T7EA 3CXRA 1YKFA 3ZHBA 5GY7A 1YE3A 5TQVA 3S2FA 4BNZA 4GX1A 3ZN2A 2YHUA 3F5SA 1NQAO 3GLQA 2HK7A 3JYOA 3Q3CA 4Y9DA 1NM5A 3BTSA 3U4IA 5ENVA 1L1FA 4CQMA 5C7IO 2PY6A 3JQDA 2O4UX 1SEVA 3IDSA 3BMNB 3RI3A 4Z9YA 3L6OO 4PLYA 3QWIA 4DA9A 2HSDA 4IINA 3RUIA 3CSDA 3KEOA 1EK6A 1T1RA 3IKVA 4OKNA 5IG2A 2YFHA 5DDIP 5AVOA 5A05A 1EE9A 2ZB8A 3RFXA 1P1HA 4CM4B 1XSEA 3H5RA 4TKMA 4EW6A 2X22A 1Z74A 4OGWA 4UUOA 4PG8A 3D5TA 4J0EA 5L95A 4WUVA 3TFOA 1RYDA 4A7PA 5DZSA 1OR7A 5HWSA 3FHLA 5AXCA 1DIHA 5JCJD 1N1EA 2ZB7A 4YACA 2I6TA 1T24A 1Y81A 2NVWA 4XGNA 4CQMB 3SC4A 4PGFA 3PWZA 3SEFA 1GYRA 5KNLA 3WG9A 4BGIA 1GEGA 5F1PA 2VWQA 4D44A 2EIHA 3OETA 3F5QA 1CRWG 3EZLA 2X0NA 3DZIA 4RV9A 2EHDA 4I5DA 1B14A 3FR8A 3T4EA 1XU7A 5L4LA 4BO4A 3OHSX 1V35A 1U3UA 3TZKA 1NQTA 1HE5A 3RKUA 3RUEA 4J2OA 4GI2A 4BGUA 5JYDA 2D59A 2OP0A 4N18A 2YV2A 1MB4A 2PZLA 2AEJA 5DCYA 2PKQO 3UCFA 1DLJA 2IDZA 1F14A 2G0TA 8LDHA 4YAIA 4F46A 5IZCC 3M2PA 4YAEA 4URFA 3B1FA 2Q1UA 3ENKA 3PEFA 2R00A 5HS6A 2OGUA 2Q2VA 3P19A 3AUUA 2DBQA 5JDIA 2AEMA 4CMHA 1NPDA 1OI7A 1ORRA 1SAYA 4JX8A 2VHYA 3NDIA 1ZH8A 5COBA 3WIDA 3PGJA 2PLAA 2C20A 4G2NA 4LRSB 3ROPA 5F3RA 4QXMA 3CZEA 1LXCA 1YQGA 1DAPA 1Y6JA 3AOEA 3ASUA 3CMMA 3FNGA 3UH1A 3DO5A 5EESA 2B69A 2R6JA 1XWFA 2A9FA 1VL0A 2FPIA 3KRTA 3GRKA 3O4RA 4OXKA 3JQBC 3LF1A 4NJMA 2P5UA 3TL2A 1V3TA 4JN6B 2FPPA 5IDWA 4IJUA 4U7WA 1YL5A 2GN6A 4Q3DA 3ZU4A 4ZHSA 3KTDA 3ZCXA 4BB5A 2RH8A 2O3QA 2WE8A 2GZ2A 4CMCA 3SLKA 3V2HA 4U8GA 4F3YA 1IL0A 2GRAA 3AM4A 3DZHA 3IOYA 2WPGA 4N54A 3K8ZA 2DBRA 4E5KA 5HRUA 3JYQA 3L6EA 2YYYA 3PVZA 3E9QA 4C7KA 3QP9A 4BQRA 1Z82A 1XQ1A 2C7GA 2GF2A 3INTA 2WEKA 3K9QO 2WYUA 1H5QA 1MG0A 4O6VA 3QVXA 4IXWA 4PG7A 5ENDA 1EE2A 1UXHA 4J1QA 4NJMB 3UW3A 4C4OA 1TVEA 5IFLA 3ABIA 4KUEA 3UERA 4NZ9A 3D4OA 2ZTUA 5F21A 5JY1A 1E7SA 3UXYA 5L4SA 3N58A 1YL6A 4CLDA 4AVYA 2Z1MA 4ZQHA 1BG6A 1IHXA 2JD0A 2NWQA 1QXSA 4EYEA 4FC6A 1HDXA 1LDGA 1JG9A 4CUJA 3MJSA 3QV1A 4MDHA 3GPIA 4PIVA 2V6FA 3FPLA 2POQX 4CM8A 3MJCA 4KTTE 1B8UA 4CPDA 3DZGA 5HBRA 2X0IA 2AQ8A 3AY6A 4BNUA 1K0UA 1T4BA 3PXXA 3A06A 1XHLA 1LQUA 2WM3A 3OEYA 5EPOA 1NR1A 2HMVA 4PLFA 2DAPA 1BWSA 3DBRA 3JQAD 3P2YA 4B3IA 3NV9A 1LSSA 1QV7A 4H3VA 3RU7A 4CM6A 5KKAA 4R9SA 1HLPA 2I3GA 3CZMA 1ZMTA 3ROQA 1LLUA 2D5AA 3WJ7A 5EJ2A 4DUPA 1B7GO 3DAPA 3MEQA 2Y05A 3DOJA 1L7DA 4CMBA 1LEHA 1X0VA 4CM8B 5GZ1A 4CMAA 3OMLA 4OHUA 4EJ6A 3OH8A 3PQDA 2EW2A 4YRBA 1ZK1A 1I36A 3WQRA 4NBRA 2D2IA 2PKRA 4WASA 3LU1A 3DOOA 1R4NA 3W1VA 3E6AA 4DMMA 4IDFA 5G0TA 1NYTA 1BDMA 2J5RA 1E7YA 3WBBA 3LT4A 4B7CA 1AHHA 3DBRB 2VHVA 4Y6PA 5JC1A 1IOLA 1GYPA 1P1KA 3BTOA 4ALIA 1ID1A 2H6EA 3F46A 4E6PA 2JAHA 4AJPA 4Y6RA 2HRZA 4XYMA 2FZEA 2NTNA 5COQA 5B4UA 3LLSA 1Y8RA 1T2CA 3PJDA 4ZD6A 1R66A 1FDUA 1NVTA 3NT4A 2X7HA 2ZATA 4WCFA 3QA9A 3QW2A 2RIRA 3HDHA 1N92A 4KTVE 4HFNA 2C82A 1PJ4A 3VZPA 2FPGA 3QVSA 1R4NB 3NUGA 3VZQA 4QFDA 2CDBA 1Y1PA 2NADA 1EFLA 4IDDA 3HE3A 4FB5A 2FHSA 3B6ZA 2VNSA 2W2LD 2YV3A 4BV8A 4II2A 4U0JA 4YR9A 5G0UA 3O8QA 3W8EA 5ADHA 1AN9A 5L7YA 1GCUA 5T5QA 5A9TA 1YOVA 1PL6A 2X9NA 1NASA 1W8DA 3ANNA 1Y8RB 4XA8A 2ZTMA 4FIZA 4TSKA 5JMPA 3WLFA 4WCFB 1P74A 4FDAA 3PRJA 5CPBA 1JW9B 2AXQA 4RO0A 7MDHA 1WDKA 4L76A 5A04A 3GEDA 3I4FA 1BRMA 4MIOA 1GL3A 3F4BA 5DOVA 4D3SA 4PG6A 5JAMA 4OIMA 3GUYA 2G5CA 1LU9A 3HNPA 5I7FA 1KVTA 4PLHA 2HU2A 2EJWA 1KEWA 3O8QB 5IJZA 4TRJA 3SBOA 1LI4A 4MVJD 3K5PA 4QSMA 1YOVB 2IE0A 3WOHA 1NP3A 4R1NA 2BKAA 3GDOA 1DC3A 1X7GA 1WWKA 2PH3A 4XDYA 4YQZA 2VHZA 3ZU3A 2CZCA 4O5OA 3GVPA 1DBVO 1GFSA 2VOJA 2VYNA 3R3SA 4BO2A 1HLDA 3RBZA 4E3ZA 5CDYA 3VTZA 4G65A 3N74A 4BO7A 1Q7GA 1ONPA 4ITUA 3U4DA 1JKJA 1NWHA 1R0SA 1IB6A 3EHEA 2VZ9A 4OYRA 4ZRNA 3IUPA 3QVOA 3EUWA 3LK7A 3IJPA 1TB4A 4DLAA 1AUPA 1LLQA 4YAJA 3ZGYA 2B0JA 3ZV4A 4I5GA 4IMRA 4XJSA 5CP8A 3D7LA 4OL9A 1M6HA 1K6XA 3H5NA 1DIGA 1JAXA 3Q2IA 2BI8A 3UCEA 3DOCA 1E0DA 3UAGA 3SVTA 2ZQYA 1ADFA 2HO5A 3LC2O 1DOHA 3LVFO 3UOGA 2YY7A 3FNEA 4QTZA 2HMTA 4ZQFA 1UXGA 4R69A 3BMCA 1ULSA 3D3EA 2FR1A 1KBZA 2GN9A 2WYWA 1BXZA 4NG5A 4XRGA 3M2TA 2RH4A 2VRBA 3JQFC 2X9VA 2VWPA 1W0CA 3EC7A 2VT2A 1H9BA 2D5CA 4D45A 4IZIA 3I52A 3SLGA 4NH4A 1LC0A 4L74A 3ETEA 3WTBA 1HEUA 1KC1A 1HDZA 3RFTA 5G4KA 4M8SA 4YB8A 4DBZA 3M1LA 3LZ6A 3ONEA 4NFHA 3FSRA 1ZUD1 2WYVA 4RLHA 2BMAA 1K5HA 2BFMA 4S1VA 5CEJA 1MFPA 3PWKA 4DMLA 1XDWA 1DC4A 3KBOA 4AJEA 5ICMA 1YB4A 4LVUA 1V3UA 5H83A 5TRTA 5AXAA 5KJEA 3GC6A 4BVAA 3JTMA 3BMCB 1LSUA 3RD5A 1F17A 4FFMA 4ILKA 1N2SA 4BNLA 5CPFA 4EJ0A 2G82A 4DLLA 3K92A 2QRJA 1DSSG 4LK3A 2B4RO 2O3SA 5B37A 3KSZO 2QIOA 4R51A 4YJFA 4FOOA 4YRDA 2QZ9A 3I4CA 4BKUA 2D1YA 3DZKA 3WFJA 5G4KB 1PQWA 3TNLA 4D43A 2IXBA 4GAEA 1SC5A 2VTDA 1JWBB 2Q4EA 1DPGA 4NIMA 5CG2A 4HNGA 3VKVA 4LISA 3IAHA 4R3NA 1QSGA 4M87A 1PQPA 2H9IA 2X0RA 1PJBA 5KJ6A 3HFGA 4IMPA 2Z5LA 3GGPA 4MIEA 4EUFA 3GDGA 4GKBA 1QKIA 1KETA 4N5LA 4YT5A 3K2EA 5TSDA 1UAGA 4MVJF 2NSDA 3NT2A 2FN7A 1PL7A 3S2EA 3RASA 5JDCA 4Q3BA 1WDMA 4CMKA 3R0IA 3OICA 3BMQA 5CDTA 3GK3A 1QYXA 2VRCD 3W4KA 1H93A 3JD3A 2PGJA 3HB4X 1GAEO 5CDUA 3FN4A 1DHRA 4YJFB 4K6CA 2O50A 1LUAA 4D42A 2PR2A 3D64A 4J9UE 2O7SA 2Y0CA 3OIGA 3ENNA 5H81A 1HXHA 1WNTA 4Q3NA 4RVUA 1KEVA 1R15A 5T57A 4IBOA 2IYPA 4ALNA 1ZK3A 4R1TA 3ETGA 1BDBA 2XXJA 3F1LA 4UVEA 5L45A 1XEAA 4O1MA 4FLRA 4J4BA 3R3JA 4DPLA 4HXYA 5A4DA 1DC6A 4P8RA 4PLCA 4YA6A 2AA3A 2Q1WA 1PGOA 9LDTA 4KQWA 4L9RA 3V2UA 4B8WA 2DTDA 3BMQB 3VPSA 3MZ0A 4KUGA 3GNSA 1JLLA 1C1XA 5T64A 3ZWPA 1GADO 2NACA 4WLNA 3JQ9A 1PJSA 3KV3O 5K6AA 4IZHA 4RVHA 4I9UA 3S2GA 3UN1A 5I9NA 4NHEA 2C54A 3QJ5A 3IP1A 4GSKA 4XB1A 3BMOA 3I1JA 2D3TA 3GGOA 2W98A 3H9GA 3KM0A 5I8ZA 1XR3A 3H2ZA 1NAIA 6ADHA 1IZ0A 3MCVA 2BELA 1ZXLA 4ZICA 4U6SA 2VN8A 3HUDA 4B4OA 2HJRA 3AU8A 4JROA 4RCVA 4CXFA 4K6FA 4IGFA 3FNFA 3DQPA 3S55A 5JMWA 1JAYA 5A1TA 2O3UA 3ON5A 4RGBA 4DXHA 5ICSA 4RZHA 4HBGA 4XDZA 5DT9A 2NTVA 2H5LA 3OJOA 3OJEA 3G3EA 1C1XB 5JLAA 5JFOA 4FS3A 4OXYA 4ONEA 5I7EA 3CEAA 3ZWNA 1T2DA 2DKNA 5HTOA 1NVMB 4FW8A 1PJ3A 3GOHA 2QG4A 1BXGA 4FLOA 3DXFA 4BNYA 3BMOB 1MW3A 1XU9A 2VHWA 4O0LA 4HUJA 2JJYA 3JQCA 1C1DA 2WMDA 3FCOA 3RQSA 4HY3A 1B16A 4M86A 1PEDA 1Y8QA 3ICPA 2B5VA 3KUXA 1LDBA 2C59A 1DFGA 2LDXA 3PP8A 3QWFA 1X0XA 4J9VA 3ICCA 3I9NA 4UVGA 1HDOA 9LDBA 2TMDA 2Q99A 2Y93A 1GY8A 4XR9A 3ZV5A 1I8TA 2GO1A 3ZW9A 5A03A 1SZJG 1LSOA 5CDSA 1DIAA 1A4IA 1XG5A 1DXYA 1EUZA 4FFNA 3U4CA 5BSEA 1Q0LA 5CAEA 2Y1EA 4GL4A 3WB9A 2HRBA 4YXFA 1BXGB 4OKIA 2W2LA 2VUUA 1YDWA 3WS7A 5MGBA 1LSJA 4YTEA 1P31A 4TRNA 5TNXA 1C1DB 1KVQA 3LF2A 1GUZA 2Q46A 1HSOA 1F8FA 3ZNOA 2W8ZA 1Y8QB 1Y9EA 1SEPA 1PZHA 1U2GA 1TI7A 1SBYA 1Q7CA 3K96A 4KZPA 2DM6A 4XIJA 4EI2A 5FEUA 5ITWA 2NU7A 2Y99A 3VPHA 2ZB3A 2OO5A 1Z45A 3JQGA 1HYEA 3CH6A 2EG9A 2FP4A 5KJCA 5ER6A 2JAPA 1TXGA 3RBVA 4CM5A 4J90A 3WWZA 4LMRA 1LLCA 4RDIA 4IS3A 5F5NA 2C2YA 2X8LA 3ANLA 4FPXA 5DCWA 3D0OA 2AG5A 1E3IA 4B4VA 5MDHA 1S7CA 1YQDA 3JD1A 4E5NA 1R37A 4MVJA 5DN9A 3ZWCA 2DUUA 5EINA 3EZYA 4EEZA 4HP8A 2V7PA 4YEDA 1P1RA 3WGYA 5EN4A 4IQ8A 1IPEA 2IODA 4M55A 5IDYA 2O3RA 3QRWA 5L9AA 3NJ4A 1HYGA 1NQ5A 2P91A 4OMUA 2NVUA 2BFAA 3JQGB 4YVFA 2P9EA 3VTFA 5IXYA 2Y1GA 4II3A 3ADOA 1X7DA 4I08A 3AI1A 1NFFA 1NWCA 4FOSA 5B12A 1DRVA 3INGA 1J49A 4NBUA 3HN7A 3BHMA 5H82A 4ZQGA 2I67A 1EVZA 1PR3A 1V9LA 1MVYA 1T2EA 3GN2A 4J2HA 1BXKA 4NU6A 1HZZA 3DHNA 3U4HA 3WMXA 3AWDA 2BD0A 4DWVA 4ESOA 3T0YA 3GNTA 5K0ZA 4XYBA 1VM6A 3L4BA 4E5YA 4DQUA 4YAGA 3IJRA 4XIYA 2HMUA 5CEEA 4XCVA 4ND2A 4R1UA 3PPIA 4A26A 2NVUB 8ADHA 1HDRA 3KVOA 2ZJ1A 3ANMA 2PZKA 3C1AA 4AJ2A 4M89A 5A02A 1AXGA 2JKVA 3VVBA 2CVOA 2RHCA 1N5DA 2AQKA 4ZRMA 1WVGA 3BHJA 4AJHA 4M1QA 1QYWA 3JQ7A 5FI5A 3TQHA 1QYCA 2OHXA 2SCUA 1P1JA 1HSZA 5JCXA 1FDVA 2BI7A 3NT5A 4CM9A 4Y67A 1E1MA 4GH5A 3RAJA 5I9MA 3OSUA 1G5AA 3GEMA 1ISFA 4BNNA 5A9RA 4MJLA 3ITDA 4MVJH 2QZZA 2RCYA 1I33A 4CMIA 1ZK0A 3VH1A 1RPNA 3GNQA 1E6EA 3L9WA 3PLNA 3GA0A 4RQTA 4ND3A 4OQZA 4E4YA 4Q39A 3BIOA 1ULUA 4RVGA 1OZAA 5I7VA 5TLSA 1VRWA 1A9YA 4R1SA 3WIEA 2I3AA 2BFOA 5A06A 4J1NA 2IZ0A 5L3ZA 3EK2A 1MC5A 2RHRA 3JQ7B 1M76A 1N1GA 3FBTA 4FSHA 4OAQA 3PWSA 4JBHA 4CMEC 3PHHA 2PNFA 4FJ1A 2WE7A 5DF1A 5DBGA 3ADPA 4C7JA 4YQYA 2PZJA 3OIFA 2Q1SA 2J3IA 4U6QA 4CMIB 3DMTC 1H2HA 2CVZA 2IEBA 2E4AA 3KB6A 1SO8A 4NBTA 2FWMX 3GGGA 2OORA 5A3VA 4E2ZA 2YW9A 4XEHA 3BYZA 3DZJA 1T26A 2Y1DA 4HFMA 2GD1O 5DBFA 4JP2A 4BKRA 1X1TA 3WDSA 4CUKA 3ZH2A 5IDXA 4ND5A 1RM4A 3PDUA 1UXKA 2A4KA 4N7RA 1JVBA 5LC1A 3O26A 5IZCA 2H63A 3HWRA 3KETA 1QLJA 4MIYA 3QLJA 4ROSA 4AJJA 4CL8A 2ZYGA 2QYSA 3I3OA 5BT9A 1GZ6A 1VL6A 3IQDB 5IXSA 2P68A 1ML3A 2B5WA 2FRDA 1AXEA 3JYLA 1E6WA 1U3WA 3VPGA 3ZU2A 4Z9FA 4WKGA 1CQJA 3PLRA 4IDAA 4P4LA 4D7AA 2I99A 2P4QA 1PS0A 1EFKA 3ZZNA 2V6MA 4XQGA 1I3LA 2C7VA 1DJNA 2X9GA 1HWYA 4BNMA 5JYEA 1H6AA 5KJ1A 2DUWA 5B1YA 2QW8A 3HSKA 2G1UA 3ITKA 3JQBA 3NDRA 3GVHA 4W4TA 2QYTA 3ZWMA 1OAAA 3OA2A 3I9JA 4XYEA 3G1UA 1BVUA 3WGGA 1CQIA 2EGGA 2EJVA 3BZUA 4NQZA 4H15A 4BL5A 4IDCA 2Q4BA 1CIVA 5FF9A 5CFZA 1OMOA 1WP4A 3AUTA 1VSVA 3NYWA 3ONDA 3QHAA 4YJDA 5AOVA 4W6ZA 1QORA 4EITA 3TF5A 1O8CA 4BMNA 1E1NA 2Y66A 2W2KA 3G1TA 4FFOA 4IJVA 1B3RA 2NU9A 3GRPA 2OZPA 4KUHA 3TFQA 3DB2A 1N8KA 5TX7A 1HL3A 4NI5A 4TRMA 1SMKA 1U4OA 3L9XA 4WPGA 1MX3A 5THKA 5BNTA 4OM8A 4A27A 4H16A 1I3KA 1K6IA 1Y5RA 1XQ6A 1H94A 3H4VA 4AICA 4D0RA 1GD1O 4XRRA 4KOAA 3H2SA 3ZHXA 1ISHA 2HDHA 3L0DA 1E3JA 1YJ8A 2HKIA 4JP3A 1JVSA 2YQ5A 1NPYA 1HZJA 3NDJA 1U7HA 2NLOA 5G0SA 3GG9A 1NHWA 3GVIA 3KSDO 1U8FO 4R4JA 2W2KB 4Z3DA 3I9MA 3MTJA 4WJZA 3Q1LA 1J0XO 4OQYA 3F1KA 4NJOA 4PLPA 3C7AA 4LRTB 4Q9NA 2B35A 3A9WA 3WNQA 1MW0A 4BO6A 1CJCA 3ZV6A 2PD3A 3QVTA 3BAZA 1MGOA 2UV8A 3RU9A 5EQDA 3V5NA 4CV0A 3LQFA 3PJFA 4IDBA 5JC8A 3FNHA 3VH4A 2DT5A 3WX0A 1P44A 1U2DA 2O7QA 1IE3A 4BOYA 1LJ8A 1F8GA 1R12A 4BNVA 2P5YA 1PJTA 2YFQA 2HUNA 4L73A 4MVJG 3KYCA 1MP0A 3I6QA 5FFFA 2Q2QA 4KMSA 2X5KO 3KYDA 1EMDA 2ZB4A 1YBMA 3DDNA 2RAFA 3DMYA 4Z0HO 3PZBA 4OSOA 5G0VA 2YHIA 1EK5A 1UDBA 4RPJA 3WQQA 4KWHA 1YBAA 1NPTO 1NHGA 1H3LA 3WNVA 4BO5A 4K28A 2PK3A 3HDYA 4L8VA 2DPGA 3UVEA 1E77A 3JCZA 4QT0A 1LRLA 4NFSA 4R68A 4XGKA 2E49A 3KXDA 2BRUA 2I76A 3GEGA 4E32A 4F6LA 2NVBA 3C8MA 2XOXA 3VHRA 5JPIA 1ADBA 4FQ8A 3DR3A 3Q6IA 4AJ4A 4JBIA 3ETDA 1YBVA 4CMGA 4BNFA 5C37A 1K3TA 3KYCB 4FBGA 3GT0A 2Q50A 2AEFA 4RPGA 1DFIA 1GQQA 3KYDB 2YUTA 4UUNA 3KHUA 3NTOA 2YZ7A 5GZ3A 1HDYA 2YHIB 3UCXA 1LLDA 5EMHA 1WMAA 1SOVA 2BGMA 4A73A 5ITVA 5LDGA 2LDBA 4W9NC 4OOEA 5JSFA 4IUYA 3P2OA 4UULA 3DHEA 1K2WA 4E5PA 4BGEA 4F45A 3WSVA 2ZCUA 3ROKA 4R3WA 1PGPA 1Q7BA 1LQTA 1E5QA 3U62A 3C85A 3MOGA 4PZDA 1VE9A 4LSMA 2EEZA 2Y0DA 3SC6A 2R2GA 4PRLA 3L77A 1V8BA 1B3BA 2HJSA 3C1OA 2VWHA 5IZ4A 4LUPA 2JD1A 1XYGA 2FSSA 2YDYA 5EERA 1ZSYA 4E2WA 4ND1A 1YRLA 5JCJA 1A27A 3GAFA 3NGXA 3RJ5A 5CEFA 1GZ4A 1I5RA 1DAOA 1ZO8A 3H65A 2VZ8A 4DRYA 3VVCA 2Y1FA 4J0FA 1AGNA 1WAMA 2F00A 1ZW1A 4L0QA 1HETA 4CUZA 3IC5A 1NX6A 2A92A 2YJZA 4UEKA 1TT5A 3HHPA 2HK8A 4CQMD 1Z7BA 1PU2A 2ZJ0A 5A5FA 2QRKA 3CIFA 1PGQA 1LBEA 1Z73A 2CFCA 1M75A 2B83A 1E1LA 4PN3A 4A03A 1C0LA 1OFGA 2JHFA 2GN8A 2UUOA 1WZEA 4UVDA 4Q3CA 1OOEA 1Z6ZA 4FD3A 4PLTA 1ZBQA 5DULA 1HE4A 1FXSA 1NXQA 1QLHA 1ZNQO 2CMDA 1MFZA 1ZEJA 3PIIA 3JD4A 4J43A 4MOWA 5AQ1A 4WLVA 3UEQA 3TZCA 2I65A 3TZQA 3G79A 1QYDA 4ZN6A 3DZFA 4WEQA 1JTVA 3WGIA 2CNBA 1N7GA 2BHLA 4B7XA 1BMDA 1UH5A 5CHEA 1TT5B 1ZFNA 4LCEA 4RVDA 3PQFA 1YO6A 5C3MA 3WR5A 5I8WA 3M1AA 4RF3A 2WDZA 3LYLA 1DC5A 1YB1A 1IUKA 3JQFA 4J7XA 3UF0A 5TGDA 2A35A 3QWAA 3EMKA 1TEHA 3ZWAA 4J49A 3NTRA 4D79A 3H9JA 1I3NA 2FR0A 3LT0A 4R54A 3W8FA 3IKTA 4I9NA 3D3WA 2VOEA 1ONOA 1T2FA 4PZCA 3I9LA 2DBZA 3ASVA 3ZDFA 2DC1A 4DIOA 3KYBA 1QP8A 1FJHA 4DREA 3B20A 4GMGA 2GLXA 4P22A 4NBWA 1O6ZA 1GTMA 2FR8A 4HWKA 3DAGA 1R4MA 4EJMA 1ZSVA 1CDOA 3C24A 3NKLA 4JK3A 3SJUA 3WJAA 1UXJA 3RFVA 4IY1A 3MWDB 4CM7A 1U1IA 2WWRA 1QMGA 3K31A 4QECA 3FWZA 1YXMA 1LDMA 5IN5A 3VDRA 1BTOA 2ZTVA 3WWYA 1YS4A 3EW7A 1E92A 1UP7A 3D3WB 4WOKA 1D8AA 1DFHA 3GFBA 3ULKA 1BSVA 5TC4A 3U0BA 1VSUA 1U5CA 2CSUA 2XXBA 3V8BA 5C5IA 3RCBA 3D4PA 4GX5A 3RUDA 1R4MB 3DC2A 3H9UA 3K30A 2ILTA 3RC7A 4XZ3A 1ENYA 5DOZA 2XAAA 3CINA 3F9IA 1NAHA 2O3JA 4CL3A 4CJXA 4HFJA 3JQEA 5G0WA 4TZTA 4IS2A 1B0AA 3FPCA 3DZBA 3C7DB 1NQOA 2BFPA 5GMOA 1D1SA 4J7CA 5BSFA 1AE1A 4WLUA 4DGSA 3JQAA 3WGOA 5JXWA 3O03A 3R1IA 4A10A 3PYXA 3GDFA 2V6GA 3I9KA 3QQPA 1KEUA 5HA5A 5A3JA 1JQBA 2PKQP 4WCDA 3VZRA 2D0IA 1T2AA 4UREA 4CMJA 2AW5A 4IXTA 4DYVA 1N9GA 3TSCA 3JV7A 4YYZA 1MW2A 2JCVA 1KYQA 2HMWA 1I24A 3IMFA 1EVJA 4OOFA 3EVTA 1R6DA 2DTXA 2Z1NA 3VC7A 1O94A 4WK6A 3TRIA 4EUEA 4IGEA 4CV1A 3DFUA 4HKTA 3D4NA 3CZLA 3VH2A 2I5PO 4GLLA 1WXDA 5L40A 1P0FA 4OO3A 3VAZA 4W82A 2P4HX 2JFFA 4CR7A 3JQAB 2C5EA 3DONA 3HDQA 4FGSA 3GY0A 5TJ9A 2XF8A 4RORA 3OQ1A 1IY8A 3GH3A 4YPOA 4CLOA 4P38A 1SNYA 3KO8A 1SB8A 1E3WA 3Q11A 3OQBA 4UEOA 3GN1A 1ZVMA 5F1OA 3D5QA 4IPTA 2X5JO 4QQRA 1HTBA 3W8DA 1N9GB 3X2FA 3H5AA 1KOLA 4D41A 1YB5A 4DTIA 1NNUA 4FCCA 1NBOA 2DU8A 2E48A 3KSUA 4Z3KA 2E82A 1EUDA 5LDHA 4J3FA 1JA9A 1XGKA 5K9ZA 4RF5A 1CYDA 3U09A 1QG6A 4YDRA 3UCQA 4RDHA 4QEDA 4KDEA 5A5EA 1EQUA 1O9BA 1H2BA 3PZRA 5EL0A 1TLTA 4CLXA 4MVJI 4QX6A 3EGOA 4IJWA 1UP4A 4L4RA 3RUHA 5JO9A 2PGDA 3WGTA 4CLOB 4DYDA 1JKFA 4AL4A 1S46A 2NV6A 3VPXA 1E3WB 3JQ8A 1IZ9A 1W73A 2NTJA 3C7CB 4CLHA 3E8XA 5BQFA 4BNKA 2Y0EA 3RSHA 3TL3A 3TZHA 1PJLA 3W4JA 3E82A 1A5ZA 3DFZA 4GGPA 4OSPA 1ZK4A 4GLOA 5ES3A 2HAEA 4KDFA 4HADA 5EQFA 3RROA 4YT4A 5T8KC 4KP7A 3WFIA 3TDKA 1UZLA 1M6WA 1YQXA 1IHYA 1PZGA 3QWBA 1MXFA 4ND4A 1KS9A 1DIBA 3DTTA 3PK0A 2YV1A 1GUFA 1N7HA 1TT7A 3C1TA 4Z6KA 5AXBA 1O95A 4E12A 3JQ8B 4I5EA 1K89A 3JSAA 4Y98A 2RBEA 1UP6A 4FLSA 4RVSA 3AUAA 3RUAA 4DC1A 2DBVO 4DVJA 4ZJUA 3GMSA 4B4WA 4BO0A 2FY8A 2QQ5A 3LC1O 3LT1A 4MVJM 3OM9A 5TT0A 3M6IA 3NTQA 3PGXA 1EUCA 5U9CA 1U9JA 2EKPA 4GVLA 4PLZA 3UFXA 4FC7A 1X7HA 3MJTA 3OEWA 4Y8VA 3E5MA 1P77A 4K9DA 3DEYX 4DQVA 2X86A 3S8MA 4RVFA 1HF3A 2O48X 1R0LA 2EERA 3GUCA 1D3AA 1Q0QA 4D3DA 4AJOA 1DRUA 3F6YA 1RP3A 3GAZA 1PTJA 2WSBA 3ZWWA 3OFSA 3AM3A 3UGKA 1TA4A 1E7MA 3ZWYA 4YAKA 2VHXA 2ZCVA 4RPHA 4XX0A 2JCXA 4XKJA 3WBFA 2D8AA 4UVIA 4DIFA 2MAPA 1ADGA 2HMSA 4LGVA 4YT2A 5KVVA 4E21A 1A7AA 4RL6A 3X2EA 4WNIA 4KWIA 6LDHA 2VYND 4CR8A 4YWJA 3RIHA 5FI3A 4BNJA 4DPKA 4ZVVA 3PI7A 3PHJA 3QWHA 5TS3A 2OXIA 1JWAB 3R6DA 2IZZA 2HLPA 4TMFA 1UDAA 2AHRA 4DBVO 3HN2A 1R0KA 3MJ4A 3KLPX 3VPFA 3ZU5A 4DC0A 4E5MA 1GZ3A 1FDSA 1P45A 1PZFA 4IJKA 4BNHA 3OA0A 1DJQA 1L7EA 2GERA 2GPTA 3RC9A 3DL2A 4GPD1 2R00C 3WTCA 5B4VA 2B37A 2ZIZA 2IXAA 3DWFA 3IIEA 3L4SO 4HFRA 4TZKA 3LSYA 2JHGA 4B79A 3ROMA 5JDIC 3VOSA 1ZEMA 4NU5A 2Q45A 1VKNA 1ZJYA 2O7GA 4OXNA 2Y67A 3I83A 4CV2A 2DLDA 1ZSNA 4P4GA 1GV0A 1MC4A 3HFSA 4YBZA 1WZIA 2PZMA 2ZQZA 2YQ4A 1WMBA 1WDLA 4JNKA 3FI9A 1GQ2A 1UJMA 3AOEC 4LVCA 1I10A 3EDMA 5JE8A 4CODB 1XKQA 3HQ4O 4P4NA 2AE1A 4EEXA 2NM0A 1PWXA 4YJGA 3FBGA 1OBFO 3H9EO 4RPLA 4DL9A 2HQ1A 1SB9A 4PLWA 4WLFA 4W7HA 3T7CA 2OFPA 2B36A 1GUYA 2BF7A 3ZHZA 1M2WA 2X58A 1I2BA 1H0KA 1O0SA 1ISJA 3QE3A 4G5HA 3LDHA 4MINA 4PLVA 3W4IA 3WYCA 1C0IA 4WGGA 5L7TA 1UXIA 1WPQA 5I9LA 1B15A 1E3EA 1OC2A 3VZSA 4FFRA 3CTMA 5KJFA 1JKIA 2FOIA 4BIIA 1BW9A 2VRCA 4QFCA 4GBJA 2DVMA 4JJGA 1ZK2A 3TOXA 2C5AA 1P1IA 4FGWA 3G17A 3GR6A 5U1PA 2F1KA 5DBIA 1H6CA 3I9OA 4XQ9A 3UICA 1PIWA 3IUSA 4YJGB 1Q1NA 3QVWA 4ZU3A 1M67A 2J6IA 3WSWA 4ALMA 4CM1A 3ORFA 3FF4A 4BNIA 2EP7A 4D3FA 2MAOA 3PYLA 4CMEA 3FTNA 1EEHA 1V6AA 2EWMA 1C0PA 4MVJE 2HK9A 3PJEA 2DTEA 2ET6A 4U0KA 5BSGA 1KEPA 1GYQA 1YONA 1P33A 1M66A 1MLDA 4B8ZA 1VKOA 3JYNA 2GASA 1E7QA 1XCBA 3TOZA 1LC3A 1IPFA 1BW9B 1QV6A 2ZKLA 3DMTA 4YJHA 3S1LA 2O2SA 4OJNA 1ENOA 1GEEA 1J5PA 1VPDA 1ZMOA 3QIVA 2DFDA 2UYYA 2AQHA 4OH1A 3AI2A 3I6IA 4NR0A 4RJTA 5KOIA 3ONFA 2V65A 3IP3A 2YDXA 2VZ0A 1S6YA 1XELA 3JYPA 3DTYA 1PS9A 4WNCA 1G6KA 3HG7A 4QO8A 5ILOA 3B1JA 1E7RA 5F1KA 3ZV3A 1DRWA 1D7OA 5J23A 5THQA 1CWUA 2QX7A 4LMPA 3E48A 4PVDA 2AQIA 3AUSA 1FDTA 3IS3A 1ARZA 2VCYA 4INAA 4FR5A 1Q0HA 5BNIA 3PTZA 4E13A 1ZJZA 1FF9A 2O2YA 3A1NA 4YJHB 4IQ0A 4LCJA 5KVQA 3WGZA 4BNWA 4AJKA 2EF1A 4DIBA 2EXXA 3PYMA 1KC3A 3ZWOA 2IYOA 3Q0EA 1NVGA 3V1TC 2X4GA 3H9QA 3V2GA 2B4QA 2GGSA 2W90A 3BHIA 3NAQA 1MV8A 1YWGO 3L07A 1D4FA 4M54A 4PRKA 4ID9A 4JCOA 5KCZA 1MG5A 3RC2A 3C3XA 5COAA 2EKLA 3PHGA 4IDGA 3PFFA 3U49A 3AI3A 2P2SA 4BUCA 3AJRA 3B1KA 3K2BA 4EBFA 1I2CA 1P1FA 1LDEA 2VYVD 5DNAA 2FSVA 1FK8A 5DP1A 2BGKA 1KY5A 4FLQA 5AYVA 4YCAA 2OBNA 3OJFA 3CE6A 4D0SA 1JN0A 1KVRA 4DLBA 1E6UA 4R01A 5G4LA 4ALJA 2PWZA 4WCFC 3BTVA 1KVSA 1I01A 1LRJA 1V3VA 1HDGO 4XGIA 1GR0A 1T1SA 1BGVA 4R16A 1A72A 1PR9A 4FFPA 1KVUA 3EVNA 1VJ0A 4GWGA 3PJGA 2UVDA 1UAYA 2PFGA 2X6TA 1ISIA 4BMVA 1C3VA 3E9NA 2GYYA 3GZNA 5TT1A 5L4NA 4NNJA 4XQCA 1RJWA 2C2XA 3GG2A 3FRJA 1PJ2A 2W4QA 3GQVA 2GDZA 2H1SA 4MKXA 3HJAA 4BO9A 3AU9A 1FMCA 2ZK7A 3OIDA 4Y6SA 3VKUA 4LSWA 4EUHA 5ILGA 4R41A 1GU7A 4R9RA 3WGHA 1P3DA 4I9HA 4TVBA 3ZNNA 1VJTA 1YVEI 2OP1A 5JW6A 4TKLA 3H7AA 2CF6A 4J1TA 1BHSA 4UUMA 5CG1A 3PQEA 2UDPA 3NGLA 3O9ZA 1ENPA 4JIGA 2P9GA 4A2CA 3U5TA 5JBIA 1CF2O 3EY4A 1HDCA 3GPDG 3GZNB 4LN1A 3GF4A 3BXXA 2NQ8A 4M49A 3Q9NA 5KKCA 1KY4A 2VUSA 2PD6A 5T6BA 1CEQA 1RKXA 1R16A 4L75A 2I9PA 4XQEA 2CD9A 2VNAA 2Y1CA 3F4LA 4NQWA 2ZYAA 4FJ0A 2O23A 3WMWA 2PD4A 5AXDA 4MPDA 4RPKA 1LRKA 2V6BA 1ZS2A 1I30A 4UEJA 1EZ4A 3WYEA 3RUCA 7ADHA 2IRWA 5C7LO 3L6DA 1ZCJA 5HS4A 3KEQA 1T4DA 3VH3A 3V1UA 4JJFA 3W6ZA 1MW1A 1RM3A 3CZKA 1B26A 2EW8A 3MJVA 1U8XX 5FYDA 1X15A 3FWNA 3T4XA 4IIUA 3ZNQA 3ZWBA 4IDEA 3LC7O 3GVCA 1C14A 2GSDA 2C07A 4RQUA 3GHHA 1GPJA 4XB2A 4BHTA 5JAQA 3B70A 5JAIA 5I7SA 1B8VA 3F3SA 4FN4A 4BO3A 4Q3EA 1SOWA 2WTBA 1F06A 4Z0TA 1EDOA 2PGLA 2Q3EA 1O5IA 5BSHA 5C7OO 1HE3A 3K73O 4N5NA 1E1KA 3S2IA 5T67A 1YL7A 5JAZA 1QR6A 1IULA 1YJQA 4J1SA 4PCVA 4FFLA 3CMCO 2BGLA 1I2ZA 4BKPA 1HE2A 1YGYA 3AFMA 3OJ0A 4HNHA 3DHYA 3ST7A 1KIFA 1GQYA 1F0YA 3P7MA 2OUIA 3U3XA 1PQUA 2NUAA 5KVCA 4UAGA 1RWBA 2VWGA 3OP4A 1SPXA 3TWOA 4J6FA 2OOSA 1B8PA 1ONNA 2DPHA 4QUKA 3WYBA 5JY6A 3I23A 1QYVA 4BS9A 1A9ZA 4EGFA 2GCGA 3H8VA 5KWEA 4W9NA 4ZQBA 4Z9XA 1Q2XA 1A7KA 1XIVA 4WLOA 4B7UA 4NBVA 3ZNPA 3E9MA 4G81A 1LTHR 4AFNA 2PV7A 1W6UA 4BKQA 2VUTA 4E33A 3G0OA 4BO1A 3CUKA 3NX4A 3A14A 1UZMA 1Z7EA 3JD2A 4X54A 4E30A 3CPSA 4MO2A 1H9AA 1OC4A 3K6JA 1J6UA 3RC1A 1GCOA 1C0KA 3RKRA 5A9SA 3FR7A 1JDJA 1X13A 4K1LA 4JGBA 1PJCA 2DFVA 4EDFA 3KZVA 1AHIA 1RYEA 4JQCA 4O59O 2Z95A 4L4SA 3PIDA 1XA0A 4BQPA 4O63O 1YDEA 5JO0A 4BB6A 1VL8A 3H6KA 1XLTA 5JNLA 1V0JA 1HRDA 2ZYDA 1RM5A 3RVDA 2GZ1A 1Y9AA 5GZ6A 3E18A 4PZEA 1U4SA 2UUPA 4AJNA 4PFJA 2JFHA 1UR5A 2D4AA 3OF2A 3LLVA 1P0CA 4J91A 4CM9D 1VC2A 1DIRA 2DQ4A 3OQ6A 2VT3A 4GVXA 3TN7A 1PGJA 4K26A 4A0SA 5JDCC 4I8XA 5TF4A 4E0BA 4D46A 2WJPA 4R5MA 1LX6A 1P9LA 4MP8A 5A9SB 3NEPX 3ZW8A 4ZQEA 1EVYA 5KIAA 4A5OA 4DQXA 2Y1OA 4WE3A 4IM7A 5U4QA 4GWKA 2TMGA 3NJ8A 3CKYA 1NFQA 3V1YA 5DP2A 1UZNA 4AG3A 4MP3A 5ER9A 5CDGA 2E37A 2WD8A 3AY3A 3JQ6A 1DEHA 2IZ1A 3NRCA 3TZ6A 1PJQA 4AJLA 1ZIDA 1UUFA 1H6DA 1Z75A 3CZGA 3WGQA 4B4UA 1A4UA 2Q49A 1DDOA 4XYGA 4PG5A 4CLEA 2CDAA 4Q3AA 3OECA 1U28A 5L53A 1EVIA 4AYSA 4YT8A 1PGNA 3WLEA 2Y68A 3E1KA 3HB5X 2NU6A 4PLGA 4IQGA 4J4HA 3PFWO 4TWRA 4B3JA 3CZRA 4BKOA 1RM0A 4TVOA 3JQ9C 5K6AC 4WECA 4Z0PA 3DBVO 3RWBA 4F6CA 4E2YA 2EV9A 2Q2WA 4WLEA 4GMFA 1NR7A 3AFNA 5DCUA 1MUUA 4ALLA 1A71A 2J8ZA 1O89A 5TJHA 1HKUA 4MP6A 3HZZA 3D1LA 3DBHA 1G0NA 3GVXA 1PL8A 2X1HA 1ISMA 5F5LA 4TROA 1UDCA 3ZI0A 3ZWVA 3KLMX 2JCYA 3PHLA 4KQXA 4I1IA 1ZXBA 2JFGA 3SX2A 1LA2A 3FTPA 3AY7A 4XWYA 3AOGA 4J4TA 1LNQA 3FD8A 2NU8A 3HADA 1JU9A 3LT2A 3AM5A 4XYLA 2QHXA 3WICA 4CV3A 2OL4A 2O3TA 4GX0A 4R5HA 2PTGA 4MVJP 5BNFA 3PDJA 5L7WA 1U7TA 4NDNE 1PX0A 2PA3A 5IAAA 1PSDA 4QO7A 2VYVA 2EGHA 2CY0A 4NK5A 4NMHA 3PHIA 2GR9A 2J5QA 3DBHB 2GUGA 3QSGA 4AJ1A 2Q1TA 4AJIA 5B4TA 2OMEA 4CQLA 1EDZA 1NFRA 4J7UA 2G76A 5G2OA 2A94A 2J3KA 4WEOA 3ZWXA 4HV4A 5BR7A 4BNGA 1IYZA 4E31A 1PZEA 1DB3A 1ZKMA 3MJEA 2OBYA 4GQAA 1QRRA 1U5AA 1I32A 3O38A 3BTUA 4JBGA 1GPDG 2HCTA 5KVSA 1H6BA 1PS8A 3OJLA 4JXKA 2VTEA 3MTGA 2P9CA 4CM3A 2ZTLA 3JD0A 3STHA 4RF4A 1K6JA 1GV1A 1ADCA 1EBFA 3EYWA 2CVQA 1DO8A 3ZHYA 1X14A 2X0JA 5IDQA 3AK4A 2UAGA 4IIVA 3U9LA 4E2XA 1YH3A 4S3MA 1X1EA 2FMUA 1WLYA 4ZGWA 3IL2A 3TPCA 3H3JA 5TIIA 2J5KA 4GX2A 1BVRA 4XJTA 5L51A 4CR6A 2CUKA 3TJRA 4XR4A 1E5LA 4CQLB 3OBBA 2QRLA 3COSA 1I0ZA 2EP5A 4U5QA 3WQSB 4GSLA 4BNXA 3A28A 4FJ2A 1DHTA 1HT0A 2GZ3A 3RBXA 2B4TO 4YRAA 1MXHA 4MKRA 4J16A 4W7IA 4TQGA 4DPMA 1HYHA 4BV9A 1FDWA 1G0OA 1I3MA 1SC6A 2AMFA 2I66A 3G49A 2JD2A 4NFYA 4BMSA 4L4XA 1W4ZA 2AE2A 2X5OA 4N5MA 2IEDA 3AW9A 1ENZA 2PH5A 3H3FA 1F12A 1PWZA 2GN4A 2JL1A 3SJ7A 3GFGA 3WXBA 1T25A 3P5SA 3QY9A 1VI2A
chains in the Genus database with same CATH superfamily
3BB3A 5EIHA 4KR0A 2CDCA 3MWEA 4DGQA 3GZ4A 4XIIA 3DBLA 2RE8A 1HFWA 1K9SA 5E9WA 3HDJA 1WW8A 3OWHA 3SVZA 1TPYA 1G3UA 1MA0A 2C92A 5E6SA 2ZVDA 4P3YA 2XECA 4QDUA 1CETA 2FDRA 3RTGA 1SR8A 2O1XA 2LW7A 3GJYA 4MR9B 1E0SA 1E59A 3GHYA 3E53A 5DB4A 5BO5A 4AUMA 4C88A 3PFHA 2G04A 4OP3A 1Y5MA 3T3HA 4GYYA 1DGQA 5FWNA 4FHZA 5KMGA 2Q62A 2BLLA 3C3CA 4MQMA 3AESA 3GAMA 2GTPA 1ISGA 2CUNA 3HN6A 3P52A 1GNSA 4M8LA 1GRCA 2GVZC 2I80A 4PVCA 1F4PA 2H3EA 3BD7A 1BDIA 1VLLA 2J6BA 5B53A 1FFCA 2D5LA 3SOPA 3D8TA 4TLEA 1U3VA 5EEGA 1UBFA 4HDSB 3SNKA 1A8PA 5ALEA 2YMMA 3PC6A 4HQLA 4JI1B 2W6IA 3GEIA 4BO8A 2FEWB 2ABWA 1TOAA 4BVKA 1J8VA 2ZE8A 2Z6UA 2O8BA 2PYDA 3SXPA 4RSYA 3A6GA 3L4BC 2QE7A 2JG3A 4P92A 3RUFA 1EQ2A 3R3XA 5CX4A 1TGVA 1W88B 121PA 3OOHA 4G0MA 3ORHA 1CDDA 4JVNA 4PINA 3RB8A 3C6YA 5B58C 2DHEA 2QLJA 2RAUA 1Y9JA 2XH8A 5C46F 3VQTA 5ENZA 1W29A 2P9FA 3ZDCA 3K09C 3C5HA 3P4XA 2Q1YA 5FWXB 2IYWA 3IP6A 3OOJA 5AOCA 3V4PB 5K8UA 4KR7A 3NP7A 1J06A 1E3LA 4H7HA 4HGNA 3DAFA 1G20A 4BVBA 4EP1A 2JBAA 2W6JD 4JLWA 4GGOA 4PS0A 3GO4A 1TO6A 4LVOA 1YR9A 3HRHA 1M5UA 1JIQA 1U1FA 4F21A 1B1CA 1SBQA 5GY7A 4Y0VA 1BZYA 2MSKA 3U9WA 4JLKA 4ZVMA 5CGQB 3RYFA 5F52A 1FYDA 3L7LA 4ZYYA 3K2IA 3F5SA 1WCYA 3T5DA 2IUTA 1XDDA 1KYYA 1N0WA 1NM5A 2H59A 3ESZA 3FLBA 1L1FA 4GU5A 2BFBA 5BQ3A 4RD3A 3Q6MA 4L08A 1SEVA 1P6XA 3TOVA 1RWVA 4MW7A 3RHSA 1OI3A 5IKOA 1N8TA 1YC5A 4EFNA 4EOGA 3LNTA 2OESA 4JASB 4DV0B 4G1BA 3H5OA 3PT5A 5CB4F 1UBTS 5AKLA 4OKNA 5LQAA 1JYEA 5AVOA 3RF7A 4CM4B 2XUHA 5CITA 2ZB8A 2HM7A 2A6PA 4QRIA 1SCUB 1ZINA 2HQBA 4UQPA 2NV0A 1CZOA 5FDFA 2X22A 5DEOA 2UUBB 2ECKA 3OFVA 4UDYX 1HE1C 2JGRA 1N2HA 3KKZA 3O84A 3ROFA 1IQPA 5L95A 3QA3E 1NZDA 3VM6A 5DZSA 3DTVB 3TMYA 5BMVF 3FMVA 3TB6A 5J40A 5HWSA 1MJFA 1L8OA 4JBWA 2PS9A 4IG9A 4KFTA 3BREA 1QHEA 1N1EA 4O2RA 2AB0A 4WXYB 5DNWA 5G3ZA 1P2DA 2I6TA 3PHCA 5BXQC 3RARA 2JK1A 1I4LD 1Y81A 3EQ7A 4HG2A 5EHNA 5LBIA 3TX2A 1QE5A 1Q12A 4XGNA 1FNBA 4K6OA 1UMCB 3IA7A 1GYRA 5KNLA 2VJ8A 4ER0A 2UYCA 3L8FA 1YIAA 2DJ5A 4KQKA 5FA8A 2EIHA 2EVWX 2VEDA 5TB5A 3W9UA 4YLYA 2OHOA 3HACA 4FIDA 3B51X 4GQBA 3AHEA 2HCJB 2B98A 1HFJA 4I1VA 4K88A 4KK4A 3WDMA 1U0EA 4M9RA 3DKRA 1S89A 4PY2A 1IZYA 2NSLA 5TQ0A 4BO4A 4MWGA 4GEGA 4YMVA 1N5OX 1QFSA 4ZIRA 4Y1GA 4IDOA 3CLKA 5MN4A 1IXYA 2C8VA 2DZDA 1X80B 3H2KA 3OBIA 5M3BA 3RKUA 4BGUA 2D59A 5IJ0B 5AI6A 4DPRA 2HF8A 1Q20A 5ERXA 1JDTA 3CVWA 2GVNA 1A5BB 1ZGBA 3ME5A 3SMVA 2ZVPX 1Y33E 1YZUA 2GJKA 4MQUA 3UCFA 2BFDA 1DLJA 1XTQA 2PEZA 4ZOCA 3TS1A 8LDHA 4HN9A 1A9PA 5IZCC 1E18A 3DC7A 3B1FA 3PEFA 5DM60 1FTGA 2R00A 3IURA 3PC8C 4QBKA 2XBLA 4HGZA 3W34A 3WK9A 5HNKA 3AUUA 1A7JA 4LTDA 1EX1A 3AKZA 2KM1A 5AIBA 1NPDA 1HH4A 1NVUQ 1FXWA 4JX8A 3TTVA 1JBEA 3WIDA 5COBA 4C0XA 1OFIA 5L6LB 1L5HB 4MYCA 2ZSUA 2ZREA 3JVVA 4OUDB 3ZLVA 1P1BA 2VPIA 1HG1A 2CFTA 3IQFA 4G2NA 5LZ9A 4DUGA 5AW4A 2AKEA 1XNGA 3CZEA 1MT0A 1XO1A 3JQRA 3DMNA 8ATCA 3T1HB 1DAPA 1Y6JA 4PZPA 1PWHA 3D6HA 3TO5A 3UH1A 3DO5A 2BTOA 1V43A 4ZQTA 1VL0A 1G8KA 3D0KA 1G16A 4F2HA 4PW0A 1JIUA 1XZJA 3JQBC 2CLHB 3UA4A 1V3TA 2GJAA 3DLTA 4YMTA 2WSYB 2FPPA 2P9YA 3BILA 5IDWA 1DELA 2C3OA 2V4UA 4IJUA 1UPTA 1WOMA 4RA9A 1K4MA 1YL5A 3ZU4A 5AVVA 4TWZA 3EFOA 3QXGA 2XZOA 5TVGA 4BB5A 3VMFA 3B2EA 2O3QA 2NO9A 2GZ2A 2OVFA 2PO5A 2Q9UA 3QJGA 3QLVC 4YUWA 3DE4X 7ABPA 1TJYA 4UNRA 4TV8B 1V95A 5IXJA 3DGFC 1IL0A 5ALOA 5KPDA 4LOJA 3IOYA 4N54A 1GZSA 3K8ZA 3CF2A 1HQKA 3JYQA 3L6EA 4UBLA 1Z0KA 1J9ZA 3KSRA 1RCUA 4BQRA 1UC8A 3HDTA 2G9QA 2C7GA 3INTA 2VAVA 4V1CB 4RFSA 3KOZA 3SZGA 4AD8A 2MMGA 2VVTA 5KSYA 3G5UA 3EGWA 1ILWA 2EJCA 1Z33A 5CVVA 3T3EA 2QMOA 1X74A 3UW3A 4DCJA 2FVXA 1H9CA 3MS2A 2KHZA 5GQSA 1TVEA 2FSPA 3ABIA 3GROA 4C06A 4C4OA 2NZ2A 4JJKA 4J07A 4LZPA 3A2NA 4U00A 1G8MA 2ZTUA 1FCJA 2DSNA 4HXGA 3NVAA 4K5QA 2FKAA 1YL6A 3T06B 3KWFA 1WSDA 4PAGA 2W6ZA 3OWXA 4XO5A 4K0KB 1IHXA 3LUDA 4BMOB 1NVKA 4F5YA 3E9ZA 4MI6A 2NO1A 1L4UA 3TJZA 1ZW6A 4YP5A 5CYFA 2WSSA 4CUJA 2AUNA 4IV5A 4MDHA 2ZROA 3GPIA 3GRUA 3L0YA 1JTFA 1ESCA 5FHQA 2X4LA 2FWIA 3M4NA 4ZFNA 3X1YA 3INYA 4A3SA 4QXAA 4C08A 5HSGA 4FD2A 2NQ2C 3G5AA 3FZEA 2AQ8A 4QUHA 1CG6A 3FUEA 1CB0A 1II8B 3FVVA 1DXHA 1XHLA 2Z3WA 2VP5A 5BQPA 4HMQA 3LBFA 3QUBA 4I9FA 1J0DA 2DAPA 4PLFA 2CFIA 3FB1A 3HCBA 3IIJA 1QHNA 1BWSA 4UE3S 3OQIA 2J3MA 1NG9A 4QRDA 3P2YA 4ZYLA 1YMUA 4N9QA 1K6EA 2FTKE 3EX7C 4R2HA 4CM6A 2OV1A 5KKAA 4F6RA 1W48A 3DS8A 1UOOA 4GI1A 1K98A 2YMPA 2CXOA 4UXHA 4RZUA 4B2LA 3X1JA 3WJ7A 4IVPA 2JRCA 1NU6A 1U2DC 3UG6A 3BIFA 2Y05A 3DOJA 4CMBA 5D51S 4EO4A 1LEHA 2CLDX 2ZVQX 4K6GA 4MA5A 1EDEA 1X0VA 3VR3A 1OX6A 4OHUA 4BFWA 1JFFA 3BWXA 2EW2A 1RJFA 1ZK1A 4P93A 3WQRA 4LY0A 1N9ZA 2PKRA 4G0ZA 1PFKA 1QX3A 4WASA 1N34B 1EYZA 4QOIA 4PS1A 4REOA 5EMMA 3G7NA 4EW1A 4DMMA 4IDFA 3D8BA 4ZYWA 2W6PA 5G0TA 4U7HA 1Q1GA 3DBRB 4QKQA 3FOZA 3DOUA 2NGRA 1GYPA 1P1KA 4B3TB 3I8XA 2Z9DA 1Y6RA 1TZJA 1P6UA 1SU4A 4G97A 1RR6A 2C5BA 4AJPA 2NXEA 4BATA 2HRZA 4U8HA 2FPWA 5GINE 1NJ6A 3O74A 3SCZA 4IICA 4DV5B 4TUYB 1OI4A 1T2CA 4OQLA 1R88A 4D4JA 4Z1OA 1BVHA 4ZD6A 5D8DA 3M1IA 4FN5A 4DR3B 1WMEA 2I4NA 3QA9A 4GDFA 2LIPA 4LFAB 1C50A 1N92A 2Z9CA 3ANXA 5E7JA 3OMXA 5AJYA 4C6RA 2ZIXA 3VZPA 4PE5B 4MEBA 4ZMSA 1IQ0A 2Z2ZA 2NXCA 3NUGA 4L4UA 3VZQA 4QFDA 4MVCA 3WYDA 3ZHCA 4B17A 4ER5A 1Y1PA 3M6VA 2FH5B 1Z2EA 4S04A 3H13A 1WIWA 3O7WA 1A9RA 1AZTA 2QT9A 4DMCA 1WV0A 4B9AA 1UWVA 1FVHA 4NESA 4XUEA 2ZJ8A 1ZQ1A 4IWNA 4HAUA 2A5GA 4BV8A 1KOJA 4C9BA 4CVNA 1PDWA 4GI7A 5ADHA 3R75A 1BMFA 5L7YA 1ULHA 3TLCA 3ZDBA 4QXRA 4A0QA 4F3KA 4D4IA 1U3DA 1YR7A 3HJGA 3P9QA 2PT6A 1YOVA 2C5HA 3LKVA 4DSOA 3R5XA 5M5BA 2X9NA 1HT2E 1UDRA 2IEZA 5LJIA 2WIBA 1PKXA 1ZN2A 1P4JA 1ZMRA 4LY6A 1AKEA 5B7GA 3GLGE 1KI8A 2V7GA 3DP9A 3UC9A 3WLFA 4FDAA 4HL6A 5CPBA 1G21B 1FSFA 2R11A 4KR2A 3NTXA 2OFFA 2D0DA 3VPBA 1ZUNA 3V6MA 3UKJA 1YJCA 2IPOA 2N75A 4URWR 3ZQJA 3M82A 3LV8A 1S8NA 3OZGA 4H4CA 3ONNA 2M32A 4MIOA 4N03A 1DDGA 1U1DA 3E35A 3FUUA 1XEFA 3KKLA 5K3FB 3VHQA 1JWLA 2WFZA 4OIMA 1OXKB 1Q14A 1X1QA 5KYTA 4LHVA 3S2UA 5JCOC 4C07A 4JLOA 1JJ7A 1LPOA 3H99A 3VISA 4A8JC 1KVTA 1N6KA 3RVKA 1BEZA 1RAIA 1KEWA 1RADA 1Y98A 1XRNA 1LI4A 1NNLA 1OR8A 3K5PA 3RTDA 4UTNA 4AP6A 5M2QA 5JATA 1NP3A 4I4TA 1YIOA 4M7PA 4IGKA 2IPAB 3COJA 4JT9A 1QX4A 1X7GA 4KX5A 2PH3A 4YAOA 2CZCA 1FFHA 1DBVO 1SUEA 4QZVA 5CDYA 1E79A 2OMKA 4XI9A 3RBZA 4Z4EA 5JMTA 3EZGA 2WV9A 4HDMA 3GIWA 4QOSA 4ER6A 4P2BA 1V2GA 1Z62A 4HLUC 3VHXA 4FI3C 1G2QA 3U13A 2NZJA 3LGSA 3I2HA 1Q7GA 3U4DA 1IN8A 4WJLA 1IB6A 1I4OA 1SZDA 3RJTA 1V6CA 1Z8DA 3RYIB 2J85A 3IUPA 2I2DA 3D54D 3OI7A 1TRKA 2A9OA 4D9KA 2C58A 2XUZA 1RI1A 5A1JA 4U2EA 2DH6A 3ZGYA 1YFKA 3CV3A 4EK9A 2PQ0A 5TEWA 4ZP1A 3R7WA 4F9EA 2OV2A 3RS7A 3HM2A 4OL9A 3GLHE 2RK6A 4KAFA 1RXUA 2ON6A 1X2BA 1Z28A 3Q2IA 1E0DA 1Y1RA 1ULZA 2WMOB 2TS1A 1LQ2A 4P08A 2HO5A 4EMUA 4DV4B 5C8YB 4HUQA 2R5WA 3R6LA 1FX1A 1OYOA 4NENB 1KTVA 4ZQFA 4GI5A 2AG6A 1Q1AA 4NY1A 4OMFG 3D3EA 4GPZA 4V02A 1O97D 2HFKA 4V0LA 3REFA 1BXZA 2O0JA 4B47A 1JH8A 4KVGA 1ZZGA 1GIAA 1W0CA 2Y6UA 4L15A 4O4LB 1W5EA 2LRHA 3AEXA 1PG2A 2VCHA 3Q9SA 3SZRA 5FBKA 3V4RA 3CLSD 3QE0A 3WTBA 1ZCZA 1D1PA 3VKGA 1UQRA 3RFTA 1QBGA 5G4KA 4ZDWA 4B85A 1AB6A 4PQFA 1SVLA 4TMYA 2VDWB 4ZOEA 3QKRA 5EE5B 4D9FA 4DJ5X 5A5GA 3LZ6A 3DDOA 1QV9A 4G4GA 2J30A 3M5PA 2CDNA 4DMKA 3A32A 2H7CA 2WYVA 1H4TA 3LDFA 4CFSA 5LLDA 1KFCB 1GUBA 1JA1A 2BMAA 1SPBS 1KMNA 3JAKB 1XX6A 4MUKA 1H19A 4PX3A 4KPYA 2XXAA 1Y6ZA 1QRDA 4LGYA 5J47A 3KBOA 3JARA 1S9DA 1AO3A 2O2XA 2PWYA 4LVUA 5DXFA 4EHKA 1NT2A 1BXRB 2NVOA 4I81A 3OZXA 3JTMA 3BMCB 1LSUA 1TKCA 2Q0SA 4FFMA 2NUPB 4ILKA 3NKFA 1XZDA 1YK0A 3GFSA 4HDNA 1WB6A 3NEAA 4MK4A 5LWHA 1TVMA 2J5BA 1WHSA 2G82A 2VL7A 3ZGOA 3K92A 3KQKA 4P1ZA 4EKIA 3ZXXA 3JAMA 4ISBA 5AQEA 3AXTA 3IOEA 3LGAA 1E2FA 2PPVA 4OBBA 1P61B 5CXSA 5KI6A 2NOAA 5JNSA 4YRDA 2GM5A 4BFUA 4LNAA 2D1YA 4RIHA 3TLKA 4I1PA 1PQWA 3TNLA 1ZOPA 2RHTA 1VMEA 2ORED 4HEJA 4GAEA 1QIHA 4NZMA 1D2CA 5DTMA 4CFYA 4HNGA 5FTMA 3VKVA 4R3NA 2V9CA 4M87A 5CA0B 1PQPA 1E1QA 1PJBA 2GHIA 4A2WA 1GWNA 2Z5LA 4IMPA 4RH0A 3HB7A 1X9IA 4MPTA 3CEHA 4QTXA 5IWAB 1HL7A 4EUFA 4N5LA 1QKIA 3K2EA 1UAGA 2IHVA 3KWLA 2J48A 2X15A 3H1GA 2Z57A 3EXEB 1JTEA 2FN7A 1WABA 3TXXA 3S2EA 5JDCA 1ZGJA 1KXZA 2ZJOA 5LPNA 3CN9A 3R0IA 4EG7A 4EW3A 4BLWA 5CDTA 3W4KA 2XE7A 4Q66C 1A82A 3TJMA 3UJCA 3VTKA 1GAEO 4UZEA 4MWCA 5C1IA 1PNTA 1DHRA 4FE4A 4YJFB 1L5LA 2CHUA 4K6CA 4X7BA 5CRIA 3D7SA 4MS6A 2PLNA 2VG8A 3NAMA 3MRSA 4RMHA 5KAPA 3THYA 4EUNA 2XR1A 4JI8B 5DM0A 4X3PA 3DDCA 1PK8A 2XY4A 3D64A 4I2NA 2Q4DA 2O7SA 4RSHA 3IDZA 5IP5A 3M4ZA 5BSMA 3WJ1A 4RVUA 2A59A 4IBOA 2FZGA 2V97A 1GPWB 4P4SB 4NFLA 4GE3A 3UJ7A 2G6TA 2R6DA 5BW5A 2HA0A 4UVEA 1I80A 2AK3A 3ZQ4A 4GYJA 4MV0A 4AZTA 4FLRA 1COWA 2G80A 4J4BA 4B81A 4ZVOA 3SR0A 4HXYA 4JLNA 3H86A 5A4DA 2QAIA 5JZOA 2XLBA 1P8AA 1GFZA 3LGXA 4OFXA 1DEXA 4KQWA 1DVRA 1EWVA 1JQJC 1ZWKA 4J0JA 5IANA 2XMRA 4B8WA 3GFTA 1C2TA 2PX5A 4MIKA 4KUGA 3HGTA 1MAWA 5AI4A 5BT8A 2IH4A 3E4CA 4FTWA 4FVTA 4XPIB 4ENPA 2REQA 3GNSA 1JLLA 1ML4A 1NATA 1A4RA 2PUTA 2JA1A 1QGYA 4WLNA 3DLPX 4NCXA 1VHWA 1UBCA 5DSZA 1DX6A 4IZHA 1ST2A 3RSZA 1XZ8A 1IIRA 1ZD2P 3UWSA 5HZGA 2H11A 3BMXA 3U3KA 4BZPA 3UPUA 3FGZA 4PVBA 2XUJA 3Q7IA 1SKYB 4HJRA 3HKEA 2Z04A 5ERGB 2D1RA 3S40A 2DWQA 4JQOA 2D3TA 4LG1A 3UJ8A 2C84A 3KSBC 4C4AA 4S2EA 4DR2B 5A4KA 4DMUB 4WADA 3O93A 5H8WA 3QI2A 4FYJA 4P86A 3JZDA 3A9UA 1P0MA 3K6SB 1ZXLA 2QTAA 3A58B 1QO0A 4U6SA 1QFZA 2HJRA 2MSWA 4BCCA 4CXFA 1WB4A 2B7CA 4XPZA 3NBMA 1O54A 5ECYA 3S55A 4EB6A 2C04A 5JMWA 4RHTA 1YOBA 1JAYA 3ADKA 3HY4A 5KTRA 2ZJ3A 4RGBA 2X9QA 4NDZA 4QG3A 1XMOB 1UT6A 1NVEA 4JT2A 3K72B 2AN1A 2SICE 3KU4A 3R7DA 2FW0A 2JIBA 2XCLA 3OJOA 3FLMA 3OJEA 4N0PA 3QX9A 1YHNA 4FS3A 4OXYA 3CEAA 1JEAA 2RGAA 2PYIA 2R8PA 2DKNA 3GJ0A 3B1VA 4X6UA 2YWHA 5HTOA 2VPYA 1PJ3A 3I6ZA 4X1YB 2QG4A 1IQUA 1BXGA 3CLTD 4IJ6A 4B3BA 4BNYA 4B3SB 1MW3A 1MT3A 1X7YB 3CO5A 3HH8A 1FFGA 3OT1A 3PNVA 3U60B 4PR3A 2VDOB 5LLSA 3PQ8A 1UXOA 3EXHB 3OO1A 3LRPA 3OFJA 1N25A 1X1RA 4CNQA 3SYMA 2GO7A 1P2VA 5KZMB 3FPGA 5EPUA 1VJCA 1GNRA 2CLCX 3PXCX 1CVLA 4TS1A 3ZIUA 3ICPA 1SA0B 3CUYA 4GBED 2B5VA 1U8AA 3HXPA 3LBIA 1OQAA 1LDBA 3QM1A 1DFGA 1E2EA 3DCJA 4ZU6X 4J9VA 4CEIA 4QQNA 4X66B 1DKOA 2BGUA 1HDOA 1AURA 3QXSA 2OAP1 2WHPB 2P4SA 2C83A 2VDNB 3HR7A 4IQ4A 2GO1A 3IPXA 4LWQA 4WKCA 5J2UB 1QIFA 2GBIA 4R98A 3IIKA 4EHAA 5JNTA 3HCRA 1I3OA 1CUFA 2XD4A 3F78A 3KD2A 5ERYA 3GLFB 1DIAA 1QAQA 3KZKA 1S96A 5FPSA 4CT4B 2YOFA 1US8A 4FFNA 4KMRA 1ACJA 5IKPA 1KTIA 5JAHA 3KR2A 5C5CA 1MDBA 3A7EA 2X8JB 4RYDA 4GL4A 2HRBA 4WN9B 5JEDA 1XP5A 2VUUA 1VKRA 3A4IA 1P72A 4MW5A 4LAFA 1L3CA 3FIJA 1LSJA 1P8JA 1FB5A 4P4UA 4TRNA 2JFVA 4UM8B 1KVQA 5TNXA 3ZDEA 1KFBB 3KQNA 2Q46A 1YE8A 3B36A 4O5AA 1F8FA 3ZNOA 1KEKA 1ZI8A 2W8ZA 1W36B 1MAVA 2QXUA 1Y9EA 4HX9A 1TUEA 4DILA 1G3MA 2AOTA 1TA9A 2P6OA 4F7WA 4EY4A 1QHGA 4Y7CA 5FPPA 1XVLA 3TTSA 3P9ZA 2BFWA 1LS1A 2HQRA 2ODNA 5E7IA 1A9OA 3T15A 5AMXA 5TQ2A 2NU7A 3SDZA 3K7EA 1Z16A 2HJVA 2OD7A 1SCDA 5I9BA 3VPHA 1M5RA 3ITEA 3WLHA 3VKHA 1NVDA 1Z45A 3WISA 5LP6A 4N39A 3PICA 3TCNA 3UUFA 2OSVA 4AWBA 4FEAA 3EC1A 2FA9A 5F2NA 5KJCA 2Q5LA 2QD3A 1TXGA 3FE2A 1TMGE 4J90A 1NXSA 1CUDA 5HCIA 1KQNA 4ARZA 4LV5B 1AA9A 5CAEB 1ONSA 4BWFB 1YRWA 5EIEA 1U98A 3GAAA 2C2YA 2DPMA 2X8LA 4FPXA 3SQLA 1OF1A 2YJ4A 3X1ZA 2I2BA 4DZRA 2QW1A 5C32A 2VHEA 3VO9A 1J8YF 3G59A 1ZD9A 1NXTA 5EFOA 3NLLA 1OWPA 5L8VA 5F51A 2R66A 3ZWCA 2DUUA 4J03A 4QAQA 1YZKA 2XQJA 4I2VA 5AKEA 2V7PA 3WGYA 1O97C 1P1RA 2PSHA 4B4DA 1YB2A 2QK4A 2XOKA 1F1BA 2DFPA 2BR4A 1KA9H 2IZOA 4M55A 5IDYA 3T9CA 3HRKA 3MB8A 3WRVA 4GKKB 3OM1A 4QIRA 3NJ4A 1HYGA 3NNSA 4AK9A 5LVAA 2ONYA 1NJ1A 1NR5A 3JQGB 3CVJA 2P9EA 1T9AA 2XUQA 5HMMA 5IXYA 3CLSC 3N7TA 2Y1GA 4JYCA 4OXQA 2OG1A 4GPBA 1QH1A 2AR0A 4A2PA 3ADOA 5KYUB 2Z5FA 3K0SA 3DLHA 4JITA 5B12A 2AMYA 1YCFA 2Q6IA 3EGXB 4GECA 3ADDA 3INGA 1S2OA 2JCBA 2GETA 1N5JA 1H2WA 2GD2A 2ZSAA 3BHMA 1TF7A 1RSZA 1PP4A 1VI5A 1K8RA 3UK7A 1T43A 4MAMA 2XUFA 4J2HA 1IHDA 1SU6A 3A6EA 2Q8PA 3FRHA 1KSJA 3H8SA 1OWOA 2ZZKA 3SYTA 2VRWA 3DDWA 3DHNA 2V54A 4MYSA 3G0CA 3U81A 4Y2TA 5EZ6B 3WMXA 4OUKX 3HLKA 4HHEA 4R1PA 3T61A 1CY6A 5K0ZA 2NV2B 2IIBA 4LOIA 3P2MA 2D62A 3OE7D 1A95A 1QTQA 3C3JA 1R3DA 3N5CA 3LDUA 1GU0A 4UJ5A 3S1AB 3K9FC 4IF4A 4QXOA 2NVUB 5LBUA 8ADHA 3KVOA 3A05A 3C1AA 1X7ZB 3B78A 1KKLA 4ZI7F 1RI2A 4ZC8A 3MJRA 4M89A 2VFAA 1WNFA 2GCEA 2FE4A 2OCBA 3MC1A 1J1IA 4QQFA 4KWTA 4YJ3F 1N5DA 4JHXA 4ZRMA 2N9UA 3TINA 1WVGA 1DQYA 1ZNZA 5FWQA 4M1QA 3Q0IA 4AN4A 3WLJA 1PT9A 5FLYA 1EP3B 2X5NA 4M0CA 1JLRA 1QYCA 1OX4B 1R18A 2OHXA 2IOFA 3TLEA 5K8JB 1PUJA 4EI9A 2ANCA 3OC0A 3JWIA 2JEZA 4QODA 4XWTA 5BV0A 5K3AA 3B3QA 3NT5A 1U31A 1H65A 2G83A 1E1MA 5DYIA 2PX4A 4QYXA 3SDSA 3EPRA 3SXUA 3TLJA 4AF6A 4H1WA 1W1IA 2XHEA 3GEMA 3LO8A 1SBNE 1AGPA 5A9RA 4GF5A 3CKKA 2QZZA 1XNJA 1XT6A 4CMIA 2VP3A 4MUYA 1JV2B 2BN4A 4RD2A 1LK0A 1D4OA 1E6EA 3DW3X 1Y1QA 3L9WA 4IUDS 5E7MA 4R8LA 4TT8A 4ND3A 4OQZA 3DBOB 4E4YA 2PLFA 1ZJ5A 5TLSA 3SX4A 1CQWA 3WIEA 2CEKA 2I3AA 3CO0S 2R2AA 4FLEA 4KMMA 5CLIA 4DCUA 5LA6B 1UBEA 4FX2A 2RHRA 1XXHB 4PO1A 2OD9A 3MHTA 2PLRA 1M76A 1PWYE 3FTDA 3SJCA 1ST3A 2IOHA 5FL3A 3PWSA 1XMVA 4JBHA 5AUQA 3LP5A 1EJ2A 1G291 3PHHA 1UIMA 2HA2A 5DF1A 2DKOA 1L7XA 4P7BA 1QG4A 3IHLA 1NW6A 1P2BA 1QIJA 2ZI6A 3RIXA 3EMBA 4C7JA 3DR5A 1ID8A 3Q8MA 3IVCA 1IY0A 4P3OA 4DLKA 1LNZA 3P94A 4L4YA 2BP7B 1WULS 4V2UA 2NXNA 3K9CA 2JIZD 4TKUA 1H0HA 2CNLA 4QGSA 1SXGA 1E3TA 2AHOA 2DMRA 4BE7B 2B6NA 4AZ3B 2QN2A 2E4AA 4X61A 5BOVA 4UMEA 5G40A 2PM8A 3GGGA 5JNWA 2OORA 3O1IC 5A3VA 4E2ZA 2W4MA 4DIKA 1QQAA 1I0IA 2E7ZA 4J0HA 4I4CA 2PXHA 1ZUHA 3JWEA 2F48A 2JIDA 3O73A 1HORA 2G4LA 2GJ4A 3WDSA 2XLCA 4ND5A 2KLBA 4RTLA 5CB0A 5IDXA 1OTXA 4ZK6A 5LUAA 2DPLA 3HWRA 4LBWA 1ZM9A 3HO1A 1VHDA 3QIAA 4NOKA 4ROSA 4AJJA 3OLYA 2LIVA 2ZYGA 4QYSA 1WUHS 1T36B 2ISSD 1GZ6A 1L7AA 3W2TA 3R8FA 1VL6A 2PXXA 1AQLA 2GILA 4NARA 4E1BA 2Q21A 2P68A 2B5WA 2FRDA 1JSRA 2P65A 3GX1A 3R7LA 1U3WA 3P2JA 3HEMA 1T8UA 3A26A 2FDXA 4P4LA 3SFTA 2DJIA 3TRKA 4OJTA 2I3BA 2P4QA 2RC6A 5GP1A 4XQGA 4G0UA 3S8YA 1G20E 1I3LA 1S1CA 1DJNA 2K2WA 1HWYA 2PZ8A 2X9GA 4ZDKA 1ZJ4A 3C5CA 3CVVA 1AT1A 1EA5A 4M38A 5KJ1A 2QW8A 5KYYA 2Q6OA 2R4UA 3CLTC 3L7YA 1KI2A 3PUKA 3ZY2A 3NONA 3SHVA 5DNDA 2A8YA 2FU5C 5DRYA 5EHQA 3OA2A 2BJVA 3I9JA 2I4RA 4XYEA 3DLBA 3BD6A 1JS1X 3WGGA 3ZY4A 1CQIA 1IM2A 2GK6A 1YTLA 2QG9A 2YXBA 1WPXA 1Z0SA 3ZW7A 4EVRA 5JS7A 4NQZA 1KS2A 4Q19A 3BWMA 2H07A 2I7TA 3IT1A 4JXZA 1GVHA 2QN8A 3ODPA 1QQ5A 3H4TA 4KQHA 2FWBA 1H5UA 2E18A 2ZTSA 1U9IC 4BRWA 1CUSA 3AILA 4XTRA 4YI5A 3NYWA 5AOVA 4Q00A 4W6ZA 1QORA 4HRYA 4H1VA 2JARA 3OQOA 4ROTA 1ITZA 4B46A 1QPGA 3EUFA 3B9BA 4D8TA 3VVLA 5JVDF 3K1ZA 4LJ8A 4HYYA 4BMNA 2Y66A 4LZAA 1C7RA 2QPTA 1TYZA 3I04A 3JAWB 1EIZA 1D2AA 1HDIA 2J7KA 2NU9A 1TO2E 4HDOB 4NPAA 4Q4JA 3DB2A 5HQ3A 3AUFA 1TTQB 1W52X 1HL3A 4OQFA 3EE6A 3F5MA 1U4OA 3LX4A 5THKA 1TK2A 1MB2A 4ZVKA 1VHLA 2EFDB 4HQRA 1K6IA 1UK8A 3R5HA 5AW2A 3GJSA 1E1CA 1GGKA 1M0SA 5KNCH 4DR7B 1ODSA 1E66A 2GLTA 4MUHA 1XQ6A 3VR4D 1DKPA 4KFSA 4XRRA 3CBQA 1U0OC 3QYAA 4G85A 3CB4A 4KOAA 4US1R 3Q3VA 3ZEIA 1CB7A 2H7XA 3AEQB 2PL9A 1Y4AE 2IYXA 2HDHA 2HX1A 3MJDA 3VYUB 1YJ8A 4MUEA 4ZI7A 1K5PA 4JP3A 1JVSA 1AH2A 3WFZA 3MAJA 3R09A 5M7EA 3NIBA 3W5VA 3FVQA 2JEOA 1AUQA 1E9SA 2NLOA 2OHIA 3A1CA 4OK3A 3EN0A 2PFKA 3OZEA 2IH2A 2Q7XA 5CVJA 1Z4PX 3MTJA 3DLCA 3O75A 3Q1LA 5LP6F 4CQJA 2XGJA 4KH1A 4BX0A 4OQQA 1RJGA 3I09A 2JVJA 2VPWA 5KX5A 4TWBA 2VZEA 5J2TA 3UQZA 4NJOA 1KRXA 1MJ5A 4EBBA 4HN4B 3C7AA 1E9EA 3K9HA 2B35A 2YWEA 3A9WA 4U2FA 1MW0A 3R6WA 4NJEA 3QVTA 3BAZA 4KYIB 4P31A 3UHFA 4CV0A 3NXSA 3VR2A 3LQFA 4AMGA 4TPKA 5CB4B 4YP6A 4NXNB 4JLPA 4IDBA 4RTNA 3UV3A 1Y9DA 2YMLA 4RJLA 4B3FX 4W1SA 1P44A 3H4IA 1IE3A 2J08A 1R12A 1F8GA 4U9HS 4BOYA 5HIKA 2YFQA 2N1MA 1LVGA 1EK0A 3KLBA 4I8IA 4L73A 4MVJG 1NE7A 1TJ3A 1RC0A 1QHXA 3I1FA 3FTUA 3I6QA 3R8CA 2FMKA 4RS4A 1M6YA 5EXDA 3E81A 4DM3A 5BMVB 3DYVA 1X6VA 3T9FA 4N5DA 5EHZA 3NATA 3HJCA 5IAJA 1AS2A 1YBMA 2HRCA 2RAFA 3A3NA 4FNOA 5GOZA 4F1JA 2GK7A 1M8GA 1I9GA 3PZBA 4OSOA 1CQZA 2IIPA 1MO2A 3GUUA 4Y2JA 1YR1A 2EKDA 2GHTA 2W0MA 5BPHA 4RPJA 3WQQA 3B53X 1YBAA 5AVKA 4D4GA 1NHGA 1H3LA 1ZUWA 3WNVA 4BO5A 1GRRA 2YOGA 3A1VA 2YL2A 3ZCQA 4PSUA 2DPGA 5CDFA 1E77A 2V1XA 1GNLA 3JCZA 3DNFA 4F6LA 3GEGA 4ZOLA 1L7PA 1POXA 4GE0A 5CVCA 5JPIA 3DMDA 1KAMA 2PX6A 2ZT6A 4KO8A 3ZE6A 1ADBA 4ISCA 4KRFA 4OHYA 1J1UA 1E2IA 2IQ5A 2R9VA 4J3BA 3ACBA 2VATA 3EGDB 3K0EA 5DW3A 3ETNA 3ETDA 4NU0A 2NMVA 1EZZA 1XZEA 4CMGA 4OU4A 1XD9A 3LIPA 4GBMA 4BNFA 4RTQA 1K3TA 1JU3A 2JGKA 1Z88A 3GT0A 4YPFA 3OUTA 4YMWA 2AEFA 4RPGA 3OZTA 1CUBA 5CUQA 4ERXA 2KMLA 5AW0A 3HTXA 3LOUA 4HMOA 2P2YA 4DCGA 3AUKA 2R59A 10MHA 4L16A 1PNRA 1T9HA 2BMFA 5IC6A 1NOJA 4BMPB 4Z4GA 3THWA 1F7UA 1HY3A 5HNHA 1BN6A 1SOVA 3LHFA 2GBPA 4Q24A 4CRWB 5LM3A 1GZ7A 1Z0ZA 1I13A 3CX4A 4DJEC 5F23A 5EJ6A 5ITVA 2VYFA 2C98A 4EY5A 4F97A 3C3MA 2KYRA 4OOEA 1NOIA 1QGUB 2VKQA 3OLCX 4QMEA 2PH1A 4NULA 4QOJA 3ESBA 4LRXA 4TWJA 4YV2A 5M04A 1Y8CA 4TXLA 4KW7A 4UCQA 1RIFA 1ZVJA 1R10A 2IYUA 3IT2A 2OAGA 4R3WA 1CUAA 1PGPA 3HA3A 5KDLA 1Q7BA 3BKXA 1E5QA 3QU2A 1G55A 3C85A 3EISA 2YZGA 3R6TA 4GOLD 4POAA 2AVNA 1EX7A 3LQ1A 1MEEA 4LSMA 1C8LA 2AXPA 2EEZA 3KU1A 1HC7A 4QU9A 3SC6A 4PRLA 1QK5A 3P32A 3K1AB 5A4IS 1NJSA 2CBXA 4NP6A 2CFOA 3RVOA 4BRUA 5BN1A 2CK3D 4HNAA 2JD1A 3WZ2A 2Z2YA 5H9WA 5K8LA 2EATA 5JYBA 4PTLA 4EGAA 2YWXA 2FPKA 3BULA 1T4CA 4LHYA 4E2WA 2D7JA 4F11A 5ALPA 2XBMA 2GN1A 2A1TS 1G7RA 1A27A 2WWWA 3NGXA 3LRXA 4IXDA 2HYDA 3B13B 3KK0A 2R6GA 5BV8A 2HIGA 3G68A 4IF6A 3PIRA 5CEFA 1GZ4A 2AC2A 4DV7B 1ZO8A 2GX6A 4DRYA 3DTVD 4DIEA 2MHCA 3CONA 4L0QA 3A9CA 1CE8B 1HETA 1OASA 2G9ZA 3WLQA 4CUZA 5B55A 5IYZF 2VJMA 4ZEXA 2Y9MB 3X1XA 2HK8A 4AQYB 3I6YA 1P29A 2VHUA 2F43B 4UDOA 3VTAA 5HKKA 1J07A 4A5SA 1Z73A 2QRNA 5EJ5A 5JVDA 4WHMA 4AUKA 1CR4A 4K9KA 1X70A 3TSAA 4QWMA 1YRAA 2GN8A 1E61A 5DW0A 5E2AA 2PMCA 2ZYWX 3II6X 4XLLA 4BC1A 1THGA 2HA4A 4JHLA 1OAOC 2ZR8A 4PLTA 5EIFA 4O2LA 2CMDA 4KL8S 4QARA 1Y1TA 3L4KA 1AC5A 1P1CA 1ZEJA 4JBLA 3PIIA 3JD4A 1GL9B 5JD3A 2YCLA 3WLKX 1FUUA 2YHAA 1GTJ1 3BSWA 4WLVA 5JWRA 3ZR4B 1CZUA 3TZCA 1V5GA 1P73A 2I65A 2WZDA 3TZQA 2SECE 5H4GA 3OTQA 5JRDS 3G79A 2QQFA 1S2NA 3BGOS 3L7JA 1W19A 1RPZA 1JTVA 4P98A 5B4TA 4R7LA 3UXHA 1BVYF 4YJ2B 1N7GA 1D5WA 4DV1B 1BMDA 1Q44A 1UH5A 2C1ZA 1KO4A 2WUEA 3BK2A 1UPCA 2XNCA 3IOMA 4RMJA 5EUMA 3T0GA 3KNZA 1WB9A 1P81A 3PQFA 3BEDA 4GYWA 1E6LA 3WR5A 5C3MA 5K20A 1N0IA 4OHCA 3D3KA 3DCYA 2Y4NA 1Z3CA 1HOXA 4HAIA 2QROA 5AVRA 3JQFA 3UF0A 4HPWA 5TGDA 2A35A 4FYHA 1TEHA 4F5ZA 4ZW5A 3NTRA 2BGWA 5TDHA 3LT0A 1T9GS 3WIOA 3ZTYA 4WK2B 5BURA 4IFIA 3NH9A 4I1YA 4Z54A 5I7RA 5KHOC 5IVHA 4I9NA 3W5AA 5IWCA 1ONOA 3W9BA 3B1YA 3ND8A 4LC9A 4FWTA 2Z3VA 2GPWA 5TPZD 5K0CA 2DC1A 5HJ7A 4XE5A 1RZUA 1V1JA 3KKMA 2XAUA 2FCAA 3HGMA 2FPXA 3A1EA 1I7SB 1O6ZA 3O4GA 4MUIA 4HWKA 4QPNA 2R6R1 3R7NA 3WZMA 1ZSVA 1CDOA 2HPAA 3C24A 4MQ5A 4YMSA 3WJAA 4ESEA 1GN9A 1UXJA 2AX3A 3MMXA 4PR0A 4XH9B 4JOSA 1G7SA 3MFQA 4X60A 4XPIA 1UBRS 1J97A 2XYRA 3L7CA 1ZY2A 2IWHA 4JFRA 5KNBD 4V0RA 4YXWD 1YS2X 3UMGA 3FWZA 2R8BA 4Z3OA 2XUIA 5FQNA 4W8OA 1TW2A 2CEAA 2ZTVA 3TLAA 5SY9A 1FFEA 1TJPB 1CS0A 5DNUA 2OQRA 4WZAA 3KQVA 1H2XA 4O2AB 4M7RA 3VNRA 1TECE 3D6FA 3QENA 5HEKA 4FX5A 3U0BA 4R8RA 2CSUA 2MMCA 3TDMA 1MA3A 2P9HA 1FSGA 3EOAI 3R7SA 1RJ9B 2DHDA 3K2QA 4OQXA