The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
149
|
sequence length |
408
|
structure length |
408
|
Chain Sequence |
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Moraxella catarrhalis
|
molecule keywords |
1-deoxy-D-xylulose 5-phosphate reductoisomerase
|
total genus |
149
|
structure length |
408
|
sequence length |
408
|
chains with identical sequence |
B
|
ec nomenclature |
ec
1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase. |
pdb deposition date | 2015-05-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02670 | DXP_reductoisom | 1-deoxy-D-xylulose 5-phosphate reductoisomerase |
A | PF08436 | DXP_redisom_C | 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain |
A | PF13288 | DXPR_C | DXP reductoisomerase C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Rna Polymerase Sigma Factor; Chain: A | Rna Polymerase Sigma Factor; Chain: A | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |