4ZQHA

Crystal structure of dox-p reductoisomerase in complex with nadph, fosmidomycin and magnesium
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
total genus 149
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqhA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqhA01
2HU2A 4MP3A 4LK3A 4PG6A 4R69A 4MVJP 4FR5A 3SLGA 1BRMA 1N92A 2D3TA 3AFNA 3AUTA 1X0VA 4MVJI 1VPDA 1V0JA 1JTVA 1DFHA 2ZJ0A 2JFHA 5K6AC 4UEJA 1EDZA 4NNJA 1S46A 3OEWA 5JDCA 4I9UA 4BO1A 3D4OA 2Q4EA 4QSMA 1H2BA 4CM5A 3PVZA 2PKQO 4NIMA 1KBZA 3CZGA 4IGFA 1J4AA 3E1KA 3IMFA 1S7CA 1SMKA 1MGOA 4ZU3A 2YDXA 4GGOA 5CEEA 3GH3A 5C5IA 2X1HA 3LC1O 3JQCA 3JQ8B 1KERA 2ZCVA 5B4VA 4AG3A 3EDMA 2HJRA 4KWHA 4OKIA 2Y68A 1P1IA 4CQMA 2OFPA 4D41A 1JU9A 3B1JA 4WLUA 5BNIA 3E9QA 1ZK1A 4NBVA 3KO8A 1JAYA 3E48A 3ITKA 3WWZA 4CM3A 3HB4X 1H6DA 4TKMA 1PL8A 5KNLA 1I2CA 1PS0A 1OR7A 2Y1GA 1RKXA 1MB4A 3KLMX 5F1KA 1QXSA 2Q4BA 1YBMA 4HP8A 2VNAA 1LEHA 3ANNA 1DC6A 2AXQA 1QORA 2NTJA 3N74A 4XRGA 2P9CA 2PKQP 2GDZA 1PS8A 1JQBA 4WNCA 4YQZA 2QX7A 3TFQA 4YYZA 5JY1A 5L7TA 1LDYA 1T2EA 2O50A 4M87A 2R2GA 1Y8RB 1KY5A 2Y1OA 3LQFA 2NQ8A 3RAJA 4D3FA 5IDYA 3S2IA 5FYDA 1B14A 1E3EA 2BD0A 2DTDA 5ICMA 3GEDA 1DEHA 1YBVA 4ZQEA 3DBHB 4W82A 4RZHA 3BYZA 1IE3A 3EUWA 3JD2A 2FRDA 1GUFA 1U28A 1N1GA 3DB2A 4LISA 4UVDA 1JW9B 3M6IA 1PZEA 4ZRMA 1MXFA 2AE2A 1PJSA 4H7PA 4L0QA 1HDRA 2H9IA 3LDHA 4JROA 3P5SA 4KQWA 4L4SA 4A2CA 1DPGA 1DC4A 1UXKA 3OJOA 2X22A 3E5MA 2EKPA 4FLSA 1ZSYA 3IUPA 1B16A 3AW9A 3K2EA 1XYGA 4IJWA 4RVUA 4B4UA 1B8PA 5L53A 3EK2A 1NFFA 4FFNA 4IPTA 4QTZA 1HZZA 1GZ6A 3ZHZA 4S1VA 2JFFA 4BMSA 3PFFA 4GWGA 3W4JA 5IDQA 2Y1FA 2E6UX 4JXKA 1QMGA 2P68A 5G4LA 1C0PA 1MUUA 3HHPA 1JDJA 2E49A 5H82A 2BKAA 4BIIA 2O2SA 3GUYA 2AMFA 2CMDA 4FQ8A 3QWAA 4AJPA 2JL1A 4XJTA 4CM6A 1I0ZA 3CPSA 5EESA 2ZB7A 1IPEA 3V1YA 1ZW1A 1DOHA 4XDZA 2EW8A 2JD0A 3MWEB 3L6OO 2VRBA 4NHEA 2AG8A 4CL3A 1VL0A 5K6AA 4M49A 1T2FA 2UUOA 3H3FA 3RUHA 3KYBA 3KRTA 3QHAA 5L45A 2B37A 4GWKA 4CMAA 4A27A 4M8SA 4PRLA 1Q0LA 1E1KA 4R3WA 4MVJH 5CP8A 1KYQA 3RKRA 3H4VA 1CWUA 3UVEA 5JFOA 3DBLA 4UVEA 3ZH2A 3INRA 4RDHA 3DZGA 3PQEA 4CMIA 2ZTMA 4HFRA 2YV3A 1LBEA 4K26A 2X58A 3KSDO 2W8ZA 1EVIA 4CXFA 1YWGO 1TT5A 2F00A 4D43A 3BHMA 2H63A 3BMQA 5CPFA 2IYPA 3I3OA 1T26A 4PLZA 1N8KA 4A0SA 3NYWA 8ADHA 1V9LA 2B36A 1GQQA 2IE0A 3STHA 3GZ4A 1D3AA 3RASA 2PFGA 1L1FA 4BNMA 3ZV4A 1I10A 3TRIA 2I99A 4EJMA 1NAHA 1ADBA 2AW5A 2NU8A 5I8ZA 4FLQA 1JLLA 1WNTA 2GN8A 3M2PA 2EW2A 2PGJA 2G17A 2O3SA 4ND2A 4Y98A 3ENNA 3SC6A 3VH1A 3RFVA 5L9AA 4IQ0A 1AN9A 3VDRA 4FSHA 1JKFA 2PV7A 4NMHA 1NFQA 1WMAA 2HCTA 1EE2A 4YJFA 1DLJA 4GLOA 5IXSA 3CZRA 5ENVA 1SCUA 3D7LA 1P77A 3WSWA 1KETA 4QECA 3PXXA 5BSGA 4NFYA 3KVOA 2UV8A 4RCVA 3ADPA 1XQ6A 1Z82A 1KVSA 2H1SA 5DZSA 3JQGA 4IJKA 3JD1A 3AWDA 4R1SA 4ALNA 1JKJA 4CLHA 2PH5A 1DRUA 4GLLA 1UJMA 2C54A 1NBOA 2C0CA 2ZTLA 5IN4A 1G0OA 2HMWA 3PJDA 4U0KA 2X86A 5IF3A 1CF2O 2HQ1A 2JAPA 4K28A 4ND1A 3U4CA 2VWGA 4GI2A 1U7TA 2AQ8A 4AJLA 3BMNA 4H3VA 3GVIA 2DLDA 4FD3A 2P4HX 2B4RO 1PIWA 4WCFB 3RBZA 3OP4A 2BFOA 1LSUA 2C5AA 3IKTA 4OAQA 4MKXA 4LW8A 3QVTA 5G0UA 3T7EA 1ZEMA 3OA2A 3JSAA 4JP3A 3X2EA 5L51A 4OGWA 4D42A 3QWIA 3UCFA 4OM8A 3OJLA 3QE3A 2P5YA 1T2DA 3FR8A 2X4GA 2Y0CA 2VYND 3ON5A 3SXPA 1TI7A 4BQRA 2FZEA 2VOEA 4E2ZA 1MFPA 1PJQA 2DPHA 2UUPA 3NTQA 4O59O 4PN3A 1GYPA 4BO6A 5JCXA 3HWRA 3R3JA 4B7CA 3MEQA 4EUHA 1FF9A 4FS3A 1LDNA 1Z6ZA 1P31A 1GYQA 3CKYA 3JQ7A 4GH5A 3AI2A 3U4DA 3ZNPA 3W8EA 4BGEA 1KOLA 4EI2A 3MJCA 1J49A 3JD3A 1KEVA 1B2LA 4IZHA 3BHIA 2P9EA 4CM4A 1NX6A 4C7KA 1BXGA 4Y9DA 5B1YA 3QLJA 2VUTA 5F5NA 5ENDA 3BZUA 1CDOA 3DQPA 1PZHA 2ZCUA 4B4OA 3GG2A 3LT0A 1U7HA 4GBJA 2Z95A 2D59A 3BHJA 1O8CA 4RPGA 3GDOA 2Y1CA 3GHHA 4DGSA 2VN8A 5TLSA 3RI3A 3DAGA 3ONFA 2ZJ1A 5AXDA 3JYPA 2I65A 2RH4A 2ZYGA 3CZMA 1F8GA 3I4CA 1ULUA 1NQAO 4XB2A 4PG7A 3VPSA 5KWEA 1ISFA 1DJNA 4PZDA 3RC9A 2BF7A 3ZNNA 2J3JA 4RLHA 1WAMA 3ETDA 4LRTB 1NYTA 2IYOA 3GC6A 1P1HA 3PZBA 1SC6A 2HAEA 2OBNA 5A03A 4DPKA 1PWXA 4LVUA 5T67A 2PZJA 5KJFA 4LMPA 8LDHA 3K2BA 4L4XA 1VKNA 3FNFA 2IDZA 3BTUA 3RQSA 2QYTA 5TQVA 3RROA 1QV6A 1HLDA 3H9GA 1HTBA 3WLEA 2BI8A 1M6HA 4TRRA 3HFSA 3MTJA 5FF9A 1UH5A 4RF3A 3ZWNA 3IAHA 4YVFA 4J0FA 4KZPA 4RPHA 3S2GA 4NU5A 1L7DA 4GX5A 1I32A 2ZYDA 2X0RA 3IQDB 2GN9A 4D3SA 2V65A 4DLLA 2PGDA 4XJSA 2E82A 3NDIA 1PGQA 3KYDA 4PG5A 4BKUA 5JS6A 1KVRA 1UDCA 1VI2A 4II3A 4RV9A 1D1TA 1ZO8A 4CM8A 2J5RA 1KIFA 2HMUA 3VZPA 3GK3A 1IOLA 3WYBA 3KB6A 3HQ4O 4K9DA 2W2LD 1BVRA 1FDSA 4JNKA 4RVGA 5DBGA 5G0WA 2C5EA 2FPIA 4XZ3A 1X0XA 3DBRA 1LNQA 3F1KA 3JD4A 5JAMA 3RUEA 4F6CA 3D4PA 1XCBA 1NQ5A 4GVXA 3RD5A 2B83A 5A3JA 5COAA 5JSFA 1NP3A 4E2WA 2OBYA 1TLTA 1E3JA 4F46A 1EDOA 1ZXLA 1EK6A 1X7GA 4YJHA 4RVSA 1C3VA 3OICA 4TVOA 5DBFA 4B8ZA 4JP2A 2IZZA 1IL0A 4QXMA 2P9GA 1RJWA 3G1UA 1R4NA 3UW3A 2DT5A 4PGFA 3H2ZA 2B35A 3NTRA 4IMRA 5EN4A 2O3JA 2CDBA 1LQUA 3PJFA 5BR7A 1HYGA 2D1YA 2J6IA 2Q1UA 4HY3A 4JQCA 2NVUB 4Q39A 2X6TA 1M2WA 4ZHSA 2Y99A 1OI7A 3Q1LA 4IJVA 4DPMA 5COQA 3WMWA 2WTBA 2ZIZA 3E03A 1Y6JA 3PYLA 5U4QA 1U1IA 2AE1A 3UN1A 4MDHA 2FR1A 2WEKA 3AI3A 1U5CA 3QV1A 1U2DA 5G2OA 1MW1A 1U3TA 2VT3A 3AOGA 3I9MA 2GR9A 4W99A 2ZATA 5JAZA 5KKCA 5JAIA 1H9AA 3E8XA 5J23A 1TA4A 2X0JA 1DJQA 1IYZA 3JD0A 5K0ZA 3DBVO 3DMTC 1E1NA 3JQAD 3NJ8A 1NPYA 2ZK7A 1N5DA 3L07A 1QLHA 3JQAB 5L7WA 1A9YA 4AJOA 5DCWA 4IMPA 1E5QA 1PQWA 1Y8QB 2HUNA 1JWAB 1UP7A 2Y05A 3GDFA 1RM4A 3H9JA 3JCZA 4CM9A 4PG8A 1RYDA 1C1DB 3H2SA 9LDBA 4E5PA 3FWZA 4EJ6A 4WUVA 3HUDA 4TROA 1HE4A 1NVMB 4D79A 4HNGA 1R4MB 3L6DA 3IL2A 1N9GB 4O63O 3WB9A 3W4IA 3BIOA 3WR5A 5LDHA 1LSOA 2C82A 3M1LA 3QP9A 4MP8A 5EL0A 1EE9A 4ZICA 4YRBA 5L4SA 4BNZA 4N7RA 3UERA 2J5QA 1JVSA 1BVUA 2HMVA 5KJEA 4CLRB 2ZQYA 5CEFA 1MFZA 1GADO 4OYRA 2HK7A 2DUUA 3GZNA 1D1SA 2NQTA 1HE2A 1KY4A 1ZK4A 3LC7O 1D4FA 1R12A 4FLRA 3DFUA 2IODA 4J1TA 5L7YA 3IKVA 3NDRA 2PY6A 4B79A 1FK8A 4FBGA 4N5MA 2JHGA 1MVYA 3F5SA 1E0DA 1ZH8A 4LSMA 4CMKA 1OOEA 4PLCA 4CLXA 2H5LA 5I7VA 2WD7A 3WIDA 3L4BC 5G4KB 4XCVA 2AEJA 2OOSA 5DT9A 3ASUA 4J9UE 1P0FA 3H3JA 1P74A 4CMEC 1MG5A 3DZJA 4YJGA 3ZWAA 1Y5MA 1RM3A 4R3NA 5I9MA 3HJAA 4TZTA 5FFFA 4LSWA 2YHIA 1ZS2A 1YL5A 1O0SA 1KVTA 3M2TA 5A9SB 3D3WA 2DBQA 3GRPA 3ZWBA 1LSSA 2O23A 4UUNA 3TL3A 2I66A 2OP0A 2WYWA 3CSDA 3DHYA 3JQDA 1HRDA 3SEFA 4ALLA 3PI7A 1JA9A 3QW2A 4K6FA 5A9TA 4D0SA 2GO1A 3GFBA 1YQDA 3MWDB 3O38A 1QYVA 1GV0A 4BV9A 4DMLA 1HSZA 3JQEA 2GN4A 2PR2A 1E7YA 2D8AA 2B5WA 2BRUA 5ITVA 4HBGA 1EZ4A 1NR7A 2BGKA 3WBBA 3MOIA 1T25A 4A10A 4MIEA 4LVCA 4E5MA 2V6MA 1GCUA 2X8LA 3ETEA 1E77A 1A4UA 4UAGA 3DMTA 3G79A 3GRKA 2RH8A 3FNGA 3K73O 4ALJA 3GQVA 1ZJZA 5THKA 3WG9A 1C0KA 1ZJYA 4MVJM 4WKGA 4XIYA 3DR3A 3GGPA 3LU1A 4D45A 3ADOA 4R1NA 4XEHA 5KJ6A 1T4BA 4D7AA 4Z9YA 2OL4A 3HFGA 2G0TA 3NT4A 2CZCA 3OSUA 1PGOA 3RBVA 2AHRA 1KEPA 3HSKA 4IQ8A 1GFSA 1XG5A 1LC3A 4E30A 5A3VA 5JYEA 1VL8A 1TB4A 4ID9A 4OQZA 3VH2A 3BA1A 5GZ3A 5KJCA 2ZB8A 4AFNA 3OH8A 5ICSA 2GD1O 3ASVA 1QRRA 1DLIA 1I24A 3DFZA 1HLPA 2G1UA 2HKIA 3TSCA 4NJMB 2TMDA 2ZTVA 4WE3A 3ZWXA 4RPJA 2P2SA 1ADGA 2IZ0A 3WGGA 5KVCA 2EERA 1DRWA 2BFMA 1H3LA 5JNLA 4CLOB 1H2HA 1DIRA 2Q45A 4HFMA 5TX7A 1K6JA 1KVQA 4E12A 4HX5A 4YTEA 5A5EA 2O4CA 4AJKA 4WK6A 4YB8A 3HDYA 1GYRA 2DBRA 1NTOA 3RKUA 3E82A 3UF0A 2I3GA 1A5ZA 1R15A 2IRWA 4E3ZA 3JYNA 4OIMA 3CZKA 3AM3A 3L4BA 2DPGA 3WMXA 2VUUA 1Q7CA 3L9WA 3S1LA 1H6AA 3HZZA 4QFCA 3U5TA 4ZGWA 4CMEA 3ZW9A 3T4XA 1QV7A 1VE9A 3K5PA 1C1XA 3TZKA 1K6XA 4QT0A 4W7IA 2VRCD 4NH4A 4ZRNA 3ZDFA 1GQYA 1N7HA 1GU7A 5IDXA 1ISMA 2FP4A 5KVQA 5F1PA 3F4BA 4BNVA 4YACA 3KUXA 4BO7A 3B1KA 2RHCA 3VVBA 2GZ3A 4DWVA 3KM0A 3DHEA 4UUOA 1UXGA 4IDDA 2FSSA 4PLPA 4BNYA 2YFHA 4DUPA 2Y0DA 1OZAA 4IBOA 4YAKA 2QZ9A 3KHUA 1YXMA 1FJHA 3BMOB 2H6EA 3PWSA 1XA0A 3RU7A 2DBVO 2QQ5A 4RJTA 1LC0A 1KC3A 3KEOA 5JCJA 4W4TA 4DL9A 3GR6A 4EEXA 3PGJA 4MKRA 3U9LA 2CD9A 4EEZA 3NEPX 3JV7A 1U4OA 4F6LA 3UAGA 1LDBA 1WLYA 1LA2A 2NWQA 4BNNA 2ET6A 5JMWA 3FPCA 4RQUA 3MJSA 1Y8RA 1I3NA 4E13A 4ZVVA 2PGLA 3V1TC 1ZK2A 4CQMD 1YRLA 3JYOA 1SOVA 5JCJD 2X0IA 3GY0A 3UKOA 4CQMB 3ZV6A 3HE3A 3ZWVA 3I4FA 4XRRA 3ANMA 1Z45A 2AA3A 3OJFA 3Q0EA 5H81A 3WGYA 4OOFA 5I7SA 4XQEA 2VZ0A 5BSFA 2DC1A 1V35A 4FFOA 1QG6A 5TGDA 4QO7A 1HXHA 4J7UA 4ND3A 5I8WA 1DIBA 1UZNA 5JBIA 1KEWA 3Q3CA 4DQXA 2PD4A 4E21A 4XGKA 3WQSB 2HK8A 2BMAA 1ISJA 4IUYA 1E1LA 4OQYA 2O7QA 3GF4A 4YRDA 1YOVB 3QWFA 5IXYA 5EPOA 4HNHA 2VNSA 1EFKA 3HNPA 2QW8A 5T8KC 4RDIA 1SZJG 5EJ2A 2E4AA 1LU9A 5TJHA 4WCFC 4JJGA 3PFWO 3X2FA 2HO5A 4BO0A 3W1VA 1E7MA 1I8TA 1JG9A 5TSDA 4UVGA 1VLLA 1YKFA 4R01A 4BO5A 4WECA 3CZEA 2GASA 2Y67A 4YR9A 4RPKA 2WM3A 5EINA 5DF1A 1YO6A 4YQYA 3QY9A 4EYEA 5IAAA 4UVHA 3WXBA 3L9XA 4I5EA 5EMHA 2PA3A 4FJ2A 3UFXA 3ZWWA 3E9MA 5GZ1A 4GVLA 4NQZA 1XGKA 2I3AA 4F45A 4PVCA 5CDSA 2VOJA 1Q7GA 3H8VA 4IM7A 4XD2A 4BGVA 4CLEA 2Y66A 3ZWOA 1O89A 4AJHA 4L75A 2Y1EA 1AHHA 1ZIDA 1LLQA 3EW7A 1DSSG 4CMBA 5B4TA 1P1FA 1WW8A 1P1JA 1EUDA 2BHLA 2X5KO 3I9NA 3DTYA 3JQBC 4FPXA 5CHEA 1PJBA 4GSKA 1VC2A 2WYUA 3LVFO 2UVDA 3NV9A 2FSVA 5DCYA 2CF6A 5DP1A 2PK3A 1EFLA 1LQTA 1XR3A 3O4RA 3H9UA 3QIVA 4LCEA 3WGZA 4YT4A 5FWNA 1YDEA 5JO0A 4W9NC 1K5HA 1LTHR 1OBFO 2YV1A 3DBLB 2EJWA 4M86A 1Z73A 3AOEC 3WFJA 2EP5A 4LCJA 1C0LA 4I5GA 2UYYA 4CMIB 4I1IA 4NU6A 5DCUA 4ALMA 1ZSNA 2YJZA 4BNWA 1DIAA 3GFGA 4E5KA 2RAFA 3I5MA 5TT1A 1I36A 2O7SA 1TT5B 4FGSA 3TOXA 2FY8A 3BMQB 4JK3A 3RIHA 1W73A 2AEMA 3TQHA 5KCZA 3E18A 4IGEA 5EERA 2DFDA 2HMTA 4CQLA 1ONPA 5L4NA 2ZYAA 3PPIA 1HZJA 1EMDA 3AU8A 3G49A 2FR8A 5BQFA 4K6CA 3OQ1A 1DHTA 1PJLA 3LK7A 1D8AA 4FGWA 2V6GA 2PZKA 4S3MA 2Y0EA 3P19A 3PHLA 1LLUA 3ICCA 3VTFA 2I76A 2EKQA 1JN0A 1ENOA 2GN6A 4WASA 3VPGA 3WQQA 1M6WA 3PLNA 1B3RA 1GPDG 1M75A 5F1OA 4FFPA 1K89A 4XYEA 4RGBA 4RPLA 3FTPA 4YJFB 2IEBA 4WCFA 4J4TA 4MPDA 1GDHA 2CUKA 3H9EO 4YEDA 1E7RA 4D44A 4FOSA 1NM5A 4P22A 1MC5A 5A05A 3H6KA 2X5OA 3CE6A 3JQGB 3O03A 1EK5A 3D0OA 1LJ8A 4PLYA 1DRVA 3DEYX 1HDGO 1TXGA 4FC6A 3VZRA 5A04A 3FF4A 2PNFA 2VT2A 3BTVA 3NTOA 4FJ0A 3KZVA 4XR9A 3TWOA 4E4YA 3UHAA 1ADCA 4JBGA 5CFZA 5HS4A 1LDMA 4NI5A 3EYWA 3EMKA 1BGVA 1R16A 4XYGA 1NAIA 1ENPA 3VH3A 1J0XO 3PK0A 3PIDA 2Q49A 3NGLA 1PJ2A 4DXHA 4DBVO 3BMNB 1XEAA 2P5UA 2YQ5A 3HG7A 2QHXA 5F21A 2C29D 3DO5A 3CH6A 2EEZA 3UOGA 1H6BA 3O26A 3FRJA 3GNQA 4IXWA 1FXSA 4DPLA 2AQIA 3KXDA 1H94A 4WEOA 1KC1A 3KEQA 5F5LA 5A5FA 1A4IA 3PIIA 3JQBA 4J6FA 5ER6A 1LRLA 4TZKA 3MOGA 2VWPA 3EZLA 1O95A 4Q3NA 4GGPA 3W4KA 5KIAA 5HS6A 4TRJA 3ZWYA 3TZQA 4DC0A 4OXKA 4GKVA 2YDYA 2NACA 3WJ7A 2FHSA 1LLCA 1PEDA 1Z7BA 5DULA 1HDCA 1L7EA 4IS3A 3Q2KA 4Q9NA 3JQ7B 3ZN2A 2YV2A 4GAEA 4W9NA 3VHRA 2XXJA 1PU2A 4ALIA 1MW0A 3AOEA 3HB5X 4FDAA 3UXYA 3H65A 1ZEJA 1LRKA 3D5TA 3PRJA 3I9OA 4M54A 4CM4B 1W8DA 2NU9A 2EIHA 1NWHA 1DXYA 3F3SA 3NJ4A 4P4LA 4Z0HO 4YAIA 3D64A 2VHWA 1HF3A 4P4GA 3NUGA 4BUCA 3T0YA 3F1LA 1M66A 1I01A 2EHDA 4CV2A 2CVZA 4ZD6A 5DDIP 2R6JA 4B8WA 5CG2A 1UDAA 4DIFA 3PQDA 1X1TA 5HTOA 2JHFA 1ZK0A 3GEGA 1FDWA 1ID1A 4IS2A 1Q7BA 1E3WA 2YUTA 2Z5LA 3H7AA 4AJNA 4D3DA 2O2YA 1GUYA 1M67A 1GY8A 3W8FA 2B69A 4XB1A 4Y8VA 4FOOA 3VZQA 4DYDA 4P4NA 3KBOA 1WZEA 1EUZA 2PTGA 3ENKA 1R0LA 3VZSA 1O9BA 1UP4A 1VL6A 2G82A 2V7PA 3PYXA 3ZNQA 3OJEA 4Q3AA 4FFRA 3PP8A 4BNFA 4HKTA 2D2IA 4FC7A 1UUFA 3D3EA 4O1MA 4I9NA 3WBFA 3BTSA 2W2KA 2JCVA 4Y67A 3AJRA 3O8QA 4DA9A 3B1FA 4PG4A 5LDGA 5BSHA 3FBGA 3AUSA 3OETA 3RJ9A 4BHTA 2O7GA 1DO8A 3NT5A 1DAOA 4GMFA 5JDIA 3UEQA 3A06A 5I9NA 4KOAA 5C3MA 5GMOA 4B4WA 1KEUA 4LRSB 4DIBA 1PGJA 4JCOA 3PDUA 4J2OA 4OH1A 2OUIA 3C1TA 3C24A 3PLRA 5DN9A 3TN7A 1MW2A 2W98A 4NBWA 5DP2A 4CODB 1GTMA 3DAPA 3OIGA 3CUKA 3LLSA 1ZKMA 3DZFA 4OSPA 3ORFA 2O3UA 1U8XX 1EQ2A 4KQXA 3KYDB 4MIOA 4U8GA 5I7EA 1E3LA 2A9FA 1E7WA 3MJ4A 3R0IA 4LN1A 4JGBA 4YDRA 3WSVA 4Z6KA 2O3TA 4A73A 4PFJA 3ABIA 3P7MA 2J5KA 4CM8B 2DTXA 4N5LA 3IS3A 3UGKA 1K2WA 4EZBA 1G1AA 4PLGA 1W4ZA 2ZB3A 3CIFA 1QYDA 4RLSA 4MVJF 4AL4A 4A5OA 2WWRA 4JN6B 4DREA 4Y6SA 1VJ1A 3GNSA 2YZ7A 1R37A 4KTVE 1FDVA 2GGSA 3GN1A 4UEOA 4KWIA 4I5DA 4YCAA 4EGFA 1ZVMA 2RIRA 2ZQZA 3SX2A 1I3KA 3ST7A 3A14A 1KS9A 2ILTA 3KYCA 1S6YA 4YJHB 4QX6A 4BB6A 1XDWA 1RP3A 5TRTA 4EJ0A 1QR6A 3WTCA 1UXJA 3MJTA 1I2BA 4IINA 3QVSA 1HDXA 1SO8A 2BGMA 3G0OA 1VSVA 2ZTUA 1ADFA 5GZ6A 3IP1A 4HADA 3OM9A 3S2FA 4I9HA 5JPIA 1ZNQO 4KP7A 3G1TA 3UCEA 3DWFA 1AHIA 1E1MA 2B5VA 2PLAA 3UH1A 4CR7A 4XGIA 3UCXA 3SJUA 2B0JA 4X54A 1GAEO 3NT2A 3G17A 1WDLA 5AXCA 4J3FA 5ADHA 5I9LA 3WNQA 4QO8A 2NADA 2Q2VA 4AJ4A 4KUHA 1A27A 2PZMA 3U4IA 4R9SA 3BMCA 2FMUA 3AY7A 3F9IA 5AYVA 3WYEA 1HDZA 1P1RA 5ILOA 2Q1WA 2C2YA 2FZWA 2G76A 2WE8A 4BB5A 4QQRA 4L9RA 4FB5A 3ZV3A 1PZFA 4CMGA 4OMUA 2DM6A 4CLRA 1ZBQA 3NKLA 4Q3BA 3ZU5A 3VPXA 3LC2O 1YQGA 4G81A 4CM9D 3WYCA 1M76A 2A35A 1HEUA 1EVJA 2YFQA 5G0TA 2OORA 2Q46A 4MJLA 3OA0A 4CUZA 3AY3A 3BTOA 5DOZA 4QUKA 4RZIA 2WYVA 2X9VA 4NBTA 4BO4A 4BVAA 1CETA 3Q6IA 4E5YA 4GX2A 1PR9A 4PVDA 3AUUA 4R68A 3QVOA 3T4EA 4E32A 1WZIA 1W6UA 3RUFA 3DL2A 1EEHA 1LSJA 3OECA 4NR0A 4BO9A 1F06A 3IUSA 1TVEA 3EGOA 4P8RA 3EVTA 5BNFA 2CY0A 1CYDA 4YBZA 1Q2XA 2QYSA 3SLKA 1CEQA 3IP3A 4GKBA 3GZNB 3WGHA 3GAZA 1XWFA 4AJEA 1IUKA 3JQFC 4WOKA 4MKZA 4M89A 1EVYA 4U0JA 5TS3A 1Z75A 4B4VA 2PKRA 2VHYA 4RVFA 3GLQA 4J0EA 3OIDA 3I23A 3H5NA 1GV1A 1XHLA 4L8VA 2EGGA 2Q2WA 3IC5A 3S2EA 2BFPA 2PWZA 1YB5A 4HV4A 3B20A 3RCBA 5MDHA 4YPOA 2VYVA 2YYYA 1E6EA 2WD7B 5FI5A 1ORRA 1HL3A 5T5QA 2NLOA 2VZ8A 4DLBA 1OMOA 1V3VA 4YJGB 3RUCA 4G65A 4OXNA 3ROQA 3H5AA 1YB4A 3LF1A 1P9LA 4XQGA 5ES3A 4O6VA 2OZPA 1HYHA 1NVGA 3H9QA 5T64A 4EITA 1T1RA 1SPXA 2VYVD 4XDYA 1J6UA 1V6AA 3D3WB 3N7UA 1GD1O 1B3BA 4BNJA 4D0RA 3RBXA 1LI4A 3ULKA 5K9ZA 3TNLA 2NU7A 4WGGA 5TT0A 2GPTA 2C7GA 3HDHA 4CMJA 4Z0TA 4J90A 3AK4A 4FN4A 3C7CB 4RL6A 1WVGA 2E37A 2ZKLA 4HWKA 1KVUA 3AFMA 5KTKA 3TJRA 2VHXA 4J91A 5JAQA 5JYDA 1ONOA 4BKQA 4BNUA 1EBFA 5CDTA 1NPTO 2J3HA 2EXXA 3A9WA 3SC4A 4Q3CA 3GOHA 4XQCA 4WNIA 3ZWMA 1HT0A 5DBIA 4N5NA 1MA0A 1T4DA 2Q50A 3E9NA 5JO9A 2J3IA 3GVCA 3U49A 2JJYA 3V1UA 2DBZA 2C7VA 4AYSA 1YVEI 4C4OA 3WJAA 1FMCA 1XKQA 3IJPA 3LF2A 2DKNA 3PZRA 1DC5A 4GX0A 5TIIA 4AJJA 2I6TA 4XX0A 1B8UA 2EWMA 4LMRA 3WGQA 1XU9A 1G5AA 1R0SA 3U0BA 2E48A 4JLWA 4F3YA 2DFVA 4CL8A 3CXRA 3Q9UA 4J4BA 4YJDA 1JGIA 3Q11A 3KTDA 1BW9A 4PZCA 4CV3A 4CV1A 3ZWCA 3WWYA 4KTTE 5IZ4A 1DBVO 3DOCA 1NNUA 1O94A 1ISGA 5EQFA 4P38A 2GERA 1X1EA 3DXFA 4N54A 2BFAA 4CJXA 2V6FA 1UAYA 1OC2A 1OC4A 1AUPA 2NVWA 3P2YA 1WDKA 1F8FA 3Q9NA 4YAEA 3ZZNA 2PD3A 5T57A 1NHGA 3L77A 3JQFA 1GUZA 1F17A 4M1QA 4EUEA 2I9PA 1YDWA 3MJEA 3PWKA 2WJPA 3NAQA 1ZFNA 4DQVA 4E5NA 1K0UA 1YL6A 4IDGA 4RF5A 3V2UA 4ZQBA 1FDTA 1SEVA 3OJ0A 2Q1SA 4UVIA 3WFIA 2NTNA 3GPDG 1H0KA 4WLVA 4E2YA 3C1AA 4YT8A 2NV6A 3GHYA 4B7UA 1IHYA 1HKUA 1P44A 2PD6A 4CUKA 3JYQA 1NR1A 3JQ8A 4M55A 1H9BA 2CFCA 3BMOA 4Z0PA 3ZU4A 5B12A 1QP8A 2HJSA 5HA5A 5CDYA 4U5QA 1HWYA 1C1XB 4TWRA 3ZI0A 1RYEA 2YW9A 4PLWA 4N18A 1PGNA 5TC4A 2G5CA 2Y1DA 2DQ4A 3ROMA 5AXAA 3ZU3A 2GSDA 3I9KA 3VTZA 3OIFA 1BDBA 1MXHA 3I9JA 3K8ZA 1WDMA 3CMMA 3K31A 3VC7A 1X7HA 5A4DA 1N1EA 2BI7A 3RJ5A 1EUCA 1LRJA 5EIOA 3ROPA 4B3JA 5CG1A 3CMCO 4NZ9A 4B7XA 4ZJUA 4B3IA 2XPCA 2WPGA 1CQJA 1LUAA 1YE3A 4R16A 4R1TA 1XLTA 3DBHA 4JJFA 5L95A 3A1NA 1N2SA 2GCGA 3O9ZA 3SBOA 3JTMA 1B26A 4HXYA 2LDBA 2WD8A 3D1LA 1A9ZA 1CJCA 3TPCA 3DZKA 2NTVA 4E33A 1ISHA 2P4QA 4PZEA 4NQWA 3WX0A 3RWBA 3N58A 1PS9A 1U3VA 5C7IO 4ALKA 1PGPA 3INTA 1UDBA 3I52A 4MO2A 4TSKA 2FPGA 2Q99A 5IG2A 2V6BA 5BNTA 3I9LA 1YOVA 5CPBA 4GPD1 1ARZA 1F0YA 1GQ2A 3PJEA 1A7KA 1Q0HA 4BNTA 4DQUA 5HRUA 3DZBA 4IIVA 3GVHA 1B15A 2MAPA 3WTBA 3BAZA 2I5PO 1G6KA 4MIYA 1BWSA 2AEFA 4UREA 3ZV5A 1U9JA 5BSEA 3BXXA 2BELA 4XWYA 1YQXA 5L3ZA 1RPNA 3EY4A 1UZMA 2DVMA 5ER9A 4YAJA 2Y93A 4HUJA 4MINA 2HDHA 1PSDA 4URFA 2LDXA 1NHWA 1BXZA 4BNGA 3GEMA 2VWHA 1H6CA 1EVZA 5A06A 1YL7A 5HBRA 2GNAA 3GVXA 2WSBA 4PLFA 4IXTA 4UUPA 1DHRA 3L4SO 4YT5A 2CVOA 4R4JA 2J8ZA 2VHVA 3TOZA 4EDFA 3VDQA 4INAA 3DAFA 3OQ6A 4J16A 3GMSA 2JAHA 3VKUA 3WS7A 4IDEA 4BO2A 4DMMA 3COSA 9LDTA 4BNKA 4ZQGA 1PQUA 1B0AA 2W90A 1MG0A 4XA8A 2WE7A 3QWBA 5KVSA 2JD1A 3OBBA 1HE5A 5JY6A 4AICA 1U3UA 1XU7A 1LDEA 1NFRA 3ZHXA 1SAYA 1SOWA 1WWKA 2YQ4A 2NVBA 3D4NA 3L0DA 3PHHA 2OXIA 4CMHA 3QJ5A 3IIEA 1W0CA 2HLPA 4J43A 3OF2A 4PLHA 3FBTA 4YWJA 2OP1A 1WPQA 3IJRA 1NWCA 2OMEA 3GVPA 5JW6A 1LXCA 1SEPA 1E3SA 4OXYA 1YGYA 4QEDA 1Q1NA 1VKOA 2C20A 1QSGA 4RORA 2WDZA 4TKLA 2IZ1A 1A71A 5A1TA 5CDGA 1U8FO 1VJTA 4BOYA 2X9NA 1P1KA 3DONA 1E5LA 2CDCA 2X0NA 2VTEA 4BKRA 4L74A 4JX8A 4CV0A 1H93A 5HM8A 4BMNA 1Y7TA 1I3LA 5L4LA 1DDOA 1SBYA 2JCYA 1WXDA 3C3XA 3DMYA 3GNTA 4DRYA 2VUSA 2WMDA 4GMGA 4I8XA 5CDUA 3HDQA 1HYEA 3GA0A 4R1UA 2EGHA 1CIVA 2QRJA 5FEUA 1YB1A 3EAGA 1BXKA 2XXBA 3KV3O 4Z3DA 1NQTA 5CEJA 3U4HA 3RC7A 3VH4A 4BMVA 1YJ8A 2NUAA 2HK9A 4D46A 1SB8A 1ZCJA 1IPFA 3CEAA 4BV8A 1WMBA 1PTJA 1UAGA 5IZCC 4XKJA 2FOIA 4J1SA 2VQ3A 3RUIA 1XIVA 3LZ6A 4A26A 1QYXA 3DHNA 2RCYA 1AE1A 3AU9A 1WP4A 3C8MA 1QYCA 2NSDA 3V8BA 4GQAA 3WQRA 1ENYA 2O3RA 1ZUD1 3AY6A 3PHGA 3FR7A 3ZNOA 2EP7A 3F5QA 5T8KA 4KUEA 4OOEA 3TL2A 4AJ1A 3DC2A 1R6DA 4CQLB 3VPHA 1MC4A 3GUCA 1DIHA 4Q3EA 1MP0A 2BGLA 1DB3A 1Z7EA 1P33A 4L73A 4BO3A 1MV8A 2VCYA 4BKPA 5DNAA 4J7CA 2AQKA 3FNEA 3DDNA 2IXBA 3K92A 3VVCA 4GX1A 5C7OO 5MGBA 3R1IA 4YRAA 1B7GO 3GGGA 4WPGA 4R54A 3LT2A 3F4LA 3EVNA 4J7XA 4EUFA 2IEDA 1HSOA 2YHUA 3K9QO 3PHIA 2CDAA 2X5JO 2VYNA 2R00C 1QKIA 4BO8A 5BT9A 3INGA 1GZ4A 1UZLA 4C7JA 5FI3A 2NNLD 4R51A 3NDJA 4FCCA 1B8VA 4GSLA 3DTTA 3RC1A 3PHJA 3VOSA 4II2A 2YY7A 1VJ0A 3MJVA 2GLXA 2RBEA 4J49A 1ONNA 1SC5A 5B37A 1X15A 3DZHA 2NU6A 1XELA 1K6IA 3F46A 4I5FA 1SB9A 1PWZA 1NXQA 3LT4A 4GL4A 5AQ1A 2XOXA 1AXGA 2DU8A 2FN7A 1BMDA 2P91A 5KVVA 3TFOA 2A92A 4L4RA 2J3KA 5LC1A 5JC1A 4JBHA 1E3IA 5T6BA 4ONEA 1VM6A 4EBFA 4TMFA 1JKIA 2JKVA 2NM0A 5IJZA 4IDBA 5JC8A 5U9CA 2Z1MA 4OHUA 4Z9XA 3RFTA 2QZZA 3PGXA 3V2HA 3GN2A 4DC1A 1T2CA 1X13A 2CVQA 4NBRA 4LUPA 3TZCA 3SVTA 1R0KA 1HDOA 1I2ZA 3GAFA 3WLFA 2AG5A 3A28A 2JD2A 3IDSA 1AGNA 4BS9A 1U3WA 1BXGB 3F6YA 5JE8A 1P3DA 4BQPA 1MW3A 3FI9A 5H83A 1GL3A 2EG9A 4MOWA 4H16A 1GCOA 4OL9A 4ND4A 2Q1TA 1U5AA 3V2GA 3NRCA 3RUAA 2O4UX 1Z74A 1TT7A 2F1KA 4J1NA 5EQDA 1ML3A 3ZGYA 2AQHA 4DBZA 2X7HA 2MAOA 6LDHA 5IZCA 2EV9A 3AUAA 4ILKA 4IZIA 1LX6A 1V3TA 3PEFA 3FWNA 4MP6A 3QWHA 1E6WA 3ZHYA 2CSUA 4FW8A 4CPDA 1E92A 1NVTA 3FSRA 4ND5A 2GYYA 1UXIA 1IB6A 1HETA 3ANLA 3EC7A 1A7AA 3ROKA 1Y81A 1IZ0A 4J4HA 4Q3DA 4L76A 1N7GA 1RM0A 4U7WA 3JQ9C 2IXAA 3ZCXA 4FFMA 4Z9FA 3ZHBA 2OGUA 3CTMA 1E3WB 3T7CA 4XYLA 3M1AA 4CMCA 4FJ1A 4KDEA 3C7DB 3MTGA 1YBAA 4WCDA 5ITWA 2PH3A 4J9VA 2A4KA 4DLAA 2W2LA 5A9RA 3B6ZA 4HFJA 3I1JA 1K3TA 4UEKA 4EW6A 3R3SA 2A94A 3U09A 1LLDA 1ZMOA 1E6UA 1ZXBA 1IZ9A 2R00A 4XQ9A 5JLAA 3VPFA 5L40A 4NK4A 4XYMA 1XSEA 2W2KB 3MZ0A 2XF8A 3O8QB 5IDWA 4IY1A 1LDGA 3ZU2A 1PJ3A 5JMPA 1Y1PA 1YONA 3FNHA 5CAEA 3S8MA 5GY7A 3PQFA 1E7SA 2BH9A 1CERA 1BHSA 3KSUA 1CQIA 1NQOA 2C59A 2EKLA 2QG4A 4Y6PA 3CINA 3F47A 3LT1A 1TEHA 4CM1A 3Q2IA 5IFLA 5HWSA 1UR5A 4BNLA 2NVUA 1Q0QA 4FFLA 4CLDA 1C0IA 1MX3A 7MDHA 3DBRB 2B4TO 4DVJA 4TRNA 1I33A 2D0IA 1GPJA 3LSYA 1D7OA 4OKNA 3DZIA 3WGIA 1A72A 4NK5A 1RWBA 2QIOA 5TJ9A 3C85A 4J2HA 2VTDA 2TMGA 5I7FA 1EQUA 4WLFA 3KOUA 1X14A 4B3HA 2ZB4A 3K6JA 4KMSA 1E7QA 1H5QA 2Q3EA 3I83A 3I6QA 3K96A 4NJOA 1ZZEA 3NGXA 2D4AA 3UCQA 4AVYA 2HSDA 2VZ9A 4Y6RA 1R4NB 3KLPX 3LYLA 4G5HA 4LGVA 4AJIA 1UXHA 3B70A 3OQBA 2UDPA 3W6ZA 5KOIA 3OMLA 2QRLA 4NG5A 3FN4A 4JBIA 3ICPA 4NPCA 4BKOA 3RU9A 1AXEA 1PR3A 3JQAA 4G2NA 4ITUA 4A7PA 1Y8QA 1IY8A 5U1PA 4RVDA 3PTZA 2D5AA 2EJVA 3OHSX 4FLOA 4U6SA 1C1DA 1YH3A 4WEQA 1V3UA 2CNBA 3KYCB 2GZ1A 3RVDA 3HN7A 3FPLA 4UULA 3EHEA 2QRKA 1GEGA 1HDYA 4UUMA 4W7HA 1GEEA 1R4MA 5JXWA 1N9GA 4IJUA 1UP6A 2O48X 1HE3A 3U3XA 3GMDA 1BTOA 3G3EA 4CUJA 3RSHA 5AOVA 4YA6A 3ZWPA 4XGNA 4U6QA 1U2GA 4J1QA 3ONEA 5C7LO 5B4UA 1DFIA 4CR6A 1SNYA 3RFXA 1DAPA 1YJQA 2DAPA 5AVOA 3OEYA 1T1SA 3JQ9A 4IDFA 1PL6A 2HMSA 3C1OA 4H15A 3WIEA 3UUWA 4XR4A 1OFGA 1V8BA 3TZHA 4BNHA 2X23A 2GRAA 2VWQA 3BMCB 1P0CA 3S55A 3K30A 4OSOA 3W6UA 3L6EA 2Q2QA 4ROSA 5TNXA 1ZMTA 3ETGA 3NX4A 3QQPA 2OO5A 3EZYA 3FHLA 3QVWA 5G4KA 4DTIA 3GG9A 4NBUA 3ITDA 1X7DA 3ZW8A 4ZQHA 3C7AA 1G0NA 3HN2A 3DOOA 4IDAA 1I5RA 3TZ6A 3U62A 3WGTA 3LLVA 3SJ7A 4PLTA 4E2XA 1VSUA 1Y9AA 2C07A 4PIVA 4WJZA 1O5IA 1VRWA 3TF5A 1ENZA 1DC3A 4IDCA 5TF4A 2FPPA 5A9SA 4FIZA 1C14A 3WGOA 3FD8A 1NPDA 3WNVA 2D5CA 1R66A 3RUDA 4RF4A 5LCXA 1GR0A 3WICA 4R9RA 2XAAA 1Y9EA 2RHRA 2BLLA 4R5MA 4RQTA 3I6IA 1FDUA 2DTEA 4XIJA 3KETA 3GDGA 3VKVA 3W8DA 4TQGA 3GT0A 3JQ6A 5A02A 4BGUA 5G0SA 2HRZA 4HFNA 1IHXA 2B4QA 3PWZA 3JYLA 4E31A 3DOJA 1PJ4A 3HADA 5KJ1A 3WDSA 3QRWA 4BNIA 4DIOA 5F3RA 4KUGA 3WOHA 4Z3KA 5JDCC 1JVBA 1OAAA 2GF2A 2Z1NA 3QSGA 5ILGA 4MVJE 4E0BA 2YHIB 1PL7A 3ONDA 1ISIA 4KDFA 3AI1A 3QA9A 3PYMA 1BDMA 4ZA2A 4RO0A 2X9GA 1DIGA 4ZN6A 4PRKA 1QLJA 4WLNA 3AM5A 1I3MA 2CF5A 3H5RA 4R5HA 2JFGA 2O3QA 2DUWA 3PDJA 3HDJA 2C2XA 3E5RA 1U4SA 2JCXA 3KSZO 4IQGA 1JAXA 1I30A 5G0VA 3FCOA 4ZQFA 4CM7A 1Y5RA 1F14A 4BL5A 4DYVA 2GUGA 1RM5A 3PJGA 1MLDA 4K1LA 3QVXA 3VAZA 4BNXA 5IN5A 4JIGA 3D5QA 4MVJG 4NFHA 4PCVA 3GGOA 1JWBB 2POQX 4I08A 5AXBA 3P2OA 3TDKA 1PJCA 4W6ZA 2EF1A 3FTNA 1CRWG 1T2AA 4YAGA 4OJNA 1F12A 4RVHA 4NJMA 4OO3A 3R6DA 4TVBA 1O6ZA 2I67A 2FR0A 7ADHA 3A4VA 4XYBA 1ULSA 2GZ2A 4WOJA 4O0LA 4YXFA 4JJIA 3V5NA 3OFSA 1YS4A 4CLOA 1QYWA 1XQ1A 1DFGA 2W4QA 3AM4A 3E6AA 4R41A 3GPIA 1EBUA 4CR8A 4NDNE 3CZLA 1NASA 4YT2A 2SCUA 1IULA 1J5PA 2OHXA 1ZK3A 4MVJA 2FWMX 3UICA 1PZGA 2HRBA 4ESOA 4RF2A 4BGIA 1PJTA 4A03A 2UAGA 5JDIC 5KKAA 2VHZA 4WLEA 4NFSA 1BG6A 1ZSVA 1GZ3A 1BSVA 3MCVA 2VRCA 4TRMA 4IIUA 1BW9B 5COBA 5THQA 4WLOA 3RC2A 1PQPA 3IOYA 4O5OA 4E6PA 2PZLA 5DOVA 1T24A 4MVJD 4PLVA 1P45A 4QFDA 5C37A 6ADHA 4AJ2A 1PX0A
chains in the Genus database with same CATH superfamily
2XOKA 3STVA 3U44A 2WY2D 2FLKA 1NXTA 2BEUA 3HN6A 1MO2A 4HQKA 4EHLA 1Q1AA 1G3QA 3EGWA 2UXBB 4K7JA 1DKLA 4NRDA 2PS1A 4AJ9A 3BPSA 1MT0A 3F98A 3RODA 4M8LA 2VKQA 5JROA 3E81A 5K6AC 3TTYA 1E1RD 5E3JA 1EDZA 4D0NA 4QNNA 4NNJA 4D4HA 1G20B 2K87A 3FTXA 1DAIA 2X1VA 4DANA 5FPTA 4G8BA 4YMLA 1H2BA 1AS2A 2PXCA 3DD5A 4C43A 3S6JA 1DARA 4DWWA 2PEYA 4NIMA 2RGGA 2YH2A 1U3CA 4HUQA 4CFSA 4F06A 4ETIA 4ZO4A 3WL7A 3O4IA 4E4TA 1S7CA 3AEUA 1MGOA 1KGDA 4W5TA 1E4VA 3FZQA 4GGOA 2J0QA 4C0WA 1SUSA 4WY8A 3TMAA 2XPZA 2D1QA 3ZJVA 1TE2A 4IKOA 5IM4F 3C6XA 3ER9A 4TYWA 5F9FA 3CLTC 2Q5QA 3ZVKA 3EDMA 3EXIB 3E3LA 3ZKWB 4D41A 2Y68A 3KT3A 4CQMA 4ZCRA 2DKOA 3IAM1 4J3NA 4WINA 4EFDA 3BICA 5BWCA 4YC7A 1LNZA 1WMDA 3BN3A 5AI4A 2KJQA 5HGJA 3KO8A 1JAYA 1BEEA 3UEOA 1QC5B 2X3UA 1E18A 3HB4X 4TKMA 1X3ZA 3JVDA 4YJ2F 4E94A 1I2CA 1I6LA 1OR7A 1NXOA 3PFBA 4OH7A 2UUBB 4OLAA 3AETB 3KAQA 3KLMX 3GMIA 4JQSA 3TJZA 1YI0A 4B9EA 2DYKA 2XHEA 2NUPB 2G9QA 1YBMA 2ZWIA 4QULA 1SHJA 1LEHA 1I1QB 3N74A 3LVRE 2P9CA 2PKQP 5BUSA 2BMEA 2CDRA 3FTSA 3QPUA 4I1YA 5L7TA 1GPMA 3FH5A 2OAP1 3WKDA 2CB9A 2AZTA 1ZPDA 3BFKA 3C6BA 3O0DA 3T6KA 3KSAC 2R2GA 1C29B 1KY5A 1Y8RB 4L2LA 2R5WA 1XRMA 3LQFA 3OQHA 3RAJA 3I6BA 4C4AA 4D3FA 3S2IA 2AFRA 3MB8A 3DCNA 4IGIA 4MI1A 4ZTBA 3WYDA 3JQQA 1U2QA 4Q93A 3MFQA 1IWPB 2JW5A 4ZQEA 1Z07A 3DBHB 4Z2YA 2Q8PA 3F9RA 4RZHA 1G8JA 4QYTA 3IHTA 4B3BA 3R8FA 4RZSA 2IPOA 2XT0A 1NDUA 2H8KA 2FRDA 4UVDA 1GQOA 4OJTA 4FW9A 1RD4A 2A0KA 3M9LA 2IOHA 2VXCA 4KAJA 5M29A 5B3JA 1JW9B 2ROQA 3BXZA 3HKBA 1C9EA 4ZRMA 5JAUA 2NXNA 3FU3A 4H7PA 5A5GA 3LBIA 1HDRA 2H9IA 4FKMA 4L0QA 4A2CA 4DMGA 4DNPA 1DPGA 4PSKA 2WAYA 3DCJA 2QG6A 2OBMA 1SCKA 2Q4TA 2RHTA 3KOWA 4R7GA 5IAEA 4AMVA 3GL9A 3E5MA 1TJ3A 4FLSA 1TVKA 1JL3A 2QGZA 2OFOA 3IUPA 3ND8A 4V38A 4EHBA 1TUIA 4QTZA 4OQMA 4F85A 3MHTA 1HZZA 1GZ6A 1PV4A 3U40A 3FHEA 4S1VA 2JFFA 1EFRD 1R7RA 2QJFA 1E61A 5CNJA 2NZWA 2WAMA 4NE2A 5B2EA 3PTLA 2Y1FA 1UMDB 1LK7A 2EL7A 3L02A 4XN5A 1C0PA 2HHLA 1F2DA 1PG0A 1VJCA 4INPA 4J0CA 1VL1A 4LBVA 4QU5A 1JDJA 5DHQA 2OTCA 2IHJA 4ASUA 5H82A 2OV4A 1JHPA 2BKAA 2Q5CA 3PNPA 3AJ8A 1G8KA 3K09A 3MN1A 2V0GA 4KR7A 1RE0A 4Q34A 2CLMB 4FQ8A 5HW0A 3HR7A 4XJTA 1JQJC 1II9A 3NHLA 2FQ1A 2B7BA 1WU8A 4DQLA 1ECJA 1W5FA 1I7DA 2OAGA 4DR4B 3IOCA 1CBUA 3L6OO 4L6IA 2VRBA 5CFQA 1TK3A 1QFJA 5ARDA 4ZX5A 2QTGA 2P7HA 3FCYA 3QVGA 4WNYA 2OGSA 2QK4A 4QTTB 3HKEA 1BU5A 3R3ZA 3IUEA 1Q3TA 2O0KA 3QHAA 3K0BA 1TZJA 1OGYA 2ZI5A 5L45A 3UC9A 1Y48E 4HDMA 3OE7A 1LGYA 1TCCA 3D6MA 3K4QA 1LTKA 1E1KA 2WILA 2YWBA 4M8SA 2GZDA 4MVJH 5H80A 3RKRA 3UVEA 1CWUA 1TA9A 1ECCA 1ULTA 1XT6A 2VK1A 4FMBB 3R74A 5B64A 5EYPB 4UVEA 3ZH2A 1D09A 3PUYA 4BFVA 4ARCA 2HT1A 3IBCA 3DZGA 2OVFA 3CNBA 4H18A 4IVNA 1IMJA 2ZTMA 3N6RA 4HFRA 4ZALA 2HSJA 4WKOA 2VJAA 1OW3B 3GBVA 3MRSA 2UZ4A 4U2CA 4K26A 1E8MA 1XEXB 4PNHA 4TT3D 3DEKA 3OPXA 4JH0A 2R7NA 2JG3A 1QPGA 1C7FA 4CXFA 1VE3A 1U5BB 1YWGO 3G2HA 2ZUSA 3GH1A 3MS4A 4P54A 3EH1A 4TS1A 3RVBA 2FDRA 2H63A 2BHTA 2QGFA 4HNQA 5GJBA 2IYPA 1ZLXA 3I3OA 4U6NA 2E1PA 4XMVA 4PLZA 3AHHA 1CJBA 4QARA 5FT9A 2PM8A 4A0SA 4D99A 1XVUA 1V9LA 2XA2A 1GQQA 2IE0A 5LQMA 3HXQA 1D3AA 4NEGA 2WF6A 1M8FA 1L1FA 1P5JA 1NF9A 2XVAA 1GRQA 2YMQA 3DE3X 2I99A 2GZMA 3HA7A 4IAOA 1P60A 4EJMA 5EUBA 4TTVA 4CF6A 4EH1A 5BMOA 2Z9BA 1FL9A 4FLQA 5ADVA 4TLAA 2GN8A 2Q3DA 4JA0A 2PGJA 2E5WA 1NSFA 1N0IA 2CXOA 4XLTA 3ENNA 3LWBA 3VH1A 3DA8A 3AR9A 1RRGA 1AQ6A 5LQDA 3QPBA 2PV7A 4KU4A 1OF1A 1NFQA 4NDAA 2HCTA 1J0EA 2QXYA 1O96A 3FUIA 3BJIC 4BATA 1EE2A 2WC1A 4CEJA 1D7AA 1DLJA 4XN1A 4GLOA 3OURA 3MPOA 3CZRA 3QEJA 4LIPD 4LJ5A 3M6FA 4TXLA 5ENVA 1OA0A 5IPFA 4IIJF 3WSWA 2I1QA 1QHIA 3PXXA 4FUTA 4QECA 3FNBA 3KVOA 4RACA 4Q9LA 1BJKA 5DHTA 4YUYA 2WHXA 4QJIA 4Y2RA 2H1SA 4D9NA 3HKCA 3JD1A 1C9JA 1JPJA 1Z39A 3OWHA 2HWKA 2EARA 4DR2B 4Y1FA 3ORYA 3QEBZ 1KDVA 4D8WA 4O08A 2WJJA 3OEED 2B34A 2L2QA 4I1OA 4HYTA 4X20A 2VH1A 2YYSA 3UT5B 1UJMA 3JQRA 4OU5A 3QVUA 4ES6A 1G0OA 4ZRDA 1M0WA 1XZEA 3FZEA 4U0KA 3WL5A 2LCQA 1CF2O 2HQ1A 4K28A 4ND1A 4ND8B 2VPTA 4GI2A 4MV6A 4EM6A 3AVTA 4ZODA 2P6UA 4AJ2A 4EG0A 1MO4A 1TUBB 2NZXA 1WD5A 2G08A 3ELWA 4QTXA 2B4RO 2C8JA 4FDUA 3RBZA 3OP4A 2YHBA 3ROXA 5AD1A 2ZU6A 5BURA 2BFOA 4OAQA 2BH2A 1Y5LA 3C70A 2VYCA 4GI3A 1A77A 2BMDA 4QYWA 1QVWA 5CVDA 5AHRA 2HIHA 3JSAA 2Z8XA 2DETA 4D42A 3FDXA 4ABTA 4JEUA 1XNRB 3SAJA 1T2DA 4PIMA 3PWTA 3CVWA 1DWOA 2HHJA 2VYND 3SXPA 5J43A 5IM4A 1T43A 4DQDA 4BQRA 1T2VA 4KI7A 2VOEA 4LDPA 1RJFA 1PJQA 3L8FA 4KVFA 2K7ZA 5IVPA 4BE7B 1GYPA 4ZW5A 4GYKA 1I1HA 4ADSG 1HMPA 5JJLA 2R65A 3MEQA 4EPTA 3N39C 3ZCTA 1JDBB 2VP5A 1MB9A 2VK8A 2ZSHA 2PZ8A 4YJKA 1V25A 1H8HD 1O3YA 1P4JA 2A3RA 2N46A 4FVTA 4XARA 1TM5E 1W1IA 4R8LA 2Y2VA 3BM5A 5TQ0A 1HPLA 4MI9A 1T1EA 3DVSX 1DBSA 1U8CB 1WOYA 3W8EA 3ZNPA 1KOLA 3FW1A 4NZNA 4JSRA 2ALJA 4K5OA 1Z4PX 1OFIA 4IX9A 3BHIA 1S3FA 4QU0A 2P9EA 3GT7A 3MT8A 4IH4A 4CM4A 5LA6B 4US2R 3VNUA 1DG9A 4NCNA 4J3JA 2VUTA 3FFTA 2P1RA 2VFAA 4HNAA 4ITRC 4NHOA 2XX3A 4U7JA 2W6MA 3DP9A 4RYLA 5BW8A 4IR7A 3BZUA 2WJIA 4LKRA 2YWGA 5CA0B 2C4NA 2WSMA 5FTNA 2I1LA 1U7HA 4RTSA 2Z95A 1Y9ZA 3VU0A 4X60A 3CHQA 2D59A 1ZWLA 3OX2A 3BHJA 3GDOA 2Y1CA 3GHHA 1VMIA 2VPQA 3FSEA 4WFJA 2PU5A 3RI3A 2O1XA 2NO4A 5B7PA 2GD0A 4UM8B 5KYYB 3MTBA 3I4LA 3JYPA 3MUOA 2RH4A 2ZYGA 4K2HA 3EBGA 1F20A 1ULUA 2H1FA 1YNOA 1VG1A 3TX6A 5I4KA 2CVHA 3KXLA 4L4UA 3RC9A 2ZI4A 1DAKA 2J3JA 1J0BA 1XALA 2G9ZA 3RLIA 3WLRA 4C3VA 1AOXA 1XYYA 1RHKA 1NYTA 4ZCQA 4BRUA 2P6NA 3FSJX 3TINA 4S35A 3TL6A 2OBNA 4LGYA 4DPKA 1B1CA 3N2ZB 4Q05A 1LBQA 1RBMA 1XP5A 1M9NA 5KJFA 3K2BA 1D2MA 4XSVA 3FNFA 3HJBA 1XTTA 2GEDA 2QYTA 5TQVA 4AWXA 4QBIA 3GLSA 4NS4A 1QV6A 5FJJA 3ESQA 1E58A 2C3OA 3MIIA 5FA5A 4UCWA 4I1SA 1E79A 1U8TA 5CNKA 2JCSA 1JJFA 4PPGA 5FF9A 3MTJA 1UH5A 1CUCA 3MJHA 3PCRB 4DM4A 3S2GA 3X1JA 3AEYA 3V7WA 3NUQA 4GX5A 2H07A 2J6HA 4HDAA 2ZYDA 1KOFA 2XUZA 3IQDB 2WZDA 3A3KA 4PV7A 1G59A 2GN9A 4QLOA 1E2NA 4COOA 5ALEA 4D3SA 4GPIB 3UBTA 2WM9B 1UANA 2PGDA 3UJ7A 4LRWA 3GXOA 3JPYA 4R1QA 1BHO1 2C2KA 5CR9A 5F33A 2E82A 4K9RA 2NPFA 1P8AA 2EHJA 3WDKA 1XCGB 2B2CA 3S2UA 2NZJA 5JS6A 3IAUA 3C14C 3L7MA 4R9UC 1TJ5A 2W48A 3DVRX 1IIBA 1PR0A 3OIWA 5F7ZA 5T3YA 4RV9A 5SYAA 1D1TA 4CQJA 4BP8A 4D9JA 3QE9Y 2N3ZA 3HO8A 2JJ2A 1XTBA 3O8NA 4NLLA 3ZY4A 2ZSFA 2HMUA 3VZPA 2WM2A 3AFHA 1GNRA 2C1ZA 2ODAA 4K9KA 2W2LD 2IA5A 4IRMA 4JNKA 4YCJA 5L3SB 3ABSB 2W4MA 3O4FA 4W5JA 5IP5A 2ZOSA 1VQ1A 2FPIA 3H42B 3O74A 2AMVA 3T5BA 5BWBA 1A8IA 3NNNA 4G0QA 2ARKA 4Z5XA 4EJSB 1SD5A 5J2UB 3RUEA 4NZZA 3D4PA 1NLFA 5JCOC 1Y3IA 1ZUIA 1XAJA 1FX0B 5COAA 3G5UA 4N82A 3T3DA 1NP3A 1OGIA 2Z5GA 4BAZA 4BEVA 3ZDXB 1E3JA 1EB8A 3FCAA 1DWUA 1ZXLA 4FOTA 1A82A 4G24A 2MYPA 4MQ5A 1VECA 5DM2A 5CAEB 3P8ZA 1PV2A 3TOCA 4E2FA 1C3VA 3OICA 1WBDA 1YS9A 4B8ZA 1DBRA 1SC4A 2G3YA 1IL0A 3OZVA 2P9GA 2GCPA 2ASVA 4DLUA 1TZCA 4EI8A 2FZCA 3NVAA 3SKXA 5ADUS 2G0NA 1GAWA 4B3TB 4EKNB 3NTRA 2ODNA 5CT4A 2O3JA 2ZUUA 5LXTA 4EATA 4QEZA 1KYTA 3HFRA 3AUJB 1CVLA 4HY3A 5KZMB 1DT3A 2F3QA 2QORA 3VC2A 3QOXA 4D57A 3E2PA 3QX9A 2J41A 3QIAA 4H7DA 3LDAA 4OBEA 5COQA 3RRFA 5DWQA 3AUFA 1Y6JA 4Z7JA 1AMNA 1SKYE 1B6RA 3NRJA 3FTZA 3PYLA 4PU0A 3HACA 5IEBA 5U4QA 4MDHA 3RH0A 3T7AA 3AI3A 4RM3A 3JU3A 1U5CA 4LVOA 3QV1A 4OD0A 4EHKA 1RAAA 2VT3A 1Y4UA 4MUJA 2NO9A 1GLGA 2JZCA 3DDOA 1YS6A 3EXHA 4IIJA 3MBIA 2GR9A 4AB1A 1T9AA 3BFPA 2ZATA 1QANA 5BWLA 2VP3A 4HH0A 2IBTA 1VPEA 2XMGA 4INOA 1DJQA 4NICA 1XTQA 2ZRFA 1KEZA 2GAAA 3DBVO 3IPRA 1WMFA 2AX4A 2Z6AA 1YQUA 3O2QB 1O87A 1CUXA 1XZBA 4EY4A 3LI2A 1XD8A 3LWNA 1G5PA 1UKAA 3RYIB 4ARBA 3JVEA 3SJBA 3KPJA 4INZA 1B76A 1OYYA 1PQWA 2HUNA 1H2EA 3KALA 4AR8A 1M54A 5K0NA 2XD9A 1WCYA 4V03A 1GGFA 4AECA 2IX3A 2PUAA 5FWXA 1FDOA 2HF8A 1RYDA 1ZH6A 3H2SA 1J1ZA 4XNDA 5G53C 1G42A 3O2SB 2Y0PA 4OYHA 1L8XA 5ESRA 5HJ7A 2JLWA 4TKVA 1NVMB 4PM4A 3RVQA 1JIKA 1HFJA 2OB1A 2AN1A 5BY2A 3T3OA 1XEWY 4PNEA 2EWWA 2HA3A 1A1SA 4PC1A 1LV7A 3WR5A 3KQKA 3ZDBA 2C82A 2PMBA 3M1LA 5EL0A 1K4KA 2ISQA 5D51S 1HC7A 1P0MA 3HCRA 4Z1MA 5HCIA 3UERA 3MTEA 4MW1A 1SUCA 1BVUA 2FJ0A 2R9VA 2ZYRA 1AZWA 3GD7A 1BN7A 3CZAA 4N9WA 5CFRA 2XKKA 1WKBA 1YHZA 4DV4B 4KK4A 2FDXA 1RZRA 4CCYB 2YJ5A 3CXBA 2OCLA 5EKDA 4L3WA 3SVZA 1TKRA 4HB4A 1D9ZA 4TX1A 1KY4A 1E3QA 3DMDA 2JH8A 3NETA 2CCGA 1MC8A 1HQYE 2A5DA 2QUIA 2REXB 3DFUA 4F11A 3ZZUA 1FFSA 1Z8FA 1P2DA 2IODA 2IQ5A 3C5WP 4J1TA 5CMLA 5L7YA 1G291 3WMFA 4C2UA 3AR8A 4GICA 2EATA 4GYJA 5DIZA 4FEAA 2O7NA 3N86A 5KMGA 4KC0A 3EN0A 3UATA 3DSRA 3QFTA 1MA3A 4MPRA 4RCZA 2AJCA 2F9FA 3ROTA 1FTQA 4HQRA 2H5LA 5I7VA 2EZUA 1JQAA 3FLEA 1X86B 4MUFA 4POOA 1UJBA 5F2EA 5KSOA 1T5HX 4KN9S 4EZEA 2ZUDA 3DV0A 2MSDB 3GEPA 1HRKA 3Q12A 3H3JA 4FB4A 5IKMA 1P74A 1O6BA 3L5KA 3P2JA 1R8XA 3ND9A 4YJGA 3QFCA 5EIEA 2J30A 1V71A 2IPMA 1WSBA 1SKYB 1RM3A 2GPYA 3HJAA 1Q3KA 4POAA 3HBAA 4LQ4A 4TVSA 2R8PA 2YTZA 2HLDA 1YL5A 3TCKA 1RWXA 3FRIA 4UCXA 5DHRA 1IEXA 5AENA 1Y42X 2DBQA 3OE1A 1J8QA 1CUFA 3PPWA 3GRRA 5K01A 2ZI3A 1PNTA 3OLZA 1X3LA 4BPRA 1LSSA 2H5JA 3PEWA 4MV1A 1UJ5A 4P80A 1VLZA 3CSDA 4UUNA 3HCCA 3RS4A 1HRDA 3G8BA 4ALLA 1JA9A 3QW2A 4ZAXA 3H8SA 3GFBA 3O75A 1DWPA 1WY5A 3K4PA 4UATA 1LFAA 5FHQA 1QYVA 2ZSUA 3U39A 2ACKA 3DWIA 4DMLA 1JBEA 2QX6A 3LQKA 2CXQA 1V5IA 1S9HA 4V2UA 3PNOA 2BRUA 4IVQA 4QJBA 5ITVA 4HBGA 5FUXA 2ONZA 2VJCA 4LG1A 4B71A 3U5ZB 3RTAA 4LVCA 5C34B 1TM3E 1GCUA 2A9QA 4X8OA 4F5DA 2WA1A 3ETEA 5FNVA 3GWZA 1GKKA 1A4UA 3JSZA 4G0YA 5PNTA 3GRKA 1FSFA 1GO2A 1R5OA 3M6MD 4GYYA 4Q03A 3NHFA 2FEMA 1ZJYA 2ASEA 3IVXA 1FSSA 4M1SA 4WKGA 4XIYA 5CJPA 5K0EA 2A0UA 1T29A 5IAGA 1RKQA 4XEHA 2AKEA 4QUBA 2AKAB 4JXXA 3ZD7A 1N6OA 4D7AA 5FUYA 4UTRA 4UCFA 3HFGA 2G0TA 3HXMA 1HYQA 2JLZA 2D6FA 3AINA 3OSUA 1PGOA 5KDDA 1CUIA 4ON9A 1IZZA 4LWOA 1QRTA 3CURA 5G3YA 1BD3A 4KR0A 2IYRA 5DM0A 5A3VA 3A25A 1VL8A 2HTEA 1X6VA 2QAJA 5JYEA 1TB4A 1CUZA 4ID9A 3C6QA 4FZ3A 4WD3A 5ALFA 4KREA 3ABZA 1KTIA 2EBWA 3RRNA 2XRFA 1WUHS 3C3JA 3PB3A 4KW7A 4CIDA 1X1QA 1YZUA 2EU8A 3C3WA 5ICSA 2VAVA 4B7AA 3OO1A 3ASVA 4BBJA 2O8VA 1NR5A 1W96A 3A05A 4KQ2A 4PHCA 1I24A 3C16C 3W77A 3JWPA 2HKIA 2BC9A 2F9MA 2GB4A 4HWGA 1TQ4A 2ZTVA 4HQFA 5AUOB 1TQ2A 4TWIA 5CLGA 2PUCA 3GLFA 3HKDB 2PJRA 2B2XA 2FMFA 1O08A 1BXRB 1ZWKA 1QVRA 2BZGA 2Y6UA 4AROA 2QMHA 1XE3A 1G9XA 1JB9A 2MYNA 5AKYA 1H2HA 1DIRA 1W46A 1WXHA 5TX7A 2QMZA 1EWTA 2D13A 3L84A 1YDHA 2R48A 4E12A 2MWMA 5A5EA 2IH4A 3HO6A 1RHRA 1XNJA 2G5GX 1S96A 1SUPA 3RJMA 3WRWA 4EL0A 1RVV1 4I55B 3RKUA 4HB2A 2I3GA 1CEXA 1A5ZA 3P96A 1RAFA 3U6BA 1LF5A 4OIMA 5KYGA 1V3QE 4GD3Q 2WYHA 3MPUA 4KXQA 3T0FA 3WMXA 2JLYA 3S1LA 4N5HX 5JIBA 2ISSD 3FKSD 5CM9C 2YHSA 3MK31 1UOQA 3RREA 5LQSA 1IB0A 4JR0A 3AEXA 4UHDA 5CLHA 4CMEA 4V1CA 2Z3ZA 2QX8A 3VJLA 3T4XA 2P2GA 3RIXA 1C1XA 3DOHA 3EEQA 2OFWA 2PVPA 4QT0A 4N0EA 2NXEA 1G19A 3L41A 4OQQA 3TW8A 1MOQA 3UMRA 4X90A 1J20A 4YRQA 5IDXA 2WIBA 1ISMA 4ZAGA 4E5SA 1SHTX 2FP4A 2QTRA 2E4WA 1DTSA 3AVOA 1Q2UA 2OV1A 3WLMA 2HSEA 2PZAA 3OTGA 3PICA 2WKSA 3NKFA 3B1KA 5B1SA 1CKEA 2RHCA 1JXOA 3VVBA 3KM0A 4BO7A 4DWVA 1FUEA 3RC3A 3B37A 5D2CA 4TKUA 5FLEX 1DTWA 3TLGB 1H4QA 1IY1A 4OHVA 2HY7A 4CKWB 4HEQA 3R8XA 4J7AA 2VPXA 3CEMA 3K0KA 4P35A 1OZAA 2EVWX 4IBOA 5B53A 4YAKA 4BGDA 3E5NA 3EXIA 4DCMA 5IF9A 4KRYA 4BMPB 3BMOB 5KTNA 1E3DA 1EP9A 1YR6A 2R96A 3PWSA 4GZ3A 4BLUA 4DOMA 2QTFA 3RU3A 4MX8A 3V32A 2PRYA 3RU7A 2DBVO 3EQ7A 4RSYA 5I5EA 2FSVC 1ZVVA 4RJTA 3KEOA 3FA2A 3DVAB 2J07A 5JCJA 5E2IA 3D6VA 4V1CI 4G3XA 1AIPA 4W4TA 3EUFA 2A9PA 2DWUA 4AQYB 1OZFA 3R20A 2IVZA 3NEPX 4BECA 4D4KA 2FMTA 4QOEA 5LA6F 2OBXA 4PSDA 3UAGA 4F6LA 1NSTA 4S2UA 4X92A 4TWBA 4C0SA 1O0BA 2C0QA 4MQFB 2NUTA 1VDMA 1OHHA 3TSAA 1Y8RA 1C8KA 5FJIA 2DQSA 4E13A 2OYRA 2C1EA 1S4MA 3W8NA 5CA0F 1ZK2A 1QQ7A 1OI4A 5EMKA 1YRLA 1TJNA 1GILA 3AB3A 3VZDA 1SOVA 2QQGA 3LT5A 3AEQB 1E4OA 3LXMA 4NONA 3ZV6A 4YMIA 4JELA 1KSHA 3AZPA 1NVWQ 4TTJA 1HY3A 3EEOA 3ANMA 1NN1A 5FEMA 3WGYA 2FEXA 4OOFA 3E9CA 4TLCA 2RC5A 3WKBA 4UQLA 4XQEA 4EK9A 3W2GA 5D3ZA 2XNHA 4CYMA 2ID8A 2VLAA 2FCRA 2IZ5A 2QE7A 1FTNA 2DC1A 4XN4A 3QVVA 4UXJA 2GBFA 3OIYA 4NSNA 5KNCA 3EY9A 3A27A 5I8WA 1JPVA 2ZM5A 2DKFA 1KEWA 2BFBB 3N2GA 4XM1A 4D6PA 4H6VA 2IXFA 2BMAA 2Q3LA 1AB5A 3L7IA 5JBQA 4IUYA 1U1DA 5HQTA 3KQOA 4YRDA 1MNQA 1JECA 3BWDD 4FR2A 3PX7A 4HMQA 3QWFA 3SI7A 4PX5A 3TKAA 5IXYA 3NVKI 5JZ9A 4HNHA 2R3SA 1OX4A 3ZJTA 5EQTA 3HNPA 5AJXA 4BV2A 1GNQA 1SZJG 3R5SA 1GPUA 4J0DA 5EJ2A 2FEOA 5G1OA 3AUYA 1LU9A 5TJHA 4EWLA 4XWKA 2C7PA 3PFWO 1QX4A 3W1VA 1E7MA 5EZSA 3PUVA 5HF9A 1W52X 2F4VB 1VLLA 2PG3A 1VG8A 3T7RA 4LYDA 3SSAA 2OESA 2FK8A 4BO5A 3R77A 1J23A 1UQTA 1R3DA 3CZEA 1FBNA 1G3UA 1GSIA 2WAXA 3KL2A 4YS6A 5IULC 4I36A 1OAOC 2QVXX 3FUEA 1Z29A 3K0AA 2WVJA 4DYHA 2TMYA 2WM3A 4P4TA 1QHFA 1W4RA 1NUUA 1WMSA 4Y0AA 5EINA 1F6BA 1YO6A 3T1OA 2GNPA 3SJAA 4BQIA 3B6JA 3QY9A 2P3LA 2A67A 3OSZA 3HW2A 1K68A 2J9ZB 3H4IA 2RHBA 5IMBA 1RQ2A 1XTPA 4P3OA 2QENA 4GKJB 2ZS9A 4GP9A 4GVPA 1FJGB 5E1BA 3DFIA 4NQZA 1XGKA 3I9FA 2YRWA 4E15A 3U80A 4X8LA 1RFGE 4PVCA 2NZ2A 4L0CA 1CUSA 3ZXYA 1LBTA 4BGVA 2G8LA 1O89A 2GEFA 3KXPA 2Y1EA 1ISPA 2FF7A 1HMYA 1M1YB 3GJTA 2H2GA 3GFQA 4GBED 3F6CA 3KSMA 5BN5B 4CMBA 5B4TA 1WW8A 4F93B 5J2UF 4E88A 1Z0KA 1DOAA 3MCZA 4Y3UA 3UIEA 1ULZA 4ZC1A 5IJ0A 3A2KA 4FPXA 2R6FA 2EKDA 3CHOA 1PHRA 2Y9PB 1O95C 1I2AA 5ULLA 4PYNA 1U1GA 1WZNA 3FYUC 3S70A 1R0CA 2JEOA 4JLVA 3BXOA 1YA6A 1A96A 3QIVA 4G5SA 3WIVA 1F3OA 1UKBA 4XN8A 1JLKA 4TMWA 4E07A 3HCNA 1TK9A 4CKEB 3KVVA 4W9NC 4ZMSA 1K5HA 3K0CC 1U0OC 4N65A 4U7FA 2PAAA 3DBLB 5CLQA 2ZE5A 1DQNA 3WMEA 4NV1A 3WFJA 3LWZA 4OREX 2ZULA 2UYYA 3KTOA 4I1IA 4NU6A 4YI5A 1T6BY 2ZI6A 5DCUA 2GM4A 3PNKA 5D3KA 2FP3A 2PUHA 5HIKA 3DAOA 4WZBB 1DIAA 2IW1A 1UM9B 4A8JC 5LSAA 4R83A 4LWZA 1QHHB 3EVGA 2ST1A 3N76A 3I1YA 3ITNA 1WTCA 4XUDA 5HBGA 5F7OA 2AZ4A 1Q0TA 4Y2TA 1RDFA 1ST2A 3GLIA 3RIHA 1W73A 3EPRA 4JB0A 4IGEA 4RHTA 2MSEB 2OC4A 2HMTA 3KDPA 5D8DA 4F5WA 2ZYAA 4XVRA 1OROA 3DPIA 3JPWA 4G25A 5SYMA 3DE7X 1L5QA 1ZA2A 2FR8A 4K5NA 2PRKA 3PUUA 3TTUA 2IS4A 1TYDE 1DX9A 5LZ4A 4H35A 1D8AA 5EVCA 2VVTA 2CFRA 1IN5A 2BIFA 3CR3C 2SKCA 3UAZA 1JLLB 3QE4A 2CNDA 4GS5A 1KJYA 4KJZA 4J0KA 3VTFA 1GP2A 1BU8A 2H08A 2I76A 4MCJA 4EIWA 1B0PA 1E2IA 1JN0A 1TC1A 2PSJA 2YWRA 3EGDA 4ND8A 3KUCA 1KFCB 5C4GB 1Q19A 1QU3A 1J24A 5LU9A 3NWOA 2HXSA 1X8JA 4FFPA 3TLYA 2XA9A 3WIOA 4EHFA 3DLPX 1WW2A 3AIIA 5A2QA 5BV0A 4B1FA 1E2JA 4UHKA 4XH9B 1BEZA 4YEDA 2R79A 1CR2A 3NVDA 4ZOEA 3RABA 1JHYA 1NM5A 2ODTX 2XE8A 3JX9A 1NUSA 3U4AA 1OYOA 5CA1B 2LUOA 3HXOA 3Q8LA 3P4YA 3CE6A 1CDDA 3D0OA 5WRFA 1LJ8A 3FMVA 5KYUA 1SVKA 1AB6A 1NKTA 1WM1A 1DRVA 3DEYX 2A0XA 4JA2A 4NABA 2HHHB 3FUWA 3IPLA 4FC6A 4RD4A 3DKIA 1UPAA 2XZPA 3FF4A 3NU1A 3K4HA 1K66A 1U1CA 2PNFA 3HPRA 3BTVA 5HS4A 4JBGA 5JXHA 2FX3A 1USWA 1MR3F 3WZ2A 1GL9B 1IZYA 4D81A 1R16A 3I28A 4BFZA 1QIDA 3F74A 3FSGD 1ENPA 3VH3A 3RADC 1ZNXA 1NF3A 3PK0A 3NGLA 2A0YA 4DXHA 4DBVO 3RNLA 3EWSA 1XEAA 2P5UA 3AESB 2QHXA 3F7NA 5HTKA 3RS0A 3B7TA 1CR0A 5E7QA 4YECA 2UVQA 1U7WA 3S4YA 3B1XA 1MENA 1EFCA 2PO5A 3U31A 1FXSA 4DPLA 3DB1A 1EDBA 3HGQA 4XMXA 4WEOA 2Q27A 2C5HA 3PIIA 3H6GA 3JQBA 4NU8X 4J29A 1GZHB 3CZ4A 3KLOA 3UXHA 4JLDA 3FOEC 3NASA 1E6KA 4MA4A 5HMLA 5JJCA 4HNRA 4Q3NA 5KIAA 5CFNA 4IKEA 2KQUA 5J4YA 1W581 3OQPA 1W4LA 3K8YA 2CN1A 2YDYA 3PF9A 4GKVA 4OXKA 2JFXA 2BUBA 1O5OA 3OO0A 4IS3A 3X2SA 1QONA 4LNAA 3JQ7B 4H7FA 3VBCA 4HC4A 3EXFB 4FHEA 2WF9A 3EIEA 1Z5NA 3ET5A 4ID3A 3S1SA 1TIKA 3O1IC 4ALIA 1NVEA 5JATA 3TLEA 5MFZA 3WLPA 3AOEA 3GFRA 1UPTA 3GGDA 3UXYA 2D00A 2PL1A 3PFIA 1RXSA 3TRDA 4X24A 1RWOA 1G2OA 3T4UA 4IX1A 1EK0A 5DGXA 3TW6A 2RJ3A 2WNHA 3KUKA 1EFHA 4O3FA 3F1LA 2BEVA 1GSAA 1M66A 3GQBA 2C8KA 3A26A 2EHDA 4TLLB 4ZD6A 4P33A 1PX2A 3G7UA 4HS4A 4Q3KA 5DDIP 5AIBA 2JVJA 1XV5A 4NYIR 3N9IA 3WGLA 3PQDA 1X1TA 5HTOA 1Q21A 2XVZA 1K88A 3L8EA 4P86A 1X77A 2J87A 1QE0A 2IHVA 3RYHB 4AJNA 3ZGOA 2NTEA 1V16A 4D3DA 1JXQA 4P84A 3W8FA 1DXHA 2HDNB 2X0EA 3NATA 1SQFA 3AF1A 3E0XA 4RWEA 3Q3VA 1M8KA 3IT0A 3FJ1A 4YX9A 1QE5A 1GAXA 1K8ZB 2PSHA 4FC7A 4IEEA 4O4HB 1MRZA 3WBFA 2NZ8A 1DBWA 2W2KA 1KK3A 1XTKA 1HURA 3PFKA 2LCIA 2VCEA 2KBEA 3O8QA 2XADA 3WGNA 1U8EA 3R3UA 2PANA 4C20A 1YE8A 5BSHA 3ENQA 4GKAA 4RWZA 3W2TA 4F0JA 1YJAA 3AUSA 1VZ3A 3FHJA 2O7GA 2GT1A 2OORC 4GMFA 3TQQA 3EPJA 4BKMA 4F91B 1C7ZA 1N2XA 4JMLA 4KOAA 3JYHA 3VX4A 3B51X 1DQSA 4G1VA 4YJ3A 3KT6A 4OF4A 4Q3OA 3SZLA 4DJTA 1WSDA 5I7HA 4HRYA 2Q2OA 4QGBA 4DIBA 3D4IA 3N8GA 4JCOA 2HSZA 3UV7A 1BE0A 2W6CX 1FFHA 4MUEA 4C4RA 2QWXA 3FZNA 4A6XA 2CLSA 1CHNA 2OZLA 4RMIA 2W2QA 1MW2A 2GSWA 4JUCA 4NBWA 2P69A 5EJIA 4CODB 3EQ9A 3FZGA 3UUEA 3IVMA 3ZWKA 4WHMA 2FZKA 4OSPA 2EJTA 4N47A 3ZWDA 2VHTA 4IH9A 1CP3A 1H0SA 3KYDB 4MIOA 4JB2A 4U8GA 1EUYA 1JG3A 4RYDA 2Z8YA 1R4AA 4Z6KA 4TUYA 4LGCA 4YDRA 4JGBA 3WSVA 3CVYA 3W5JA 3A0UA 3NFRA 3TAXA 5A5DA 4Z4QA 1NVBA 1KQOA 4PFJA 4Q4CA 2YS7A 5AI8A 2I2WA 2J5KA 5FL7A 3QXCA 2YIVX 3JWIA 4I55F 3CH4B 3FLAA 1GNPA 2R1VB 5AM2A 2EQ5A 3VO9A 1G1AA 2PX6A 2Q6TA 3FGNA 1ZA1A 3QBVA 3NEYA 2GK7A 4MVJF 1FB5A 2O2XA 3KKPA 4PX3A 2RG7A 4A5OA 2WWRA 3OOJA 4UUAA 1ZD8A 2YZ7A 3TXXA 1VBNA 4GE0A 4HGPA 3GN1A 1BX1A 4MUIA 5LWHA 4RZ3A 3SX2A 5CGZA 1TAHA 3GV0A 5FFNA 5K51A 1YS1X 1GQFA 4YV0A 3KYCA 4YJHB 3I58A 4P7BA 2AMLA 4XVUA 4MUMA 1XX6A 3MRVA 1XCJA 5K1ZA 5F98A 4JFAA 1RI5A 2D1FA 2C3YA 3QVSA 4OHOA 1ZGGA 4J6EA 1DXQA 3ORQA 4IKPA 4A36A 1IEWA 1VSVA 1W1WA 2C31A 1UBGA 3CX8A 3D1JA 4EYQA 2P78A 3DDCA 3FPGA 2ZJ6A 3QJXA 3S2FA 1PEYA 1XCLA 3WXMA 1TIPA 4O33A 4A82A 3KWMA 1CFJA 4WESB 5MF6A 3KQNA 4KP7A 1XA3A 1FTWA 1ZISA 4CNBA 3GJSA 2B5VA 2IEAA 1WZUA 4N3CA 1E2QA 1UDXA 3HCDA 4XGIA 2WJWA 4PPQA 3FTVA 3SJUA 1P9NA 3LV8A 1L4YA 5B6JA 5LUBA 3SF0A 3NT2A 2W2NA 4GOKA 4ZP1A 3HM9A 2G63A 1R88A 5F51A 2D54A 1V5WA 2JGDB 5AXCA 2B30A 2G80A 4GMDA 3WNQA 5JEDA 2QLLA 3RYCA 5JMTA 1M2VA 5AKXA 3WIUA 2PZMA 1EP2B 3U4IA 2W9XA 4M37A 3OY7A 4NU0A 2A1UA 1H2ZA 4IMJB 1IOZA 2C2YA 2FZWA 2WE8A 4BB5A 3HJNA 4ZDJA 3WO1A 4L9RA 4ZI5A 2FKNA 4FB5A 1PNVA 5KX5B 5JD5A 2HA0A 5DBEX 1EXMA 3C48A 1TM2A 1BE1A 3UHOA 1EWRA 3LC2O 3OAAA 4CM9D 3QKUA 3KKMA 1A7JA 1EVJA 2MU1A 2VT6A 3C97A 1DADA 4R2WA 3ZHSA 3IQFA 4H0CA 5KDLA 4L07A 2Q46A 1KR5A 1OQAA 2IY7A 4MJLA 3WQBA 1RHMA 1J9GA 4MW9A 4Q1VA 4Q4HB 2QN1A 2I4TA 1IOVA 1WEHA 1IPHA 3AY3A 3ECCA 5SY9A 4B17A 1KFEB 4CUZA 1WPRA 4K8RB 4RZIA 3EIFA 5DM1A 2VHCA 4BO4A 1TYEB 3BGIA 4C2TA 3TO5A 1IXSB 1CETA 1YOBA 1OWOA 5I51A 3O8BA 4LZOA 1ZCBA 1PP4A 1PR9A 1QFXA 1SHUX 3P45A 4M0MA 1BE8A 2C4VA 3QVOA 5HRCA 1WZIA 5ITZB 4JU8A 3EAQA 3TTSA 1EEHA 2GUWA 4I1VA 1U3DA 4NR0A 2V45A 4QL3A 3ZVLA 1E59A 4RTMA 1OLOA 1TVEA 4FCWA 2BDUA 3HVHA 5K8VA 3B2EA 5BNFA 2CY0A 3FPSA 3ZI7A 2QYSA 2AC4A 3K1AA 1CEQA 3Q7IA 5SYNA 1BQ4A 3SLKA 3IP3A 2OHIA 4X6YA 3GARA 3I12A 4DUGA 4GECA 1NC1A 3WWOA 1WJGA 5GGXA 5A62A 1T1GA 3BXGA 1JQDA 3LH5A 5EKXA 1P0IA 3I2GA 2QTWB 1Z47A 2FPLA 4M89A 4MKZA 4R1PA 5TS3A 1EFPB 4RADA 2IITA 4S1TA 2YXBA 1P1CA 4B4VA 2PKRA 3ESDA 4MWBA 4N48A 2VJLA 2FMXA 4IYJA 2E2WA 1JXMA 4J0EA 4FQ7A 3I23A 3H5NA 1GV1A 3RANA 2IPAB 3GX1A 1DJOA 4RFSB 2PWZA 1LX7A 1H22A 2VBFA 1YB5A 2XYVA 4LRQA 1PFUA 5KWVA 1MJFA 1PAUA 4E5VA 3UG6A 3RSZA 3MLAA 2WD7B 4BFTA 5TS2A 4UNIA 2Q5HA 1ORRA 1YR8A 3UTDA 4CTOA 3PNLA 4EOGA 4HVCA 3TI7A 4KB5A 5T5QA 1ZGHA 1JIUA 4FEYA 5EE5B 4DJAA 4JS0A 4LE2A 3QJYA 1ESZA 4UU7A 1VMKA 2ADFA 3CW2A 3ROQA 4ZTUB 3H5AA 4OAPA 2M32A 2FXVA 1NNEA 1Z0AA 1NLUA 2UZ1B 2VAMA 4DV7B 4X3CA 3IXLA 3ZDCA 1C7QA 5AM0A 2AYXA 2FG7C 2