4ZQHA

Crystal structure of dox-p reductoisomerase in complex with nadph, fosmidomycin and magnesium
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 149
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqhA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqhA01
1DIHA 3JQ7A 3CEAA 4F46A 4IXTA 2G82A 3D5TA 3OJFA 3AUTA 4H7PA 4IUYA 1FDUA 4BV9A 2R00C 5AXBA 3C1OA 2BFPA 2YYYA 2WYWA 3T0YA 5ICSA 1KC1A 1J49A 2EF1A 4BMNA 4QX6A 1ADGA 5IJZA 2AE1A 4BNMA 1HE2A 4KZPA 3WQRA 1NPYA 1ZK2A 4P22A 4RPHA 4PG8A 5K9ZA 5FWNA 3WGHA 4KQXA 1M66A 1ZO8A 4UAGA 1EVYA 2I5PO 4D46A 1JKFA 1PL6A 2UAGA 2FHSA 5BR7A 2QRJA 4WLOA 1B26A 1ADFA 3H7AA 4IM7A 2O50A 2O3QA 3MTJA 1EQ2A 1U8FO 5TS3A 3GT0A 2RCYA 4KWIA 3TFOA 1D3AA 4QXMA 3AWDA 4PCVA 5T6BA 3WLEA 5HS6A 1C0KA 3RUIA 2YUTA 4IDDA 3HFSA 2H1SA 4GI2A 4B4UA 3U4DA 3DZFA 3FNHA 3ROPA 1KS9A 1A27A 4XGKA 2W8ZA 2P68A 4UREA 3GRKA 1V3TA 5THKA 4RLSA 1TT7A 4PG5A 5AXAA 4NJMB 5CFZA 1TT5A 3FPCA 4HFJA 4WGGA 3U4HA 1GFSA 4S3MA 5JXWA 3JTMA 4MKZA 4DQVA 1IY8A 1HZJA 4ZICA 3WTBA 3DC2A 1HLPA 4FLRA 2ZTMA 3NRCA 4A73A 2NLOA 4KQWA 4QSMA 3BMNB 4JBIA 3WMWA 3HB4X 1ZUD1 1RM3A 5A4DA 4DUPA 1E6WA 4GLLA 1T1RA 1XHLA 1LJ8A 4CQLA 3RUHA 3TPCA 4M49A 2GZ2A 2V65A 5TGDA 4PLGA 5L51A 3EVNA 1Y8RA 2Q1TA 1YE3A 2XXJA 1ZZEA 1J5PA 3UAGA 3OH8A 4MKXA 2W2KB 2YHIB 3TF5A 1LQUA 1B8PA 3GF4A 3D3WB 1OBFO 2B0JA 4IS3A 1LDNA 3QVOA 4J1TA 1YO6A 4BO2A 3U62A 2I67A 3LC1O 2FY8A 3AM3A 3HG7A 4CLDA 3JQ8B 4XR4A 2O23A 1R37A 3FWNA 2I3GA 4UVIA 4BNIA 3OQ1A 4B79A 3FWZA 4EUEA 1T4DA 2GD1O 4BGUA 1PZGA 4YPOA 2AMFA 4BMVA 2X86A 3ZV3A 4TRNA 2P91A 3PQDA 3AUAA 5JC8A 4CMGA 3JD4A 2WE7A 5ENDA 4J2HA 4LISA 3ANLA 1MFZA 4CMIB 1NWHA 1D1SA 4Z9XA 5JAIA 3F46A 3WSWA 3U09A 3CZGA 1HETA 1HDZA 1ZFNA 4K6FA 4BIIA 4BNZA 4OO3A 3UCQA 2PZKA 4PRKA 3BMCB 3GLQA 4H15A 4Q3CA 4CM9D 3JYQA 4NBTA 1EBFA 3LU1A 4IINA 1RKXA 2HMUA 4FC7A 4DL9A 4LSWA 4FJ1A 3RC9A 4OHUA 2OOSA 4EEXA 1NQAO 2FZWA 1V0JA 4J1SA 3O8QB 1T26A 4O63O 3Q9UA 2G76A 3M2TA 4GVLA 4PVCA 2OFPA 5TC4A 3I9JA 4I1IA 3AK4A 4WLVA 1AHIA 3P2YA 3EHEA 2G17A 4GX2A 1DOHA 2ZJ1A 4PG6A 3WBBA 3KYDA 3GVIA 3V1YA 2B35A 2EW2A 5ITWA 3L4BA 4IDFA 4YJGB 5KJEA 1A7AA 2GLXA 3HJAA 2QYTA 4BNVA 4WCDA 5JPIA 1JTVA 4GMFA 3NV9A 1Z45A 1VJ0A 3F5SA 2E82A 1G1AA 2I9PA 3RC1A 5JAZA 5JLAA 2NU7A 1P1RA 2BD0A 5KOIA 1MV8A 3I5MA 4FCCA 5AVOA 3FBTA 3GPDG 4ALLA 2P9GA 2YDXA 1PGOA 1MW2A 2G0TA 2VWQA 4R3NA 4RF2A 3BHIA 1R66A 3ROQA 3QW2A 2DBZA 2D59A 1M2WA 2NU6A 1TB4A 2QW8A 2F1KA 2Q46A 2J6IA 5H83A 1ISGA 2Y1OA 1DLIA 1NFRA 3MJVA 2DM6A 4R54A 1QYVA 1KEWA 3O8QA 5TJHA 3WS7A 4J90A 4CLRB 3LT0A 1LDBA 2GRAA 4B4OA 3MTGA 4FFRA 4K9DA 4R1UA 4TRMA 4YWJA 1ZK3A 4JK3A 4WEQA 4CM7A 4W9NA 4Y9DA 3BMCA 1QLHA 5IDYA 4CM1A 1B3BA 4ZHSA 2IZZA 1HYHA 5JMWA 3U9LA 2WSBA 4YJFA 3S2FA 3EDMA 5MDHA 1Y5RA 4DQUA 4AL4A 4N5LA 2EERA 4YAIA 4R9RA 3QRWA 3C1TA 2NVBA 3UF0A 3W1VA 4MINA 2X9GA 4E0BA 5I8WA 2VUSA 3PJFA 3ZWMA 1E6UA 1BMDA 1CIVA 2ZTVA 1MW0A 5I9LA 1DB3A 2GN9A 1PZFA 5JDIA 4J7UA 4OXKA 3K9QO 3KSZO 4RPKA 3GC6A 4PG4A 1BSVA 3JQ8A 2NTJA 2NTNA 4Z0HO 5JCXA 4KDEA 4WCFC 1B7GO 1SO8A 3H3JA 2Q2QA 1I8TA 1S6YA 1BXGB 2FP4A 1YBVA 1H9BA 3PQEA 4ZVVA 3DAFA 3IIEA 3PIIA 4NBUA 4DPLA 1IE3A 2HO5A 2JD2A 1DIBA 1WAMA 4PZCA 4XR9A 3WJAA 4OGWA 4BNHA 4NU5A 4FFPA 3LZ6A 4CM4A 4ZJUA 1A4UA 1XR3A 2YV2A 3PPIA 1SC6A 3MJSA 2FSVA 4XEHA 4AG3A 1ARZA 1NXQA 4IZHA 5C5IA 4JP3A 1PGPA 2BLLA 3RKRA 1ZS2A 1VI2A 1M76A 5A9TA 3Q3CA 1P0FA 3ENNA 2DTDA 1K89A 4DA9A 2LDXA 1I3NA 1T1SA 3OF2A 1JAYA 1SNYA 4UUPA 5AYVA 3HB5X 4B4VA 4PFJA 1Q7CA 4CR8A 1RM4A 4ND5A 2IODA 3ASUA 2HUNA 4YJGA 1P74A 1LDEA 1CQIA 3ZGYA 1E3SA 3K2EA 4XYLA 1CF2O 1HL3A 1SB9A 3JD1A 1JWAB 1K6IA 1P0CA 2CDAA 4QT0A 1EUCA 1NAHA 4FIZA 4NU6A 3RFTA 3RU7A 2CF6A 3OJEA 3HSKA 1UDCA 4WNIA 3HDHA 1UXJA 1O6ZA 2XPCA 3QIVA 1YXMA 2WE8A 3OA2A 1B2LA 2A9FA 4DMMA 3B1JA 3GHHA 1WDMA 1U5AA 2POQX 2HKIA 4FPXA 4RPJA 1W73A 3LQFA 3NT5A 3L9XA 1C0IA 1KOLA 4OQYA 2H63A 1P1IA 4BNLA 3DZJA 2C59A 3ABIA 2X4GA 4PLVA 3T7CA 4E5NA 1F0YA 4AJEA 3JD3A 4FFMA 4U5QA 4B3IA 1J4AA 4D42A 4AJNA 4WLUA 4GSKA 2YJZA 2GZ3A 4ND4A 1U3TA 3TSCA 5L40A 4EGFA 1PX0A 4UEOA 1E7QA 3WB9A 3CXRA 3PJGA 1R6DA 3PGJA 2VWHA 4XRRA 3NTRA 4RVUA 5TT0A 3DFUA 2Y1FA 2ZB3A 4CMHA 3IJRA 4FFLA 4UVDA 1UR5A 4D0SA 1Q0LA 4L9RA 3ENKA 4G5HA 4MVJF 1IHXA 1E77A 1MFPA 1YB5A 3P7MA 5THQA 5I7EA 3WMXA 1H6AA 1NNUA 4I9NA 2Y93A 1IL0A 3O4RA 4FFOA 3VH2A 1HDGO 2C7VA 4IGFA 1N9GA 3LT1A 1H6BA 2Q1WA 4J4HA 1C1XA 3DBHA 5C7LO 4OIMA 4E13A 1BW9B 1NFFA 4PIVA 4Y6PA 1UUFA 3Q2IA 3GA0A 3VZQA 3AI1A 3HQ4O 1MW1A 1U4SA 2CVOA 3BTSA 1VPDA 3DZGA 4J43A 1I2ZA 1BRMA 3RC7A 2Q2WA 4AJOA 3UCFA 3OP4A 3PTZA 2FRDA 3BTUA 2PA3A 4CV1A 1R16A 2PNFA 2W2LD 1MXHA 1YQXA 3BMQB 4QFCA 2V6GA 3ROMA 2JCVA 3E18A 3F1LA 1XLTA 1XQ6A 2GASA 4PZEA 1P1FA 5AXCA 3GHYA 3HDYA 3WBFA 1QP8A 1BXGA 5LCXA 3G79A 3TZKA 2O4CA 1MG0A 3H8VA 1TI7A 2UUOA 1P9LA 2D5AA 2O3JA 1S7CA 1JN0A 3KSUA 5KTKA 5CG2A 1BDBA 3FCOA 4BKQA 4A26A 3BA1A 5DDIP 1VL6A 2EP5A 4MJLA 4TWRA 6ADHA 4YRAA 2J8ZA 1GZ4A 2ZB8A 2H6EA 3JD2A 2NVWA 4BS9A 4KP7A 5TQVA 3KV3O 2IYPA 2JAPA 2YZ7A 1XU9A 2AQHA 3I4CA 4PN3A 1ML3A 2GERA 2C07A 1LLUA 3H3FA 4WCFB 4J7CA 1P31A 3SVTA 2P5YA 1K0UA 1KVUA 2BH9A 4GBJA 1WXDA 1ZIDA 3HFGA 4MP6A 4XYEA 3GGGA 1NVGA 4LN1A 1HTBA 2PY6A 3ITKA 1CEQA 2DFDA 1MGOA 4OMUA 1SOVA 4OSOA 2FR8A 2HDHA 1DFGA 3W4JA 5JAQA 4C7JA 2AW5A 1KERA 4IQ0A 2X5KO 2AG5A 2X7HA 3VPFA 3RU9A 2WYVA 1ENYA 5T64A 5L4NA 1JVSA 1G5AA 1KBZA 4BO6A 4NQWA 3ETDA 4U0KA 2CY0A 1I2CA 1DC3A 3QV1A 5B4TA 5IXSA 3WYEA 1R4MB 4D3DA 3JQ9A 3WQSB 3JQ6A 1UP6A 4XX0A 2O3RA 1DRWA 4IS2A 4BO1A 3ZWCA 3QQPA 2CDCA 1GZ6A 2EWMA 4O59O 2EKPA 4ILKA 4QTZA 5LDHA 4U6QA 5GZ6A 4MVJA 4D3SA 2VUTA 4WE3A 5G0UA 3RASA 2EHDA 2DQ4A 2JFHA 1UXGA 4A2CA 1BDMA 2PKRA 2QRLA 1E5QA 4ZRNA 4ZQHA 2PR2A 5JE8A 4KUEA 1ENPA 2JCXA 1FJHA 4CV0A 4YT8A 3L4BC 1QKIA 2PGDA 3KTDA 1PQUA 5U4QA 5KCZA 1YH3A 3OJ0A 2B4QA 1X7HA 1DIAA 1PJ4A 1QR6A 1DIGA 2Z1NA 4ND2A 3R3JA 5I7SA 2G5CA 3RAJA 1GDHA 3CKYA 2IXAA 2O2SA 1T2FA 3U49A 4WLFA 4YVFA 1QYDA 4M55A 4EJ0A 3KM0A 4CMIA 5A5FA 1JKJA 1V6AA 2RH8A 5F5LA 2DUWA 4RJTA 5BNTA 4XDYA 2VRCD 2VCYA 4CV3A 3ETEA 4Q3NA 5GZ3A 1EE2A 2O7GA 1K2WA 1QSGA 5IDXA 1YKFA 1FXSA 3RI3A 1K6XA 1ZMTA 1IULA 5JDCC 3AOEC 1YWGO 4YTEA 5IG2A 4R3WA 1NR7A 5DP2A 2HMVA 3KLPX 4AJ1A 4IDAA 4NFHA 3KYCB 1Q0QA 1K3TA 4BOYA 4DYDA 5TX7A 3D4OA 3IP3A 1E3LA 1PS0A 3STHA 1JDJA 4GQAA 1C3VA 2AG8A 2GUGA 3JV7A 2W2LA 1JWBB 3O9ZA 3QP9A 4LVCA 3ZHXA 1KEPA 1PGNA 1HE3A 3GMDA 4KTVE 1EVIA 2AQKA 2X6TA 2ZB4A 3AI2A 3PEFA 2O4UX 4W4TA 3DMTA 1ZW1A 1YOVB 5COBA 5A04A 5KJCA 1PTJA 3RBZA 3KVOA 4CMCA 5JY6A 4WOKA 3GEMA 4R69A 5A9SA 4Q3AA 4FSHA 4R51A 5KJ1A 5F1PA 2ZTLA 4QECA 4D43A 2X23A 5I7VA 4U8GA 2OZPA 1R12A 3GGOA 3RUDA 4CUZA 1DRUA 2D1YA 4CLOA 2VZ8A 3TJRA 2YHUA 1UDBA 4BGEA 4R5MA 4DYVA 5DBIA 3SEFA 2B69A 1ZH8A 3ZU5A 3FTPA 3A06A 2WEKA 4YQZA 3FN4A 3JCZA 1U1IA 4FW8A 3NKLA 2I99A 1QV7A 1MUUA 1QMGA 3IKTA 5JC1A 1QYXA 3DO5A 5BSEA 2HCTA 2B4TO 1WDKA 2DC1A 1B8VA 3H5AA 4NG5A 4D3FA 1RPNA 4TKLA 3IQDB 3NJ8A 3B1FA 2DFVA 3GNSA 4TVOA 2C20A 5I9NA 3I52A 1YRLA 1MB4A 1EDZA 3DOCA 3PHIA 1HF3A 1MLDA 2B5VA 4MVJM 5CDGA 4NI5A 4BNFA 4JCOA 4MVJD 5IDWA 2JKVA 1R4NA 2GN4A 1NASA 1OFGA 3SX2A 4BNJA 1SEVA 4TSKA 4F3YA 3ZNOA 4O0LA 4B7UA 4HFRA 3JQAA 1TVEA 1LDYA 4LSMA 4EBFA 5IF3A 3ZV4A 3H9QA 1NHGA 4JX8A 4M8SA 2TMDA 3GY0A 4ZQFA 2FWMX 1P77A 3QJ5A 2ET6A 1E0DA 5JFOA 4CM6A 3GG9A 4AJPA 1G0OA 1YQDA 3JQAB 4CQMA 3Q6IA 4FOSA 5KJFA 2X5JO 3MEQA 3TZCA 3WGOA 3FNEA 4LCEA 4WLEA 1O95A 2NU9A 3MJTA 3HHPA 1PJTA 5EJ2A 4HP8A 3MJ4A 3UEQA 1OC4A 1PZHA 5EQDA 1GY8A 3GDFA 4LRTB 4XGIA 4A5OA 1FDWA 3EK2A 2J3HA 1PWXA 4NK4A 4BGIA 1HEUA 4YEDA 4IDEA 4NIMA 5KVQA 4Y8VA 1OZAA 2IYOA 3AY3A 1NVTA 4U0JA 3GR6A 3JQ9C 1RJWA 3P5SA 1EEHA 4ITUA 1QV6A 4QUKA 2R2GA 3W6ZA 4W99A 3VPSA 4PLPA 3TQHA 2BI7A 1MVYA 1B8UA 1LLDA 4CLEA 4Z0PA 4K26A 2Y1DA 3L77A 1ISFA 4BNTA 1GUYA 3BTVA 4P4GA 3AUSA 2OO5A 3NDJA 3F9IA 2BKAA 3WQQA 3FPLA 5JYEA 5A9RA 1BGVA 4ROSA 3BAZA 2H9IA 1M6WA 4DTIA 2C82A 4MOWA 4UULA 4IQ8A 3AFNA 3I9LA 4UUNA 1ZK0A 4E5MA 4BV8A 2QHXA 2HJSA 3GFBA 4WUVA 1KEVA 4W9NC 2VTDA 5F1KA 1VJTA 1T4BA 3PYXA 5KVCA 4NZ9A 2HSDA 3WNVA 2VHVA 1XGKA 3NJ4A 1E1LA 4BGVA 4GSLA 4CLHA 4F6LA 3ITDA 1F8FA 5G0VA 1P3DA 3PFFA 2TMGA 4LK3A 3W4KA 2O48X 3MJEA 4RLHA 3V5NA 4YRDA 2Q49A 3EVTA 3IP1A 5IN4A 2PZJA 1P1JA 1Z73A 3KSDO 5EMHA 3V1UA 3BMOA 4XQCA 3HADA 1AHHA 4RGBA 2BELA 4P4LA 4CLRA 1X13A 3WIDA 3C7AA 4B7XA 4ND1A 4YYZA 5ER6A 5BSGA 3GZ4A 5EIOA 2W98A 3TN7A 2WD7B 3I6IA 1DRVA 2SCUA 1C1XB 4IGEA 1FDSA 1L7EA 1F06A 1L7DA 3I6QA 4YAGA 4MIYA 1XDWA 3S2GA 4PLYA 1DDOA 3ZWAA 3V8BA 1WWKA 3B70A 3O26A 4A03A 4HNGA 1DJQA 1WPQA 3PYLA 1MP0A 4PLTA 3DB2A 2YQ5A 1HDRA 1AN9A 3VPGA 4OYRA 3VPXA 1XCBA 2Q1SA 3GZNA 3TZQA 1LDMA 3NX4A 1PQWA 4JROA 3ST7A 3GFGA 3ONDA 1EK5A 3KRTA 3U0BA 3I9NA 1NAIA 3INGA 3U3XA 5EPOA 1C0PA 5A5EA 3ZW8A 3OICA 4XKJA 3E82A 3K5PA 5BQFA 1Z6ZA 3F1KA 4ALKA 3LC2O 5H82A 1DHRA 4E2ZA 2DTEA 2PGLA 3C3XA 5ENVA 4EZBA 2I76A 2VZ0A 4MP8A 1D8AA 2QX7A 3QVXA 4CM8A 3D4PA 4IMPA 3OSUA 4YBZA 3ZZNA 1H5QA 4RPGA 5DULA 5GZ1A 5JSFA 4OH1A 4BO7A 2X1HA 4D44A 4XRGA 1YJ8A 4B8ZA 3JSAA 1DLJA 1DHTA 3C1AA 4DREA 2VYND 2UV8A 1ID1A 3JYLA 5DOZA 2BHLA 4XWYA 1NTOA 5DZSA 2HLPA 5T67A 4GGPA 4N5MA 1E7YA 1Q7BA 3CH6A 3TOZA 1LSUA 3L6EA 4IJKA 2OL4A 1ZVMA 1C0LA 1ZMOA 1XQ1A 3QHAA 1VSVA 1P1KA 1ADCA 3INRA 3JQ7B 2MAOA 1V8BA 4GGOA 4N18A 1S46A 2A92A 3UCEA 3TOXA 2QYSA 4XIYA 4CODB 3R6DA 1BXKA 1NFQA 2X0IA 1JGIA 5HBRA 3RJ9A 3K73O 2BFAA 3A28A 1VM6A 1ZCJA 2O7SA 3ZWYA 2PZMA 4YXFA 2OGUA 5EERA 4YT5A 3F4BA 4Q39A 3UN1A 4AJIA 3GRPA 1IPFA 1U2DA 2DBQA 2VWPA 4OQZA 5B37A 3VAZA 2RHCA 5AQ1A 5CEJA 1ZEJA 2WM3A 4EDFA 4Q3EA 3CSDA 4ALNA 2E49A 4J91A 4DRYA 4RF4A 1LX6A 3NDRA 4LW8A 4NH4A 4KWHA 3HN7A 3DONA 3DBHB 3EGOA 1LEHA 4YCAA 4RORA 4CMAA 8LDHA 2VT3A 4OAQA 4IPTA 3ZHYA 3IKVA 4J16A 3TWOA 2RIRA 1GUFA 2P4HX 3QWBA 4YA6A 1X7DA 4BNKA 3G1TA 3ZV6A 1GV0A 3JQGB 4I5DA 2VYNA 3KZVA 3FI9A 3UW3A 2I3AA 4HXYA 3PJEA 4ZN6A 1KY5A 1XKQA 2NV6A 4ESOA 3D4NA 4J49A 4BNGA 5JO0A 2XF8A 1HE5A 4YJHA 1ULSA 2XOXA 2ZTUA 4XJTA 3QWFA 4CL3A 1YDWA 1SB8A 3CE6A 5IZCA 4BQRA 1VE9A 3T4EA 3RROA 1XYGA 3EC7A 5U1PA 1DIRA 1QRRA 1DPGA 1VRWA 4XDZA 5L3ZA 5IXYA 3PDJA 5L7WA 2Z5LA 1B14A 2HMSA 3IDSA 2WTBA 5C37A 1LSJA 2HU2A 4HKTA 1U9JA 3SLGA 2QRKA 2O3TA 3PK0A 5MGBA 1R15A 4ZGWA 2B5WA 4QO8A 3B1KA 3L6DA 3KEOA 2B83A 3JYNA 1Z75A 4G2NA 4NQZA 4RZHA 1EUDA 2D3TA 5IAAA 2CVZA 4DIBA 4JNKA 3W8FA 4BL5A 4RVFA 2BGKA 3LSYA 1DBVO 2IE0A 2IZ0A 4DBVO 1PQPA 4FDAA 3QY9A 2IZ1A 3CZKA 4GMGA 1SC5A 1MG5A 5C7IO 1OOEA 1PS9A 1HT0A 3I4FA 5TJ9A 4RQUA 3RFVA 1Y9EA 2Y68A 1X14A 5G4KA 1OAAA 1N1GA 3ZI0A 4MIEA 3WYCA 3F4LA 5JCJA 3ZV5A 5CPBA 2QZ9A 1NQOA 4IDBA 2Q4BA 4OL9A 1XSEA 5EESA 4I5FA 4FLSA 1Q0HA 4C7KA 2Q99A 1H3LA 3I9KA 1MC5A 1V9LA 1IHYA 1P44A 4UEKA 2CZCA 3GH3A 4D41A 1U4OA 5FFFA 1VLLA 4J0FA 5G0TA 3VKVA 3ZNPA 4JBGA 3U4CA 1LRJA 2GN8A 4HADA 4NBVA 1R4NB 2HMTA 2WD7A 5BNIA 1V3UA 5K0ZA 1GCOA 4BKRA 3PZBA 3OEYA 5FEUA 3S1LA 2IDZA 3DHNA 3QSGA 3AUUA 4URFA 5T5QA 3T4XA 4AJHA 2P4QA 3IOYA 3PGXA 3I23A 2WMDA 1DFIA 4G65A 4OXNA 5H81A 3ZHZA 1I0ZA 4R5HA 4EW6A 2DBVO 2CVQA 4HV4A 1ENZA 1GPDG 1NP3A 4R1NA 3VVCA 3RKUA 3L9WA 4HWKA 5BSHA 1UXKA 5F3RA 2EW8A 4MVJP 2NADA 3W6UA 1IPEA 1X7GA 1U3WA 4JIGA 1KC3A 1WLYA 3GAFA 3NGLA 2Y0DA 4WCFA 3E1KA 1DJNA 3E9QA 3LT4A 4KMSA 3B6ZA 1CETA 4FD3A 1ISMA 1Z82A 3VH3A 4ZU3A 2C54A 3RCBA 4J0EA 5L7YA 3V2GA 5L45A 2EGGA 3UCXA 2GPTA 1PGQA 2PFGA 3ZU3A 4R1SA 2D2IA 1A71A 3RBXA 4ZRMA 3EMKA 3WICA 4D79A 4FQ8A 3OJLA 5TF4A 3WSVA 4XGNA 4CJXA 1R0KA 4CL8A 3EY4A 4WOJA 3FSRA 3ON5A 1F17A 3CINA 5ES3A 2EP7A 3C8MA 1Y81A 4IJVA 4E12A 2ZQZA 4GL4A 3PJDA 1IB6A 2ZATA 3GVCA 3H6KA 3DBVO 3KEQA 3SBOA 4E2YA 1VKOA 5G0SA 2CF5A 2E4AA 3ZH2A 2VHYA 4PVDA 3BZUA 3PHHA 4L74A 3ICCA 3VDRA 4A27A 1UZNA 3IAHA 3PIDA 3CZLA 4RDIA 4E4YA 4R4JA 3M6IA 3NYWA 3QWAA 3HDQA 1GQQA 1PS8A 2CDBA 2VOJA 4RPLA 3WXBA 4DWVA 4EITA 3QA9A 4YDRA 5G4LA 1AXEA 1RP3A 3DBRB 3UFXA 1XA0A 2J3KA 3BHJA 4YR9A 1GYRA 3RVDA 4Y6SA 1QORA 1GQYA 1FDTA 1LC0A 2FPIA 4DQXA 4F45A 2AQIA 4WKGA 4NMHA 1YBMA 1NBOA 4G81A 4IZIA 5KIAA 2Q1UA 3V2HA 1JVBA 5COQA 5ILGA 1GADO 1WNTA 1JQBA 2WYUA 4H3VA 4KUHA 3RWBA 1N2SA 3ZU4A 2OMEA 3C7DB 5JYDA 4PG7A 4XJSA 1GQ2A 1IYZA 1PWZA 1Y8QB 1EUZA 1O94A 1YB4A 2UUPA 4J9VA 4IQGA 4PLFA 4E3ZA 4INAA 5LDGA 2PTGA 4QQRA 4TZTA 3JQFA 4DXHA 4IDCA 4L4RA 3ZWWA 1JA9A 2EV9A 1W6UA 3RUAA 1Q1NA 2YDYA 2VHXA 4F6CA 3GMSA 1D1TA 3ZW9A 3INTA 2J3IA 5B4UA 5EQFA 2V7PA 7MDHA 1ONNA 3RUFA 1YB1A 3CMCO 2NTVA 3PXXA 5CPFA 3JQCA 1K5HA 5KWEA 4HUJA 4Y98A 3H65A 1RM0A 1CERA 1LLQA 2VN8A 2J5RA 1LSOA 2WJPA 4TROA 3GUYA 4N7RA 1DAOA 1HE4A 1E7RA 4AJ4A 2VTEA 4HY3A 4NBWA 3ZWBA 1XELA 1YBAA 2LDBA 3RFXA 1DSSG 2X9VA 2E6UX 3GPIA 4BB6A 3WIEA 3NTQA 1UXHA 1ISJA 4RVHA 4MVJE 1RYDA 2IXBA 3KXDA 4L4SA 3TNLA 4TRJA 1I3KA 3PWSA 4J6FA 3D0OA 4PLHA 1ZK1A 3CPSA 3GDOA 1Z74A 1VSUA 4E5PA 1E7WA 4NJOA 3UH1A 3UVEA 2GCGA 1LU9A 2VHZA 5TSDA 1GV1A 4XYBA 5CHEA 1R4MA 4NDNE 4FGWA 3QWHA 3ANNA 3FD8A 3FNFA 3WGQA 1E3JA 1PJBA 1N8KA 2PK3A 1PL7A 5EINA 3H5RA 3O38A 5L9AA 1H94A 2JD0A 1UXIA 1NX6A 4M1QA 3DBRA 3HWRA 4HX5A 3WFIA 3PWZA 2YHIA 2W2KA 3GG2A 1TEHA 1VL8A 1C1DB 3S8MA 5CEFA 3AI3A 2D4AA 2X8LA 1EQUA 3EYWA 4BMSA 5JAMA 3WGZA 5BT9A 3MJCA 3O03A 1YOVA 3VHRA 4CQLB 5JW6A 1NPTO 3GDGA 3VPHA 1EBUA 3SC6A 1WMBA 2FSSA 1KVSA 4WK6A 5FF9A 3X2EA 3K96A 1QYCA 5I7FA 2HK8A 4AVYA 3I83A 2FOIA 4XZ3A 1LTHR 2VNSA 4J3FA 3WX0A 4R9SA 3ADOA 2EJVA 5DT9A 3N7UA 3TDKA 3OEWA 4KOAA 4CR7A 2CUKA 3AU9A 1P1HA 4O1MA 4RDHA 2A94A 2P9EA 1SMKA 1G0NA 4M86A 1HXHA 3DZHA 2DKNA 1OR7A 2C2YA 1ZXLA 3D5QA 4HFNA 4UUMA 4K6CA 3KHUA 2JAHA 1KIFA 2WPGA 3F47A 4Z3DA 4YAEA 3HN2A 3BTOA 4N5NA 4OXYA 4FJ2A 3DHYA 3ZDFA 1A5ZA 3HZZA 1DEHA 1BG6A 3BXXA 4GH5A 3L0DA 3OQBA 1SBYA 2FN7A 3QE3A 3S55A 4E2XA 1WP4A 1EK6A 3E9NA 5CAEA 4EJ6A 4D0RA 4Q3BA 1NVMB 3RIHA 3I1JA 1XWFA 3E5MA 2PH3A 1FF9A 4P38A 4RZIA 3WGTA 1C1DA 4MKRA 1X1TA 1QXSA 1ISIA 1Z7EA 2GSDA 4Y6RA 4II2A 1HZZA 5AOVA 1UAYA 4BB5A 1ZBQA 2J3JA 3BMNA 2HQ1A 5A3JA 1T2AA 3B20A 1DAPA 1E6EA 3LLVA 4FBGA 4P8RA 1N92A 4Q3DA 2QQ5A 1NM5A 2EGHA 3S2IA 3G3EA 5G0WA 1CRWG 3NGXA 4GVXA 4NJMA 4MVJI 2Z95A 4M54A 3ONEA 1GCUA 3OFSA 1UZLA 5TLSA 2X0NA 5A03A 2BFMA 2EIHA 2Q45A 1A9ZA 3OHSX 4YAKA 5G4KB 3GEDA 4RV9A 1VL0A 2ZIZA 4KDFA 1UJMA 5TIIA 3KYDB 3DAPA 1KEUA 2CSUA 3UXYA 3WOHA 4XD2A 1LRLA 3DMYA 1AXGA 1QYWA 3D1LA 2NM0A 2DPGA 5TRTA 3V2UA 4A0SA 4DC0A 9LDBA 4A7PA 1MXFA 3QVWA 4LMPA 4D7AA 1ZSVA 3X2FA 1A4IA 1ISHA 3MWDB 1QLJA 4W82A 3RUEA 1GAEO 4LCJA 5BSFA 5F21A 1YVEI 4JJFA 1ORRA 3K2BA 1GEGA 4TVBA 4YQYA 2EKLA 1KVRA 1WMAA 4YT4A 2V6FA 3HDJA 3A4VA 3IC5A 5J23A 1PJ3A 1HDXA 1GEEA 2O2YA 4N54A 1PJ2A 2RH4A 3FBGA 1PSDA 2A4KA 3VH4A 2B37A 1LNQA 5JO9A 3A9WA 3DL2A 1N7GA 1GUZA 3Q1LA 1G6KA 1ZEMA 4HFMA 1ZKMA 3GNTA 3N74A 1I01A 5L4LA 1H6DA 1EDOA 1UP4A 3ZCXA 3AM5A 1A72A 2ZYDA 1XEAA 3FTNA 4W6ZA 4XQGA 3ZU2A 3H9EO 4OJNA 4Z0TA 4Z3KA 3ANMA 4E31A 1JG9A 1HKUA 3V1TC 5G2OA 4X54A 1T24A 3L07A 1PIWA 3H9JA 2X5OA 2DAPA 4O5OA 3QVSA 4OSPA 4J1QA 4TZKA 4NR0A 5A3VA 5CG1A 1GPJA 3UERA 2JL1A 3FF4A 1KYQA 2A35A 4B7CA 2CFCA 4I9HA 4IDGA 1FK8A 1ULUA 2RAFA 3FHLA 5GY7A 2C5EA 2QIOA 1FDVA 3FR8A 3HNPA 3KLMX 4R68A 1YONA 4CPDA 4EUHA 8ADHA 2O3SA 1Y8RB 4CM3A 2WD8A 3DHEA 2E48A 3C24A 2UVDA 5JNLA 4FLOA 3CTMA 1DC4A 1EZ4A 3JQDA 2BMAA 1LRKA 3PHGA 4U7WA 3RUCA 3HUDA 1E1NA 4EUFA 1ZSYA 3KB6A 4BUCA 4E5KA 2UDPA 2PGJA 2ZKLA 3MWEB 4GKBA 5JMPA 4BKPA 4DIOA 2H5LA 1EE9A 1M6HA 4TKMA 4TQGA 3M1LA 1WZEA 4OM8A 1PZEA 3ZNNA 3L6OO 4FC6A 3WTCA 2P5UA 3OIGA 3KYCA 3LVFO 5CDUA 2C5AA 4L76A 4RF5A 3D7LA 2DUUA 2FZEA 1NQTA 2X22A 4ZQGA 2R6JA 3DWFA 4IBOA 1P45A 1LDGA 4CQMD 2BI8A 2WWRA 2HK7A 2OUIA 1WZIA 5JDIC 4B4WA 4NNJA 4MVJH 1IZ9A 1UP7A 4BQPA 4PRLA 1AE1A 2VYVD 1NR1A 4M87A 4YJFB 3TL3A 2PD6A 1E1MA 3KYBA 3PFWO 4ID9A 3WGYA 2NACA 4HBGA 4NK5A 1U7HA 2CMDA 3LF1A 3K8ZA 4JLWA 4ZQBA 3BMQA 3AU8A 3IUPA 3ICPA 1NPDA 5COAA 3JQFC 4JBHA 1EVJA 3AJRA 1YS4A 1XIVA 4D45A 4IJWA 1DFHA 4XYMA 1HYEA 2Y0EA 1U7TA 1RYEA 1W0CA 5DOVA 3GUCA 3DTTA 3LDHA 3C7CB 4B3JA 4ONEA 4FN4A 3RC2A 1H6CA 1AGNA 1MA0A 4O6VA 4AJ2A 1YGYA 2FPGA 5ADHA 4BVAA 3JQBA 3G49A 1LUAA 3Q11A 3ZWVA 2V6MA 3VKUA 1CQJA 2F00A 4R1TA 3VTZA 3W8EA 4BNXA 3RD5A 4ZA2A 1AUPA 3AW9A 3DMTC 5T8KA 2XXBA 3IMFA 4WLNA 1YDEA 4JN6B 4E33A 2IEDA 1GD1O 3GN1A 4OKNA 1HWYA 1X0XA 2VWGA 3SJUA 2DTXA 3OIDA 4GWGA 2W4QA 2AEJA 3LF2A 2YV3A 2I6TA 1Y7TA 3U4IA 5KJ6A 2YY7A 4FR5A 1W8DA 2PKQO 3HE3A 3DZBA 3CUKA 5C3MA 2EKQA 4E30A 1R0LA 1UZMA 4HNHA 5ER9A 2QZZA 7ADHA 1KETA 2DLDA 2NQTA 2XAAA 3DR3A 1EMDA 1PJSA 3VZSA 4AJLA 4LVUA 4CM5A 4ALJA 4E2WA 4CM4B 1HDCA 3VZRA 2GO1A 3P19A 5DP1A 4FLQA 4FOOA 3IJPA 4DPMA 1T25A 2Y67A 2EJWA 3NT4A 5JCJD 5EN4A 2MAPA 3WG9A 4R01A 2BFOA 4CMEC 1DC5A 3ZNQA 1CYDA 4Z9YA 5B1YA 2X0RA 1SCUA 2AHRA 3H5NA 2BGMA 2VYVA 5IFLA 2HRZA 5A05A 1ADBA 1F12A 4CM8B 4AJJA 4RO0A 4XA8A 4XB1A 4BNYA 4CR6A 1H9AA 1T2DA 4EEZA 1MC4A 3DOOA 4PLCA 1LLCA 3DBLA 3GOHA 4DLLA 3DOJA 4E5YA 3KETA 1Y6JA 1E92A 2YFQA 3AFMA 4YRBA 3CZMA 3NAQA 2JHFA 3H9UA 4AICA 2JHGA 1Y8QA 3EZLA 1HDOA 3PZRA 1E1KA 3Q0EA 1LXCA 5DNAA 2VRBA 3I9OA 5K6AC 1HDYA 3E6AA 2PD4A 3LYLA 4J1NA 1GYPA 3L4SO 4I9UA 3WGIA 3WYBA 5I9MA 9LDTA 3BHMA 1WDLA 4E6PA 2EXXA 3KO8A 4XYGA 2ZQYA 3NDIA 3K92A 2NU8A 1Z7BA 3MOGA 1HYGA 3H2SA 4OOEA 1C14A 3PHJA 3VTFA 1X0VA 4R16A 5CDSA 1U3UA 1PR3A 3BYZA 3WWZA 4EJMA 1JLLA 4MPDA 1U3VA 3KOUA 4OKIA 1EFLA 5DCWA 4DGSA 1UH5A 2HRBA 2NVUA 3W8DA 4XIJA 2OP0A 5BNFA 3GK3A 4MIOA 4EYEA 2FMUA 2PH5A 2ZJ0A 4FS3A 5L53A 1X1EA 5F1OA 3ROKA 3NEPX 2VRCA 3VH1A 1YQGA 2O3UA 4I5EA 5JY1A 2IEBA 1I2BA 1E5LA 4LGVA 4BO4A 2VUUA 1CDOA 4CQMB 5B12A 2Y66A 1NWCA 3QVTA 4XB2A 4CM9A 4TRRA 4BNWA 4DVJA 3BIOA 3LT2A 1TLTA 1TT5B 1RWBA 2ILTA 4JGBA 2D0IA 4IIUA 5FI5A 4DLAA 5CEEA 3NTOA 3SC4A 3KUXA 3PWKA 3D64A 4L8VA 4GX5A 1Q2XA 2PKQP 3W4IA 4JQCA 3CZRA 4J7XA 1OI7A 4FB5A 4ALIA 3CMMA 1JU9A 3SLKA 3GAZA 1Y1PA 2Y0CA 1U8XX 3RQSA 4IJUA 3ONFA 4LRSB 1O5IA 1CJCA 4CMKA 2Y05A 3JYPA 5HA5A 4CXFA 1HRDA 2E37A 3JD0A 4WECA 2G1UA 1X15A 5JBIA 1ZJYA 3DZKA 1FMCA 3AOEA 1F8GA 3ETGA 5IZCC 2Q50A 5DCUA 3DXFA 2D5CA 4J4BA 1J6UA 4P4NA 4RVGA 4QEDA 3RSHA 2AE2A 1SAYA 2OP1A 1E3IA 4DBZA 1E3WA 1GTMA 2NNLD 3MZ0A 4IY1A 1R0SA 5U9CA 3TL2A 1GL3A 1PJQA 3DAGA 5DBGA 4IXWA 5A06A 3FRJA 1DXYA 1XG5A 3QLJA 2ZYGA 1JKIA 2BRUA 4Z9FA 4CMEA 5ITVA 3M2PA 3PDUA 1P33A 1VJ1A 1N1EA 4LUPA 2I66A 1H2BA 4K28A 3FR7A 1I33A 5FI3A 3E8XA 2Q2VA 4CUJA 3UUWA 1I32A 2AEMA 2C7GA 2Q4EA 2PV7A 1B15A 1NHWA 4RCVA 5DCYA 2CD9A 5FYDA 3PI7A 2PZLA 4DC1A 4YACA 4CLXA 3G0OA 3WWYA 4DPKA 3D3WA 3DTYA 3OQ6A 3CIFA 2VNAA 1E3WB 4J9UE 5A9SB 2NQ8A 1OMOA 1BTOA 1BVUA 3WR5A 1GU7A 4NFSA 1A7KA 1SPXA 3BMOB 4UEJA 3PYMA 4JP2A 5T57A 2PLAA 1I30A 2GN6A 1SZJG 2NUAA 4GX1A 2UYYA 2VZ9A 2Y1EA 3GVPA 4E21A 1H93A 4B8WA 1T2CA 5L4SA 2DT5A 1ONPA 3ULKA 3NUGA 1Y9AA 3GGPA 2OBYA 1LC3A 3E03A 4BO8A 4RVSA 1D7OA 4XCVA 4WNCA 3EUWA 5JS6A 3VVBA 2HMWA 4L4XA 5IN5A 3EW7A 2RHRA 1KVQA 1T2EA 1HLDA 1JW9B 3F3SA 2JD1A 3RJ5A 4YJHB 3I3OA 3LC7O 1KVTA 3EZYA 3VDQA 4QO7A 5JDCA 4BO3A 3MOIA 2OORA 3VC7A 3LK7A 5A02A 3SJ7A 3VOSA 4XQ9A 1BVRA 4GWKA 4UVEA 1E3EA 4NPCA 4LMRA 4WEOA 3IL2A 5B4VA 4PGFA 4Z6KA 2D8AA 3DQPA 5HTOA 3K31A 2VT2A 3Q9NA 3DBLB 3OJOA 4MVJG 1V3VA 1U2GA 2JFFA 5KNLA 3OETA 3JQEA 3DZIA 2FPPA 1PR9A 2GF2A 3GQVA 2ZK7A 5KVVA 1WW8A 3OA0A 3GVHA 5AXDA 1J0XO 1K6JA 3ORFA 4MO2A 4RQTA 4H16A 4JJGA 2J5KA 4S1VA 4J4TA 4L75A 3G17A 4UVHA 2YV1A 1BWSA 5KKAA 3AY6A 3PRJA 4ND3A 3OBBA 4EI2A 5L7TA 1E7SA 1PU2A 2JJYA 4DMLA 1GR0A 3RBVA 4KUGA 3A1NA 3ZWPA 5IDQA 2B36A 1N9GB 3M1AA 5HM8A 3WFJA 1H2HA 1N7HA 4ZQEA 1B3RA 1VKNA 5GMOA 2BGLA 1LQTA 3U5TA 3ZN2A 3T7EA 4CMBA 4FJ0A 2DU8A 3GN2A 4NHEA 1B16A 4GX0A 1A9YA 2DVMA 3F5QA 3TRIA 2GYYA 3GNQA 3E9MA 5EL0A 5HS4A 4I08A 2C2XA 4QFDA 5DBFA 1JAXA 3E5RA 2ZCUA 3UICA 1LA2A 3LLSA 1O9BA 4RVDA 4C4OA 2RBEA 1DC6A 5ICMA 1PEDA 4K1LA 3R0IA 1IOLA 4WJZA 2C0CA 2GR9A 1LBEA 2YW9A 3GVXA 4YB8A 5ILOA 1I36A 1TXGA 3WGGA 4II3A 5CDYA 4YJDA 2VQ3A 1E7MA 2Y1GA 4OOFA 4BO9A 1MW3A 2C29D 3H4VA 1PGJA 3G1UA 3OECA 1EVZA 4TMFA 1PJLA 3UOGA 1HSZA 1ZK4A 1I5RA 1U28A 3H9GA 2X58A 1ZJZA 4AYSA 2Z1MA 4YT2A 3PLRA 1LI4A 1GZ3A 3ZHBA 4CMJA 4XQEA 1YL5A 4W7HA 3K6JA 1UAGA 3CZEA 1ZXBA 3UKOA 5HRUA 3ZWXA 1B0AA 1W4ZA 2VOEA 3I9MA 1O0SA 2ZCVA 4PLZA 4E32A 3AOGA 3GZNB 2X0JA 4ALMA 3DDNA 4Q9NA 2JCYA 3IS3A 3D3EA 1Q7GA 4BKOA 2V6BA 3PHLA 4FGSA 3NT2A 5TT1A 3WLFA 4DIFA 5L95A 3JQGA 5T8KC 4MP3A 1QG6A 2X9NA 2HJRA 4CLOB 3UHAA 3UGKA 2OBNA 2W90A 1LSSA 5KVSA 2HAEA 2YFHA 2ZB7A 3IUSA 5I8ZA 3TZHA 4JJIA 5TNXA 2GDZA 4B3HA 1BXZA 1O89A 3C85A 2BF7A 1SEPA 1EFKA 3QWIA 3H2ZA 1I3LA 3OIFA 3DFZA 1IZ0A 3TZ6A 4IIVA 4GKVA 1Y5MA 4RL6A 2P9CA 2JFGA 2NVUB 3OMLA 4UVGA 5K6AA 4I5GA 4RF3A 2J5QA 4PLWA 1BW9A 5LC1A 4U6SA 3WDSA 3PQFA 4FFNA 4BNUA 2AEFA 1PL8A 2DBRA 2FR1A 1I10A 3P2OA 3TFQA 6LDHA 1O8CA 1BHSA 4GLOA 3PLNA 1NYTA 4M89A 4BHTA 5C7OO 1CWUA 1PJCA 1XU7A 2WDZA 2QG4A 4W7IA 2O7QA 3JYOA 4KTTE 4ZD6A 2PD3A 2AA3A 3E48A 3JQAD 4YAJA 2HK9A 5IZ4A 4AJKA 3SXPA 1TA4A 2FR0A 5CP8A 2AXQA 3F6YA 4NFYA 4WASA 1VC2A 3FNGA 5DN9A 3K30A 4PZDA 4DLBA 2OXIA 1GYQA 3R1IA 4GPD1 2I65A 4J2OA 4CV2A 4A10A 5HWSA 1D4FA 1DO8A 2Y99A 4L73A 4CUKA 2GZ1A 3COSA 3AM4A 5DF1A 2EEZA 2VHWA 2DPHA 3OM9A 3ASVA 3MCVA 2AQ8A 1H0KA 4NBRA 4L0QA 4Y67A 5F5NA 2NSDA 2NWQA 3WNQA 1RM5A 1M75A 3PP8A 4UUOA 3N58A 4BNNA 3WJ7A 3ZWNA 4MDHA 2OHXA 4AFNA 1WVGA 4JXKA 2P2SA 1HSOA 1OC2A 5CDTA 3AY7A 3Q2KA 2PWZA 4I8XA 2IRWA 2EG9A 2YQ4A 3A14A 1I24A 1YJQA 1MX3A 2CNBA 3PVZA 3VZPA 1M67A 2R00A 2Y1CA 4WPGA 1V35A 1SOWA 4IMRA 3R3SA 4GAEA 2GNAA 4BKUA 1F14A 3EAGA 1YL7A 3JQBC 1UDAA 5A1TA 2GGSA 1ZNQO 1NQ5A 1ENOA 4R41A 1ONOA 2B4RO 2ZYAA 1YL6A 3KBOA 1ZSNA 3ADPA 3GEGA 1N5DA 2Q3EA 4BO5A 3ZWOA 1KY4A 5KKCA 3DEYX 4BO0A 1IUKA 1I3MA 1U5CA 3S2EA 1L1FA
chains in the Genus database with same CATH superfamily
3P5BA 3FYDA 3HXQA 1Z5PA 4IF6A 4F46A 2G82A 1DMRA 5CT9A 1ZA1A 2OV6A 3WC4A 2WJGA 3UK6A 4F93B 5KNBA 4GPBA 3VDXA 5J4HA 5AXBA 3HTXA 1ANKA 3C1OA 2CFSA 4AUMA 2BISA 4UTZA 4EKNB 3T1HB 5JXGA 8MHTA 3DFIA 4ZPXA 3QJYA 3B7GA 5I9SA 4HBZA 5ICSA 3BX1A 4HQRA 4HTAA 5DNYB 5HW0A 2EKZA 1XCGB 1TLLA 1J49A 1HV8A 1SVIA 1OXVA 3A4MA 4GMHA 1Q7EA 5T3YA 4O08A 3RSLA 2I8LA 4RBNA 3X3HA 4BNMA 3CNBA 4BCDA 5IJZA 2PUCA 4HS9A 1NPYA 4RPHA 3OUZA 5K9ZA 1CHDA 2JIZD 5JTTA 3K9NA 4O2RA 4BFYA 3EVCA 1Z2PX 4KQXA 4OQPA 3OZGA 1UM9A 3TKLA 1ZO8A 4RLFA 4UAGA 3L7IA 1UJ4A 5KSYA 1PL6A 2UAGA 2FHSA 4LBZA 4FEEA 2QRJA 4KR6A 3TAXA 1SCJA 3ZDZB 3OZVA 5AM4A 2HFJA 1EQ2A 1U8FO 4N0PA 1E66A 4J75A 2HW8A 5ALEA 4DMRA 3GUUA 5T6BA 1IZ8A 2E21A 1K06A 2ONZA 3N0XA 5HS6A 1EUCB 5BW8A 1C0KA 3ECAA 5LLDA 2H48A 3HFSA 1YDMA 2H8KA 2OWDA 3GUHA 3PFKA 3X1DA 4DM7A 4WXPA 2K2QB 5E6RB 1CYEA 4Y1GA 3KJZA 5JSKA 1VL2A 4AMGA 1L8OA 3U3MA 4G6ZA 2P68A 4TPKA 2AFRA 3A9CA 2ZPUA 1WL8A 4MKGA 3T8VA 2FFRA 3BCHA 1C4XA 5F3DA 5FL7A 5SYAA 5THKA 4B3XA 5KNCH 6CHYA 2RBKA 2GJ9A 4P80A 4O4JB 3MYRA 4M8KA 4WGGA 1U5BB 2ODPA 4S3MA 3JTMA 3NBAA 1XN4A 2BTEA 2VJBA 3ZJUA 1HZJA 3KS9A 1Z2OX 2CXSA 3OZCA 2DYKA 3PI6A 1KYXA 4F2HA 5HRCA 5KREA 2QQEA 2IP1A 3DDSA 4JB3A 2SNIE 3NRCA 3KX2A 4IGAA 1CDDA 2NLOA 3ANTA 4KQWA 4UBIA 5SYNA 3BMNB 1SG7A 5BUQA 1ZUD1 2BUCA 2ZJ8A 3ZR4B 3S81A 3R3WA 4HQ0A 1T1RA 1XHLA 1LJ8A 3OJXA 4PWZA 3VPAA 4CQLA 3HGTA 4Z7NB 3TPCA 3TTSA 4F72A 1UFOA 1UWCA 1MEEA 1OF1A 3VPDA 1N1MA 2A88A 2HB6A 1TQDA 2V65A 3H1PA 2EZUA 4PLGA 3CLTD 4C0HA 5L51A 3K0KA 3IE1A 4UXJA 2G5TA 5FD8A 1ESEA 2D7JA 1T3SA 2BN4A 2XXJA 1ZZEA 1J5PA 3NALA 1JHQA 3MF4A 1VIDA 4MKXA 3PFNA 3UAGA 2RK6A 1VPEA 1LQUA 1B8PA 3MM4A 1QS0A 1P4RA 4I50A 4QATA 2QN8A 5DHQA 4EG6A 3LOUA 4HF7A 5F35A 1JHYA 4DG8A 2ZDQA 3D3WB 3HWWA 2B0JA 1VE6A 1G7CA 4G1FA 5IT9A 1DGQA 1PT6A 1TIPA 16PKA 1LDNA 1NXXA 3ELYA 5C1DA 1YO6A 1I80A 4L8GA 3D7MA 2WYOA 4HEA6 5LBIA 2EQBA 5KYUA 2PKCA 2IWHA 4AP6A 1NVKA 5LIRA 2BEKA 3AZOA 4NTZA 5DISB 5KQGA 3BD7A 4O4JA 1NQVA 2I3GA 5HFNA 1B6GA 4UVIA 3TJZA 3ZGLA 3OQ1A 4BNIA 3TKYA 1G5RA 1JQJC 1HY3A 2H5EA 3T3DA 2QPAA 3KWLA 4ZO4A 2GD1O 4LJ8A 3ZS8A 4BGUA 4DANA 4G85A 1L5FA 2ATCA 2EDCA 4YPOA 2YVQA 3TBFA 4G09A 1X1AA 4CETA 5FADA 3ZV3A 1R6VA 2FN9A 3TLGB 2YYSA 4PXYA 5ENDA 4AROA 4LISA 2D8MA 1LPMA 3L2OB 4LNHA 5AI0A 1MC1A 5K99A 1RQPA 3PKJA 1MPXA 3UJHA 4XAQA 1KJYA 5KTMA 3I45A 3SYTA 3U37A 1J25A 1PD1A 3HCNA 5AUNB 4JR2A 5C5CA 1M9NA 4BNZA 3B5JA 2HA6A 3UCQA 1I1OA 1PWEA 2OECA 4AUKA 4ZANA 2AH5A 4RMNA 2XUKA 1V9SA 4FGZA 2HMUA 4FC7A 4DL9A 5B6IA 1RD4A 4ZZ3A 4OHUA 5TPWA 2J30A 2ADOA 2WIFA 3DBIA 4PU0A 4ZI5A 4CT0A 3A27A 4UAVA 3SDSA 3Q9UA 3IEVA 3W79A 1G3IA 3M2TA 1M8PA 3EBGA 1YJCA 2OFPA 1KHHA 1SC3A 2R1UA 1MCZA 3OPYA 3AK4A 1GVNB 1PRYA 2D1RA 2PN1A 3IA7A 2FAXA 3DAHA 3KYIB 4P7JA 5BO5A 5PGMA 3G8AA 4LDQA 1G8KA 3R7FA 1D2HA 1ADJA 1KZYC 3BJIC 4D56A 4GX2A 2IUEA 4KRYA 3NCHA 4LK2A 2MHCA 1RI4A 3I8XA 4WKBA 5GAJA 3OZUA 5DNWA 4ZAXA 1F7UA 2EW2A 1U2SA 2IYXA 1AF4A 3L4BA 4UNSA 4IDFA 5ITWA 2ZWPA 4EHJA 3HI6A 5CT8A 2CNNA 4XWOA 3C3CA 3MGAA 1ZISA 4P3YA 4W5WA 3MMSA 4HWTA 3RC1A 5JAZA 4Q4JA 5JLAA 1LBTA 2YXDA 1VMIA 2NU7A 3FPKA 3L1JA 1MV8A 4FQ7A 5AVOA 2DUJA 4JNDA 3FBTA 4IOKA 3DTVD 5KYUB 2E5WA 5LP1A 1MW2A 4RF2A 4IVRA 3BHIA 2HU7A 5H80A 3AKYA 3QW2A 2DBZA 3R6TA 4P0PB 4B2IA 3WK5A 3IESA 2YICA 1TB4A 2I87A 1QVRA 2I4IA 2J6IA 2QL7A 2YW2A 3QPAA 4W1SA 5IH7A 1ODSA 4Z2YA 2BMFA 3JARA 3CNHA 3L1UA 4DCNA 4EENA 3V32A 5TMPA 1C4WA 5AW2A 4UXHA 5TJHA 2CB0A 1XTUA 3LVQE 2PUFA 5JEDA 3Q85A 5BSVA 2GRAA 3TQQA 1DCMA 3MTGA 4IWXA 1Z07A 4B4OA 4R1UA 3DEJA 4W5RA 4G4SP 1OYVA 4OQXA 4YWJA 2QE6A 4JBWA 2QENA 3EUAA 2ECFA 2XECA 1XTZA 4W9NA 5DHRA 4NMMA 1FB5A 3E53A 2FYTA 4AS1A 2IZZA 1HYHA 3LQ1A 4CKCA 2PL3A 2QN2A 2HPOA 4YJFA 1Y5RA 4LE2A 1EVEA 3KWMA 1RYFA 3UTCA 4E88A 4YAIA 3C1TA 4E0BA 3SM9A 1KARA 1Q12A 3GPLA 2I0FA 2ISCA 3FH0A 3COWA 4G5XA 2NTEA 1F48A 3L7BA 1MW0A 4ERNA 1DB3A 1Q84A 2WYHA 1Z4NA 4HLNA 4MA5A 5K0EA 1XMXA 3G6WA 1KXJA 3MGCA 3K9QO 4WKOA 1E0KA 2O54A 2JHPA 4X66B 2GZSA 3D8BA 1H1LA 5E6RA 4KOEC 3VYRB 2NTNA 3TIIA 3EBOA 7REQA 2B6NA 1WO8A 3DVAA 1T5TA 1EU1A 2AD1A 3HRHA 4L4YA 3EDCA 4PC3A 1R0CA 1JB1A 1YBVA 1Q0TA 2OFOA 3X2SA 2J41A 2ZSDA 3DAFA 4HH4A 4ZVVA 3VJMA 3QX3A 1RLTA 1IE3A 1JA0A 4K5LA 3KIPA 3L8FA 3PD1A 1QGOA 4HGQA 3SGLA 2QU8A 5J5VA 2XE6A 1WAMA 3OIYA 4B40A 1WE2A 3HFRA 3WJAA 1GLNA 2DR0A 3FTEA 3E4CA 3OT1B 2NXWA 2AUMA 3RU3A 3HBJA 1QVAA 2WJ4A 3KPUA 5E1DA 5KKNB 4A0GA 4CM4A 4ZJUA 5F2KA 1ZNZA 1IBCA 3DEAA 1SC6A 1XHEA 3MJSA 1OE0A 5FTKA 1ARZA 4RTLA 2AD5A 4HDQB 5BQ5A 3GNLA 3OQJA 4WDRA 3EN0A 4DNQA 2QSYA 1VCNA 1HGXA 3SXUB 4J3JA 2BLLA 3IUJA 1NIJA 1XZDA 3PHCA 3M4JA 1M76A 5JI3E 1T3LA 4ZDJA 1EIWA 1PVDA 2A14A 2H11A 1CKEA 2QRUA 3TK1A 1NKTA 2MMGA 2R8BA 3CIAA 3ENNA 5DYNA 3OEHD 2DTDA 5G41A 4ZXPA 4BBAA 1OH8A 4F3TA 1N78A 3P9YA 1I3NA 1KPGA 2CLSA 1SNYA 1P3JA 2VXYA 1SC4A 3CRZA 3FRHA 3KZNA 3LPAA 2Q5IA 1M10A 5HSGA 4UMFA 3FGPA 3IAEA 3DLBA 2IODA 4YJGA 4ESHA 1P74A 1CQJB 1IBRA 4XYLA 1GNLA 1FFEA 2B3TA 3I2YX 1SB9A 1HL3A 5LWHA 1JWAB 1P0CA 1XDDA 2Q6VA 4FIZA 4UHHA 4WNYA 3RFTA 2A33A 2XBUA 5HNHA 2CF6A 3RU7A 1U3CA 1MQ9A 1QQ7A 1V11A 2H2FA 4G8JA 4ROTA 3ROXA 3MA0A 2IYSA 2XPCA 2PVCA 1AQYA 1BEZA 2H00A 3QIVA 1ELOA 2CV2A 2ZPAA 5A4IS 3RODA 1KMQA 1FS5A 4GKAA 4HLUA 4CL0A 4B0PA 2HDOA 3SX0A 3B1JA 4G3XA 1XQ9A 5J4KA 1DO0A 4NYJR 5CXSA 4RPJA 4BLUA 4D02A 3NT5A 1ULHA 3VJRA 4ETNA 1CIPA 3P9NA 5EJIA 1RQ7A 1E18A 2GVDC 1JDZA 1ZIXA 2H63A 2HWWA 2JH8A 2XRMA 1HPLA 3EA4A 5DNEA 5F2EA 8AT1A 2OVBA 5AW6A 4B2YA 3SFZA 3DYBA 1JIUA 1PLJA 1CUEA 4NEHB 4QJIA 2F3PA 3T7CA 4B3IA 3HEAA 4FFMA 1DMSA 2DUMA 4WA7A 1Q2UA 3HZHA 4AJNA 1GVHA 2O1EA 1EGHA 1NVWQ 3ZQUA 4S05A 4YJ3B 4TSFA 1CQIB 1C2YA 2PX3A 4Y2GA 1W9HA 3PS9A 4UEOA 1E7QA 3DUFA 1I4TD 2VRNA 2VWHA 1R0ZA 4FFBB 4N03A 4XRRA 3NTRA 3B2PA 3VUEA 4MQBA 2Y1FA 4GWLA 5EMJA 1CUAA 4LDAA 4FFLA 4UVDA 5B1IA 4EG1A 3GCGA 4AMZA 1ZD4A 2VLAA 1Q0LA 3BJEA 3BOSA 4BJ5A 4G5HA 3OCZA 5A62A 4KDCA 4U9HS 2RGXA 2GA8A 1YQQA 2GNOA 4QXOA 1YB5A 4DABA 5JH7F 1RKBA 3RRMA 1XK6A 3I2GA 3ADDA 4HLDA 2BBWA 2ZRMA 1G5PA 1T2NA 3IXQA 3PNPA 4I9NA 5EP4A 5HF9A 3G8YA 2C7VA 5EJ6A 1S96A 4J4HA 2LKCA 1EH5A 4NBSA 2JA1A 2SKDA 3U80A 2F62A 1JNYA 3UWOA 2QZJA 3KLNA 2VYCA 3IUEA 4OIMA 4E13A 1BW9B 4Y6PA 4EY3A 3GA0A 3AI1A 2P5TB 3DFMA 3BFJA 2C5ZA 3IP9A 3A2MA 2YIVX 3HA7A 2W2NA 3GARA 3FCCA 1UFKA 3DZGA 4UDXX 1I2ZA 3IEUA 1PKEA 2YXEA 3UCFA 2AFHA 3RUPA 4AJOA 2I8AA 1TQHA 1REQA 3QFHA 5CTAA 3WZLA 2W2LD 4QDTA 1YQXA 1GL6A 3DGFC 2ZYUX 3FKQA 4LQ4A 2V6GA 4EZEA 2JCVA 1GJRA 3TLCA 1XLTA 4YJ2F 3H13A 5AXCA 4D1YA 1KSGA 1QP8A 1S02A 1BXGA 2YFYA 3S8EA 5HOQA 5EJ9A 3HP7A 4G1MB 4RELA 2UUOA 1JEOA 2O07A 1H65A 1S7CA 5CB6A 3K0EA 2CNLA 1KR2A 1BDBA 3H04A 2MMCA 3HR4A 3RABA 4BKQA 2PBRA 2VJ8A 5DDIP 1X1SA 4P5EA 2OO7A 2CLHB 4DCTA 4LF9B 4KLZA 5C31A 1UBOS 2V4MA 6ADHA 1H69A 5BWNA 5K0TA 1YZKA 4U39A 3JD2A 4UEWA 2ZTSA 3F7TA 3SK0A 1G6HA 4BS9A 3LC0A 5K4HA 1O0BA 5LDDC 3MERA 1VTKA 3B3JA 4IKEA 1S3FA 3QXHA 4G0MA 2XI4A 3EIFA 3SVTA 1P31A 4CN9A 4GHWA 3AF5A 2IWRA 2WJZB 1K0UA 2BH9A 4E5VA 4GBJA 3SQNA 5F33A 1PTKA 1TKAA 3BWCA 2IEIA 1OBVA 1P0IA 3G5UA 3ZJ5A 2GK4A 4UNIA 3GGGA 4A4DA 4LN1A 1IJEA 2JJ8A 1Q5PA 4ERXA 5BUCA 1Z8NA 2QTVA 1RACA 1KORA 1YQ9A 1UOQA 1U0FA 3ITKA 3T5MA 3FUDA 1WPXA 2D00A 4X44A 3R9IA 1CEQA 2DFDA 3TVTA 1DAGA 1UPUA 1OB2A 5F9FA 2XDQB 1VE5A 4R0NA 3CSSA 2J3QA 2PVPA 1P80A 1KERA 1XZHA 5J1TB 4IQ0A 4NRDA 3R9XA 2X7HA 1X74A 2NO1A 2RB4A 5AKJA 3F49S 5G1NA 2IH4A 1JH8A 2HA3A 4PYKA 3BULA 3HKCA 4MKTA 1XRPA 1OLXA 1VXRA 1SD5A 5L4NA 5F23A 1H3FA 1SZPA 1TK3A 2LNDA 4LJ7A 3BQNB 5FBLB 5CIYA 3ZIAD 1QF6A 2YIDA 1N5MA 1KBZA 2PX8A 4BO6A 5JS1A 2Q07A 3KWFA 5EWMB 1PUIA 2QZ4A 3X1XA 4U0KA 3SFTA 2CJYA 3FYUC 3GRVA 3W6NA 3GLIE 1C2TA 5DI3A 1RJ9B 4KFTA 2CHEA 5I51A 3WYEA 4D3DA 1XP8A 1N77A 2Z98A 2F3SA 1URPA 1UP6A 2O3RA 1L4KA 2V74B 4BO1A 1SCAA 3ZWCA 2VXOA 1AF7A 2BEWB 4ZVTA 2CDCA 1GZ6A 3ZKWB 4Q03A 1RKUA 4O59O 3IBYA 1ITZA 1T0HB 2XUAA 2YNMC 1OGYA 4U6QA 4MVJA 3TX6A 4JMPA 4D3SA 2QORA 3ZCVA 1GPWB 3HSYA 2XCQA 3HUUA 4RK5A 4XTCS 5HR5A 4DV6B 2QRLA 4ZRNA 4UAUA 5JE8A 2B9EA 1TRHA 4QG7A 1YS7A 4OQ4A 4X7PA 2JCXA 1XTKA 3MT7A 1QRDA 3RYIA 1Y42X 3OIUA 4HPWA 1A9XB 1XP5A 2ZSUA 3BWEA 3EWNA 5E1BA 1XJCA 3NO4A 2ZJ7A 5U4QA 1PD0A 2QAGA 5J4VA 5KCZA 4YDHB 1XBTA 2DCUA 1GDTA 1O6CA 2ONCA 4YR7A 5F76A 3SU8A 3QLVC 3CVOA 4C3OB 1X7HA 4EW2A 1H5NA 1FFSA 1VYHA 2ODQA 4CVNA 2WZDA 2PGXA 1V2HE 2ZT7A 3LT5A 2DFNA 3P9ZA 3W0LB 5EHIA 4Q7KA 1QTIA 4HK4A 1GDHA 1GPKA 4U00A 3RAJA 3MGKA 2BE7A 3KCQA 2XA1A 3WKCA 5GONB 4WLFA 3RVMA 2PWAA 1T6XA 3TVYA 1YJXA 1P3Y1 3AHJA 5D3MB 1SVWA 5A5FA 3ZCTA 4B81A 1C9YA 3ECSA 3UK0A 2DUWA 1LV7A 4URVR 3DOHA 4QAJA 1U9IC 3O0DA 1A76A 4ESEA 5HUJA 1NBAA 1WOMA 4U2BA 4JL5A 2AS0A 3ETEA 3FWPA 1AB5A 1JPVA 2PXAA 3IELA 5ERGB 1BYIA 1F1JA 3LYUA 5HIAA 5IDXA 2J4FA 1ZMTA 2YJ6A 3V7NA 1YWGO 2KQUA 3RW9A 2Q6KA 5CU7A 4F9TA 5IG2A 5DP2A 1EDEA 4IFIA 4IJ5A 2I33A 2IXFA 3AMVA 2GARA 3FZEA 2XAUA 4AY5A 1CUIA 3MT0A 3GLGE 1E3LA 3EY9A 2IPNA 4IWNA 1JDJA 1F2UA 3FTWA 3BB3A 3QBDA 5IJ0B 1QRSA 3Q0IA 3LQKA 4XN2A 4BMCA 1L5MA 1V8ZA 3PTAA 3VNVA 4AY2A 2Z6VA 3ZHXA 2VSXA 2XOKD 1WS6A 2ZRHA 3UENA 4Y2TA 1V1MB 1XD9A 1XJQA 4WBNF 5G1OA 2ZB4A 4RK7A 4UFNA 2O4UX 4I3FA 1ZMBA 1U2ZA 3DCIA 2EX1A 2QKYA 5COBA 4QHSA 3H9CA 3QITA 2Y27A 3RV3A 3KUDA 1THGA 5DX0A 4RIHA 5KJCA 1QOQB 4F6RB 3RBZA 1UQUA 1EAMA 3KVOA 1PUXA 2R5WA 4ZI7A 5CA1F 3GEMA 2IX3A 4R69A 2WWIA 4YPVA 2EL7A 2X4LA 3QE0A 3UWDA 4FSHA 4IH4A 2AYXA 4IYJA 4QPEA 2WFZA 1PL0A 4QBIA 2ZTLA 3ILSA 3NC1C 1NZJA 4KXYA 1G55A 3L6UA 4D43A 3C6XA 3H5OA 4LFCB 3ELWA 3GFQA 2OZPA 3I39X 4H3SA 3FFXA 3TUZC 1LD3A 4HQNA 1UMCB 1T36A 3DWGA 5JNVA 3T1NA 2WJAA 1DRUA 2Z09A 1N5JA 4CLOA 1VMAA 2I54A 3LLCA 2H51A 2N9UA 3P2MA 3ED5A 2BR3A 3KHSA 2A5FA 3GT7A 2ZOSA 2P8SA 5CVJA 2G9QA 3X1JA 5DBIA 4BGEA 4C4AA 4H7FA 3A06A 3L05A 2WEKA 3OM1A 3GLFB 5B30A 3Q7IA 4J0HA 1MUUA 2R9VA 2RHJA 1Z34A 2QLTA 2QRGA 1AQJA 1ZI6A 2XHEA 1E5TA 1E94E 1A95A 2ZSKA 2PCLA 5BQ3A 2F48A 4YLEA 3X1MA 3ZWKA 5I7OA 4KJXA 2NSJA 5AVSA 2NZUG 3G2JA 4ZCTA 3UANA 2F8TA 3KPWA 5BSTA 1BEUB 2EC5A 4B09A 4D3FA 1OV4A 2DP4E 5BYAA 1RPNA 3Q8MA 2CHVA 4TKLA 3NJ8A 5EAIA 2PZGA 2XTMA 3OF5A 3O31A 4ZRDA 2DFVA 4MW0A 5J9FA 4YQFA 3RF7A 2YH2A 5A7GA 5I9NA 4L95C 5GV7A 3MUNA 1MLDA 1OGJA 2B5VA 4MVJM 1NV8A 2Y4NA 4LYEA 5CDGA 5LFAA 1JSCA 4O5AA 2Y1WA 3N28A 5IJ9A 5TF0A 1R4NA 4D92A 3SNKA 1XLVA 5L3SA 4KZKA 2NXCA 3LAWA 5EE9A 3PGMA 3ZNOA 2MTBA 4LKOA 3D7NA 3AYZB 1EFAA 4HFRA 1YZUA 3JQAA 3R3VA 2JKYA 4QJ5A 1MRSA 4IDOA 2IH2A 4LSMA 4EBFA 2O8EB 2ORED 2WV9A 2EFDB 5E7QA 2OGSA 5L3QB 2C77A 3QLVA 2ZWIA 3GY0A 3WAGA 3TOCA 1JFTA 3QJ5A 4G8BA 1UC8A 1RBMA 1LWOA 2J0UA 3A0RB 5JFOA 2VJQA 4CM6A 2JANA 4AG6A 4M1SA 1P91A 1PR6A 5L6LB 4KR9A 1YQDA 3JQAB 3V33A 3WADA 1DOZA 4CQMA 2UZ0A 1XXHE 1ECJA 1RRFA 1UC9A 4GE3A 4TM8A 1O08A 3K0AB 4F7DA 5JV5A 2GBPA 3FJOA 3FNEA 2NZJA 3M4YA 4L08A 3W77A 3QHQA 3MJTA 5IWCA 3HHPA 3GJ0A 3RYCA 2FFHA 1QPBA 1Y4AE 1V6SA 4QUJA 3LHIA 1ABFA 3UEQA 1GSHA 1OC4A 3Q5GA 3LGAA 4JLDA 4D96A 3SZUA 4A5OA 4FUTA 4E4TA 4PO3X 1OD6A 2FKAA 2J3HA 4B9AA 2XPYA 3AVQA 1W52X 1BHJA 4BGIA 4NIMA 4AC9A 2HRRA 3LYHA 4YV0A 3EQ9A 3KLBA 2BW0A 3NTLA 3KTAB 3MS2A 3PF9A 3TNJA 1UXOA 4ITUA 5J43A 1TUGA 2FW0A 2IT1A 5LD2B 4QUKA 3COVA 3Q7EA 3R8XA 4W99A 3WGJA 2VZEA 3ZK8A 4PLPA 2BI7A 4HJRA 2Z2KA 2ZSFA 2Y1DA 1O4WA 2R1VA 3DGEC 4LXUA 1A9OA 3NOVA 5CCEA 3K8YA 1MQSA 3NAZA 2RGRA 4BNTA 4BE9A 3CEHA 1G42A 1GWNA 4OGGA 3NDJA 4GRAA 2HQBA 4IHJA 3KR2A 5F5XA 3GXOA 3TINA 1O6BA 1SOMA 4RESA 1BX3A 1VBMA 2O0MA 2VSFA 4OH7A 4RULA 1APBA 4FQ5A 4MOWA 4IQ8A 3I9LA 3R76A 4EBBA 4P82A 1WCV1 1S1CA 1D03A 3FMVA 4BV8A 3CKMA 5JS2A 2QHXA 2V7XA 1J0EA 3GFBA 3GP3A 1UK7A 3LI2A 1XD2A 1M2JA 2GBLC 3H1AA 1XTBA 5JYBA 2COUA 1VZ2A 3LKZA 2B7LA 2VTDA 3I30X 3YASA 5KVCA 3ETCA 4BP8A 1G5QA 2AF4C 3BS4A 1XGKA 4K9QA 1E1LA 3KNZA 4LHSA 4MKFA 3SC3A 1WNFA 1JJVA 2HO4A 4B7AA 4DSUA 3C3EA 3ITDA 5G0VA 1G98A 3DMFA 4R3UC 4EYKA 2TMGA 4LK3A 4TN1A 5ALGA 3MTBA 2Q0HA 1XAIA 2FB9A 2X9LA 2AN4A 3IAM1 4FE3A 4K87A 4L6CA 4W6QA 4C5CA 4C87A 3IP1A 4A2WA 3NFRA 1N2CE 1Z73A 2BDTA 2P27A 3TYXA 2V3CC 1J2UA 3AR2A 5JNSA 4C43A 1B42A 1T1IA 2NO7A 2WFAA 5DM1A 1DARA 2FUG1 4TWJA 1ATZA 1ZD5A 3K6SB 3C7AA 2A0YA 1UJ6A 3KVNA 4GT1A 3KSMA 1MAUA 3L1HA 3PC7A 1UFQA 3QNWA 4LJ5A 4UE6A 4PHTA 5BN3A 5BSGA 4F1WA 3GZ4A 2D54A 2FPOA 4H18A 4JEHA 4W1PA 4KXFB 3LO8A 1DRVA 1L7EA 1F06A 2FMHA 5IARA 4YAGA 3T3IA 4U7TB 4MIYA 4IIHA 3S2GA 1AUXA 3CX7A 4PLYA 2AVNA 3UC5A 2CE7A 3HJCA 2C42A 3AFHA 4MJXA 2VP4A 5KYXA 2UXBB 5IJ0A 3BG5A 3O26A 4D98A 4HNGA 3QGMA 1N5RA 1V1RA 1FLDA 2C4KA 5ESXA 1VKJA 3UK7A 3DB2A 1ULZA 3IV9A 1PFGA 3CNEA 1AN9A 3VPGA 4LGYA 2GVNA 4OYRA 4MWSA 1NU6A 5HKAA 3GZNA 3WLFA 1CUGA 6GPBA 4JROA 1PQWA 5EIFA 4EX7A 3ST7A 1U9YA 1EK5A 3ONDA 2N1MA 4UU0A 1C0PA 3KJFA 1XVAA 2AJBA 3OICA 4FOTA 4XKJA 3ZW8A 5B6PA 5IK2D 3CLRD 3DNFA 1SY7A 3F1KA 4ALKA 1LS6A 5BQOA 1SIWA 4H6VA 4MP8A 4HDMB 5GONA 1D8AA 5LD2C 3EXEA 1ICIA 4L2LA 4K6GA 2HCRA 2FE4A 2J32A 2JFOA 3EFOA 3QVXA 1II0A 4CM8A 5JAHA 1AQLA 2FHPA 3WYAA 5ALHA 4DOMA 5LMZA 4AQ7A 4Q0MA 3BORA 4EY8A 4E07A 2UZ1A 3D2LA 4XRGA 2X1HA 1X3ZA 1KAQA 2CZQA 2QN6A 3W1EA 4YV1A 1H3EA 2GPAA 1QIHA 3OQIB 1XD8A 3WKBA 3TXYA 2UV8A 1ID1A 4MS4B 4QEZA 4RQBA 4F4UA 1KOJA 1MJ5A 1ODJA 2BHLA 4CL2A 1UC4B 1Z4KA 2HLPA 2VHJA 5T67A 4L7QA 4B71A 3K1ZA 3C5EA 4N5MA 1E7YA 1KIMA 1Q7BA 1XF1A 3M9XA 4CCYA 2E89A 4JU8A 3I5YA 3BAFA 2HPAA 1LSUA 3NB0A 5ADWA 4NAHA 5JADA 5LLSA 4FFDA 1C0LA 2XYHA 3CPJB 2ONKA 3HHEA 3PDCA 4PWYA 3RJMA 1V7PC 3L02A 1DOAA 3T1VA 1PF7E 1W93A 3O8BA 1G4UR 4GAAA 1ZMOA 4G0OA 4BIMA 3X44A 2A0UA 2F43A 2ZVDA 4NECA 4Q6BA 5HKLA 1X7YB 3AUXA 4YV7A 5IPFA 1JEEA 4GGOA 1NMEA 3RARA 2HRDA 3N2ZB 1SKMA 2WJIA 2PFKA 3W2IA 3JRNA 4LWPA 4ZX5A 4X60A 1G8FA 4XIYA 3RS2A 1CVRA 1OAOC 1OVMA 2V5VA 2WKRA 3F6PA 1E20A 1CQPA 2B2NA 2R86A 3R6DA 4JENA 1BXKA 4WNAB 2VH1A 5AW1A 1T2UA 3T34A 2QP3A 2ZI7A 2X0IA 1T4GA 3M7IA 3O73A 3SPXA 3J7AC 5HBRA 2E5FA 2R1TB 2JH9A 5CGZA 4RADA 4PYJA 2BFAA 1LZLA 1XRQA 2GO7A 3E35A 5J1SB 1ST2A 1L5GB 3F8SA 4QBGB 1AKRA 3L6CA 2P62A 1MX9A 4HG2A 2XEXA 3ZWYA 4WBNB 1BXRB 4KLCA 1ZGAA 4TV9B 1WXXA 4JBYA 4KBGA 4GXRA 3V4ZA 3F9RA 3VPCA 2FN8A 3GRPA 2WG2A 1AGXA 1IPFA 1U2DA 2DBQA 2VWPA 1E1DA 3CZQA 2PRKA 2J9FB 3TTWA 5AQ1A 4CIWA 4N7JA 3UTDA 2XDQA 3IB3A 4KK3A 2XCOA 4XE5A 4CTOA 2XCLA 2QX8A 5A4FS 1LPSA 3PUHA 5K8VA 2KE5A 4RKFA 4Y7DA 2HLNA 1I0IA 1HR0B 4ZO9A 1KY3A 1L8XA 1PP4A 4KNVA 1Z0UA 4GGMX 2XMQA 3CBGA 3HN7A 4PBRA 1E2JA 2WJ6A 4KIUA 5HQ3B 4RORA 4S1OA 3V8QA 2ZCJA 5JZ9A 4M1TA 2JAQA 1GGVA 1L5VA 2WF7A 4YA6A 5EEGA 3TWOA 3ZQKA 3NRBA 4B3TB 1NRWA 4UHEA 2AWNA 3P27A 1Q0ZA 4UDNA 1VPWA 4IIJB 1MF7A 1RWQA 3JQGB 1AKUA 3AHCA 1GAWA 3KJXA 2YXBA 1PLLA 2I3AA 2O9JA 3H19A 4LI3X 4ZN6A 4AF7A 3MPUA 2ZE7A 2NV6A 3I62A 4AMBA 3HO6A 4ESOA 4J49A 3W8RA 1DXHA 4RIGA 1A8PA 1C81A 1HE5A 1ZN2A 4XJTA 2XOXA 4B2LA 3BXGA 4KR0A 3QWFA 4YDQA 5JQGA 3GFOA 1SB8A 1WA5A 2XDYA 3ISVA 1AKYA 5AKXA 1CR6A 4XO3A 1NOIA 2OCKA 3DVLA 4BQRA 3UT5A 2P7HA 3PDIB 4R2WA 4NU8X 5U1PA 1GGEA 2XOKA 4F06A 5IXYA 2F1OA 2V9CA 3PDJA 5DLEA 1B14A 1Z88A 5L7WA 3H2GA 4QARA 4AXXA 1G17A 1VXOA 4KPUB 3N0WA 4FGJA 3HU3A 1CXZA 3II6X 5E9WA 2B8WA 2H2GA 5EWLB 4YRZA 1XNRB 1K5GA 2IA5A 1R15A 3SSAA 5MGBA 4EO9A 3SD7A 3A1VA 4UQOA 3L6DA 3R20A 3GLUA 1VMKA 1T10A 4PRZA 1HE1C 1NMZA 3WY9A 4IHAA 3MELA 3SQXA 3AUKA 5IKOA 1JILA 2QI9C 1SCQA 2D3TA 4FHEA 2Q5LA 1NBMD 3OLVA 2IP4A 4HGZA 3THOA 1VKHA 4L8WB 1XRRA 3K0FA 4PSVA 4M8NE 4RVFA 1ZJ6A 4LHZA 2VHUA 4JT9A 3TB4A 2IE0A 5CB0A 1R6UA 4B3DA 2CLLB 4YMHA 3FDFA 2IZ1A 1A9PA 1GSOA 3CZKA 4GMGA 3UWSA 3GEHA 1OOEA 4ZI2A 1PS9A 4NZMA 3CX4A 1HT0A 2X13A 3PQ7A 1KI8A 3LGXA 2VPWA 1G3MA 1SCDA 2UYOA 4Q3KA 4RQUA 2YN0A 1M2GA 2GM5A 4O4JF 1Y9EA 4C7OB 3HYTA 1I5OA 3PEYA 4MRVA 5I7WA 1N1GA 1UADA 5KINB 2OAGA 4F8YA 4D0NA 1WBBA 2RKWA 5CPBA 4ZOLF 3ND6A 3VR3A 2FR8C 2Q4BA 2A9PA 1BROA 1R0RE 1XSEA 2PUTA 5ILQA 5AI5A 4KREA 1C1YA 1Q0HA 2FGJA 2ZEJA 5M2QA 1CJTC 1O54A 1GZHB 3A37A 2Q99A 3I9KA 3BVPA 3FJYA 3QK7A 4LNUB 2WHYA 1P4AA 4IH9A 4XDGA 4PC6A 1U4OA 2POCA 3G2NA 3VKVA 3MQ4A 3ZNPA 1WXWA 2N47A 2PKYX 2XYPA 1M6NA 3FLBA 5CVUA 2GVZC 1R4NB 4C22A 1D2CA 2HMTA 4D0GA 3AF1A 2E6KA 1GR1A 2HCJB 1DT3A 3I6YA 3UV6A 2FF5A 4XVHA 3S70A 3IJ5A 1JAHA 3LD9A 3D6NB 1JG2A 1ZD3A 3N0TA 1WG8A 2BFFA 3C8UA 4TMYA 3QSGA 4RCYA 4URFA 3QOYA 1T1EA 4PNZA 1IWOA 1IG0A 1CFJA 3PFCA 5E7JA 5T5QA 4YMUA 4DR1B 1EX7A 4M0EA 3CG0A 3COJA 1YVPA 1NDUA 3ZHZA 5H81A 1K75A 4R5HA 4HV4A 5FA8A 1ENZA 4NF2A 2I1WA 4XFJA 1GPDG 2ID4A 2R47A 1A88A 1UXKA 2EW8A 4IVPA 3RRZA 2NADA 4H7IA 2PAFA 3W6UA 4BX0A 2WJHA 4UARA 1DEXA 3DXZA 2C96A 3THSA 4HGOA 1DQPA 1S1MA 5LQRA 2JLAA 3H16A 1E2EA 4KMSA 4YRJA 3UUEA 2OT3B 3OEHA 4MR7A 2C54A 3F3KA 2LTAA 3C39A 5DGDA 2F4VB 3KOWA 1MVNA 1SUSA 4LQDA 4BVJA 3CTPA 5L45A 2CLFB 3F73A 2NNWB 1W0JA 3AONB 4F5EA 1QIKA 1VIYA 2FMIA 4YQEA 3IEPA 4NZZA 4FQ8A 4WXEA 5I7UA 3OJLA 2H9YA 5TF4A 1ZQ9A 4XGNA 4BXOA 3IEXA 3NV7A 1R0KA 1LPPA 3EY4A 4RFLA 3LRPA 5EGSA 3UHOA 5KQPA 4LZNA 4O4LB 1P2VA 3CINA 2MR6A 5ES3A 2EP7A 1KPIA 4NYMQ 2LRHA 1E64A 5C51B 3EEIA 4E12A 2ZQZA 1WDWB 4YGXB 4GL4A 2IYEA 3ACCA 2W2PA 1QIGA 1NSTA 4X6YA 3SBOA 2JK1A 1VKOA 5G0SA 3A6JA 3OAAA 4RANA 2XDAA 1DVRA 1HFJA 2BOVA 4PVDA 2XGOA 2FPLA 1D2AA 1VIAA 2VP2A 2ZRGA 3MNFA 2GRJA 2XB4A 3NIGB 4HDRA 4N3GA 1JG7A 2NN3C 1VGQA 3FDJA 4M9QA 3NHRA 4ZEXA 3IAHA 2HI0A 1UOPA 4XIGS 2JGIA 4M1EA 1PS8A 1YZLA 2J4DA 4H1UA 4RPLA 2IYFA 4LE0A 1AURA 1AK9A 1L4BA 1OFHA 2FKNA 5HHTA 1KYWA 1BKDR 2WZGA 1Y3FE 3UFXA 1GAXA 2C2GA 1P7VA 1CTQA 4XWTA 2C9YA 2Y1LA 5CUQA 2MINB 1GYRA 2G08A 3RVDA 4D9FA 1HE8B 4YV2A 1P19A 1SJ9A 1YU6A 3KQVA 2V4UA 2R1TA 1WB5A 5TV2A 3ZY2A 7REQB 3I0MA 3VBCA 4YONB 1E3QA 5BMVB 4TZ0A 4MS6A 2AQIA 3PC4A 4NMHA 1TYCA 2Q1UA 3C6BA 4F84A 1NKVA 5AQEA 1BGXT 1H2AS 2XIQA 3PFBA 4HX2A 5COQA 1O97C 1JQBA 1TMKA 3M6MD 3Q7RA 4KUHA 4RAOA 4UBOA 2GF9A 5JNTA 1L1EA 1N2SA 3C7DB 1I2MA 4H3HB 1IZZA 3R7AA 1GQ2A 1X7YA 1EUZA 1YB4A 2XLBA 2NP7A 4IQGA 4ZEOA 1EXVA 4INAA 1SKBA 2QG6A 2PTGA 3V2IA 2IW3A 4DLKA 4TWIA 1W1IA 4X65B 1B73A 1WUKS 3FMIA 4INZA 4KU4A 5DTRA 1U0GA 3ASYA 1USUA 4L4RA 4C08A 1NYRA 2HRCA 4R8SA 5EJMA 5IP5A 3RUAA 1Q1NA 4CCYB 1DPFA 3PDHA 1JHZA 1N25A 3ZW9A 1I3CA 4JXZA 2XA2A 4OATA 1FZQA 3SHQA 5I7RA 5EQFA 3DE2X 1NT2A 2RGNA 2V7PA 2H59A 3B52X 5AK5A 7MDHA 4OP1A 3COZA 1C7JA 1FMTA 1YB1A 2P6PA 4BVEA 3FUVA 3PXXA 1XTIA 3I73A 2AYYA 5CPFA 1BCSB 4P32A 3UG7A 2RC6A 1EE1A 2XWPA 4Y98A 1RM0A 1CERA 1DKNA 2WJPA 4HH1A 4TROA 1G9XA 4TL9A 4TTRA 5EJAA 1D2MA 4LC9A 1ID8A 3ELBA 1QLWA 1HE4A 1T3TA 2VTEA 3IAS1 1UPBA 1EB8A 4H7JA 3MUFA 1YFLA 1T13A 1IZ7A 1DL5A 1YBAA 1O96A 4KJZA 1NV9A 2EATA 2MT9A 2VQSA 4PF1A 3RFXA 2IYVA 5AVKA 3UOAB 4Z2AA 5C8YB 4KLAA 3O0TA 5FB3A 3VR6D 4CDNA 4HRYA 1V5WA 2MSLA 5FOWA 3WIEA 1AHPA 4KXMA 4KX3A 3EZNA 3JR3A 4M22A 3TNLA 3OOSA 2R8ZA 4EPWA 1R8XA 5CYGA 4TRJA 4EATA 1GXSA 1QVVA 3TGPA 1NBEA 3EHDA 1DG3A 4JUDX 4NOJA 3G9ZA 1X8JA 4MV5A 3LPMA 3IMGA 4O2LA 1H4TA 3B3BA 2GCGA 4BU0A 1HOXA 1M1UA 3O94A 4K7JA 4WZBE 2GA9A 1X7ZA 1O97D 3LH5A 5B3KA 2F7SA 2W2TA 3E3AA 1R9JA 4RMHA 5E1MA 3WGQA 5EWMA 4WKCA 3C3BA 1N8KA 1Y4ZA 3IQFA 1H94A 3K9HA 3DBRA 3UWMA 3HKCB 4LZPA 5DXJA 5JI2E 2VHEA 1IQPA 2W2KA 5DTMA 1XV5A 1OROA 3CVUA 2QVLA 3L43A 3DT6A 3OCWA 1VL8A 4ZGGA 4ZOQI 2XTJA 5AKHA 1UMBA 1P0QA 3WL4A 3AI3A 2DQKA 5JAMA 1WY7A 2FQQA 2MSKA 1WCWA 3O03A 3ESDA 2G7MC 1HDEA 4C7BA 4EHFA 5JW6A 3ILYA