4ZQHA

Crystal structure of dox-p reductoisomerase in complex with nadph, fosmidomycin and magnesium
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
408
structure length
408
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
molecule tags Oxidoreductase
total genus 149
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqhA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqhA01
5FI5A 2UVDA 2O3QA 2HK9A 2WEKA 4L4RA 4DBZA 1QG6A 4NK5A 3ANMA 2Q1SA 4DLLA 1SPXA 2DTDA 2C5AA 3PLRA 1QSGA 2VZ8A 4TVOA 4UUMA 3GLQA 2Y0EA 1G1AA 2FY8A 1GEEA 1A5ZA 3QVOA 4WCFB 2VUTA 1R0KA 3E9MA 4DLBA 1E3EA 2VT2A 4YJFB 4BNFA 2DT5A 2JJYA 4NR0A 1LLQA 4RJTA 3WIDA 1DOHA 1Q2XA 1N7HA 3QW2A 1X15A 1PS9A 2ZATA 1YE3A 4E5NA 2I6TA 5LCXA 3R6DA 4II3A 4UVHA 4D3SA 1DJQA 3CKYA 2C07A 3D64A 1O5IA 3B6ZA 1MP0A 3FTPA 3DZFA 4ALLA 4JJFA 5L3ZA 3S2GA 3ASUA 5DT9A 4A73A 1U5CA 2Q2QA 2HDHA 2HSDA 4FJ0A 3KV3O 4S3MA 3WICA 4NMHA 1DO8A 1RM3A 4Z3KA 2FMUA 2UUOA 4RF4A 4JN6B 4MPDA 4CMCA 2FWMX 1CQJA 4YQYA 5G0VA 4FFRA 3RBZA 1K89A 4CM8B 4QEDA 1GR0A 1SZJG 1E5QA 5L7TA 1TT7A 5KIAA 3CH6A 3GRPA 3CXRA 1E3WA 1MC5A 1NQTA 3ZU5A 2Y67A 4NG5A 3JQEA 1CJCA 3B1KA 3ETEA 4HX5A 4IPTA 3C1OA 2GCGA 3V2GA 4OMUA 3TFQA 2DBQA 4F6LA 1ADFA 1QYXA 3L4BA 3RUFA 2Q49A 5JO9A 3ZNNA 1UZNA 1Q1NA 3E9NA 4OHUA 5HTOA 4XR9A 2GZ3A 2QYTA 3QVWA 4Q3BA 2OP1A 4D43A 4E12A 2PFGA 1XDWA 2AA3A 4FFMA 3GRKA 3O8QA 5L95A 1GZ4A 3S2IA 5ICMA 2G82A 5BNTA 1X0XA 1K3TA 3F6YA 1ISMA 4AICA 3LQFA 4IDAA 4CLXA 4J7XA 4FR5A 4R1UA 2CVZA 2PR2A 4XIJA 1BXGA 5TJHA 3CZMA 4EZBA 1VC2A 1A71A 3WGIA 2NADA 3OQBA 2GN8A 3WJAA 2I67A 2Y99A 4AJEA 4BO5A 4IINA 5HM8A 2CMDA 4IGFA 1G6KA 4NBVA 4U6SA 1MX3A 3WSVA 3NJ8A 3ZWXA 1ENYA 1QYCA 1YL6A 2Y1CA 4Q3NA 3WBFA 2RAFA 2OBNA 3GVIA 1M2WA 3WFJA 1GYRA 3BHMA 1DJNA 4DC1A 1PZEA 3WTBA 3ROKA 2NTVA 4CQMB 3MTGA 3SLKA 3WS7A 3AU8A 1O8CA 1SCUA 4D42A 4CM6A 2X23A 3OIFA 1R66A 1K2WA 3QVXA 4KUHA 1B3RA 4IDBA 1HSOA 1O6ZA 2I99A 4I08A 4IUYA 1IZ9A 2O3TA 3KO8A 1QORA 3GH3A 1XHLA 3TRIA 4GX0A 3AY7A 3UVEA 3W1VA 1PGNA 5B1YA 1EEHA 2IDZA 3F5SA 1E7YA 4NJMA 3W6ZA 5TIIA 5T8KC 1A7AA 1RM5A 4RZHA 4YXFA 1CF2O 4O59O 3LZ6A 3JD1A 2ZIZA 3QHAA 2VNSA 1U8FO 1HDZA 4J4TA 3UF0A 4ZQEA 4GLOA 1ZK4A 5JCJD 3A14A 3LVFO 5CG1A 2MAPA 4XB2A 1CWUA 1PJ2A 1A72A 3RKRA 1FDVA 3TZHA 3W4KA 4I1IA 3AY6A 4CUKA 2V6MA 5A05A 3SEFA 1GFSA 4PLYA 5K6AA 3U5TA 1BW9B 3DWFA 3KYCB 4UVEA 3H4VA 1ZSVA 4EUHA 4L0QA 1JVSA 5I7EA 5IXSA 2YFQA 4B4VA 1YB1A 2A4KA 2E4AA 4YDRA 2RHCA 3VH3A 4E3ZA 4IZHA 4F46A 4GVLA 5B12A 3GDGA 2D5CA 3AI1A 2J6IA 4PRKA 2Q4EA 4YT2A 4MVJD 1SEPA 4PG4A 1CETA 3WB9A 3ETGA 4S1VA 1E7QA 2PLAA 1DFGA 3ZW8A 4BNYA 1F0YA 5A02A 2YJZA 1VL6A 3WMXA 1UAYA 3WNQA 2RIRA 4H3VA 4R01A 3TWOA 1DB3A 4ALIA 3D5TA 3I23A 3DXFA 3CIFA 1O9BA 3LDHA 2C5EA 1LBEA 2G5CA 3KVOA 1JVBA 1NTOA 1EZ4A 4PG5A 4PRLA 5DP2A 3WGZA 1E1NA 3D7LA 4Z0TA 3AFMA 3WBBA 3WXBA 3G3EA 4DQXA 2RH4A 4QFDA 3CZLA 1H3LA 4W9NA 3ZNPA 2GYYA 1ZEMA 3PEFA 1UP7A 2J3HA 1ZJZA 1F8FA 3K9QO 1GZ6A 2O2YA 3COSA 4E2XA 3WQRA 3UAGA 2VN8A 1IB6A 4LISA 4I8XA 2DVMA 1O0SA 4INAA 3EGOA 5C5IA 1HWYA 2E6UX 3RROA 3HFGA 1B8VA 4WOKA 3FPCA 3ADOA 1I01A 2C59A 3PFFA 4XDZA 4CM3A 2YY7A 1I24A 4IDGA 2X0JA 1IE3A 1YB4A 3HFSA 5L40A 4QQRA 1ZH8A 1AE1A 3QRWA 3DTYA 2Q2VA 4NBRA 4OQZA 3RC2A 4JJGA 1EDZA 3ZWCA 2X9NA 3OJLA 4WK6A 4YT5A 5TNXA 4AJ1A 3ZWBA 4B3IA 5HS4A 5IZCA 2C20A 3AI3A 3E5RA 4NHEA 1U4OA 1QMGA 4CLOB 5HS6A 3R3JA 4GX2A 1E7MA 4IY1A 3VKVA 3GF4A 3L9XA 3SBOA 2Y93A 2EHDA 4XR4A 2H9IA 4TSKA 4YT8A 1MV8A 4TRRA 2GLXA 4J0EA 5EESA 1GCOA 3ZWOA 4J7CA 4A27A 3AOGA 1PGJA 2BI7A 4CL8A 2VUUA 3ZHBA 2X4GA 3EVNA 4QO8A 1T2EA 2LDXA 4I5FA 1E77A 2QYSA 3U49A 3RC9A 1JW9B 1ONOA 1IULA 1JQBA 1H2HA 3N7UA 1KEVA 1Z82A 4B3HA 1SEVA 3WYCA 4ZICA 3OMLA 3RC1A 3PVZA 1N92A 4FJ1A 1PR3A 1X1EA 1IZ0A 4D45A 4CQLA 1IYZA 4OAQA 4CM5A 3E8XA 3BZUA 1SAYA 4BKQA 2HRBA 1HF3A 2BELA 2NU7A 1MG0A 3ADPA 2CUKA 5TGDA 2CDAA 5A9SB 1DIBA 3RJ9A 2P9EA 4MIOA 3VVBA 3P19A 1A7KA 5ES3A 1YB5A 1P0FA 3VTFA 1ORRA 3VZQA 4DA9A 4W82A 3QJ5A 3FN4A 5TT0A 5CPBA 1DLJA 3EUWA 1GZ3A 3GDFA 3DBLB 1N2SA 4AJ2A 3GR6A 4AJJA 1GD1O 1MW1A 1YBVA 3KSUA 4DPKA 3K30A 1E1LA 1OC2A 3K2BA 5IDYA 3RKUA 4YAJA 3TZ6A 1P31A 3IKVA 1PJLA 2FR0A 3JYQA 4CV2A 2JCVA 1SOWA 4OL9A 4NFSA 1VE9A 3WGOA 2FR1A 1O94A 5G0TA 2HMWA 1BDMA 5JDCA 3I9OA 5DCUA 2XXJA 3H9UA 4HWKA 3HUDA 4RLHA 2TMGA 1XU7A 4E13A 6LDHA 1PL7A 2EWMA 3VTZA 2P4HX 3OSUA 2F1KA 3PPIA 3OA0A 1CERA 4URFA 5G2OA 1XU9A 3RU9A 2VCYA 1JU9A 2J5QA 3SJ7A 3L6EA 4GKVA 3OF2A 4L73A 2O2SA 3DHNA 3GMDA 1EBFA 1G0OA 3FR8A 4BB6A 1M66A 3M2TA 1RWBA 4I5DA 4XGKA 5EL0A 2GO1A 5DOZA 3WQQA 3I1JA 4RV9A 1WMAA 3R3SA 2BF7A 4UUNA 1ENPA 4IDDA 3AUUA 3CEAA 1YOVB 1RKXA 3ZNOA 4GX1A 1XLTA 4H15A 1OOEA 4R5MA 4YA6A 3LF2A 2NTJA 1B7GO 4AL4A 1UDCA 4BNXA 1C1XA 3AUAA 4BMVA 3F9IA 3FNHA 3OBBA 1UP6A 1PZGA 3V8BA 3D5QA 4FOSA 2HAEA 4J91A 5KNLA 3VH1A 1Y5RA 4ZQHA 4DC0A 1O95A 5C7OO 1BVUA 4GI2A 4OH1A 2JAHA 3H5AA 4BNNA 4PLWA 1PJTA 2F00A 5IDWA 2QRKA 3WGHA 5AQ1A 2X8LA 3ENKA 1JWAB 4IIUA 4Y6PA 3JQGB 2UV8A 3KTDA 1QP8A 2I3GA 5ICSA 3FD8A 1P1RA 1NYTA 2X58A 3O26A 4IM7A 3F4BA 2TMDA 4M1QA 1RYEA 4YYZA 4PCVA 2H63A 2D0IA 5IG2A 3RC7A 4PLCA 4E5MA 1HETA 2NNLD 4YRBA 3NDRA 1PL6A 3TFOA 4BO7A 1JKJA 3BA1A 1NM5A 1B26A 3CE6A 1K6IA 1ARZA 4CV1A 1PQUA 1C0KA 2VWQA 3DZKA 4BGVA 4RVGA 4KOAA 7ADHA 4NFHA 4OGWA 1D1TA 1E6UA 1U4SA 4HKTA 5G0WA 3F47A 3ZV5A 8LDHA 2UUPA 4M55A 5KVQA 4K26A 1DHRA 3GG9A 1TVEA 2VHVA 1ZMTA 4FLSA 4OKIA 4WCFA 4YAEA 1QXSA 4LRTB 5U1PA 4YJFA 4UVDA 4ZQBA 2BFAA 2VOEA 3D0OA 4PN3A 3U4IA 2NSDA 2WD7B 4FQ8A 3DZJA 3B70A 4AYSA 2X0RA 5L45A 1Z6ZA 1SC6A 2IRWA 4PLZA 5JNLA 4WLFA 3MJEA 3JQAB 5JS6A 1DXYA 3NT4A 5BSGA 2Y1FA 4IDFA 3K92A 4J9UE 1ZW1A 2ZTMA 1NPDA 3E1KA 3BTVA 4JNKA 2IXAA 1ZJYA 3M1LA 1OZAA 3DEYX 2C82A 3PFWO 4P4GA 3UCEA 4YPOA 4U7WA 1PZFA 4A0SA 1GUZA 3PTZA 1Q0QA 2B4RO 1LDEA 5ER6A 4JBIA 3JD2A 3W4IA 3T0YA 2WYWA 4PLTA 4JGBA 3OETA 5A06A 2EV9A 4EUFA 4FBGA 4CQLB 3Q2IA 1NVGA 1PS0A 2GR9A 3WGTA 1FK8A 4CM8A 5FI3A 3BMQB 4AJLA 5I7FA 1ISGA 3JD4A 2I3AA 3PIIA 5AYVA 4CXFA 2AW5A 2CF6A 2EJWA 3GGPA 3OA2A 4E4YA 2NUAA 1E7SA 4DTIA 3MEQA 2QW8A 4NBUA 2BGMA 2YDYA 3UUWA 2BGKA 4E6PA 1HRDA 3BHJA 3W4JA 3JQ7B 1A4IA 1PTJA 4YB8A 4B4UA 3I9MA 3NAQA 3PQDA 2HQ1A 2GN4A 3RUDA 4ID9A 1PQPA 4B8WA 4EUEA 2DUUA 1FDTA 5THQA 3D3EA 1Z74A 3PK0A 4RGBA 1M75A 1M76A 3L9WA 4WLEA 4TMFA 1ISJA 2FN7A 2HUNA 1VJ1A 3P5SA 3D4NA 3NTQA 4ITUA 3G0OA 5CFZA 4NZ9A 4IXWA 5IDQA 3P7MA 3ZWNA 4AJIA 1XQ1A 5JSFA 2J3KA 3LLSA 3S55A 1X7DA 3UH1A 1XA0A 4HNGA 4Z6KA 1MXFA 2ZB3A 1D7OA 3CZEA 1QYVA 4I9HA 3M1AA 3VZRA 4XYLA 4UAGA 1HDOA 1DC6A 1GUFA 1I30A 4J1SA 4CQMA 1E6WA 2EG9A 3JQFC 1NFFA 4TZTA 4BO1A 2IYPA 1QKIA 2GN9A 2UYYA 4EJ0A 5ER9A 4DIOA 3FTNA 3KHUA 2R00C 3B20A 3E82A 2X9GA 4JBGA 2PK3A 1YONA 3MTJA 5ENDA 2C0CA 1SC5A 5I9NA 2Q1TA 1AHIA 3ETDA 3M2PA 4CMEC 2QRJA 1ENZA 1DRUA 1GEGA 1WAMA 2ZYGA 5EERA 5DCYA 3ON5A 3X2FA 3NTOA 4TRMA 4KMSA 4RVUA 1B3BA 1MUUA 1DC4A 1AGNA 3HDQA 1N5DA 4XWYA 3BMCB 1SOVA 1M67A 4WKGA 3RAJA 2FPPA 4K6CA 1T2FA 2RCYA 3ICPA 4WOJA 4IQ0A 4RZIA 4W99A 3GEDA 5TRTA 1R4MB 3JQDA 4XYMA 3UERA 1YDEA 4YACA 1W6UA 3WLFA 3EY4A 2PZJA 5TSDA 4JP3A 3OJ0A 3PGXA 4FC6A 4JK3A 3KYCA 1KY5A 2OBYA 3OIGA 4QX6A 5CHEA 1C14A 2GN6A 2IZ1A 1C0IA 4R3WA 4BS9A 1G0NA 1BXKA 1GQQA 1MW2A 2O3SA 1JKFA 2PKQP 4ZQFA 3OEWA 4D0SA 1IPFA 5KJ1A 1NXQA 1DFHA 1NFQA 2RH8A 4D79A 2PH5A 4EGFA 1ISIA 2NLOA 1YL5A 3AWDA 4LRSB 2QZ9A 3D4OA 4XX0A 4N5LA 4U8GA 5L4SA 1YBAA 1E0DA 3KM0A 3CTMA 5JC1A 3ZWPA 4NBTA 3U0BA 2OORA 4E0BA 9LDBA 4DIBA 1ZK3A 2PKRA 5CDTA 5MGBA 1TB4A 4ALKA 3DR3A 3CINA 1X7HA 4FPXA 3E18A 1TXGA 2I76A 3GNSA 4KUGA 5EPOA 4DXHA 3TPCA 1PGQA 3GZ4A 2BRUA 2GSDA 3TL2A 4PG6A 3GFBA 1FDSA 3L0DA 5C7IO 1I2BA 3VDQA 3Q11A 2Q2WA 2X86A 4RLSA 2PGLA 1ZSNA 4PG8A 1BWSA 3AJRA 1AUPA 3CUKA 3DAGA 2WSBA 3GOHA 2I9PA 4ND3A 1R12A 5T6BA 1VI2A 1WW8A 2JCXA 1XCBA 1V9LA 1QYDA 5EN4A 3ZDFA 4CM7A 3W6UA 1NWHA 3IMFA 4W6ZA 3WWZA 1PWXA 1LSUA 4RCVA 4IS2A 1H9AA 3FRJA 3TN7A 4HP8A 4EJMA 5DCWA 5JAMA 1U1IA 4XB1A 4OSOA 3AW9A 1DSSG 1F12A 2WD8A 1SO8A 3UICA 1JTVA 1PZHA 2PD6A 4R54A 4H7PA 4PZEA 3VH2A 5A03A 4B7CA 3R1IA 4R3NA 1HDRA 2YQ5A 2GERA 3HG7A 2NM0A 5TF4A 2DPGA 2Z1MA 4J0FA 1EFLA 4M86A 1UDAA 1ZBQA 4CLOA 1LA2A 1V0JA 2OP0A 2PD4A 3ZHXA 3FCOA 3INRA 4JROA 3PXXA 4YVFA 3HADA 4ZRNA 5KCZA 1P1FA 1PS8A 2YHIB 2D2IA 1JAYA 3BHIA 1B2LA 1NX6A 3GVCA 3EC7A 2IZ0A 2CNBA 3KYDB 1G5AA 1LJ8A 1IY8A 4G5HA 1B16A 5DULA 2DLDA 1I3KA 1CYDA 1UXIA 2G17A 2Q99A 3F4LA 4PFJA 4JIGA 4M89A 4BO3A 5T5QA 3FSRA 5ADHA 4FW8A 1B8PA 1B15A 3FWNA 1H6AA 1V3UA 4AJPA 1JDJA 3QWHA 2NTNA 1KVQA 4CV3A 1P9LA 1L1FA 4C7KA 1M6WA 5JBIA 2QZZA 2BFPA 5IF3A 1P1HA 2FRDA 2YFHA 4MOWA 3V2HA 3V2UA 1V3VA 2Z1NA 2HMSA 5A4DA 1GL3A 1WDKA 1A4UA 2W2KB 3ST7A 5L4NA 1FDWA 5CPFA 3GUCA 5A9SA 1R37A 2XF8A 4Z0HO 3PHJA 3RUEA 4R16A 1Y7TA 1V3TA 1HE5A 3PQEA 4GKBA 1UDBA 3LC2O 2X7HA 2Q3EA 1P0CA 3RUHA 1IUKA 3AM4A 3GN2A 3DBLA 1Z7BA 3LT4A 5ITVA 3LT2A 2ZQYA 3UXYA 1LNQA 1K6JA 2JD0A 3VVCA 3IS3A 1Y81A 2VYVD 3K6JA 1NAIA 3S1LA 5CEEA 4AG3A 4IGEA 4LMRA 4FC7A 4CV0A 3GFGA 4K6FA 2FP4A 4P38A 4RPKA 4NU6A 4ND5A 1NQ5A 2PD3A 4HADA 1PL8A 3QV1A 1BHSA 4GX5A 4XQCA 1KIFA 2UDPA 5CEFA 5I8WA 5G4KB 4PLGA 3JQCA 2O7QA 3GNQA 3ZWWA 4BNTA 1J5PA 1Z45A 5GZ1A 2QHXA 1MA0A 1UR5A 3HWRA 3U9LA 4A03A 4DYVA 3WIEA 3TNLA 3ZCXA 4L4SA 1ZEJA 3PYXA 2DKNA 4OJNA 4FFLA 1H6CA 1F06A 4DPLA 1J0XO 4O5OA 4XZ3A 2WWRA 3G1UA 3LSYA 1X0VA 3NDIA 4FFPA 3RFTA 4R1TA 2Q4BA 3PRJA 4KWIA 4Y8VA 1Q7CA 1T4BA 1YOVA 2JKVA 1ML3A 2W98A 4KUEA 4L74A 3H65A 4ND1A 3UN1A 4BL5A 1EVIA 3G79A 4R69A 5I9LA 6ADHA 1HDXA 4XQGA 1HZZA 1U5AA 4RDHA 3GNTA 1GV1A 4CLDA 4O1MA 3OQ1A 1B8UA 3PQFA 1Q7BA 5EINA 1EBUA 1PGPA 1I10A 1UZLA 1N7GA 1GAEO 1LLUA 1VSUA 2OHXA 1YQGA 5JLAA 2R2GA 3C7AA 2YYYA 4CQMD 3LLVA 4LMPA 1BVRA 1A9ZA 1LU9A 4FGWA 1BRMA 4FOOA 3OECA 3F3SA 3U3XA 1NVTA 4FSHA 1E1KA 1ZKMA 4UVIA 4A26A 4CR7A 3DDNA 1HE3A 1YH3A 2D3TA 2EGGA 4YJGA 3JQGA 3WYBA 3GGOA 2PY6A 4E2ZA 2VUSA 2YQ4A 3K8ZA 5H81A 7MDHA 5J23A 1GPJA 3ZGYA 1BGVA 1K0UA 2NVBA 4OXNA 3C8MA 4GL4A 5BSEA 3PJDA 1P1IA 2JFGA 5T8KA 1X7GA 3F1KA 3H5RA 4CM9A 4LCJA 3RUCA 4G81A 5B4VA 2AEMA 4CR8A 3G49A 3A28A 3PHIA 3GK3A 5BNIA 2XXBA 2X6TA 3Q3CA 4F3YA 3CSDA 2PV7A 2AQ8A 2VHYA 3JTMA 2A9FA 4NQWA 3D3WB 1HYGA 3CZRA 4EI2A 2ZJ1A 3PDJA 2X1HA 1YKFA 2B5WA 3FWZA 3KXDA 1YQXA 4EDFA 5AVOA 4K1LA 3ENNA 1U8XX 4YEDA 3L6DA 3HQ4O 1DRVA 3GPIA 3DBRB 4IZIA 4R4JA 2FSVA 4TROA 1KOLA 2WD7A 3WJ7A 2BD0A 1CDOA 2O48X 3H9QA 5F21A 3RASA 1P1KA 5I7VA 3NUGA 2YW9A 3JYOA 3JQAA 3FF4A 5G0UA 5DBGA 3BTOA 4KWHA 2C2YA 4XYBA 3T4XA 4CMBA 4F6CA 1T2AA 1U2GA 5CDYA 3IP1A 1CEQA 1NASA 1Y9AA 3EYWA 1I2CA 3KLMX 3VKUA 1AHHA 1AXEA 1NFRA 1YJ8A 5DOVA 1WP4A 1A27A 1NHWA 2ILTA 2VRCA 5JXWA 2YZ7A 4DREA 3KSDO 1N9GB 1K6XA 2AHRA 3ZHYA 5AOVA 3QWBA 4MVJE 1QLHA 2IYOA 1U3VA 2VHZA 2VRBA 2YDXA 3VZSA 3ZV4A 3PDUA 5L9AA 3H9JA 2BKAA 4JLWA 4PLFA 1I8TA 5IXYA 1H6BA 3DFUA 4LVCA 3NRCA 2I66A 3BMQA 3ONFA 2PZKA 5IN5A 3NKLA 3ITKA 1KY4A 2ZYAA 3LC7O 4RVDA 3H2ZA 2ZTLA 4BQPA 3GZNB 2EKQA 3DOJA 4CMIB 1LLCA 3EDMA 4RPGA 4QO7A 2PWZA 3WYEA 1J4AA 1E7RA 2O3JA 1KEUA 1UAGA 1I33A 1B0AA 3JQ7A 5DF1A 2BGLA 1OR7A 3WWYA 1P74A 2FR8A 2J3IA 9LDTA 3SXPA 1MLDA 4TKMA 1NNUA 1RJWA 1XKQA 4YTEA 4AJHA 4UREA 4B4OA 1HE4A 2A35A 3TQHA 3DHYA 2EKPA 5GZ3A 3QWFA 2WPGA 2QIOA 2V6FA 4MKXA 5TC4A 4KQWA 1CRWG 1A9YA 2DU8A 1HSZA 3GN1A 4IS3A 4WLVA 1YRLA 2WMDA 3NGXA 2Y0CA 1SB8A 3SJUA 4R51A 3ZU4A 1LDNA 4JCOA 1LRLA 3VC7A 4ALJA 4CUZA 3MJVA 3RD5A 4PIVA 3DHEA 1ONNA 4L9RA 4E21A 5FEUA 2Z5LA 4TWRA 1ZXBA 4G65A 3GUYA 1T24A 3JQ9C 2GD1O 3L6OO 3FBGA 1E3JA 1UXKA 4Q3CA 4JP2A 4E30A 3T7EA 4FS3A 4A7PA 1F8GA 1FMCA 4MP3A 4ZQGA 5JW6A 1Z75A 3PP8A 3RVDA 4WUVA 1I3LA 1OAAA 3IIEA 1HDCA 4MVJH 3AK4A 4MVJG 4LK3A 1KETA 5JE8A 1ZK2A 3ASVA 4CLRA 2BFMA 4LW8A 1ADBA 1EUDA 1JG9A 3IOYA 3DAFA 4MO2A 5A3VA 2W8ZA 4ALMA 2POQX 4YJHA 3WGQA 4WCDA 5L4LA 4TVBA 2WTBA 4J2HA 3WDSA 1N1GA 3IAHA 5DBIA 2GDZA 2X9VA 4KP7A 3ICCA 2Y1OA 4H16A 3VZPA 1DAPA 2DFDA 2I65A 3INTA 2Q45A 3BMCA 3I9KA 4FGSA 1YBMA 4NK4A 1JLLA 2G0TA 3MJSA 5ENVA 2PNFA 2B0JA 2JHFA 1R4MA 4DYDA 2X0NA 3Q2KA 4Z0PA 4K9DA 4DUPA 1DDOA 4WE3A 4WLOA 4KZPA 4JQCA 2YV2A 5AXCA 2ZB4A 3Q6IA 1PU2A 3C3XA 4RVSA 1HZJA 1ZFNA 2DBVO 1DIHA 4NNJA 3DMTC 4GSLA 2SCUA 5KJFA 3ZI0A 2NVUB 1DRWA 3A06A 1XEAA 3G1TA 3I9NA 3JQBC 3BYZA 3I6IA 1P45A 3GVXA 4MKRA 3GG2A 4YJGB 1PEDA 5EQFA 5JDIA 5GMOA 3U4CA 4DQVA 3ZWAA 3O38A 5IZ4A 5A5FA 1HYHA 2BMAA 1U28A 1MVYA 5GZ6A 2JCYA 1L7EA 1WDLA 2ZCVA 3S8MA 4BIIA 5LDHA 3TZQA 2J5RA 2P5YA 1ISFA 4XYGA 3A1NA 2D5AA 4E5YA 2E82A 1SMKA 1JA9A 4EITA 1EDOA 1KC3A 4EEZA 3H6KA 3ZNQA 3OICA 1HYEA 2C54A 1DIAA 3NV9A 2PZMA 1LTHR 2V6BA 1T26A 2QX7A 1Y9EA 1XYGA 4EEXA 1P77A 4FN4A 2JL1A 1J6UA 3U62A 1X14A 1U2DA 3UHAA 3ZV6A 1GTMA 4IJWA 4BGIA 2EXXA 3RFXA 3AM5A 1KBZA 4QFCA 2AQHA 1NQOA 2ZK7A 4QUKA 2VYNA 1RP3A 4F45A 5TT1A 5COAA 1Z7EA 1MB4A 4Q9NA 5AXBA 2AEJA 3H2SA 2ZQZA 4BUCA 4RL6A 3CZKA 1NPTO 2OZPA 1XG5A 1LI4A 1VL8A 3ZN2A 3U4HA 2P2SA 1AN9A 1I32A 1R16A 4GH5A 1MGOA 4OSPA 2VT3A 5KVCA 4PLHA 4Z9FA 2CVOA 1QLJA 1DPGA 2HK7A 3AOEC 3L07A 4I5GA 2GNAA 3GA0A 2VOJA 3O03A 3X2EA 4TKLA 2HMUA 4GWKA 1M6HA 2D59A 1GQ2A 1YL7A 4HNHA 5C3MA 2B36A 3U09A 3GEGA 5H82A 2JD2A 3LF1A 2OXIA 2WE8A 1LQTA 3INGA 4CPDA 3RUAA 4D0RA 2CSUA 2P91A 3MCVA 2YHIA 5CEJA 3CZGA 1NP3A 4FDAA 5IFLA 4DWVA 4OOFA 5L7YA 3KYDA 3C7DB 3DL2A 2G76A 4J2OA 4TQGA 1YVEI 1DIRA 1RYDA 2BHLA 3TL3A 2WYUA 3I9LA 4TZKA 1LUAA 4O0LA 2D8AA 3ZZNA 5HWSA 1GADO 2DC1A 4ILKA 2YV3A 3FHLA 4GLLA 4J3FA 3IJRA 4OKNA 4BNUA 2PA3A 3ANNA 4XJTA 1V35A 4EW6A 4RVFA 1PWZA 1D8AA 5COBA 1VRWA 2B69A 1NAHA 1I2ZA 2CY0A 5JCJA 1LDMA 1VLLA 3FNFA 2NU6A 2P68A 3BMOB 3OP4A 2W2KA 2J8ZA 1WWKA 2VHXA 5BSFA 3WMWA 3GVPA 4LVUA 3DZGA 5THKA 4TRNA 2RBEA 3JQAD 2NACA 4E5KA 3KBOA 2OL4A 3EK2A 2VZ9A 4NI5A 4J4BA 3V1UA 4DBVO 4B8ZA 5TLSA 3G17A 3MJTA 3FBTA 3GQVA 4J1NA 3IQDB 2DTXA 3H5NA 5A04A 5KKCA 3VHRA 2IE0A 2XPCA 3KUXA 4MVJA 4CMJA 4CLRB 5ITWA 4D7AA 2WYVA 2IEBA 3C24A 1SBYA 1LX6A 4DL9A 4YJHB 4E2WA 3JV7A 4BKRA 1TT5A 4ZU3A 1S46A 1ENOA 2X22A 5JMPA 3RCBA 2PH3A 1C1DB 4BHTA 3UCQA 3DZIA 2GUGA 1NQAO 3CPSA 4WNIA 1DAOA 1R15A 3PYMA 4IDCA 1VJ0A 5G4KA 4N54A 4Q3AA 4YAGA 4XRGA 4OO3A 2W2LA 1UH5A 4QTZA 4DRYA 3I52A 1IL0A 5BNFA 4GSKA 3KEOA 4E5PA 3H7AA 2YHUA 4OQYA 2Y1GA 3HN2A 3HZZA 2V6GA 1UXHA 2X5JO 3QIVA 3O9ZA 1D4FA 1EMDA 1XSEA 2MAOA 1WXDA 4J43A 1LRJA 2Y1DA 1WNTA 1NWCA 2NV6A 3MOGA 1YDWA 4YCAA 1WLYA 5KOIA 1HDYA 3V1YA 4CUJA 1CQIA 3HDHA 1GQYA 3IUPA 5CDGA 3NJ4A 4IMRA 3U4DA 3DONA 4KTVE 1IHXA 4NPCA 4E2YA 1F14A 4W4TA 3PZBA 3RWBA 4P22A 3ZU3A 2EJVA 3DC2A 4UULA 1HXHA 2FOIA 2IZZA 4GVXA 1NVMB 4JX8A 4N18A 4P4NA 5TX7A 3IC5A 4D3FA 1LDBA 4P4LA 1V8BA 3DQPA 2QG4A 1ZK0A 1U7TA 4MVJM 3CMMA 4CMAA 1FXSA 4RF3A 1GUYA 3ITDA 2WDZA 3GDOA 2NQTA 5JFOA 2O7GA 3JQFA 4AFNA 4OOEA 2AQIA 4O63O 3QA9A 3FNEA 4XRRA 3HSKA 2YV1A 2R00A 3RUIA 5JAIA 2BH9A 1N8KA 1TLTA 3NTRA 4BO9A 1DEHA 4CMEA 1DIGA 3DAPA 1Q7GA 3JCZA 3E5MA 5K9ZA 1NR1A 2B83A 3F46A 4JBHA 3WSWA 3L4BC 2BLLA 3KOUA 1VM6A 3W8EA 4IQ8A 1HDGO 1KEWA 1YXMA 1EQ2A 4J4HA 4YQZA 3HB5X 3OJOA 2E48A 3OM9A 3GT0A 3KSZO 4Q3DA 1AXGA 3D3WA 2A94A 1QRRA 3I4FA 4L8VA 1OFGA 1K5HA 3GPDG 3LT1A 4XGNA 4XQ9A 3GAZA 3C7CB 3TJRA 1QYWA 4CM4B 5C7LO 3H3FA 4ZA2A 1EUZA 1LXCA 4MVJI 3GY0A 4I9UA 4IQGA 1FDUA 4RORA 3AU9A 3I3OA 2VZ0A 1UZMA 1Y8RB 3KB6A 5F1KA 1XR3A 4RDIA 3O4RA 5TJ9A 5FWNA 3IKTA 3E03A 3DBRA 4CODB 5JO0A 3HJAA 2ZYDA 4XJSA 1YS4A 3IJPA 2AG5A 2B4QA 1C3VA 3AUTA 1ZUD1 4M87A 3TDKA 4W7HA 2ZTUA 4DIFA 4YRAA 3WGGA 1ZIDA 1ADCA 3MOIA 4RO0A 3WNVA 3TF5A 2PKQO 3ZWVA 3ZWYA 2PZLA 4OXKA 1PJSA 3QP9A 3AUSA 4WPGA 4R9SA 5JDIC 5IAAA 5CAEA 3PJEA 4PLPA 3OQ6A 3QQPA 3PZRA 1R4NB 1PR9A 2NVWA 5DDIP 3AFNA 1ZZEA 1N9GA 1PGOA 2O4CA 3PGJA 1JAXA 4BNJA 4JJIA 4MJLA 3EAGA 3NT2A 1ID1A 2J5KA 5GY7A 3OHSX 1T2CA 2VYND 4L75A 5F5LA 3UGKA 3PWKA 4A10A 2Q50A 4K28A 3EHEA 5FF9A 4LUPA 1I3MA 2JFFA 1BG6A 2NQ8A 1KVUA 4RPLA 1LDGA 3MJ4A 4GBJA 4WEOA 5U4QA 3GZNA 5K6AC 1H94A 4A5OA 3RFVA 4NU5A 4CMIA 1EK6A 1Y8QB 3ONEA 2G1UA 1IPEA 2Y1EA 4XKJA 4Y67A 1EQUA 2CFCA 3DBHB 3I83A 5TS3A 2VNAA 3I4CA 4B79A 5KWEA 3IL2A 4QSMA 4XD2A 3AI2A 4R1NA 3PJGA 4WEQA 5IN4A 1OBFO 1BMDA 1E6EA 1HT0A 3BTUA 3STHA 4AJ4A 4B7XA 3SVTA 4ZN6A 3JSAA 1H9BA 3AY3A 1TA4A 2O3RA 3HB4X 5JC8A 1R0LA 3DOCA 4WASA 3QVTA 2O7SA 5JY6A 1ULUA 1TT5B 1E3IA 3K5PA 3UEQA 3DFZA 3QE3A 2HCTA 4BNZA 2CD9A 1QR6A 4YT4A 1DC5A 2HJRA 1NPYA 5JY1A 2HJSA 4PGFA 2ZTVA 4HXYA 5EMHA 1I0ZA 3DB2A 4RF2A 1LEHA 1H5QA 1T4DA 1HE2A 4ZVVA 1NBOA 2HLPA 3EW7A 5KVSA 3LT0A 2EERA 3JYLA 4W9NC 4WJZA 5T57A 2HRZA 2C7GA 3E48A 8ADHA 5LDGA 4ZJUA 2NU8A 2W90A 3GC6A 4R9RA 2VWHA 1T1SA 1QV6A 3A4VA 3WGYA 1KEPA 3A9WA 1XWFA 4J90A 4YJDA 3RI3A 3MWDB 2WE7A 4J16A 2DPHA 2H1SA 2W4QA 4GQAA 3SC6A 3JYPA 1ZSYA 5A9TA 4DQUA 2C29D 4IBOA 1JN0A 2LDBA 4C7JA 3Q0EA 3P2OA 4YAKA 3F5QA 3ROQA 4BMNA 5ILGA 1GYPA 2HMTA 5JYDA 2Q46A 3JD3A 5AXAA 5ILOA 1YJQA 3L77A 1YGYA 2GZ2A 3DOOA 4R41A 1PJ3A 4NH4A 4ONEA 3WX0A 4BO0A 1RPNA 4LN1A 5B37A 4YRDA 1P1JA 3DMYA 3PHGA 5IZCC 1MFZA 5COQA 4MP8A 3VPSA 2HO5A 2HMVA 1ZMOA 4IXTA 1LC0A 1C0PA 5G4LA 3K2EA 5DP1A 5CP8A 5TQVA 2DUWA 2NVUA 3KRTA 3ZU2A 1VJTA 3NYWA 2DQ4A 3HE3A 1UP4A 3TOZA 4RF5A 1V6AA 4BKPA 1EVJA 3SLGA 1DHTA 1GV0A 1P3DA 2A92A 3WR5A 1U3WA 1LC3A 2AE1A 3IUSA 1VL0A 3GEMA 1S7CA 3JQ8B 3EMKA 3EVTA 4HFNA 4CM1A 2P9CA 3JD0A 1WPQA 2CZCA 3S2EA 1DFIA 5B4UA 4A2CA 2W2LD 5KJCA 5EJ2A 1GDHA 4BO2A 3QVSA 1PQWA 3GGGA 2ET6A 4UUPA 4D46A 1N1EA 2P9GA 2DAPA 4BOYA 4YAIA 1JKIA 1L7DA 4LSWA 1UUFA 1E92A 1UXJA 2OO5A 4Z9XA 2GASA 3C1TA 4FLQA 4HFRA 5IDXA 4WECA 2EP7A 4IJUA 5DBFA 3H9EO 3RQSA 1SB9A 4GWGA 1OMOA 3GMSA 4FJ2A 1EFKA 2V7PA 2B35A 3PWZA 4BV9A 2EIHA 3HDJA 4B4WA 1H2BA 4DGSA 4WLUA 1VKNA 4YR9A 4KDEA 1U9JA 2OFPA 4BNKA 4MKZA 3ZHZA 5CDSA 1LLDA 5B4TA 1EVYA 4FB5A 4RQTA 3BTSA 2CVQA 3DZBA 4ALNA 3Q9UA 4BO4A 4M54A 5A9RA 4LCEA 5DN9A 5CDUA 3VPGA 1X13A 4XDYA 3H8VA 3F1LA 3HHPA 4M8SA 4YWJA 1UXGA 4RPJA 5JDCC 3S2FA 4CJXA 3C1AA 3H9GA 3V5NA 5JYEA 2GRAA 2PTGA 4EBFA 3DBVO 2O23A 1E3WB 1HEUA 3MJCA 4FFNA 2Y05A 3SC4A 5JCXA 3ORFA 3TSCA 1FF9A 2CDCA 2O3UA 4D3DA 1KVTA 3NX4A 2ZCUA 3LK7A 5L7WA 4I5EA 5G0SA 5LC1A 1OI7A 4QXMA 1E5LA 3KEQA 2AXQA 1ZK1A 3BIOA 3PHLA 4J6FA 3AM3A 4ZRMA 3TZKA 4B7UA 4E31A 3D1LA 4CLEA 5F1OA 4J49A 5A3JA 3WTCA 5T67A 1P33A 5BSHA 3BXXA 2NWQA 3O8QB 5JMWA 4N7RA 1KVRA 1LSSA 3HN7A 1LRKA 4BO8A 3T7CA 2EP5A 4MINA 3WG9A 3WFIA 1W73A 2O4UX 4AJKA 4MVJP 4Y98A 3ZWMA 2JD1A 3KYBA 2C7VA 1BXGB 3PYLA 4Z3DA 4X54A 1WZEA 1PJCA 4BNWA 2XOXA 5F5NA 3ROPA 4FLOA 2CDBA 1PSDA 2E49A 3BMNA 5EQDA 3BMOA 4E33A 1J49A 2OMEA 4HFMA 5H83A 1U3TA 2RHRA 3OIDA 5KJEA 4ND4A 4FD3A 4R5HA 2X5OA 1HKUA 5HRUA 2GPTA 2P5UA 4R1SA 2VQ3A 1BTOA 2JAPA 1WZIA 2X0IA 1I36A 4BV8A 2EW8A 3ZH2A 1ZCJA 2I5PO 5KTKA 4NJMB 5KVVA 2AG8A 4GGOA 1YWGO 1W8DA 4J9VA 1T2DA 4DLAA 4HV4A 2ZB8A 2Z95A 1I3NA 5F1PA 5AXDA 1I5RA 1XGKA 1PJBA 1XQ6A 3ABIA 3FNGA 4MIEA 2GZ1A 3FI9A 4WGGA 5C37A 1GY8A 3RJ5A 1C1DA 3EZYA 1WVGA 2Y0DA 4CMGA 5I7SA 3UKOA 3OFSA 3SX2A 2HKIA 3MWEB 4UEJA 3CMCO 3VPHA 5JAZA 1FJHA 1DBVO 1LQUA 1MFPA 2HU2A 2V65A 4J1QA 2DM6A 1GPDG 4UEKA 3TZCA 4C4OA 3W8DA 1B14A 1WDMA 4Y6SA 4RPHA 3TOXA 1KERA 1Y1PA 3PI7A 3Q1LA 4WCFC 4DMMA 1VSVA 2CF5A 2DTEA 1KS9A 1ZXLA 4GMFA 4YBZA 3KLPX 4OYRA 1ZS2A 3LU1A 2D1YA 4NQZA 1ISHA 4BGUA 2AEFA 3QSGA 3VPFA 2OGUA 3RU7A 5F3RA 1EK5A 2UAGA 4UVGA 3PJFA 1PX0A 2VWGA 4IDEA 1NR7A 4GGPA 4Q3EA 4CMHA 3D4PA 4ZHSA 1GYQA 4BNGA 4PVCA 3L4SO 1PIWA 3WQSB 2C2XA 1KYQA 5JPIA 3B1FA 3T4EA 3HNPA 1H93A 3JQ9A 3PIDA 1GU7A 4XYEA 4BB5A 2IXBA 2Q1UA 3M6IA 2QQ5A 1EE9A 3I5MA 1F17A 4ZGWA 3E9QA 3K31A 4AVYA 3EZLA 4BMSA 3PHHA 3ROMA 3E6AA 4NJOA 2D4AA 2B5VA 5FFFA 3LYLA 2JHGA 1ONPA 5HBRA 3RBXA 3DTTA 5KJ6A 2JFHA 2H6EA 4WLNA 1U3UA 2ZB7A 4XA8A 1EE2A 3PWSA 4KQXA 4L4XA 4W7IA 4ND2A 3RIHA 3OJEA 4BQRA 4U0KA 3UOGA 4E32A 2IEDA 3HDYA 2EKLA 4QECA 4BKOA 2EGHA 1HLDA 1MG5A 1T25A 1WMBA 1Z73A 1U7HA 2EW2A 4FIZA 4PVDA 4HY3A 2B4TO 5A5EA 5U9CA 1E3SA 2R6JA 3JYNA 3H3JA 3UW3A 3ZV3A 3B1JA 4GPD1 4PZCA 3Q9NA 1T1RA 1MW0A 2FPIA 4GAEA 3RSHA 2FHSA 4RQUA 4MIYA 5I9MA 4OM8A 3OH8A 4DMLA 1KC1A 5JAQA 3ONDA 1BDBA 4BNVA 1E1MA 1LSJA 4XGIA 4CM4A 4D41A 3DMTA 1E3LA 2GF2A 1W4ZA 1EVZA 3QWIA 3C85A 4HBGA 5MDHA 4XQEA 3JQBA 3UCXA 3LC1O 1ZVMA 1Y8RA 5BT9A 2ZKLA 3FPLA 3RBVA 3K96A 1Y6JA 4NFYA 2J3JA 4G2NA 3UCFA 3NGLA 5CG2A 4N5NA 1P44A 2DFVA 3GAFA 4FLRA 1R0SA 2IODA 3IDSA 4CM9D 4EJ6A 4MP6A 4CLHA 3IP3A 2GGSA 1Q0LA 4KDFA 4PG7A 1YQDA 1PJQA 2Y68A 5L53A 4CMKA 4DPMA 1E7WA 4M49A 2WJPA 2VYVA 1SNYA 4BNHA 5KKAA 1GCUA 1X1TA 4GMGA 4U6QA 4UUOA 2X5KO 4JXKA 5BR7A 1R4NA 4NBWA 2AQKA 4OIMA 1JGIA 1OC4A 4WNCA 2FZWA 1VKOA 4FFOA 3DO5A 5I8ZA 1RM0A 3BMNB 5HA5A 4TRJA 4NIMA 5EIOA 3I9JA 1H6DA 2Q1WA 4R68A 4KTTE 4ESOA 3GHHA 1D3AA 1PJ4A 4Z9YA 1YO6A 2VWPA 3OEYA 4DVJA 4CL3A 5DNAA 4OXYA 2YUTA 1Y8QA 5L51A 1XELA 4O6VA 4PZDA 3N74A 2XAAA 3DZHA 4PLVA 3AOEA 3KZVA 3DBHA 3WLEA 2VRCD 4LSMA 4MVJF 1MXHA 5FYDA 4QT0A 1BSVA 4MDHA 4BGEA 2EEZA 3W8FA 5T64A 3ULKA 1LSOA 2BI8A 4HFJA 1JWBB 3QY9A 1VPDA 4IMPA 3VAZA 1MC4A 1S6YA 3GHYA 3VDRA 2FSSA 5BQFA 3QWAA 2WM3A 1Y5MA 3N58A 2HK8A 4J7UA 4U0JA 4XIYA 1KVSA 2FPGA 4Y9DA 4CR6A 2B37A 3R0IA 1UJMA 3K73O 1ZO8A 2QRLA 4IJVA 3JQ6A 1TI7A 3P2YA 1DLIA 2BFOA 3GVHA 2PGDA 1TEHA 4ZD6A 4EYEA 1Q0HA 4Y6RA 4AJOA 3NEPX 4Q39A 2ZJ0A 5IJZA 2VTDA 2OUIA 1HL3A 2DBRA 3KETA 2PGJA 2VHWA 4XCVA 1O89A 3MZ0A 1DC3A 4II2A 1IHYA 3BAZA 1W0CA 4L76A 4XEHA 3WOHA 1C1XB 4BNMA 1LDYA 4IIVA 3UFXA 1C0LA 2DBZA 3V1TC 4BKUA 4D44A 1NHGA 3PLNA 2NU9A 3I6QA 4AJNA 5A1TA 1ZNQO 1BXZA 3VOSA 4HUJA 2FZEA 1H0KA 3VH4A 1IOLA 4BO6A 2VTEA 4IJKA 2H5LA 1ULSA 3OJFA 3VPXA 4J1TA 1BW9A 4FCCA 1RM4A 1HTBA 3ANLA 4P8RA 5K0ZA 2EF1A 3FR7A 1D1SA 4U5QA 4B3JA 3ZW9A 2AE2A 4NDNE 4N5MA 1MW3A 1EUCA 4LGVA 3NT5A 2O50A 5DZSA 3QLJA 4I9NA 4ROSA 1HLPA 1ADGA 2E37A 1XIVA 2Y66A 4BNIA 2OOSA 4UEOA 1QV7A 2AMFA 3NDJA 4BVAA 1CIVA 4BNLA 3JQ8A 4RVHA 1R6DA 2P4QA
chains in the Genus database with same CATH superfamily
1W5AA 2I2XB 5FI5A 3ZBPA 3P2KA 2O6LA 2CHUA 4CI0B 621PA 4NK5A 3J80A 3D1VA 3BRWD 1SPXA 3GGJA 2H2GA 1ZM3A 2EHJA 1DTWA 2VZ8A 5EWLA 3VU1A 1KI9A 2Y0EA 4OU4A 1ACMA 2M6RA 3EUAA 5BSTA 4NS4A 1G1AA 4NBNA 4C20A 1VOTA 1A5ZA 3VR2D 1Z2OX 3GI1A 2BYTA 2VUTA 1Q5PA 1URPA 5HG0A 3EGWA 4BNFA 4DV4B 4NR0A 1CRPA 4A23A 1SG9A 5SZKB 2PSSA 3E22A 1ULZA 1Q2XA 2EOAA 3CXUA 1PS9A 2YC4C 1X77A 3AVVA 2G9ZA 5LCXA 1LJUA 2M6KA 3THWB 1BEUB 4UVHA 1KFBB 1TMGE 4PEVA 4D3SA 1GXSA 1U7WA 2OAQ1 4YONB 3EG9B 1O5IA 3B6ZA 4E51A 4EKYA 2CJFA 2VI5A 1OI4A 3HWX1 2O0HA 2ALJA 4A73A 1PJRA 1QMPA 3L6UA 5DLYA 2RAPA 2Z3WA 5DT9A 3RTEA 5B3LA 5LUAA 2PUWA 2HSDA 3BX1A 1G21B 1PFGA 3DDHA 1XPUA 2EX0A 2VSQA 3KV3O 2VLAA 4S3MA 4V1CA 1RM3A 3K0CC 3LPNA 4HVAA 2FMUA 4G5SA 2AFVA 3ZY6A 2H07A 1OXUA 2I62A 2WZCA 2ZBPA 2ZYRA 3CG4A 3TLZA 4K87A 1Y9ZA 3S28A 1XCLA 2G04A 4N8DA 3EARA 4YQYA 1Q6YA 2TMYA 5JD3A 3W5UA 2HPVA 4YNBA 2JLRA 4TV8B 1GR0A 4NEHB 4UCFA 1ZGZA 2O0LA 2II6A 1TT7A 3EEOA 1GPUA 1BQ3A 4HEA1 4IILA 1XRPA 2XWQA 3CXRA 3L18A 5K0FA 3ZU5A 3KXLA 2Y67A 4NG5A 4RU1A 4RZ3A 2JJ1A 5FPHA 1T0JB 5LU9A 3IDAA 5H9VA 5U4XA 4B3MB 4KDCA 2C0QA 4HX5A 2FW6A 2Q07A 3K9HA 2HJVA 4B4KA 1PFWA 4H1VA 3STTA 4ZZ0A 1A04A 3BDIA 3EC1A 1OYWA 1ADFA 2FMIA 1RXUA 2XQIA 2IXGA 1N7IA 4UPDA 3S2YA 4EUNA 1UZNA 1Q1NA 1XDGA 3BKWA 3E9NA 3IAS1 1QK5A 2P40A 3HP1A 5IC5A 1L5GB 1THTA 3QVWA 3LOUA 1YK1A 1N8NA 2EZ8A 2XMBA 4XNAA 1T8UA 2OP1A 4UNIA 1D7AA 1GPYA 5EMLA 4DCNA 4E12A 4R84A 3DCJA 3BWVA 3GRKA 1T5OA 4PZUA 1GZ4A 4ETNA 1KF0A 4S0XA 1LNZA 3F4KA 3QVJA 3MUFA 5DNEA 4Y2UA 1X0XA 3F6YA 2ZT7A 2Z04A 3L8DA 3S7ZA 1I5OA 2OBFA 5EJ8A 2CXPA 4URXR 4H7IA 1BXGA 2O2ZA 5BRJA 1WF6A 1ZUNB 2AFHB 4MUYA 1VC2A 1AVTA 1QK3A 4Q47A 3OQBA 4I50B 4AJEA 2I67A 4O4JF 5JAHA 4P5DA 4FR2A 4D9KA 4IINA 5BUQA 2JVJA 4RK6A 5HM8A 4IGFA 1G6KA 2RGGA 3GYGA 5DYNA 4MA0A 3OUZA 3QYFA 2JGDA 3NJ8A 3ZWXA 1ENYA 2D4HA 3KPUA 3HM9A 4Z86A 4IRMA 3WVNA 3R5KA 2RAFA 2OBNA 4S24A 1M2WA 3WFJA 3BHMA 4DC1A 1PZEA 2XB9A 3HJBA 2NTVA 4L50A 5AKEA 1PR2A 3SLKA 2GF0A 2WQ6A 2W42A 1SBIA 2IS6A 1WM1A 4PM4A 2C3YA 1RRPA 1Y63A 1SCUA 3O4GA 4LVNA 4N5HX 3TFWA 3QVXA 1K2WA 4I6JA 4NYMQ 4KUHA 5JXJA 3RAPR 4JMLA 1B3RA 3COJA 2XPZA 1O6ZA 1Q2UA 3CVJA 4YRZA 4HLUC 1A5BB 2FPWA 2JH8A 2OCAA 3AY7A 4GX0A 4KBYA 2IZOA 1IJEA 2IDZA 3DEAA 4NJMA 4BMXA 1ST2A 2PX2A 4Y7DA 3UOWA 2XNJA 2YRFA 4D92A 4YMUA 4IDNA 5JOQA 3CRVA 5AW1A 1RXSA 3H5TA 1WY5A 5HJEA 2XMCA 4YXFA 1XZ8A 3W1EA 5IKPA 1CF2O 4RCYA 3KQNA 4O59O 4N01A 2Q28A 3U19A 3VGJA 1GM5A 3UF0A 2ZUEA 1P5JA 4GMXA 2MSCB 3LVFO 5CG1A 3T9BA 3CZ5A 1B1AA 1X7XB 4QYTA 1TAQA 3RS3A 1PJ2A 2ANBA 1S2DA 1L9KA 2IJGX 3AHGA 3M49A 3TZHA 3W4KA 2J4DA 2JLVA 4CUKA 4G0XA 4CG2A 3HCFA 5K6AA 4F56A 2XAUA 3GARA 1BW9B 3SZGA 1QQ5A 2GXUA 2WJ4A 3U5TA 4V1CI 1PI3A 1MC8A 1P60A 3U5ZB 5CD9A 3BA6A 4NZOA 1SUFA 4Q19A 3DLPX 2LWIA 2QUHA 1DQSA 2YFQA 3LO5A 3IVXA 1MORA 3V34A 4Z4FA 2A78A 2WSIA 3VH3A 5B12A 5TXGA 2D5CA 1EUCB 2YJ3A 3N9IA 4URZR 3CGWA 3OT5A 2QM3A 4LKOA 4MYDA 2FFQA 1OILA 1E2PA 1A9QA 1PG0A 2YHAA 4HPJB 1CV2A 2ZBEA 3AVTA 3ETGA 4RY9A 3DZDA 2BEKA 3PD7A 5A0TA 4BNYA 3ZYZA 3UWOA 3VYRB 3WNQA 3GPCA 1VGVA 4GO1A 4WKNA 2XE4A 1CJKC 1JEAA 4H3VA 4J0DA 4YAWA 1OPXA 3AHJA 3WNBA 3IUEA 2WPNA 1B0PA 1Q91A 1RWMA 1ZN7A 1WCYA 2HU5A 3Q88A 2BOVA 1LBEA 1NUPA 2CJXA 4QRIA 4YAOA 4XUGB 3D2BA 2IP4A 1G21E 2IX9A 2R65A 3KZCA 4PG5A 4PRLA 4MQLA 3RIGA 3SR4A 4JV5B 2PMKA 1EGAA 4Z0TA 3WXBA 3WBBA 3PHBE 1M54A 4AG6A 2P8SA 3PGKA 1N0IA 1P6UA 1A9XA 3BDVA 1YSCA 3ZNPA 5I7RA 1RZRD 3MAGA 5F51A 1AUOA 2R6HA 2AKAB 4G2TA 2V7QA 2GBGA 3H3XA 4LE0A 3PDHA 1F8FA 1Z7GA 1GZ6A 2GPAA 4E2XA 2VPZA 4FMCF 1EP1B 1M34A 4K5NA 2AS0A 5IM4A 4G9GA 1YR9A 1PLLA 2AJ8A 1IB6A 4BIMA 4KITB 2DVMA 3A32A 5ALHA 4ZC1A 4NJEB 3NEAA 5C5IA 1P4RA 4FTWA 4OQXA 4KPEC 2PFKA 2Q5HA 3JATA 1B0ZA 3HDVA 3PQ5A 4WOKA 2W2TA 4ZJYA 4HS9A 3DWEX 5CMLA 3FPCA 4BQOA 3A7EA 4KXUA 2C59A 4H77A 3O2JA 3IUYA 5BRAA 1I24A 4OP3A 1EB8A 4YWHA 2G83A 3VR6A 1IH8A 4RH3A 1W75A 3BG5A 3HFSA 2QR5A 3UJ7A 1S9DA 3ANTA 3V55A 4QQRA 2NSLA 1MH9A 4J94A 3PC6A 1JIKA 2EFEB 1RKBA 1SXJB 3DTYA 5HK8A 5BUZA 4CCYB 1Y3IA 4NBRA 2IITA 5JQGB 3BIFA 3I04A 2I3BA 5IBRA 2V98A 3GU3A 4WK6A 5TNXA 3ZWBA 2VAPA 3GV0A 4O4LA 3AI3A 2A2ZA 3CEPB 3NHLA 3OO1A 4GM1A 4EY8A 5T7BA 1B0UA 1L4YA 3ONWA 3L6RA 5EKDA 5LOVA 2ISQA 4U7GA 1QO7A 1E7MA 4HNAB 4MRRA 3D8TA 5TARA 4HDOB 3AR5A 2AFHE 3GF4A 3SBOA 4GXRA 2Y93A 4JHXA 4EPRA 4RFSB 1R6UA 2V3WA 1A7JA 1G17A 5JASA 2RHTA 1MV8A 4TRRA 1KMQA 1ZD9A 2GLXA 3NW9A 1OLUA 2TSYB 2OCBA 4J7CA 4PNHA 5JADA 1PGJA 2P0EA 2QMYA 2XZTA 3WQBA 2VUUA 1F2TB 3EVNA 1AO0A 2XBMA 4IFTA 2LDXA 4TTQA 1NYRA 1CR6A 3TAUA 1N32B 1NNSA 3T0GA 4L5IA 4RIIA 1DADA 3O93A 4QICA 4LXIA 1H2HA 3N7UA 1JQKA 1KEVA 1UK6A 4XUDA 5JS7A 2O8BA 5GINE 3NUQA 4HXEB 1SVIA 4K9OA 4B3DA 1SEVA 4KIGA 3LDUA 2JIMA 2HZ7A 3Q6MA 5LZ8A 3RC1A 1PR3A 1N3IA 4CQLA 2W83A 2XNKA 3DF7A 1GNQA 1SAYA 4DR4B 3DNFA 5KNCA 2BGTA 3DVAB 5TGDA 3ZIAD 1JBQA 3M6FA 4EY7A 4JKIA 4MGYR 4CIAA 2W6QA 4LYEA 2P9EA 2QI9C 4PYRA 2FPLA 5ES3A 1BCSB 1C2TA 3QHPA 1XMVA 4DA9A 3C6KA 2JBAB 3FN4A 5EGNA 4FHEA 1M33A 4MI1A 3QZUA 4EECA 1WE2A 2WWHA 3AO0B 3AKCA 3IO5A 1M7BA 4JB3A 4P7FA 1DJLA 1GZ3A 3GDFA 1QHGA 2VDVE 4P1ZA 1NIPA 1C9YA 1H0SA 1W87A 1MW1A 2WZQA 5JVDA 1IVNA 3K30A 3HGQA 1NUQA 1U2TA 3NVDA 5ECDA 4DLRA 1ZH2A 2E3JA 2PYZA 2FXIA 3TZ6A 4WT7A 3TS1A 3LIPA 3E3MA 1L5HA 1QWSA 1J5EB 1PJLA 4CV2A 2A9JA 2JCVA 5FBLB 1SOWA 2QL6A 1J7KA 2JAOA 2I9KA 2PA0A 1BDMA 4LXUA 3RU2A 4W9MC 5K0SA 3MFQA 4JU8A 4HF7A 1KWGA 1VQ1A 2XXJA 1VGRA 3WDKA 2C4UA 2V4MA 5IAKA 1TA9A 1RLMA 3FPEA 2ZE8A 3NHZA 1XTJA 4E13A 2XCTB 3I34X 2HDNB 1PL7A 2DPLA 2X8AA 1BQEA 4NVRA 2Z9BA 2F1KA 3KQHA 3OA0A 5AVRA 2VUHB 1OH8A 4QQKA 5G2OA 4HH0A 3AI7A 4KLRA 2A67A 1JU9A 1PZXA 2M1ZA 4GKVA 1F3OA 4OHXA 5EHZA 2O2SA 4IHJF 3RWMB 4GU5A 2ECPA 3PRKE 1T36B 4B0OA 4PSVA 1M66A 5JVDF 1RWBA 1U2DC 4QQNA 2FSHA 1AS2A 5ICEA 3SYNA 1M1NB 2BFBB 1TRHA 3IAXA 2RGAA 3C43A 1E2KA 4UUNA 3R3SA 1GARA 3L93A 1N75A 2C03A 1MN6A 2QL5A 3E7FA 1RJGA 4RSHA 1P8AA 1UBEA 4GX1A 4DZZA 2Q41A 5EGSA 4G26A 5E9AA 3SHTA 2F9LA 3WLMA 5KC8A 2F55A 2D7CA 2DE0X 3U56A 4IGAA 2YYSA 4H08A 4P86A 1R9GA 4F6RB 3C8UA 1BU8A 1U90A 5EI5A 3TSOA 4UHDA 2XZOA 5CYGA 721PA 3TLGA 3K9BA 2V45A 1UP6A 3OBBA 5DISB 3RQIA 5CD1A 3V8BA 1OH7A 4B33A 3VSCA 4RV5A 4BWGA 1HPLA 1VYVA 2IYNA 4ZEMA 3R7AA 5D6NA 4JBXA 3VH1A 4ZAGA 3JWJA 3U31A 4Q01A 2H57A 3L7LA 4OH1A 2VEOA 3ZY4A 4PLWA 4TYMA 2F00A 1OBVA 1V8OA 1ZYUA 2I2CA 3G7UA 4JWKA 1SXJE 1N2CA 1YS1X 4YASA 5SY6A 5A3SA 4H4CA 4RHXA 1E96A 2I2BA 4IIUA 4OB7A 4Q00A 4Q6WA 4QPJC 3UCXA 3TAHA 4Y6PA 4RFLA 1QVZA 1Y3HA 2YZKA 3KTDA 3TVTA 1M6VB 2Q5CA 1KDYA 4HTFB 3ZJTA 3KFVA 1NYTA 1MPXA 3IELA 2X58A 3RAEC 4IM7A 3HJFA 3R7FA 1GKLA 3F4BA 3NBMA 1NJ6A 2X8WA 1A88A 2Z2ZA 2HIHA 2QOEA 4EA6A 3WA7A 3ZHTA 4OAPA 4LGYA 3O4VA 3R3YA 2X6QA 1Q1BA 2PJUA 4DMHA 5AM3A 4JP8A 3RC7A 4JI5B 4PLCA 2BUCA 1F6BA 2NNLD 4W8HA 4ESHA 4TYPA 2VDLB 5JNTA 4BO7A 4HDNA 1XDUA 3BA1A 3CPJB 4CVNA 1Z13A 3TIGA 3ETCA 1ESCA 4IH9A 4QPEA 3DEFA 4OJTA 4QSHA 3RWOA 2V3VA 4CV1A 2BP7A 3AUJB 3HCDA 4MK4A 1YZUA 3BBPA 4GI7A 2AR0A 3AT1A 1VXRA 2G9RA 5ANRB 2P27A 3TZLA 1GWNA 3F47A 1XBTA 8LDHA 3KSBC 2B25A 2QTCA 1ESEA 1PCXA 4LZJA 1QG2A 4M55A 1MENA 5LXTA 1W1WA 4AMVA 1EA5A 2FWAA 1TUEA 1W30A 4XNBA 2QSJA 4GYKA 5FNVF 2VHVA 4YLEA 3HXKA 3X1ZA 1GR1A 4FLSA 1VCIA 3EE6A 1M83A 1U8EA 1QXSA 1U0TA 1YJ5A 3BIWA 3G59A 4NICA 1ACJA 1XK6A 5U1PA 4DV3B 4KRYA 3EAQA 2CL5A 4O0MA 1OAOC 3BFKA 1Z5WA 2NSDA 1FDOA 3CRRA 2DQYA 3U4IA 5AW4A 1EFVB 1RXEA 5L45A 1SC6A 4PLZA 2AI1A 1KWKA 3MJEA 4IKOA 1AKQA 4HAUA 1U5BB 1UWLA 5JS6A 3D7RA 2Y1FA 4L4UA 4IDFA 3TM5A 1MIOB 4H3SA 4BLUA 1P3Y1 3S8EA 3S81A 1NPDA 4W63A 4XAQA 2HHHB 2JGJA 2WLSA 3M1LA 3KKMA 1YI8A 3I5AA 4PTLA 1OZAA 1FTWA 2C82A 3DEYX 3LOPA 4IIXA 4MWZA 3TIVA 3E7DA 3UCEA 4BYMA 2CYBA 4U7WA 3AFIA 5KTMA 2JI7A 4QU5A 4AR1A 4BCDA 3O90A 1KTVA 4D2IA 3RC8A 1OXVA 4UEWA 1Z8FA 3LCVB 3GA7A 4XNDA 4JGBA 4Q4HB 3RPEA 4F5WA 4WXRA 3O3OB 3H0KA 3E0XA 4R83A 4P32A 2R70A 1LX7A 4WKBA 3WGTA 1FK8A 4F4FA 3HU3A 4RGVA 4AJLA 5KC9A 3WZMA 1VGQA 5JZ9A 5BRNA 1ISGA 1T1JA 2YXPX 3PIIA 2J9GA 4WSOA 2QLFA 5AHXA 4ACAA 2AW5A 5C1OA 3CF4G 1DOZA 2P3QA 2IU3A 4E4YA 2PE5A 2NUAA 5EZYB 3BZWA 1NXVA 4ISCA 3MEQA 1T8YA 2GPWA 1JBKA 2BGMA 1D07A 3FFBA 4QPNA 3UUWA 1HRDA 3W4JA 5LL6P 3N7AA 3GB9A 2PS0A 5K05A 3COVA 1N2IA 2PUSA 2VJLA 1FXWA 1SD2A 3U7QB 4O1IA 4WD3A 1FBTA 5LUBA 3VOAA 3TRHA 5FNZA 1NDUA 3RV3A 1PQPA 5AK6A 3HUTA 3BRQA 1P5ZB 2DUNA 2OCLA 4RS4A 2VPYA 3QLVC 2P3OA 3LQYA 3O31A 2XD9A 3QOXA 2YZNA 3VMMA 3VSAA 1Z74A 1G20A 1GN8A 1ECJA 2GEBA 1M75A 2XVZA 4BVLA 2ZM6B 1M76A 3L9WA 3CVXA 1XEFA 3QE2A 1ISJA 4PIPA 4PW0A 4TMFA 4U9IS 3P5SA 2HUNA 1EQAA 1O03A 4MV7A 3D4NA 1FLAA 3AF5A 3G0OA 5CFZA 1JHZA 2G67A 3P7MA 1T3GA 4AJIA 3ZCQA 4EO7A 4Z4HA 1J0BA 4AROA 3NIFB 1BHO1 3FMPB 3S55A 4CKCA 1X7DA 3CHQA 2HBYA 2J0UA 1WW2A 4GP9A 2PL9A 3EBHA 4B87A 4ZI7B 4N9WA 4W5NA 2VKQA 3BAFA 4DR3B 3CZEA 1J2YA 1J1IA 2PX5A 4UOEA 3N8DA 2ZSKA 3M1AA 4P54A 2GXAA 4XYLA 3RJTA 1EVQA 3R0XA 4O4HF 5B58C 3OKPA 3VAAA 1GUFA 2W43A 5K8LA 2EG9A 3JQFC 3MFYA 1IM2A 4TZTA 2IF2A 2UYYA 4JX9A 1OI3A 1CT9A 3ZPXA 5LMCA 2V03A 3THRA 4DIOA 2D8MA 3FTNA 4Z3OA 1WPGA 4DEYA 2X9GA 2JGEA 4JGGA 1YONA 1MOSA 4KAXA 1SC5A 3WLAA 1YZYA 2EARA 1VE7A 3BQNB 3NONA 3ZEAA 1EGQA 4BVGA 1JMKC 1AHIA 3ETDA 1E9CA 2PQ6A 5J40A 4CW7A 3TXXA 1AKRA 5ALOA 1TIPA 4Z9AA 1WAMA 4GOOD 5AVKA 4DIKA 4NOJA 1PR1A 2WTXA 1DC4A 3FPAA 3LX8A 3LFHA 2JFNA 3GGCA 1N5DA 4YRTA 1XAJA 1SOVA 1M67A 2GX6A 4L8WB 5EJIA 1FP4B 2FPPA 4K6CA 4TN1A 3ICPA 4D56A 1L3IA 1NKVA 1FBNA 1RHQA 3X1KA 5J2TB 4KQMA 3JSZA 1VYTA 2K7FA 4B40A 5CA0F 2HIAA 1YCHA 1N5IA 5ALPA 4OBXA 2F43B 3WLFA 3DO6A 3AEXA 3MGCA 1WXQA 4MW6A 2OCYC 4UTRA 1UKAA 3C6XA 1CUWA 3DV0A 5JJBA 3UA4A 1B23P 5AM5A 4OQNA 1NLYA 3IEIA 3FUDA 1Z2AA 3KJIA 4HX9A 5DNDA 5KX5A 1XXHA 2CLKB 4MGZR 1VHDA 1QHFA 4BV2A 3OEWA 5C52B 4KRXA 1CB7A 2HCJB 4ZOLB 1DFHA 2A0KA 1LS1A 2RH8A 4TKZA 3WLLA 4HAOA 3GJ3A 4D79A 1YCGA 2C2OA 4U8GA 4K6HA 5EEGA 3U16A 3NVKI 1P80A 1WABA 1YBAA 1YQEA 2Q3MA 3B78A 4YUAA 2I91A 3CTMA 2H2WA 1DQNA 3ZWPA 3BGIA 3NO4A 3U0BA 4BFXA 4TMTA 4IIGA 1MX5A 2XHEA 3UENA 1ZK3A 3U80A 2QIPA 2A5GA 5MGBA 4I1UA 4W5HA 4E5VA 4ALKA 3DR3A 4PZ9A 4JQZA 3R74A 4X3PA 4GC9A 4E08A 5EPOA 2I76A 4HH3C 4IXNA 2CCKA 3TPCA 3MYRA 2CWDA 1MDBA 1WSWA 3GZ4A 2BRUA 4UM7A 1MZVA 2EFGA 5B2ZA 2IUUA 4PG6A 3TL2A 2XQJA 3A2NA 2D13A 4OQMA 3VDQA 1L8AA 4WESA 2WWWA 4OIFA 3SNKA 1X19A 2W48A 2X86A 3WO0A 1RWOA 4TKUB 4TTVA 3TZBA 4RV4A 4GR5A 2ZJ6A 3BDAA 1MQ9A 1NRJB 3OZWA 1AS0A 3CUKA 3DAGA 5ALFA 2F8MA 2JPDA 2BT4A 4R2JA 1YVUA 3MBIA 4ND3A 1YDFA 2JCXA 1DBQA 1KKUA 3HYRA 3LNCA 1V9LA 2J9XB 1QYDA 4Y2VA 5FFMA 4ZZ2A 3RTDA 2XTJA 3SDBA 2QRVB 4ISBA 4U9UA 3W6UA 3IMFA 4PAOA 3NM4A 2R48A 3T5DA 2P4SA 2CXRA 1SOAA 2P2DA 4LMAA 1LSUA 4RCVA 5D00A 4PYKA 4EJMA 2ANCA 1KZ6A 1DQRA 2XTZA 4URWR 1U1IA 4NQRA 4A6EA 2JLCA 5LZ9A 1J8DA 2WD8A 1QX4A 3VR4D 3A6KA 3F90A 1M8FA 4E22A 3AVYA 4MS6A 1DT3A 4MV0A 5F9MA 3ND8A 5ALVA 1VHQA 1X1BA 4H7PA 4FSDA 3QTLA 2F3SA 1T35A 5FX2A 2E87A 2ADMA 1X2EA 3B6KA 1SH7A 4R3NA 3PB3A 3ZTTA 1K7SN 4UUBA 3DGEC 4D82A 1IZ8A 4KQJA 3FUEA 1GKUB 2AD5A 3HG7A 2NM0A 2DPGA 2GJ4A 3KKOA 1VSQA 1DAEA 1IEVA 1ZMXA 1V0JA 2C1XA 2C2GA 2DQZA 3ZHXA 2PD4A 3NWEA 5FWQA 5HA5A 3T9CA 1X7ZB 2QVBA 2YHIB 1JAYA 2BSAA 3BHIA 5K0BA 1B2LA 4MICA 3DP9A 2IZ0A 3Q15C 1K7XB 1G5AA 1CFJA 1V95A 1FQJA 3IKJA 1IY8A 3N59A 4XN2A 4G1EB 2ZUSA 3BWMA 4LC1A 3OURA 5IWCA 3O7WA 3CF4A 3STUA 1KEKA 4PFJA 2WHPB 4Y6LA 1B42A 1VHTA 4I4TF 1Z22A 1RJEA 4FW8A 1HNZB 3NNDA 3ROZA 3PSAA 2UU9B 3WB0A 4ZYWA 4C7BA 3JRXA 5E8RA 4IF4A 3LBNA 2OD2A 3R6WA 3E3AA 3HB0A 2H92A 1OZ0A 2NTNA 1GIAA 1R00A 2JIDA 1IOVA 2QTVA 1RXVA 3L7AA 4BQIA 1M6WA 2BN4A 3D8NA 4HZIA 3FUCA 3RT1A 3RHSA 1T5DX 5M34A 1P1HA 4O25A 3HKDA 4MOWA 3U1BA 3WAJA 4REOA 3OFKA 4RD1A 1AQNA 3HFJA 3BSFA 4JJKA 5FQNA 2ZE7A 2HMSA 4KPUB 4KSBA 3WL7A 1GL3A 2W2KB 1A4UA 1Z3IX 3IR6A 3ST7A 5EP1A 3TKLA 4YJ3A 1ZMBA 5JNUA 3I05A 4DJAA 1R37A 2XGMA 3KVYA 4HNUA 3KG2A 3JYHA 5FADA 4R16A 1V3TA 1HE5A 4GKBA 3KB8A 4X91A 1V26A 2W2MA 4FMBB 2DR0A 4PAMA 5DHTA 2VHJA 3DDZX 3EIXA 2X7HA 1L9XA 2Q3EA 3RUHA 4BJ5A 4JYZA 4COOA 4AO8A 3RSZA 1M8KA 1H2XA 2C4TA 3PCTA 5CJPA 5B6JA 3RV4A 2ACKA 2ZQYA 4YP0A 4PE5B 5MN4A 1JU4A 2ZU0C 3YASA 5E6UA 5HZHA 1TF5A 2C1EA 4B34A 1NVVQ 4FDLA 4AQYB 4ZCRA 1R6VA 1X8JA 2VYVD 1STOA 1NAIA 5EE0A 4X65B 2ZRNA 5CEEA 4IFEA 4IGEA 1Y7IA 5G1PA 3RVQA 3WP0A 3UJ9A 4EFLA 4B6RA 3QGMA 4ZX3A 2FP4A 1WXHA 1RZVA 4Y7CA 3ROXA 4AS3A 4R9NA 3QUCA 4Q7EA 2ZT6A 4DHEA 3ZQ4A 1OWLA 3FJOA 4F84A 1WUYA 4OTZA 1NQ5A 2PD3A 3ECAA 3GX1A 3K0KA 1BHSA 3BF8A 3Q5EA 3QV1A 4X95A 3H2HA 1GPMA 3AGPA 2P9HA 3JWIA 2UDPA 5D3QA 2VCEA 3MTEA 4RH1A 4AY4A 1ZXXA 2KMLA 3ZWWA 4BNTA 1J5PA 2QHXA 3EXIA 3B7RL 1KI4A 3AP3A 2VBCA 3HPQA 3VZCA 4I46A 5LPNA 4QULA 3VTKA 1UR5A 3EQ6A 4PF1A 5K51A 3U9LA 4A03A 3WIEA 2IIPA 2A8YA 5D5PA 1EWVA 1KMHB 1ZCZA 4IJ6A 4S04A 1UZAA 2OO7A 3ILSA 3BC1A 3K1JA 1Z2PX 4IDOA 1TYAE 2Z4TA 2YBDA 3VFDA 2WSMA 3G1UA 3RFTA 3QVGA 2R6ZA 4FCVA 2QBYA 1ONBA 2CFRA 2I78A 1HYQA 1FLDA 2B78A 3G2KA 3T1TA 1GFWA 1M3SA 3NCTA 1CQIB 1V7CA 3UUEA 4R69A 3G79A 3HABA 5FOTA 3FGZA 1NJFA 5JISA 1KS2A 1I6LA 3EQZA 1AMNA 1XJWA 1W36C 3RTAA 3K6KA 1KU0A 1UBMS 4IX1A 3UV6A 1WMEA 3DFIA 4J0GA 1GAQA 4UMEA 5EINA 4QHSA 3TLCA 1IVYA 1QGED 1LLUA 1Z29A 2R1VB 4IIJB 5EFOA 2F17A 3VBCA 1NN0A 1YJXA 1MD9A 1EZZA 2YYYA 3H1PA 5AM4A 1IEQA 2P9YA 5FPTA 2CDNA 3C41J 1LU9A 4R05A 1G2IA 4FOOA 4AF8A 1T34A 1CBUA 3U3KA 2AOXA 3EIWA 1D4OA 4JJAA 2Q6LA 4W9RA 2ARKA 3U3XA 3VVLA 1XWWA 2DWOA 5DKFA 4FSHA 4DNXA 2BKVA 1ECPA 2ENUA 3TB6A 4UVIA 2DSNA 3NRJA 2W8BA 4IIHA 2GPJA 3DDNA 4DLWA 4G0NA 1QO9A 1R1DA 2EGGA 2ZRIA 1DMSA 4FU0A 1NT4A 1DRJA 2PY6A 3GGOA 2KJQA 3CF6R 3ZIUA 1FLVA 5ELMA 2ZDQA 5L3QB 4ZO4A 3QV2A 1BGVA 1UJ5A 2IGTA 2IXDA 4ZVNA 1QUEA 4I1YA 4EVIA 3C8MA 3UT0A 1H2YA 1RQXA 1MJNA 1OWOA 2JFGA 4TSFA 3C48A 1MT3A 3A4MA 3A27A 3NDBB 1DBIA 4LCJA 3ABRB 1L5LA 2VPTA 2G9NA 1LJLA 1QHIA 2F1OA 3B34A 5LQSA 1KAHA 2AEMA 2OV6A 3WB1A 3PICA 3A28A 4I81A 5BNIA 5LKAA 3M4XA 5AENA 1RJDA 4CCWA 3ZE6A 1R5BA 2W6ID 2HA6A 1X42A 3JTEA 3Q3CA 3CSDA 5AJUA 4PW4A 2AQ8A 4F3YA 2VHYA 3JTMA 2A9FA 1SIWA 3D3WB 3CZRA 4DPRA 2RGCA 2ZI9A 2ZJ1A 3B51X 1M5TA 1E2FA 1MAUA 3BN3A 3GBSA 4R2MA 5FUWA 1QE0A 3RYHA 4QKQA 4LF4B 2J3DA 3FYUA 3GD7A 1U8ZA 4XXHA 1S8FA 3GLHB 1K8QA 2XCLA 1FEZA 1XF9A 2WJZB 4S0ZA 3ZJUA 1TJ4A 3ENNA 1KH1A 1ODIA 2F3TA 2RHWA 3L6DA 1G6OA 5FYQA 5LQJA 2FAXA 2E1PA 2Y8EA 3P27A 3FSGD 4H7KA 4Z4CA 2CXTA 3TIXB 1JPJA 3M4ZA 2QEQA 3CRQA 2FSVA 4L95C 2WD7A 3QNWA 4ASUD 2XQ0A 2YUIA 1E0AA 4B45A 1AM4D 1ZM4A 3H9QA 2XBUA 5BSKA 1JNYA 4Z53A 3SXUB 2FKAA 5FL7D 2YW9A 3MWKA 4CIXA 4XMWA 5HKKD 2BV3A 4GQBA 3CXBA 3HH8A 2VHUA 4IR7A 1T2AA 4ZCSA 1Y9AA 1NASA 3MB8A 5AKLA 2ZRDA 3KLMX 3O3CA 2K87A 1AHHA 2M9MA 2WSSA 1NFRA 1YJ8A 2NAPA 3HWSA 3ND5A 5CLHA 5DOVA 2ILTA 4X61A 1KQGA 3JWPA 3FTYA 2YNMD 4DREA 3SOPA 3OWHA 1Q16A 4MRMB 1K6XA 4DUGD 4CKWB 2EQAA 5FOQA 3KOMA 2IYOA 3VZSA 2VHZA 4HT3B 1W52X 2J41A 2NO5A 4KVAA 3PDUA 3ICOA 4JLWA 1I8TA 4BGVA 5IH3A 5IKMA 1FFCA 2OLEA 3DE1X 3CLSC 3ONFA 4TT3A 4C0KA 1HNNA 2PVSA 3THYA 2NVOA 2CLLB 1VL1A 2WABA 1KY4A 2QRGA 3H2ZA 5ECGC 5KHAA 2ZIEA 3BFJA 3NYRA 5JR3A 3MJDA 3HM2A 2B6NA 1T0IA 4QO7A 4R7ZA 5DGHA 3RTGA 3WYEA 4ZVSA 2J7PD 1J33A 4URUR 4BFYA 2O3JA 3ORSA 3RRZA 3I04M 2EW1A 2DRIA 1UAGA 1J2TA 2XRFA 1B0AA 1CQWA 2PV0A 4MW1A 2O8FB 3FZNA 1YCFA 4OBBA 2D1FA 2PUVA 4FFBB 1MLDA 2OKGA 2C5SA 4JBLA 4YTEA 4O08A 4AJHA 4OX9B 2HUPA 2QMQA 5JBNA 1UMBA 1W88A 2XDQA 3JPYA 1A96A 1MQ8B 1W9HA 2GA9A 1GSOA 1U1CA 3QWFA 4RYLA 4YI5A 3NZEA 1GTG1 4Q1CA 4QC2A 4TXLA 3ELDA 2AVDA 4KQWA 2MSWA 5BW4A 2WIDA 1JG4A 1HOXA 2WMDA 1K7CA 1NR5A 1SB8A 3SJUA 1G16A 4TKVB 3V6LA 1TJNA 2BR5A 1FTYA 4WFJA 3SJZA 1Y0BA 1PWEA 2O20A 5JNVA 5K3EA 1LV7A 3MCZA 1BD3A 3E27A 1ONNA 2H0QA 3OD1A 3QVUA 3UK7A 1RXCA 1DAKA 5ERYA 4WFIA 4LXYA 4TWRA 4AZTA 2J45A 2QLNA 1DI0A 2VJ8A 1FFHA 1JH9A 3FBGA 1ODJA 5CXUA 1L7AA 2ZI6A 1IATA 1K6EA 2WJGA 4Q3CA 3M9WA 4E30A 3T7EA 2C4NA 5PNTA 4NULA 1R6AA 1FMCA 3PPWA 4A7PA 3LLUA 1TPZA 3OZEA 1Z75A 4WUTA 4XMVA 2V5UA 4NBKA 2VPXA 1GDDA 2OKCA 2D2EA 1XMJA 1HDCA 3AK4A 4U2KA 2IPAB 2WF5A 1FMLA 4CLRA 2BFMA 1QFMA 4OHPA 5AVSA 1J2RA 4IUBS 5AK5A 2OV4A 3B8EA 4OY3A 1JG9A 3CEMA 3GJYA 3E9EA 3IOYA 1MOZA 3BJZA 3STWA 2WJ3A 5CFLA 1RWPA 3DOIA 2POQX 2GAIA 4YJHA 3WGQA 3QMWA 5L4LA 3NPMA 4UD2A 3F98A 4IWNA 6Q21A 3WDSA 2AMYA 2ZRPA 4LY3A 4KR6A 3IAAA 1GA4A 2HSWA 4HDRA 3W5BA 1QF7A 1DAPA 4MWSA 2O8CB 4KFSA 1GL6A 2NUTA 1UBSB 3H2IA 3C4VA 5TMDA 3H2KA 3RS5A 4NK4A 4BEVA 3GRCA 1NV9A 2PEYA 2ADOA 3MJSA 2I7XA 3GJQA 2PSJA 5JECA 1SKQA 2QJTA 2X0NA 2I1WA 3I39X 3I37X 3Q2KA 1YD7A 1P0PA 4O3FA 4Z0PA 2J67A 2V3CC 3ESDA 3KZ1E 2YV2A 2QN7A 4B3BA 1FJGB 2XCOA 4CDGA 2BONA 1EP3B 1JEQA 2GYVA 3DMTC 2X1LA 4HB0A 1K06A 2Q5FA 4DE5A 4KIJA 3TMYA 5BN5A 3MMPA 3GLHE 3IXMA 3L0SA 3G1TA 1OY1A 3BYZA 3LP8A 4OL0A 2HA7A 1SA0B 3QF4A 1Z6PA 2WWVD 5GMOA 1Z0SA 3X1YA 3O38A 5A5FA 2PS1A 2NMVA 3DH0A 1MVYA 5K45A 3UWPA 1OZGA 3S8MA 3TQCA 2AFRA 5HOQA 1L5FA 2Z8YA 1J06A 1V11A 5K1ZA 1OIVA 2J5RA 2P5YA 1V8ZA 1RIFA 2ZANA 2D5AA 3Q3VA 4C4PA 4F12A 5KWSA 2ZITA 2VJCA 1M6NA 3AYXB 3Q7IA 4LX0A 1JA9A 1QZUA 2ODTX 4ZEOA 4EAQA 2VJMB 4E03A 1T0UA 1NVAA 1EDOA 3VBEA 3H6KA 3OICA 1ML4A 2C54A 1CY0A 2PZMA 3B37A 1LTHR 2PYIA 3NKFA 3OF3A 4FMPA 4K5QA 2IFTA 4FN4A 2JL1A 4LTMA 1X14A 3CT6A 4A82A 1KO4A 2K7ZA 4C3ZA 2OQVA 1JXMA 1NF8A 1S2NA 2EXXA 1NL3A 4H27A 3A6HA 4H0NA 4QFCA 3OHMA 4M46A 2GT1A 1NQOA 2ZK7A 4H0FA 4LC0A 4F45A 2GCPA 2O2IA 3OZFA 1O6CA 1OBCA 5TVGA 4BBZA 1MB4A 5K09A 5LP1A 5B3AA 4AP9A 3ETLA 3A1FA 3M6WA 1CP3A 1E4OA 2H65A 4XD7A 1JBEA 4YH1A 1J21A 4RPCA 4NAHA 1LI4A 1VL8A 3KOWA 3VDNB 3ZN2A 2QB5A 2WWTA 1FPQA 3CZQA 4PYLA 2PL5A 3KQVA 2B30A 2GHQA 4OSPA 1IBMB 2C9CA 2R72A 2BHNA 4UXHA 1DQPA 2WR8A 1RI2A 5I4KA 5KVCA 4PLHA 3AIOA 4JLMA 4URYR 4HH4A 1W2WB 2CVOA 4DV7B 2HK7A 3AOEC 3W77A 1SU4A 3HV0A 4MZDA 3WKAA 4BN5A 2RHJA 5JYCA 4IXDA 4GWKA 2BEUB 1JAHA 4GBED 3RHZA 1DX4A 3OTGA 2B36A 3U09A 3GEGA 2XI4A 2YOHA 2PPLA 4LHEA 3K6SA 3I12A 1MBZA 1T5BA 3VNUA 2QTLA 2QKYA 3DOUA 3LF1A 3OU7A 5CB4B 1RJ9A 1LQTA 4PONA 1JHXA 2B8NA 4MYHA 4O2BB 3RUAA 4CPDA 2H1FA 4H6XA 2NAFA 4QOFA 4D0RA 2ZBFA 2C92A 1DWQA 1NW6A 3O8OB 3L7BA 4TXNA 2X0FA 5CJJA 4EY5A 5CEJA 3C0KA 4Z7QB 3WDMA 5KDDA 3LXXA 3T5AA 5JJKA 2DLNA 1CNMA 2FX5A 3CIAA 1XB2A 3C7DB 2V1UA 5IABA 1Y3BE 3M3PA 3I61A 5EZQA 2PIAA 2A84A 4UFNA 3FZGA 1AQYA 2BHLA 3V1KA 4WZBB 2WYUA 2ZYTX 3S44A 4UW9A 1FPMA 1J2EA 5H9WA 4HGZA 4B09A 2MJLA 4LWPA 5DE3A 4AT1A 4ILKA 4ENVA 5FHQA 3F8WA 4FQ7A 3Q8KA 3QJXA 3HY4A 2H4HA 3BQMB 2LP4Y 4NOLA 4OKNA 4BNUA 3QENA 2PA3A 4GKJB 5JTTA 3I8XA 5CJ2A 3R9WA 3T3NA 2J3LA 5FEMA 1U8YA 1UWKA 2FK7A 2E5WA 4D9NA 5B6PA 4NXMB 3FZQA 2Y6VA 4XWWA 2ZIXB 2B69A 2W22A 2WT4A 5SY9A 5KREA 1O7JA 2J07A 3HCNA 2CY0A 3L06A 5EMJA 5I7HA 3MMXA 1LF0A 2NW6A 2RKBA 4MW4A 2PRSA 3FNFA 3BJEA 5IM5A 1AT1A 2BY4A 3BMOB 4GP7A 4I50F 4D4LA 1NZFA 1WWKA 3MC1A 5BN3A 1A8HA 1RE0A 2FV8A 1LLFA 3HR7A 2I87A 4AN0A 2DHQA 1D09A 1JQ3A 1XJCA 2RBEA 3JQAD 4J1TC 3W1WA 3BWXA 4LJ7A 3TINA 3PFKA 4XM2A 4J4BA 4OHRA 5GOTA 2H2DA 1EM8A 2ECKA 4AXXA 3IDOA 5L3VA 3I9FA 4P7GA 3ESQA 5JPDA 3ZR4B 2ZVPX 5TLSA 3MJTA 3HW2A 4JB2A 5EHNA 3IQDB 3TXYA 1O97D 1C2YA 2IE0A 3FZYA 5CT6A 4CMJA 5M04A 4XIFA 2QXYA 3DB1A 4KXFB 1GP2A 1Y5NA 3PXBA 3OZDA 4UE3S 1L5QA 5IT4A 2IEBA 3HYLA 4L0CA 1K7EB 4DL9A 1M1YA 4F71A 3JV7A 4MCIA 1TT5A 2