4ZQFA

Crystal structure of dox-p reductoisomerase fosmidomycin and magnesium
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
408
structure length
402
Chain Sequence
LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFHPVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAIVGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDSEHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNASVKEAVMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIHPNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQLGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKICLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAKIKLLKQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
rcsb
source organism Moraxella catarrhalis
total genus 147
structure length 402
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zqfA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zqfA01
2EERA 1E1MA 1BVUA 1A27A 4BNWA 3ADOA 4AJLA 5FI3A 3AM3A 2BFOA 3IUSA 1KS9A 2DC1A 1LRLA 3JCZA 3ASVA 4GAEA 2GN9A 2O3QA 3EZLA 4FJ2A 5I7SA 3U4IA 4M55A 2Q49A 4ND4A 4XYBA 3AFNA 1D7OA 3M6IA 4FSHA 2UUOA 1R0LA 2WYVA 1B7GO 1EQ2A 1P45A 5KJCA 3DONA 4HFRA 2D5AA 2VHZA 4I08A 3TJRA 4BNNA 4XGIA 4R9SA 1E1KA 1HDZA 4ALIA 1WDMA 5JDCC 1YJ8A 1Y7TA 2DBQA 1N92A 3R1IA 3TOZA 1FDUA 1ZEJA 1CERA 1H9BA 1PEDA 1LX6A 3PJDA 4OQYA 3RJ9A 3RROA 2I67A 4PLTA 4F46A 1E3SA 1C0KA 4MIOA 3WOHA 5KKCA 2WE8A 1R4MA 2A4KA 2Z95A 3MWDB 4WLVA 5G0VA 4K1LA 1EQUA 1KVUA 3WMXA 4Z0PA 1TT5A 4MINA 2VHYA 3M1LA 3F47A 2D3TA 1ZCJA 4P4NA 4XQEA 3ZWBA 1QV6A 1E7RA 2VHVA 5EQFA 4B4VA 3HNPA 4FN4A 4BGUA 5DT9A 2FPPA 1LNQA 3JQFA 5EJ2A 1MC4A 3IIEA 2CFCA 1Y8QA 5A9SA 1ZSVA 4ITUA 3OFSA 3OHSX 2HUNA 3PFFA 4NQWA 5I8WA 1KY5A 2HO5A 3HADA 4IZIA 4WLEA 4DMLA 1ISJA 1A7KA 4CM4A 4UEKA 4XEHA 3AY6A 3EAGA 3UGKA 4DIFA 1LEHA 4EJMA 5JAMA 1ZK1A 3K9QO 4EW6A 1X7HA 3JD1A 1WPQA 1NBOA 4TSKA 4AJ1A 2QQ5A 1LC3A 4PLGA 1DAOA 4BO6A 3DBVO 4R1UA 4OL9A 2NNLD 4Z9XA 2SCUA 4D0RA 2HCTA 1SC6A 3I9KA 3PTZA 1TXGA 3L77A 2ZYGA 3I9MA 2GZ3A 3I9LA 1X14A 4Q3BA 3RUCA 2Q3EA 1U1IA 2IZ1A 2IE0A 1FK8A 4MJLA 3RBZA 2WSBA 4XQGA 1IHYA 5K0ZA 2V65A 4CUJA 4B79A 2Y99A 3NTRA 3DHNA 3W4KA 4E32A 4CL8A 1UP4A 4E6PA 1IULA 3E03A 3NTOA 3ZWWA 1DBVO 1TVEA 4BNJA 4BV8A 3WG9A 3VZSA 3O4RA 2Y1EA 3LT1A 4LUPA 3F46A 1Y9AA 3GNQA 2OOSA 4Q9NA 2YJZA 3JQEA 2VYVD 4CLOB 3G3EA 3LT4A 5L53A 1KEUA 3D1LA 3JQAB 4RVDA 4I9NA 3ANLA 2J8ZA 4IIUA 3ZW8A 4IINA 4N54A 4PRLA 3C7DB 5A5EA 1Y5RA 2C7VA 2EP7A 1U4SA 3PWKA 3R3JA 4TRRA 5AXAA 3SC4A 2PTGA 4O63O 1E77A 4CQMA 2B4RO 5H81A 4TRNA 4B4WA 4CLHA 3T4XA 1XEAA 1N9GA 3P2YA 5JAZA 1GEGA 4LVUA 1V3TA 3HN2A 3FHLA 2DVMA 1EDZA 4OSOA 1YONA 3PQEA 4II3A 1PJSA 3UCFA 4NU5A 1M66A 3GH3A 1JW9B 1YS4A 3KLMX 1C3VA 3GNTA 1LA2A 4E2XA 3VPFA 3ITKA 1YQGA 2VN8A 4FJ1A 4IMRA 3NTQA 1T25A 3P2OA 1V35A 3ZU5A 4OM8A 1EVIA 3DB2A 3JQFC 4X54A 1U8XX 3U49A 4BO3A 1E7YA 1ZMTA 4UVIA 2HRZA 1GFSA 2VQ3A 3P5SA 2Q1TA 4MVJF 3CZGA 4EUFA 1EVYA 1LDBA 2WDZA 2OHXA 3DAPA 4D3DA 3VPGA 1I5RA 3NT4A 4F6CA 1BSVA 3IP3A 4IPTA 1R15A 3GDFA 5G4LA 2YHIA 4LCEA 4FC6A 1T24A 3I23A 3Q0EA 2AE2A 3E1KA 3KYDB 1TT7A 3WGIA 3ZDFA 2C5AA 3M1AA 1ARZA 3BTSA 4CUKA 1PWXA 3PHIA 3BMQA 1X0VA 3H7AA 2RH4A 4FPXA 3PWSA 3SBOA 5ILOA 4FFOA 3QWHA 3B1JA 2FRDA 2C29D 4C4OA 5KVCA 2GF2A 1ZBQA 1C14A 3NGLA 1RWBA 1WMBA 4JJFA 5L4LA 4KUEA 1W4ZA 2OO5A 5JAQA 4OGWA 5THKA 3A14A 4RPHA 4S3MA 4EYEA 4IDGA 5EL0A 2DBRA 3GGPA 1C1DB 2YHUA 5DCUA 4QFDA 3CTMA 4A73A 3ETEA 3U62A 3WGZA 4E21A 5K6AC 5ER6A 5DP1A 2BFAA 3KRTA 3KXDA 5DCYA 1SOWA 2PH3A 4M49A 5IXYA 1MW1A 1R37A 4WNCA 5C7IO 4KTTE 3ITDA 1H0KA 3G17A 1PJBA 3KETA 4DUPA 3DZKA 4CXFA 3I6QA 3TQHA 1XQ6A 3QA9A 4BNUA 4CV0A 3HE3A 2Y66A 2P68A 4AL4A 4Q3CA 4UULA 5ICMA 4PG6A 4D42A 1SBYA 1AXEA 1PTJA 3JYNA 3U9LA 2O23A 5A4DA 4UAGA 2VZ8A 3MTGA 1H5QA 1P0FA 1JKFA 4QECA 5HA5A 4RVGA 2A9FA 3CMMA 4RF3A 3ROMA 5JMPA 2ZYAA 1NPTO 4KQWA 1YL6A 4B3JA 3VDQA 1YDEA 3EDMA 2RAFA 3JYQA 1X1EA 2P9CA 3EYWA 2FMUA 3V2GA 4LGVA 1ZUD1 1N7HA 1NPYA 3AU9A 2G82A 3GNSA 1Z7BA 1C0PA 2ZB7A 2R2GA 4B4OA 1KEWA 4AJEA 1YB4A 3F6YA 1B8PA 4MP3A 3JD4A 3S8MA 2VYVA 4UVGA 2Q2QA 3WQRA 4BB6A 3TOXA 1QSGA 1SC5A 1Q1NA 1H3LA 4OKIA 1U3VA 4PLVA 1R16A 5H83A 4Q39A 3CSDA 1YB1A 4HX5A 1PJ3A 4G81A 4PG7A 5COAA 1GADO 3COSA 2PZKA 4GLLA 1Q0LA 3R3SA 3AUUA 3VH2A 2ILTA 1MC5A 2AXQA 1PJ2A 4ZQFA 3ONEA 3QSGA 4IJUA 2O48X 3UEQA 3TZQA 2VNAA 3X2FA 3ANNA 5G0WA 3KEOA 4A7PA 3GN1A 5DBIA 3UCQA 4PZCA 5TT1A 5JYDA 3ZNNA 2EGHA 2PFGA 2XPCA 3AUSA 4H16A 5FI5A 3ULKA 3JQ9A 5AXCA 2WTBA 2PZLA 2D5CA 4WKGA 2X5JO 2GCGA 3DEYX 3GN2A 3D7LA 2EIHA 5COQA 3RD5A 1R4MB 1BGVA 1Z45A 4XDYA 4GGPA 1YBVA 5CHEA 1LJ8A 1JA9A 1I36A 5FFFA 4EEXA 1SAYA 5BSFA 2LDBA 3N58A 3TFQA 1YQXA 5KWEA 1YOVB 1RP3A 2I76A 1NFQA 1SMKA 1HDOA 3DMTA 1JAXA 3PYMA 4MPDA 3UW3A 4I5DA 4W6ZA 5G4KA 1YWGO 3IC5A 3GHYA 3GQVA 4BO5A 1NFFA 1LI4A 3HDQA 4CMIA 5B12A 1UXHA 3I9JA 1EEHA 4RL6A 1JU9A 2E82A 1VJ1A 3CMCO 4L8VA 1H93A 3DZJA 2AEFA 4N5MA 4UEJA 4DTIA 1KY4A 4Y98A 1HRDA 4YB8A 5IDQA 4RVHA 5GZ1A 3JTMA 3KM0A 4WEOA 4R4JA 2VT3A 3DL2A 3V2UA 3C8MA 2Y0EA 3H5NA 3TL3A 4I5GA 5CP8A 4FD3A 4IDBA 3G1UA 4IMPA 3JQGA 5EQDA 1B8VA 5DOVA 5L9AA 1VC2A 4ALMA 1NXQA 5IJZA 3D4PA 3DZGA 1E7QA 1XWFA 2ZQYA 4PG4A 1LDYA 4E4YA 4UUPA 4FFLA 4OXKA 1ISGA 3UKOA 3ZU2A 1YE3A 5BQFA 3X2EA 3JD0A 2X58A 3DTYA 2ZCUA 1H6CA 4XQ9A 4HV4A 3E5RA 4ID9A 4J16A 2B4TO 3FNGA 3I52A 5TJHA 3S55A 1GZ4A 3ZHXA 1BHSA 3WGTA 3RCBA 1D4FA 4IIVA 3GZ4A 2HKIA 3MTJA 2UDPA 1ZXBA 1OBFO 4GX2A 1HSOA 2JFGA 4ZU3A 1HDCA 4ESOA 4R1SA 4RPLA 4NR0A 1VM6A 2FOIA 3AM4A 4GVXA 1I3MA 3QHAA 2CVOA 4QUKA 4CQMB 1T2CA 4YRDA 1ZFNA 5IF3A 1N9GB 3GEDA 4BL5A 2GN8A 2GD1O 1O94A 2VHXA 2CVZA 3ZU3A 3W6UA 4YAIA 1ONNA 3AU8A 1PJQA 5IXSA 3GVCA 1MXHA 2FSVA 2QW8A 4Z3KA 4FS3A 4ZQEA 1VPDA 4GH5A 4D45A 1PU2A 4NIMA 1NVMB 4WPGA 1NWHA 3DMTC 4XYMA 3PIIA 3CKYA 4CMBA 3EHEA 1QYXA 3ZHBA 3JQ6A 1NQAO 3GFGA 2I5PO 4IDDA 5IG2A 1WDKA 1YJQA 4B7UA 3LDHA 5JY1A 2Y1DA 4KOAA 2CMDA 3E48A 4ND2A 4L4XA 3FN4A 3BMCA 4UVDA 4WCFB 2YHIB 2AMFA 4CLDA 4OAQA 5L7TA 3LLSA 4YJDA 5EINA 1D1SA 2GZ1A 4JBHA 5TC4A 3DC2A 3OJOA 3S2GA 4P4LA 3GOHA 1VKNA 5KIAA 1KVRA 3BMQB 5CEJA 3MWEB 1QRRA 4PIVA 3ORFA 4RO0A 3H65A 1LQUA 2Q1SA 1OZAA 5F5LA 1GQYA 1YL5A 3MJTA 1ONPA 4M8SA 5LCXA 3U09A 3PZBA 4XRRA 3GAFA 3NT5A 1RPNA 4A0SA 4XB1A 5CDYA 3DZBA 4MKRA 1HLPA 2HK9A 3JQ8A 1E1NA 2BFMA 4NK5A 4R5HA 3PDUA 5A06A 1CF2O 1UXKA 4GX0A 5TSDA 1YBMA 2XXJA 3W6ZA 3RFVA 2GN6A 4LISA 2BGMA 2E37A 1VL8A 4B3HA 2YUTA 4AJKA 2Y1FA 4A26A 3UH1A 3KOUA 4CMEC 3GT0A 2GYYA 5KKAA 2EKLA 5CPBA 4MP8A 1HDGO 4DPKA 2NUAA 2ZB3A 1ENZA 4MKZA 4ZQBA 2HJSA 3EGOA 3F1KA 3WBBA 1NFRA 4YJGA 3DTTA 4IGFA 1M67A 4ZN6A 4PN3A 2HRBA 3GMSA 4LN1A 4DC0A 1ZO8A 2JCXA 6ADHA 3W8EA 4CM6A 3UXYA 5JW6A 2ZK7A 4GI2A 3VKUA 4M89A 3W1VA 2Q4EA 1JG9A 1DAPA 4MKXA 3PLRA 1E7SA 4DQXA 1H2BA 4HFJA 5KJFA 3FRJA 5KVVA 4HUJA 3AI1A 1EBFA 2EW2A 3M2PA 1E3EA 4UVHA 1R4NA 3C1TA 3A28A 2O3JA 4EJ0A 5T6BA 1NHGA 2JHGA 4IDFA 1MG5A 1X13A 4NFSA 4GKBA 4CODB 4IQ0A 4BGEA 2JFFA 2VWHA 4DA9A 2Y05A 1R12A 4NBTA 1ZJZA 5JY6A 8LDHA 2ZKLA 2VZ0A 5IZ4A 3PQDA 1CQJA 3DWFA 3GEGA 3BTVA 4INAA 4N7RA 3GA0A 5TF4A 3RUFA 4CPDA 4ALKA 4JJGA 4YAEA 2O4CA 3PJFA 2AW5A 4CR8A 1Y8RA 3DBHA 2EHDA 1RYEA 4URFA 5HS4A 1ZVMA 4J0EA 4RF2A 3FTNA 4R5MA 1X15A 3A06A 1H6DA 3NDIA 2PA3A 2G5CA 2Q1UA 4BMNA 1P31A 2PD3A 3MOIA 1U5CA 3WYCA 5A02A 3V1UA 1Z74A 1N1GA 1MXFA 3D4OA 2JFHA 4J3FA 1Q7GA 1QYDA 1KBZA 2QZ9A 1PSDA 1DFHA 1E3JA 2O3SA 3BHJA 1ZIDA 2GN4A 4IXTA 5ADHA 3RFTA 4TRJA 4NFYA 2EF1A 2EGGA 1HSZA 2DFVA 4BKQA 5TS3A 3F5QA 2R00C 1ZMOA 3U3XA 4DGSA 2DPHA 3ZV4A 3FWZA 4CMIB 5T8KC 2PLAA 5JDIC 4Y67A 1NX6A 2I65A 4MIEA 2O3UA 4JBIA 1MUUA 1IYZA 1B2LA 3VH4A 1LLCA 2EEZA 3ETDA 3WB9A 1DXYA 4FLSA 3AUTA 1O6ZA 4EUEA 4PLPA 3KUXA 4KQXA 5T67A 3D3EA 3RAJA 2TMGA 4DRYA 5BNTA 3TSCA 1EFLA 1P1KA 2VUUA 2C0CA 4BNMA 1AXGA 9LDTA 2FN7A 1PJCA 1EFKA 3CH6A 1GAEO 1NVTA 5CDGA 4LRTB 2ZB4A 3OJEA 4W7IA 2AHRA 4NU6A 1U7HA 2BHLA 4CMJA 1UAGA 2O7SA 1HE5A 1EZ4A 1U4OA 2JCVA 1DDOA 3WR5A 4U7WA 4BNVA 2VWPA 4DC1A 3R0IA 1NAHA 3BAZA 1FDSA 2B37A 4JXKA 5CFZA 1ZK4A 2NVWA 2Z5LA 3VPHA 4H3VA 1RJWA 2G76A 4YJHA 2NM0A 2C59A 2NVUA 2NU8A 2BRUA 2R6JA 5JE8A 2PGJA 3C1OA 5HTOA 3E9NA 1PGJA 5TLSA 2ZQZA 3PHLA 3VC7A 4KZPA 1O89A 3RBXA 3K31A 3RKUA 5U4QA 3PXXA 3RC2A 4P8RA 4RPKA 4WJZA 2X9VA 4CLRA 1IUKA 3NGXA 1Q0QA 3OF2A 1WP4A 1GEEA 2NSDA 4LK3A 4NG5A 4CL3A 1UDAA 3IKVA 4F3YA 2EP5A 3PI7A 5HS6A 2EWMA 4DYVA 4H15A 1CRWG 5KCZA 1GZ3A 3L07A 4GX1A 3KB6A 1OC4A 4NBUA 2B83A 4MOWA 4XDZA 1QYCA 5GZ3A 1QYWA 3MJCA 2Q4BA 4AJIA 1ADFA 1RM3A 1P0CA 3GF4A 2J5QA 5GZ6A 4HNGA 4GPD1 2DU8A 1BW9A 5CG1A 1ML3A 3H6KA 1T2DA 3JYLA 1DRUA 1NQ5A 1YVEI 4JP3A 4FFRA 4BNXA 1E6EA 2IDZA 4UVEA 4D79A 4XD2A 3OICA 3DR3A 3GC6A 5G2OA 3PDJA 2G0TA 3QIVA 1M6WA 2GUGA 1HYEA 4WOJA 3RUEA 4OHUA 1ULUA 4ONEA 1K5HA 3Q1LA 1GZ6A 2VHWA 3BMOA 3RWBA 3UVEA 3B20A 1B16A 1U3TA 1SEVA 4RDHA 5L3ZA 1A9ZA 1UDBA 2X0JA 4Z9FA 4BO1A 4GMGA 3ZZNA 4XJTA 3DZHA 1TA4A 3WJAA 1VKOA 5B4VA 1T4BA 3INRA 3VTZA 1LLUA 3ZU4A 4CM3A 3GPDG 4PLFA 1PQUA 3B1FA 3C85A 2O50A 4XB2A 3NAQA 4FGWA 3D3WA 1ZK2A 5TRTA 3VH3A 1K6XA 4R51A 4J1NA 4M54A 3DZFA 1HDXA 2D1YA 4BO2A 2Y1GA 1WZEA 4E13A 1F8FA 3LQFA 3IP1A 2PWZA 4L4RA 2NTNA 1GDHA 1GU7A 1DFIA 3JQ8B 4YT2A 5K6AA 1H6BA 3B1KA 5ENDA 1NNUA 1FF9A 2FPGA 1MGOA 3WQQA 4WEQA 1I3KA 3F9IA 4HADA 1IPFA 4UUNA 1ZXLA 4FLOA 1GUZA 3NJ8A 1UR5A 1NVGA 4QEDA 2CUKA 2FZWA 1ZZEA 4OXNA 4OKNA 4EEZA 3EVNA 3OQBA 2G1UA 3RJ5A 4PVCA 2YDXA 2W2KB 2OBNA 1B0AA 1I3NA 3ZV3A 1XQ1A 2RH8A 3DQPA 3I1JA 2HMSA 2MAPA 1DEHA 5KJEA 5JC8A 2AQ8A 1ISIA 3PQFA 2Q45A 1I2CA 5A3JA 1SO8A 3C24A 5A9RA 7ADHA 4FIZA 4J2OA 2VOJA 4KTVE 5TJ9A 3WWYA 2W8ZA 1G0NA 1KC1A 3O8QB 1LC0A 4W7HA 5ITWA 4WNIA 4O5OA 1NR1A 1PR9A 4BUCA 1XU9A 1HTBA 3VAZA 4BNLA 1R4NB 5CG2A 4KUGA 3GG9A 3EZYA 1U3UA 5DNAA 3WICA 1L7EA 2AG8A 2MAOA 4BMVA 1LLDA 4XYLA 4BHTA 4HXYA 1BG6A 5A3VA 1V8BA 2B5WA 2UAGA 3KVOA 1S46A 4A5OA 4AJ4A 4FLRA 3HB4X 3KTDA 1XA0A 2QRKA 1GTMA 4KDFA 2BF7A 5BSEA 3H3FA 4XZ3A 1U7TA 1GYPA 3IJRA 3LC1O 4HWKA 2A92A 4IDCA 3ICCA 4K6CA 1MVYA 4JK3A 1BTOA 2J3JA 3WMWA 4IJVA 3GK3A 3OH8A 4BGIA 4EITA 3NJ4A 4TKMA 1NAIA 3JV7A 3D5QA 3DBHB 3N74A 3LVFO 1LSOA 3Q3CA 3OEYA 3WIDA 2PD6A 1V6AA 1EK6A 1QORA 4FC7A 3DOJA 5MDHA 3EMKA 2GERA 2IYOA 3O26A 2NQ8A 4R68A 2V6BA 3RU7A 3V8BA 2JAHA 5LDHA 1GYRA 1PZFA 2F00A 3ZWMA 3FPCA 2F1KA 3HB5X 2O3RA 4RQUA 3UHAA 1EBUA 1XYGA 5AXDA 1AUPA 1T1RA 4O0LA 4UUMA 1L7DA 1C1XA 1ONOA 2NVBA 2Y68A 2ZTMA 3JQ7B 4OQZA 3B70A 3GFBA 3MOGA 1YXMA 3LK7A 4ZQGA 3K30A 1DC6A 3OJFA 1ENOA 2Y1CA 1N5DA 4K28A 3GEMA 5MGBA 4Z3DA 4YVFA 2DUWA 3IS3A 1CDOA 3FNFA 1EE9A 3CZRA 2LDXA 3BMNA 3O03A 2HU2A 4RVFA 1B3BA 1W8DA 3ICPA 2PZJA 3RC1A 5HBRA 2OXIA 3QE3A 3TL2A 3HG7A 4QO8A 3WTCA 3IL2A 5EPOA 3QY9A 5JFOA 4IQ8A 2ZYDA 5KVSA 4WK6A 2E6UX 1U28A 1UXIA 4OSPA 1DLIA 3LSYA 3K6JA 4K6FA 3QVXA 1CETA 3LT0A 4ND5A 2QZZA 4XWYA 1ZW1A 2WD7A 4DYDA 3U4DA 2Y67A 4ZICA 2P2SA 2PK3A 2QYTA 4OOEA 1A4UA 1X7GA 3QVSA 3JQBA 2QRLA 1WDLA 3O38A 1EE2A 3DBLA 3I9NA 1D1TA 1EDOA 1A72A 2CF6A 4Q3EA 2P5UA 3WWZA 3OIDA 4YCAA 4PZEA 4L4SA 1JKIA 4WLFA 3KHUA 1DJQA 3LZ6A 2VT2A 1F06A 4LW8A 1Z73A 1HE2A 3ST7A 1HT0A 3RUHA 1MLDA 4J4TA 4YACA 4BNFA 4R3NA 4AFNA 3GG2A 3FR8A 3IDSA 1ZJYA 2J5RA 2ZCVA 4WLOA 1C0IA 1D3AA 4YAJA 3ONFA 3QQPA 3WYBA 3GMDA 4S1VA 1P33A 1P74A 1YKFA 1SB8A 1NTOA 1KEVA 2PKQP 9LDBA 3DMYA 1OAAA 1PJLA 2OBYA 3TDKA 5BT9A 2BMAA 2BI8A 4YBZA 5KTKA 1X1TA 3CPSA 4YR9A 1QXSA 1N8KA 3G79A 4LVCA 2VYND 5F1PA 2RCYA 4W4TA 2DTXA 1HKUA 4AJHA 4NBVA 4DIBA 4BNYA 3SJUA 1TT5B 1HXHA 3H4VA 4BNIA 4P22A 3NDJA 1BXZA 3V1TC 1LRJA 3RSHA 5L4NA 3CZEA 3CUKA 5COBA 2CSUA 5GY7A 2POQX 1Y8QB 1ZK0A 2X23A 3GVHA 4EJ6A 1WLYA 3ROQA 5A9SB 5TNXA 1DHTA 2EXXA 3ADPA 4DLLA 3LU1A 4NZ9A 4CM4B 1PQWA 2C7GA 1SEPA 2OFPA 3VHRA 4AICA 4YJFA 4AJNA 1PIWA 3FSRA 2ET6A 1SOVA 3UF0A 4BO7A 1MB4A 5B1YA 1HYGA 3G49A 3KYCA 3M2TA 1WAMA 2Z1MA 1U8FO 1CQIA 3H3JA 4U5QA 1Z7EA 4PG8A 1K2WA 3STHA 5CDSA 1ADGA 4CQLA 3HN7A 3MJSA 2VRBA 2YQ4A 3AOGA 3I3OA 3LF1A 1RM5A 1KERA 4XYEA 1NQTA 5JCJD 1EK5A 2CY0A 1RKXA 1HZZA 1JWAB 4MO2A 4LMRA 3F4BA 1JWBB 3JQBC 2FWMX 5TIIA 4M86A 3V5NA 5CPFA 4YTEA 1HL3A 3Q11A 4IDAA 4TWRA 2GGSA 4GMFA 3QLJA 3JQAD 4RPJA 2Y0DA 2H63A 1EUDA 3RC7A 4CUZA 1B3RA 4A2CA 5JS6A 4A03A 3WDSA 4XR9A 2WYWA 3GY0A 3U0BA 4CMEA 2YFQA 2X8LA 4FDAA 1J6UA 4RLHA 4B8WA 4EUHA 1YL7A 4GL4A 4OH1A 4YRAA 1LDMA 2OORA 2CDCA 4CJXA 4H7PA 2GSDA 3ZWOA 5JAIA 3K8ZA 3ETGA 3QW2A 5AYVA 1MP0A 4LRSB 3TF5A 5L95A 1ENPA 4D0SA 4OYRA 1IPEA 4C7KA 1DIAA 2FHSA 3INGA 4J7CA 2DM6A 3QVOA 1HWYA 4R1NA 3VTFA 5L4SA 3WTBA 1LDEA 3K2BA 2FZEA 2WD8A 3PFWO 5H82A 3F5SA 3NYWA 1HYHA 2IEDA 4GGOA 3UICA 4YPOA 4L73A 4E5NA 4MP6A 1LQTA 3KSUA 1J49A 4FOSA 1VJTA 4Q3AA 2IODA 5ITVA 1UJMA 4DXHA 5C3MA 4JX8A 5IZCA 3RUIA 4BS9A 4MVJE 4NH4A 4BKPA 5I9NA 4QFCA 2XAAA 4WOKA 2VYNA 4RV9A 2Q2VA 5L45A 4NJMA 1V9LA 3L6OO 1IZ0A 4QSMA 5JNLA 4NNJA 1ENYA 5BSHA 1Y6JA 2FP4A 1XR3A 4HP8A 1BXGA 1Y9EA 5U1PA 4E12A 1AHHA 3U4CA 5BSGA 3DXFA 1B8UA 3PHHA 2VTEA 1I0ZA 2NLOA 1O9BA 4XX0A 1WNTA 3HQ4O 3UOGA 4TMFA 4DVJA 2JCYA 3ZHZA 1HE4A 1LSSA 3DAFA 3V1YA 4TRMA 4GLOA 4CM9D 5ES3A 3Q2IA 2OZPA 3ANMA 1FDTA 3GZNA 4FQ8A 4ALJA 2IXBA 2GNAA 5JO9A 2O4UX 4FJ0A 1W6UA 4AG3A 3AI2A 1I3LA 2VCYA 1AGNA 4CM5A 3EC7A 3T0YA 4GKVA 4W82A 4FR5A 3L9XA 2E48A 2WM3A 4HNHA 3GDOA 2NWQA 3PVZA 4PLWA 4R9RA 2YV3A 2R00A 2O2YA 2DT5A 1P1FA 1IZ9A 1U2GA 2PZMA 2ZTVA 5T8KA 5JDIA 4PCVA 1VJ0A 1IB6A 2I99A 3MJEA 1SB9A 2HMWA 3BMNB 5JCJA 5IN4A 4GWKA 2P4QA 3WQSB 2CDBA 3VDRA 3TRIA 2XXBA 4CMGA 3ABIA 3K73O 3D0OA 1DC5A 1SPXA 1P44A 2ZTUA 3WLFA 1EVJA 1GCOA 1NR7A 4QTZA 2X6TA 3P19A 3ZWPA 3H8VA 4A10A 1I32A 3IQDB 2NTJA 4CLOA 3H9QA 5KNLA 2VRCD 1R66A 3JQAA 1KIFA 2PV7A 3EVTA 3GGGA 2GPTA 2VUTA 1EUCA 1KVQA 3OMLA 1UXJA 5BNFA 1P9LA 3DHYA 2QHXA 1V0JA 1YRLA 4TZTA 1E3WA 4N5NA 2JJYA 2I3AA 1G5AA 3DBLB 4TVBA 5THQA 1ID1A 1MA0A 3RVDA 5IDWA 1TB4A 3WFIA 1R6DA 4I1IA 3UAGA 3FD8A 5HM8A 4D44A 5IZCC 2W2LD 1ZS2A 3OM9A 1UH5A 4J4HA 2WWRA 3L6DA 1YDWA 2AQHA 3PEFA 4RVUA 2DUUA 3RU9A 4A27A 3QJ5A 2UVDA 2B0JA 1J4AA 2QYSA 2ZATA 3IUPA 3JSAA 3ZV6A 4U8GA 1G0OA 2IZZA 2B5VA 3JD3A 4O59O 4GX5A 1F14A 1GY8A 3IAHA 3H9GA 3WJ7A 2QX7A 5T57A 2ZB8A 2HDHA 1HZJA 3NDRA 1DIHA 4BNHA 3VZPA 1BMDA 4E0BA 3W8FA 4FLQA 4GSLA 3TN7A 2FR8A 4J1TA 4KWIA 2A94A 1O0SA 1S7CA 4Z9YA 3CZMA 2V6FA 5IDYA 3PPIA 5L51A 5C37A 2X1HA 3BTOA 4J0FA 1FXSA 3OECA 2VWQA 3VZQA 8ADHA 2AE1A 2C54A 2D59A 2EJVA 3HDHA 5BNIA 2O3TA 4B8ZA 3CXRA 5G4KB 4EGFA 5T64A 1VE9A 3PK0A 4ZJUA 5FWNA 5FF9A 1PGNA 4J91A 1Z75A 4UUOA 5JO0A 1PS9A 3QVWA 1KETA 4AVYA 5IAAA 3H9JA 4IS3A 2AG5A 5A04A 4L9RA 4CV3A 2G17A 2PGLA 2WEKA 3I4FA 4HY3A 4IQGA 4YJFB 1G6KA 5L40A 5HRUA 1VSUA 3KSZO 4TKLA 4BKRA 4PGFA 1CEQA 4CM9A 1I8TA 3DFUA 1NHWA 4QQRA 3SEFA 3KYCB 4MVJH 3WGGA 4TQGA 5CDUA 3ASUA 2J3KA 4RCVA 4FFNA 3ZNQA 3WYEA 3FBTA 1GCUA 3VH1A 1UZLA 4CQLB 3UCXA 3RUDA 3JQGB 2PY6A 3S2IA 1JVSA 2XOXA 1GUFA 2B4QA 2GLXA 3K92A 5ENVA 4OXYA 4M1QA 4HFNA 3GVIA 1MW0A 1LDGA 3LYLA 4K26A 3ZNPA 3FWNA 3EY4A 4JQCA 4E30A 2DFDA 4E33A 3F3SA 1U9JA 4JLWA 3DAGA 4IDEA 2PKRA 1DHRA 1EVZA 4YDRA 4YEDA 5A5FA 4BGVA 1DO8A 1D8AA 6LDHA 3PZRA 1UDCA 1UAYA 3DZIA 1PGQA 4DIOA 1YGYA 3A4VA 1I2ZA 4KUHA 2NADA 5ER9A 3GRKA 4R16A 3AM5A 1K6IA 3HDYA 3PIDA 4QX6A 2BI7A 1ADCA 1BWSA 1PQPA 3RASA 2VRCA 3GGOA 1GV1A 1VI2A 3OQ6A 5CEEA 3WGQA 1U3WA 4I9HA 4E5PA 2DAPA 3DOOA 4B4UA 2IRWA 4IXWA 1XU7A 1IL0A 3MJ4A 4NQZA 2C2XA 2ZJ0A 2BH9A 5A1TA 3C7CB 3RI3A 5U9CA 5JBIA 3VZRA 3WIEA 3W8DA 1P1RA 1QYVA 2ZTLA 4NJOA 1OI7A 2W2LA 1NPDA 1HDYA 5BR7A 1K6JA 3VKVA 1VRWA 4PRKA 4JP2A 1NASA 1JAYA 2B36A 2O7GA 3AY7A 4YRBA 4XQCA 3OIFA 5EIOA 5C7LO 1DPGA 2OP1A 4B3IA 4PZDA 2BFPA 2Y93A 4D46A 4U0KA 3WLEA 3OIGA 3OA2A 1OOEA 4RPGA 5G0SA 4E2YA 3JQDA 4DPLA 2DLDA 1TEHA 4MVJP 1T1SA 4RLSA 1AN9A 5IDXA 1NWCA 4RORA 2P4HX 3BMCB 3WSVA 4Y6SA 1B14A 2YV2A 3H2SA 1P1IA 2AQKA 3KBOA 2YZ7A 4NJMB 5JLAA 3E9QA 4U0JA 1K0UA 1EMDA 1YOVA 3I5MA 5F21A 4C7JA 5IFLA 1BXGB 4G5HA 1E5QA 5K9ZA 3HFGA 2X0RA 4J9VA 3T4EA 3OA0A 3DHEA 1PL6A 3EUWA 2Q1WA 1QMGA 2Q2WA 4JROA 3DDNA 1CIVA 2J6IA 1PZGA 3PHGA 1T4DA 1NQOA 3OJ0A 2OP0A 4R1TA 3Q9NA 4CM7A 4IZHA 3P7MA 4OMUA 3C7AA 1UZNA 2NTVA 3BTUA 3GZNB 4CMCA 3GUCA 1WXDA 1JKJA 2RHCA 2I3GA 1I24A 4WCDA 4XCVA 1QKIA 1PZHA 3SVTA 5FYDA 3B6ZA 3BXXA 4KP7A 5I7EA 2ZIZA 4FBGA 2NU9A 3QP9A 3AW9A 1ZEMA 1MFPA 4RGBA 4E5KA 5CDTA 1GYQA 1ZSNA 2C5EA 1NYTA 1IHXA 3VOSA 4ZHSA 4JNKA 4MIYA 1BXKA 1MG0A 1WWKA 2BD0A 1WZIA 3H9EO 2GO1A 2HMTA 3ZWXA 5LC1A 4XA8A 4ALNA 4ND3A 4BNZA 1DIGA 2TMDA 4E5YA 7MDHA 2X0NA 2DBVO 4YJGB 3TZ6A 4DWVA 4B7XA 1VL6A 2JD1A 2JAPA 4NPCA 1UP7A 4Q3DA 2B35A 2HQ1A 1GPJA 4MVJM 4BOYA 1A5ZA 1DLJA 2YQ5A 4GQAA 3MCVA 4PLCA 2D0IA 3ZV5A 3FR7A 3PJEA 2VZ9A 4BMSA 1M6HA 3F1LA 4W9NA 3BHMA 3CZLA 4FFMA 4GVLA 2CNBA 5DBGA 2X5KO 4CLXA 4AJPA 1ZH8A 3SC6A 2VTDA 4CV2A 3EW7A 5L7WA 1E6WA 4M87A 1PGOA 4YQZA 5AQ1A 1E3WB 5KJ6A 3F4LA 4HKTA 4NDNE 5KJ1A 1DC4A 5LDGA 2OMEA 2P5YA 3VVBA 1DJNA 5AOVA 1BVRA 2Q99A 5A03A 1XDWA 1HEUA 1KC3A 3TZCA 2NACA 1CWUA 1KYQA 5AXBA 3FPLA 1X7DA 3QRWA 1E7WA 4QXMA 1ISFA 3L4BA 4WLNA 3FF4A 2O7QA 3VVCA 4P38A 5HWSA 3FNEA 4BNTA 3QWAA 2P9GA 1FDWA 3GVPA 1MW2A 5DULA 2YV1A 1BDBA 4XIJA 3AJRA 2D2IA 3FTPA 3SJ7A 2QRJA 3W4IA 5JMWA 1LSUA 4O6VA 1Y8RB 1MX3A 1HE3A 4LSWA 4UREA 5B37A 3K5PA 4DREA 1F0YA 2DQ4A 3NUGA 1ZKMA 4Z0TA 3ZWVA 1Z82A 2PNFA 3GDGA 4XIYA 2BGLA 4BNGA 4IGEA 1I2BA 1P3DA 1F17A 1I33A 4WCFA 4J7UA 5JC1A 4BO8A 1E3LA 1DRVA 1ZSYA 5DN9A 1RM0A 1UXGA 1JQBA 3ZCXA 1E3IA 3FI9A 3A9WA 4CMAA 3HHPA 2YY7A 1JVBA 2C2YA 1S6YA 3NKLA 4JGBA 2CDAA 3CEAA 5G0UA 4ZA2A 5A05A 2JKVA 5DF1A 4EBFA 1PL7A 2X0IA 2D4AA 1KVSA 4W99A 1FJHA 3VPSA 3ZNOA 3GUYA 2I6TA 4IY1A 3WGYA 4BIIA 4IJKA 2GZ2A 2V7PA 3C1AA 3QWFA 3SX2A 2J3IA 4ROSA 3RKRA 4J7XA 1Z6ZA 4XGNA 3OQ1A 2W98A 2NU6A 5EN4A 4E2ZA 1E0DA 1LDNA 3SXPA 3QWIA 1GQ2A 3TZHA 4NK4A 1V3VA 5KOIA 3RC9A 1U2DA 5T5QA 2H1SA 4II2A 4DQVA 4W9NC 3RFXA 3DBRA 4CMHA 1UUFA 1ZK3A 4JBGA 4RZHA 3WS7A 3L6EA 4R01A 2X7HA 4D41A 2HMVA 1BDMA 1JDJA 1YQDA 4YJHB 3GVXA 5I9MA 4BV9A 1DFGA 4F45A 1W0CA 4J1SA 2NVUB 3MJVA 4J90A 4ALLA 4FB5A 1N1EA 3KEQA 4I9UA 3PLNA 3GAZA 4LCJA 2C07A 1T2FA 1ORRA 3ROKA 3S2FA 1WW8A 2QIOA 3Q9UA 4BVAA 2JHFA 2PKQO 5A9TA 3L4BC 4LSMA 1LRKA 4MVJG 4CM8A 1MW3A 1DC3A 4U6QA 3I6IA 1E92A 1TLTA 3Q2KA 5I7FA 1GUYA 5JPIA 1ISHA 3UERA 3LC2O 4B7CA 4J49A 1E6UA 1F12A 4NHEA 2RBEA 3AY3A 4MDHA 4CLRB 1XG5A 1GR0A 3BIOA 3H2ZA 4N18A 5B4UA 4J2HA 3PGJA 1E1LA 1YH3A 2Q46A 1HETA 3IMFA 1RM4A 4J9UE 3RBVA 2VOEA 4E3ZA 1C0LA 2DBZA 3WX0A 4RDIA 1DB3A 2YW9A 2Y1OA 2CD9A 4F6LA 3PWZA 3PGXA 4Q3NA 4WCFC 3ZWCA 3MEQA 4ZQHA 1M76A 2J5KA 2DTDA 1P77A 1BW9B 1DSSG 2IEBA 3G1TA 2V6GA 1K3TA 2IXAA 2OL4A 4HBGA 1LUAA 5F1OA 4L76A 4BNKA 2GDZA 1Q0HA 4EI2A 1VLLA 1OC2A 4FCCA 4TVOA 3LLVA 4QT0A 3CE6A 4EDFA 4UEOA 1HF3A 3ZHYA 2EJWA 3KLPX 3WSWA 2Q50A 2BGKA 4NFHA 4U6SA 2X9GA 3RQSA 4DLBA 4LMPA 3K96A 4JN6B 3BMOB 1K89A 3E18A 3NEPX 3PRJA 2E49A 1H9AA 2HLPA 4JCOA 4FW8A 4RVSA 3GLQA 1X0XA 5TQVA 4XGKA 4J4BA 5IN5A 3E6AA 1YO6A 2UUPA 3KSDO 5F5NA 2IZ0A 3OBBA 1XSEA 2HSDA 1N7GA 1J0XO 4XRGA 3IKTA 3V2HA 3WFJA 3D3WB 2AQIA 3PP8A 2V6MA 4XKJA 1O95A 3PJGA 1XGKA 3E8XA 3E5MA 1LSJA 1PR3A 4G65A 1UP6A 4CR6A 5JYEA 3C3XA 3WBFA 3S1LA 2JD0A 1H2HA 1AE1A 5AVOA 3OSUA 4ILKA 4KWHA 3E9MA 1P1HA 4L75A 3FCOA 2BLLA 2P9EA 4FGSA 3GRPA 1JN0A 4ND1A 4K9DA 3KO8A 1LU9A 2H9IA 4L0QA 1B15A 4J6FA 5JCXA 4Z0HO 1HDRA 4BQPA 1NM5A 1ISMA 4OO3A 1UZMA 2YDYA 1OMOA 2VUSA 5JSFA 3RUAA 1QR6A 1V3UA 3AOEA 2C20A 3UCEA 5ILGA 5L7YA 4CV1A 5JXWA 2FY8A 1JGIA 1A71A 2XF8A 2VWGA 2AEJA 3BHIA 3E82A 4OOFA 1VL0A 3AFMA 3DOCA 4BO0A 4RF5A 3FBGA 1LTHR 2X9NA 3ZN2A 5DZSA 1Q2XA 4HFMA 3TNLA 2B69A 3ONDA 2BELA 3ZGYA 4Y9DA 4PG5A 1PS8A 2AA3A 3DFZA 1LLQA 1EUZA 4DLAA 5CAEA 3HUDA 2WE7A 2GR9A 3HSKA 3HZZA 1GV0A 1J5PA 1IOLA 1ZNQO 2FR0A 3L9WA 3LF2A 3N7UA 4BO9A 3NRCA 3H5RA 1BRMA 2PD4A 3JQ9C 3UFXA 1QLJA 1YBAA 3OJLA 4Z6KA 2P91A 1IY8A 1R0KA 1A7AA 2A35A 3OEWA 4YA6A 2AEMA 4I8XA 1GD1O 4P4GA 3FNHA 5F1KA 3TZKA 3GPIA 3NX4A 4I5EA 3AWDA 4YAGA 2PR2A 4ZGWA 4BQRA 1PGPA 1Y5MA 2D8AA 4AJOA 4KMSA 1HLDA 1ULSA 4RJTA 4D43A 4FOOA 1L1FA 1XLTA 4BB5A 4NMHA 1Q7CA 3K2EA 4J1QA 1FDVA 2EKQA 3QWBA 1FMCA 2JL1A 4RQTA 4CR7A 4N5LA 4YXFA 1ADBA 3AK4A 1QLHA 4DQUA 1DRWA 4MVJD 1O5IA 4YT4A 3TWOA 5C7OO 1YB5A 3PYXA 3G0OA 3TFOA 4J43A 3SLGA 3HWRA 4DBZA 3JYPA 4CMKA 4PLYA 2EW8A 2HK8A 2HMUA 2EG9A 3PHJA 2WJPA 4RF4A 2HJRA 3IOYA 4OJNA 2IYPA 1C1XB 3HFSA 4YAKA 4YWJA 3TPCA 5TX7A 2GRAA 3H5AA 1CYDA 4Y6RA 3MZ0A 2O2SA 4WLUA 5TT0A 2JD2A 1LXCA 4G2NA 3LC7O 4D7AA 4BO4A 2PH5A 3EK2A 4AJ2A 1MV8A 1NP3A 1MFZA 3AOEC 2BKAA 2HAEA 1QP8A 2QG4A 5C5IA 5CEFA 1OFGA 2I9PA 4R54A 5DCWA 1DOHA 2NU7A 2VNSA 3QVTA 2YYYA 4YQYA 4PLHA 3O9ZA 3KZVA 4XYGA 5B4TA 1PX0A 3I4CA 1PJ4A 1O8CA 1PZEA 3WNVA 2FSSA 4TZKA 4WECA 4E31A 3DBRB 5ICSA 1CJCA 2NV6A 3H9UA 2WMDA 3AI3A 3ZI0A 2I66A 4Y6PA 2DTEA 2HK7A 1R0SA 2RIRA 2W2KA 1E7MA 1F8GA 2WD7B 4OIMA 2CZCA 1IE3A 5I7VA 1W73A 1SNYA 5EERA 5TGDA 4PVDA 3W4JA 1H6AA 3D4NA 4JJIA 3S2EA 4GSKA 3ZH2A 3IJPA 3Q6IA 1I30A 4DPMA 4L74A 2X4GA 3T7CA 3KV3O 2X5OA 2W4QA 1PJTA 3CIFA 4KDEA 4R69A 3ENNA 1JTVA 3O8QA 1WMAA 3NV9A 2RHRA 4XJSA 4IJWA 5I9LA 3ROPA 3AUAA 4CM8B 3R6DA 3ZW9A 1XHLA 3ZWAA 3WXBA 1M2WA 3ZWNA 1TI7A 1A9YA 1SZJG 4YYZA 1T2EA 2UV8A 4E5MA 1LBEA 2FR1A 4WASA 4GWGA 3A1NA 5EESA 1I10A 2CF5A 2E4AA 5EMHA 1KOLA 4CLEA 2WPGA 1VSVA 4JIGA 5J23A 4NBWA 3UN1A 5DP2A 3I83A 1QV7A 3CINA 1G1AA 3ZWYA 2FPIA 3BYZA 1Q7BA 5F3RA 4PFJA 2CVQA 2ZJ1A 2WYUA 4R3WA 2GASA 1PWZA 2Z1NA 4Y8VA 1DIRA 1GPDG 4I5FA 1PS0A 1DIBA 2EV9A 3L4SO 2OUIA 3KYDA 3QV1A 4IM7A 5DOZA 2UYYA 3CZKA 5JDCA 1RYDA 4AYSA 2DPGA 2W90A 4IUYA 1XCBA 1Y1PA 2PGDA 3PYLA 4WE3A 3JD2A 3RIHA 4QO7A 4BKOA 4R41A 4YT5A 1AHIA 3BZUA 3KYBA 3LT2A 2X22A 2X86A 4ZRMA 3JQCA 4MVJA 3ENKA 5GMOA 4DL9A 1XELA 1QG6A 5DDIP 3BA1A 3GHHA 4TROA 1B26A 1C1DA 4BKUA 4CM1A 1SCUA 3WGHA 3U4HA 2J3HA 4NI5A 3I9OA 4D3SA 1U5AA 3JQ7A 1WVGA 1JLLA 4PLZA 4WGGA 3OP4A 4GBJA 4XR4A 1P1JA 4ZRNA 2C82A 3GR6A 5KVQA 2EKPA 4IBOA 5I8ZA 4O1MA 2Y0CA 4RZIA 1GQQA 1H94A 3HDJA 3UUWA 4E2WA 1M75A 2OGUA 3D64A 3WNQA 4AJJA 4D3FA 2H6EA 4IS2A 1T26A 1E5LA 3WGOA 1XIVA 5DBFA 1Y81A 3SLKA 1KEPA 5FEUA 2YFHA 2DKNA 3T7EA 1T2AA 4FFPA 4YT8A 4ZD6A 3DO5A 4WUVA 2NQTA 4DBVO 1XKQA 5G0TA 1I01A 1A4IA 4NBRA 4EZBA 3JYOA 3HJAA 4DMMA 3VPXA 1KVTA 4MVJI 3NT2A 3L0DA 1OR7A 3ON5A 3OETA 4ZVVA 1PL8A 3U5TA 1N2SA 3D5TA 2H5LA 3INTA 1GL3A 4CQMD
chains in the Genus database with same CATH superfamily
1QX3A 1E1MA 1NLZA 1KRWA 1MW8X 3GLSA 1UZUA 4BLTA 3OJWA 4EB0A 5FI3A 1SU6A 1QANA 3AL3A 3BFKA 1GZDA 3I09A 1JILA 4YRNA 1INLA 3PQ7A 2YV4A 3SJAA 1WUKS 2FZCA 3TVYA 3MGBA 2DJIA 2IEIA 3R3YA 3GEBA 2GN9A 2O3QA 1HDIA 1PG0A 4FJ2A 4WK4B 1OT5A 4YP6A 3EW9A 5TY0A 4M55A 1U1CA 1L8LA 2YJ3A 5EJ5A 5KWSA 1K7YA 3O91A 4U7GA 2RK6A 2VATA 4WZAE 1D7OA 3TMYA 5SYNA 3M6IA 4GRIA 3RYFA 2R1TB 3AXSA 4A8HA 4EFKA 1B7GO 3M33A 4UAUA 5JZSA 3U13A 4K87A 5F52A 4FT2A 4QJIA 3EF3A 2WF7A 1ZWLA 1HDZA 3AI7A 3VU3A 4PO1A 1T6XA 1UMBB 3OE5A 4B84A 1T3TA 5DTMA 3CVUA 2O8CB 1V8OA 1A1SA 1QOQB 1N92A 3LX8A 3MC1A 1Y4SA 1BD4A 3TOZA 5FWXB 5FTWA 1T35A 2FOXA 4LKOA 1H9BA 1PEDA 3PJDA 1IFXA 4OQYA 2FG7C 5C8DA 3AF1A 1J8QA 3RROA 3W1EA 2GJKA 2I67A 3LDAA 4PM4A 4PLTA 4CKXA 1M6VA 5A4IS 2G9QA 1ECFA 1T9KA 1E3SA 3LD9A 3WOHA 2Z95A 5JJKA 1QGYA 4WLVA 2ZYUX 1PR6A 2ZIXB 1EQUA 3I12A 1ORWA 1K86A 5DYGA 5JAOA 2Q8PA 3PNMA 1KORA 4KEAA 1OX6A 1ZCJA 4P4NA 4E22A 2D4HA 4YJKA 5ECYA 3MELA 1E7RA 5EQFA 4B4VA 2FP4B 4HJXA 4FYPA 3HNPA 4FN4A 4HQ6A 4P3OA 4A82A 2FPPA 1LNQA 1E96A 3X1YA 4Z2AA 4BWYA 1MC4A 2KWIA 3WAKA 2VHQA 2IUTA 1H1LA 2CFCA 1CUAA 2C2BA 2VDQB 3VHQA 1ZSVA 3WLOA 2F8MA 4F4DA 1ZUIA 4UZFA 4NQWA 5I8WA 1KY5A 1CB7A 2DHCA 5E6RB 2HO5A 2ZSAA 4RESA 3K9WA 2J07A 3HADA 4QRIA 4WLEA 5K8UA 1HEYA 3LYAA 2C8JA 4CM4A 1GL9B 1SCQA 1ZC3A 2I3ZA 3MRTA 3TLAA 4DLWA 3UGKA 3REGA 3P4XA 1FTWA 2G25A 3GJ4A 1X7HA 3K9QO 5ESDA 2COUA 5IJ9A 2FCRA 1WPQA 2IY8A 1KMQA 3IP7A 3LWBA 3OZUA 3QOYA 2WWHA 3M1IA 3LY9A 4FFBB 4FMCF 4OU5A 3RSCA 1NRIA 1U98A 5E8JA 4L4ZA 3I2KA 3B6MA 4OL9A 2P9HA 5DW0A 5LA6F 2ZANA 1HV8A 1SC6A 2P7HA 2R62A 1G6HA 3I9KA 3CY6A 4QBKA 4Y30A 3W90A 4DHWA 3KFVA 5KZMB 4MW2A 5IJAA 1RRKA 2J7PA 2FMFA 4Q3BA 2Q3EA 3SQMA 3BFPA 1BMFD 3BXGA 3I8SA 1DMRA 4MQ6A 4RY9A 4EA8A 5K5EA 1D5WA 3KPVA 3WA6A 1A8QA 1TAGA 2WSBA 1C3JA 3HI6A 1NLYA 1A8UA 4P6VF 4F1WA 1ECCA 3GRZA 4DR7B 1XTVA 3IR5A 1JQKA 4B79A 3U19A 2RGBA 1E2KA 3NH9A 2Y99A 1AZSC 3DHNA 3L7LA 3UV7A 4E6PA 1IULA 1XQYA 1Y63A 3NTOA 4WXPA 1R5JA 2BFDB 3AP3A 1DBVO 2QG9A 4LWQA 4TTTS 4UW9A 5DLEA 2PJDA 3DE3X 2BM8A 4PGMA 2IYAA 1WMEA 2QD2A 3P0EA 3QMPA 1X7YA 2FQXA 4HR7A 4OFWA 5AJVB 5H5JA 3WFZA 1EXVA 621PA 3F46A 1VGRA 1Y6QA 3K9FC 3Q3EA 3TQFA 1U5BA 3BXFA 1DQZA 2YJZA 2ZQ5A 1N6LA 4KIUA 3W8RA 2BKLA 3HO6A 3JQEA 3H9CA 4L95C 3LT4A 4IQ4A 4JDPA 1KEUA 3FWYA 4RVDA 5I5GA 4I9NA 3S1SA 4IIUA 1H2YA 2P8SA 5AUQA 5EWJA 4PRLA 3QGMA 4WOBA 3UATA 3GROA 3WDMA 1NV9A 2EP7A 4RD6A 2QRNA 1LPMA 1EFDN 5EHNA 1BOFA 4TRRA 5GAJA 4OM7A 1E77A 3RV4A 2B4RO 1RWQA 1YR3A 4KLAA 4B4WA 4DLYA 1OU4A 4OXQA 1DAHA 3T4XA 2XUIA 3P2YA 2BFFA 5J4HA 1S3FA 3HN2A 3KPUA 1GFIA 1W2WB 3N8KA 4OSOA 2D00A 1UC5B 2G6BA 3H83A 4RK1A 3UCFA 3M6XA 1M66A 1RCUA 3GH3A 1JW9B 1DWUA 1YS4A 5BXQC 2WF9A 2AS0A 2AZDA 1LA2A 2XCQA 3R40A 4IMRA 2EZ8A 3VPFA 4EA6A 2AFHA 3RREA 2PRIA 1V35A 3DB2A 4MUKA 2WQ6A 3FMGA 4X54A 1TK9A 3MMSA 4GZ5A 5K3FA 3T99A 1RAHA 5ARBA 1AKVA 3QPDA 2VQ3A 4BVHA 2PAAA 4YDQA 2P5TB 1YRBA 3CZGA 1FP7A 2JANA 4IIJF 4GOND 4TTJA 3K71B 3CNQS 4Q03A 1YR6A 3TLZA 1NLUA 1I6KA 2E85A 4AZWA 5IULC 1QTNA 4MB6A 1BSVA 1UKZA 3G68A 4MI1A 4WKNA 3GDFA 3WZMA 2HLDA 3CQ9A 2XDQA 1IB0A 3TIVA 4ZANA 3I23A 1KP9A 4B3RB 2AE2A 2OV2A 3ZDFA 2C5AA 3M1AA 1L8QA 4CUKA 2IF0A 1MAWA 1PWXA 2CV2A 5K0EA 3AZQA 3PWSA 4BLOA 2B6NA 3K1YA 3SBOA 3QWHA 2QVLA 4FS8A 5BO5A 4V1CB 5KVCA 4H27A 1C14A 3PPXA 1RWBA 3PRHA 4BUJA 2PGNA 2JLYA 1T8PA 1W4ZA 1K7EB 3ACDA 2F8TA 1TA0A 5THKA 3A14A 2PX5A 4G01B 4EYEA 2R84A 4IDGA 1EB9A 2DPMA 2XVYA 2DBRA 4FYIA 4S12A 1Y89A 3NWOA 5DCUA 2O6LA 5HXAA 3N07A 3QK7A 2WVGA 2MSCB 2YXBA 4ZO9A 3KXDA 3KRTA 3ESAA 4EHDA 1MW1A 1S2NA 4NOLA 1ZI9A 2ZOSA 4WNCA 5HKOA 1CVRA 3KETA 3AYXB 3DZKA 4L5YA 4W1PA 1BCSB 1LPPA 3O82A 3QEMB 4N3CA 1H8EA 4GFDA 4PF1A 5CXSA 1IEWA 3ZWQA 5J4YA 3QA9A 1ZKDA 3WFIA 4CV0A 1VECA 4QDJA 3EUAA 1FLVA 1NA5A 2E4WA 4TSRA 3TQOA 3W3AD 3JYNA 1PTJA 1JR3E 3U9LA 1ODKA 4UHCA 5A4DA 2H5EA 2YOFA 3L06A 3VC1A 2PUCA 2MWMA 3MT7A 5HA5A 1FDIA 2A9FA 3ZXYA 121PA 2IYTA 2ZYAA 3P8ZA 1NPTO 2LTAA 2C9DA 2QP4A 4KQWA 3JZIA 4M38A 1E2EA 5EVJA 2VPXA 3A58B 3BSSA 3VDQA 1YDEA 4IG4A 4I50A 4X65B 1X1EA 2V9PA 3JR3A 2FMUA 2RSLA 2G40A 2BDTA 3V2GA 1QH8A 2JGAA 1ESCA 2DUMA 2ZE7A 4ZCLA 3AU9A 5DM1A 1DBPA 1Z13A 3EZGA 3X1DA 3VNVA 5KYNA 4FM9A 3A1SA 3PUJA 4HQ0A 4J03A 5JHGB 1ZNWA 1B8PA 5D01A 4BCDA 2IWRA 4E5VA 1DARA 3F0TA 2Y4OA 2VYVA 1ZHOA 2Q2QA 5FUBA 1ZRSA 3CZCA 1Z5VA 3ENZA 4Y2QA 1QSGA 4OYHA 2XVAA 1C7JA 4LYHA 3TAHA 1H3LA 4JHXA 4PLVA 3ZBUA 1R16A 4LDQA 1PNVA 3JSXA 3CZ5A 4G81A 4PG7A 1DWQA 3NBFA 4TYYA 2OSBA 1E1DA 3N2KB 2O07A 3R0JA 1OH5A 1LPAB 1Q0LA 1S2LA 2JIZD 4G85A 3R8XA 1JQ5A 2VAPA 2D2XA 4JC5A 1U1DA 2BONA 3KJFA 3VH2A 3WNCA 5J43A 2FTKE 3R5FA 1MC5A 1PJ2A 3GZJA 2L0XA 2VLAA 3AJAA 3QSGA 3NP9A 2F3RA 2VNAA 2R751 4EF5A 3ANNA 1FSPA 1IHOA 2WHXA 3CCFA 3KEOA 3GN1A 4XVHA 3CJTA 3NOQA 2P3SA 4HNAA 3KJZA 3ZK8A 2VBFA 2ZTHA 4ZVNA 2XTAA 4GUDA 4WRRA 3FI0A 1XCGB 2XPCA 221PA 2HA6A 5FI5A 1JT9A 1L0BA 5I4IA 3JQ9A 3DKVA 1ESZA 2D5CA 3L49A 5TEWA 3N2GA 4U2CA 5AJUA 5BUQA 4JYAB 3UT5A 2EIHA 5COQA 3WGVA 2IYYA 5H8WA 4KYIB 4A92A 2MSLA 2MMGA 3AF4A 2J4FA 2F3TA 4DJTA 1BFUA 1TM3E 5BSFA 3K0CC 2HMAA 3IE1A 1VL2A 1WOYA 4NBNA 4X64B 2H8GA 1XAIA 1M0SA 2WJGA 3KVYA 4OLBA 3SZMA 1RP3A 1T2NA 2I76A 3P97A 1CTQA 3PSHA 5DH9A 3DMTA 1JAXA 3PYMA 4ISBA 5FJJA 1KE1A 4CETA 2QX4A 1X2BA 4I5DA 4C0BA 3WYAA 3LE8A 3FETA 2X3YA 4W6ZA 4MJXA 3GQVA 2WT8A 4BO5A 1NJSA 4BMXA 1PYDA 5I8PA 1J07A 2GRJA 3VYVA 5CM2Z 3BREA 2XRZA 1QB7A 3ICVA 3KUUA 1B6TA 4XM0A 3WBKA 5BRJA 1LBQA 1EEHA 5CFNA 1YMVA 4M1MA 3G7SA 2E82A 1D9ZA 2B4YA 2W4MA 4HGQA 4JKIA 3NWJA 4G97A 4L8VA 3COPA 4PPQA 1AJEA 3HGTA 1IXYA 3HBNA 4R7LA 1X6VA 1KY4A 2EZTA 4YB8A 1BHQ1 3N0VA 2VNKA 2GJ4A 3JTMA 3D0RA 3KM0A 3TLJA 4G5YA 2PU7A 2VT3A 3DL2A 4K8OA 4UDXX 1KFKB 1N3IA 1P5HA 2D7DA 3HPQA 4NDAA 4I5GA 5HDQA 2J59A 3A9VA 2NU9B 5GJWC 5BV1A 5L8VA 4PC7A 4IMPA 3T52A 4PAQA 1J56A 4YJ3A 1AK9A 4HPXB 3K0FA 1S1MA 3K9NA 4MCAA 5AVSA 721PA 5IJZA 1Z63A 4C3VA 2VNHA 3RB8A 2GJSA 2ZYVX 2PZEA 4V3BA 3P2KA 3NNDA 2EF0A 4OUDB 3F7NA 4IFTA 2ZQYA 5AUOB 1LDYA 3RO7A 1KK2A 4YS6A 3N39C 3DLAA 1OJ7A 1JEEA 2BMWA 3FSEA 4GKAA 1YE3A 4LQDA 5J9FA 3ZU2A 5BQFA 1JG7A 2SICE 2ZCUA 4HV4A 4UNRA 1SKYB 3UC9A 1EAMA 1J2UA 1USWA 1KJIA 5BVGA 1W93A 1VLHA 1ETHA 3IHTA 1GZ4A 1F5NA 5IHXA 3U44A 4MZDA 4LBZA 3O1IC 3UJ9A 3WGTA 3OZTA 5JSKA 1E66A 2A5DA 5C5EA 3H0KA 2OQVA 1PK8A 4TYMA 5HHTA 2HKIA 3C97A 2UDPA 4PU2A 1ZXBA 3CSUA 2HPZA 3HC7A 3H1FA 4HMPA 4ZU3A 1VDZA 2VK8A 3DYBA 2XJ4A 1SPBS 1ZJ4A 5AI4A 4OHXA 4DANA 4HLUC 3OZEA 1XHEA 2FOIA 3AM4A 3DT8A 1EH5A 4HO1X 3QX8A 2YWDA 3OCJA 4JLUA 4REMA 4KH1A 5DVZA 2X7JA 5HOQA 2IYQA 2J3DA 4YRDA 4JI8B 5IF3A 4UPVA 1RP1A 2QE7A 4BL5A 4HWGA 2GD1O 5KI6A 1O94A 4MW7A 2VHXA 4YRQA 5HJEA 4C04A 2CVZA 1RABA 2JI9A 3W6UA 5B7PA 3AU8A 1PJQA 1UK6A 2CXRA 5D5HA 4GKKB 1Q0ZA 3AIKA 4I4TA 1V47A 2DFTA 1ZUWA 3GJ0A 3CV3A 2FSVA 4Z3KA 1VG0B 2XDYA 1QM5A 3BUSA 3G5MA 3WLHA 2XE6A 3AF2A 4MA4A 3G88A 5CJ2A 2LIPA 1NWHA 1O54A 1G21E 3HXLA 4YMUA 1C41A 3Q7PA 4F60A 2Y9MB 1IUPA 2JGLA 4IO0A 2ZEJA 1KARA 5CNKA 1NQAO 2MYUA 3ETJA 2Z2ZA 1R27A 4MWOA 3HM2A 2AI3A 2I8CA 4RLQA 3VYSB 4UBOA 1JIJA 1W25A 1Q3KA 1GQFA 2I1QA 3C15C 4QYMA 3L0IB 4HX9A 3VR1A 1UQUA 1YRWA 4G36A 4KOAA 4TL9A 3WV5A 4EPTA 4ND2A 3EIHA 4Y2VA 1ZR2A 4L4XA 3RK4A 2RHTA 3BMCA 2BMDA 1RBQA 1J8MF 4DLNA 4WCFB 2YHIB 3U7JA 4C4SA 3QNUA 4YCJA 4NYJQ 3LLSA 5EINA 2R25B 1B76A 3GLFE 4N76A 4AMVA 1UK9A 4JBHA 1RC8A 2DHDA 1OY1A 3OJOA 1TQ4A 4KVGA 1H0SA 4P4LA 3GOHA 4AB1A 1EFRA 2EHJA 2JGFA 3MWEB 3KLOA 3DNPA 1CY7A 1QRRA 2XADA 3ANSA 3KSMA 3QVVA 4UBIA 2YYSA 3MF4A 3DVAA 3HO1A 2VK2A 1LK0A 3H65A 4YONB 1EQAA 1VGQA 2D8MA 2HCJB 2H9AA 2IZ7A 1X77A 2BHSA 3K35A 1XZAA 2XB2A 1ZD4A 2DCUA 2H07A 3FMPB 1D4OA 1W5SA 3NT5A 5IC5A 3AEZA 2PJRA 1GR1A 2HZ7A 4QPZA 1KHTA 3LXMA 2QL7A 3DZBA 2G72A 3SLRA 5CDYA 3EFBA 2GOYA 5C5CA 1W48A 3AB3A 3CNHA 4GSYA 5A06A 6GPBA 2ZXUA 3E3MA 4ITRC 4K6OA 2FZLA 3CLUD 2IP1A 1PDWA 5ALLA 4DV7B 1TE2A 3A36A 1U04A 2AXNA 4DG9A 3W6ZA 4X6XA 4MUNA 3HU2A 3LCVB 1DAMA 2DFNA 4C43A 4PO9A 3RFVA 4PO3X 4PXAA 2R96A 1WXFA 3EGIA 5JPCA 1E3QA 3NQ41 4LISA 2BGMA 4CEIB 1X3LA 5E3HA 1VL8A 5AI5A 2VAXA 1L8AA 4AJKA 1Y6GA 2Y1FA 5D5QA 3ZVLA 1YIDA 4B71A 2AFVA 3UH1A 1C9JA 4CMEC 5BYBA 1P4AA 2FXIA 3RYCB 4JL5A 1GXSB 4MP8A 4RV5A 2NUAA 1P2DA 1ENZA 5EZQA 4QM7A 5LNK6 4ZQBA 4A23A 4TTVA 2IIBA 3QBJA 4M8NE 5H7XA 4DC0A 4LN1A 3W77A 2JCXA 5DHTA 2L69A 2VQEB 5JW6A 3ER8A 1NYQA 3FMIA 2WHEA 1MCZA 2B99A 3GIDA 1KEEB 4Q7QA 3R5HA 5JATA 3B1VA 4OBWA 1QTRA 3PLRA 4LGCA 1JG6A 1NN1A 4G4SP 4H0NA 2QSZA 4X7MA 1EBFA 4D4IA 2DG2A 4GXRA 5CFLA 2O3JA 1JQ3A 2CKMA 4WBNB 1CR2A 1NHGA 2DY0A 3QVUA 4BVFA 1ZAYA 2GRUA 3AR5A 4LF6B 3Q7SA 2ZYRA 3FU0A 4OY3A 5K3BA 5EIBD 1ODJA 3B1ZA 5HK8A 2Y05A 4B0OA 1R12A 2PHZA 4HH1A 1M2VB 4JI3B 4ARVA 1ZJZA 4U9UA 3T7DA 3WGJA 4GGMX 1M54A 4N8DA 5KBYA 3H84A 4RDXA 1U9IA 2VZ0A 5HTKA 3NBKA 3LCMA 1CQJA 3AHJA 3F73A 3DWFA 4LAFA 1MABA 2HJHA 3WI7A 1P80A 2C8LA 1UT8A 3TG2A 3R7WA 3VOAA 4F4FA 5KSOA 2AMVA 5K8IA 1RDFA 3RUFA 4O4HF 4WNAB 4LTDA 4UUQA 3KDAA 3G2QA 2W71A 3BWMA 4Y18A 4M0PA 2PX2A 3ZQ6A 2AW5A 4NTZA 4CR8A 3A04A 3HY4A 4A0RA 2LCIA 2Z08A 1A7UA 1ZVMA 2O54A 1OD6A 1X92A 1CEXA 5FKJA 3CEMA 2EYUA 2YW2A 3FTNA 1W94A 3A06A 1JEQA 4HWRA 5J5VA 1H6DA 4OH7A 4DG8A 3OZWA 2Q1UA 1DI0A 2NUTA 4CKWA 3T3MB 2PD3A 2QB5A 3MOIA 1IN7A 1G3RA 1XEXA 2V6JA 5A02A 2V5AA 1MXFA 2JFHA 3O4FA 4J3FA 1Q7GA 4NPHA 1KBZA 3CJRA 2QZ9A 3X2SA 4KR2A 1E3JA 4BWFB 3BHJA 3OCXA 3VOBA 3UAOA 4M76B 3JATA 3ZZ0A 4MGEA 4XIIA 4URXR 3ZG6A 1PFWA 4OA5A 4BFUA 3UMGA 5KYTA 3D7NA 2JJ2A 2OZVA 4FKZA 3FPHA 4AU1A 1QQBA 1JP7A 4XWAA 1XTSA 2AKAB 2R00C 2X5NA 4LOJA 3U3XA 2QN7A 1K3UB 3SJBA 2JV7A 3ZV4A 1U9ZA 4DGSA 4UHKA 2F8SA 1NT2A 2W6NA 3QUSA 2CL7X 4EY3A 4EY6A 2QYOA 5AK4A 5JDIC 2H2WA 4AC9A 2QUHA 4MI3A 4JBIA 5EWMA 2H2FA 3JVVA 3ETDA 4QGBA 2NTYC 3AHFA 2Q4DA 3AUTA 3ECAA 1O6ZA 4JLSA 3IBGA 1JVNA 5IYZB 5T67A 1S8NA 3AEKA 3RAJA 3TBFA 2OV4A 3K6SB 3SM9A 1WF6A 1GZ5A 3CN7A 4IJ5A 2DP4E 2R7LA 2FZGA 2DHEA 1MAVA 3ZBPA 3ZEIA 5ERXA 1PJCA 3V9PA 3CH6A 1XJQA 1GAEO 2YASA 4LRTB 1ZYUA 3OEED 4YUZA 1F0NA 2BHLA 4CMJA 5C5DA 1SHLA 4URWR 5LM3A 4DV4B 3SX4A 1HE5A 2GN0A 1U4OA 2JCVA 1DDOA 4QPEA 2NIPA 1SWVA 3EPPA 3HVKA 4IR7A 4X95A 4AMBA 4DC1A 1NF8A 2G3YA 1GKKA 4QDUA 3R0IA 4YDHB 2B37A 2ZI9A 2F1JA 5CFZA 4Q12A 1CNFA 1NDQA 5TGTA 2IYWA 1NVAA 2G76A 3KJHA 3ROXA 1VBMA 4EH1A 1RXVA 5AM3A 5B58C 3ERCA 4YMWA 4I4TF 2Q8QA 3ZLBA 1JBKA 4EYQA 2AR7A 1DAGA 2R6JA 2PGJA 5EV7A 3C1OA 1OTXA 3CNLA 5KYYB 1NUPA 4GPAA 5HTOA 2O2XA 4MR7B 2BGGA 2B9VA 2HXYA 1R0ZA 2X8WA 3HW2A 4MGHA 1Z0AA 1OLXB 3ZJUA 4QTTB 1QIGA 3K31A 3LBYA 4G0PA 1UPTA 4B45A 5JEEA 1ELOA 4PRYA 1IVYA 4BZZA 4PYJA 1C8VB 1V96A 2X9VA 3KZ1E 4QYXA 1IUKA 5CB4A 2NSDA 4JEHA 5J4VA 2IITA 3IKVA 3EH2A 1K1EA 1W36D 1A82A 2DQMA 1CRWG 1DEXA 2NZWA 3EDOA 3F49S 3HUEA 2ZUTA 2H2IA 4KV7A 1NURA 1V1RB 4MQLA 4P82A 2FR8C 3H2GA 3KB6A 4C4YA 1C7QA 2VP3A 1CSEE 2GZHA 4J1TC 3OU2A 5EFZA 4XDZA 2VJAA 1QYWA 3O90A 2CHEA 2X2PA 4AS3A 3MJCA 4BVGA 2PGIA 1ADFA 1D2GA 4DWOA 5B6JA 2GBLA 1P0CA 1FNSA 1MW9X 1QDEA 5GVRA 3EXIA 1KRXA 5KVAA 1BW9A 3CIOA 2V8OA 1XWWA 2HC9A 2JFQA 2P4UA 3H6KA 1T2DA 4WVFA 5E1DA 1Z47A 2CLFB 4L4YA 1NQ5A 2VRWA 5GVSA 1OXTA 2QENA 3LUDA 4NE7A 3H1PA 1KTVA 2XECA 4MRMB 4UVEA 3MINA 3WHPA 5BWMA 4LHZA 1OFUA 2RH9B 2ACKA 3DDCA 3PENA 2V5UA 3V7NA 1BCRA 2WTXA 3KOZA 1VMKA 4BRUA 1M6WA 4WOJA 3G2HA 4O2RA 1ULUA 2VH1A 4ONEA 1K5HA 3RPEA 5BRAA 1A8HA 1J2RA 3JWJA 2VHWA 1ATIA 3GPBA 3HWSA 4OGFA 2BH2A 1XVUA 4I4CA 3FZQA 4KXXA 4DOMA 2WG1A 3PNOA 5KQSA 3IHKA 2Q6VA 1U3TA 2C94A 3ADBA 1T8WA 1Y5NA 4LY6A 5L3ZA 4ICIA 1Q3TA 5GONA 2PO7A 5TS2A 2IH5A 2O8DA 4QDOA 1W96A 1HDEA 3ZZNA 1R5BA 3VVMA 1CY6A 5EIEA 1TTHA 3DZHA 5KNBA 1PP4A 2WSYB 1VKOA 3L0PA 1NVUQ 3UB4A 3BIWA 1T4BA 5IRCD 1J0CA 3VTZA 4JT2A 3HSSA 3Q3IA 4GICA 4DNPA 4KQ1A 4CM3A 4QBIA 5DT2A 4NESA 2EDCA 4M9ZA 3NXKA 3NAQA 3WB0A 1E2MA 3VH3A 1ZVJA 2IHJA 3DZFA 1FFWA 4M54A 1XDSA 3SZOA 4J0CA 2D1YA 4BO2A 3IMGA 3EFHA 2X9LA 1F8FA 3LQFA 1QJCA 3I05A 4WKCA 1VYVA 4ARCA 1S8OA 1SXJA 2IOFK 4PSUA 1CLUA 2Q5QA 4GYYA 5HQTA 3B1KA 1NNUA 2FFJA 3R44A 1G7SA 4XAQA 1NVFA 2NXWA 3QU4A 4FNGA 5C8YA 3TEJA 1UANA 3U3OA 2LKDA 1D09A 1W87A 3NEAA 3WQQA 5FPKA 4WEQA 5AT1A 4HADA 3AONB 4FMCB 3FTEA 2GXSA 4XNAA 2B3TA 2I54A 3CX6A 5PNTA 1WSWA 1IPFA 1LVGA 2VJOA 3WK4A 1EK0A 4OFXA 4QULA 4FLOA 1B8OA 2AYZA 4NLLA 5TE9A 4U7HA 5KINB 4JYBA 4BMDA 2O8EB 2WC1A 5LA6B 3VYRB 5KWJA 4F93B 2I2FA 4C4XA 5AR1A 4F9FA 1ZQ1A 2HN9A 1EPUA 2JLSA 3EVNA 3FXAA 3ZQUA 1N33B 2G1UA 4IVQA 4C7BA 5AM0A 4C4TA 2TS1A 2OR3A 4N6OA 1B0AA 1OLOA 1NG1A 5HK9A 3ZV3A 4M4SA 4HPWA 1WIWA 3I1JA 4GWLA 5G1NA 4UE3S 1EJ0A 1ZU4A 3PQFA 1CJSA 1I2CA 1Z5ZA 1RI3A 4OPMA 2A7OA 3C24A 5A3JA 4JI4B 7ADHA 2SHKA 3E4DA 5AJTA 4HN2A 5TJ9A 5HUJA 3BWDD 2QY6A 4HF7A 1B4DA 4UZEA 5EHIA 5AVWA 2EFCB 3PQ6A 1XTRA 4O5OA 1DKQA 2YCLA 1NR1A 2B21A 2GNOA 1KYIA 3K0EA 3STTA 3X3HA 1UCFA 1XU9A 5A62A 1DBRA 1VPVA 1NULA 4BNLA 2XE7A 3FNIA 1JA1A 1R4NB 2QD4A 3C3MA 3Q7RA 1J7KA 3UMYA 2NV0A 3HM9A 3GG9A 4O0MA 5E4TA 1BE6A 1L7QA 2ZBGA 1YZFA 4ZTZB 3QPAA 4DR2B 3RH0A 2PGGA 1ILEA 1LLDA 1I13A 1SC4A 4K6KA 2O05A 3GL9A 3R74A 3H1BA 2VF2A 3L6CA 2UAGA 4AJ4A 3KVOA 3TO5A 3PUHA 2CFRA 4FLRA 4LOIA 4K8RB 5JANA 3VKGA 1GAJA 2DQKA 3HBFA 1GTMA 2PX3A 3Q10A 3B60A 3IV7A 4KDFA 4UJ3A 3WKBA 5K6RA 4IIYA 4JSTA 2VJ8A 5TVKA 1TW3A 1E9EA 2A92A 4L3WA 1RZRA 1QLWA 1MVYA 2OCXA 2XZPA 3PRYA 3NZEA 2OXTA 1Z9BA 4JK3A 4R1QA 1E89A 2O2ZA 2R48A 2AI1A 3M4JA 4FR2A 3OOSA 1AGXA 4R2XA 3WMWA 1VI5A 1QK3A 3GK3A 3OH8A 1MIOA 2BP7B 3L4JA 2PCLA 1NAIA 2WUEA 3JV7A 4LNUA 2F17A 3UG6A 10MHA 2I6SA 1GM5A 1V6AA 1MC8A 1XNHA 2BCGY 5KSWB 1EK6A 5LMCA 4ZIRA 3WMFA 5K8VA 4JYZA 3IUMA 5CIQA 3ZR4B 3DOJA 1ZD3A 4I1OA 1QB8A 1V2GA 1TU3A 3ZHQA 1P9NA 4O2AA 3FTCA 4MAAA 3DMGA 5K3EA 5IMSA 2V4ZA 4R8SA 2NQ8A 2FX3A 1B42A 3IULA 1KP2A 3MILA 4IIJB 5AM1A 2IYNA 3FFXA 4CHTA 1J7JA 3K9BA 5LDHA 1PZFA 2F00A 2R0QC 2F1KA 3W2TA 4BC0A 4RH1A 4PRZA 3DPIA 4O0LA 4UUMA 1T9AA 4BY9E 1DEAA 4LJAA 2W6CX 4HVTA 1C1XA 1XJ0A 2HF2A 4Y1GA 3I6YA 1YZ3A 4TXJA 1T5OA 3KKLA 1T0UA 5JSUA 1XF1A 1YXMA 1M6NA 2FSPA 1C3XA 3OAAA 1FMLA 3NVKI 2R5FA 1BWQA 3FF1A 3PA6A 1XP5A 1XCOA 3PEUA 1UEIA 1UEJA 3DVQX 4L6AA 4IHQA 4G5SA 4N7BA 1HFKA 7GPBA 2Q7OE 1Z36A 1GZHB 2H4XA 3TEFA 1JEDA 5JCZA 5MGBA 3H2HA 4HGNA 4Z3DA 3U56A 1WCXA 1CDOA 1QIKA 4EJSA 1EE9A 4XN9A 4YI3A 3EAQA 2HU2A 3OY2A 4RVFA 3ZOKA 1WABA 1KI6B 3DZDA 1VCIA 2PA0A 2Q6IA 3QE3A 2WJYA 3KYJB 1I0IA 3HG7A 4MWSA 3WTCA 3QY9A 5CFRA 3A4TA 4ZVSA 4KFTA 3AEUB 1Z4OA 4KR9A 3KBBA 2XTJA 1JR3D 3NTXA 5BN3B 3FCYA 4R7ZA 5CB4F 1DLIA 3O8OB 3K6JA 3JY6A 1OSNA 1QP0A 1CETA 4ND5A 4QDXA 4QPCA 1ZW1A 4DMGA 1ECJA 2CFOA 3U4DA 1R0BA 2Y67A 3CKLA 2P2SA 2QYTA 5BQOA 1KDOA 2IVFA 3NWEA 4ZICA 4YPVA 2JDIA 4QWMA 1SK9A 3LKBA 2IA5A 3DBLA 4RK7A 4EB8A 3GD7A 1EDOA 2CF6A 3H2BA 4P2BA 1EWTA 4B48A 1LPNA 4EP1A 3MHPA 4BP9A 1AIPA 4DY6A 2H1FA 3WWZA 3OIDA 1B93A 4L4SA 5JADA 5HBGA 2YZGA 4F5WA 2VT2A 2PYZA 4FYWA 1ZCZA 3COWA 1ZBDA 1E9FA 1HT0A 4DLPA 1ECPA 3KJNA 4J4TA 4YACA 5K0FA 1NY5A 3ZJYA 4DM4A 3IDSA 4Z4EA 1ZJYA 2ZCVA 3PTLA 2ZT8A 3MLAA 1P61B 5E95A 3PE6A 1ORVA 1RSZA 1RQRA 1VHJA 3BC1A 4S1VA 4DSUA 1YKFA 3JZDA 1KYWA 2PKQP 3RVKA 1KEVA 3VX3A 1UC8A 4FX5A 3RANA 5AVXA 4HNQA 1QJ4A 5IVHA 4XOUA 5DM70 2OBYA 3Q98A 4FXOA 3TDKA 3BWCA 4ER7A 2V0GA 4BP8A 2BI8A 3DOIA 3VU9A 3LNCA 2ZAYA 3NOOA 4GBGA 1F1BA 3CPSA 3EGEA 4KHZA 4LVCA 1VL5A 4UE2A 5J63A 5GONF 3DMNA 2LE0A 3TMKA 2RCYA 2FE4A 4NU0A 3M4YA 2DTXA 1CZNA 3HL4A 4Y2YA 4N3BA 1KTIA 4Q47A 2DH6A 2D0OB 3SJUA 1HXHA 1ZAKA 3H4VA 3G23A 3F9CA 2OQ2A 4G8CA 1MB3A 4EAAA 1LRJA 2JGKA 2G9VA 2YNMD 3C0KA 5L4NA 3CUKA 4ACAA 4EGSA 2YINC 1H1LB 3QMMA 4EJ6A 2P9YA 1JPUA 4N3AA 5A9SB 1Q17A 2ETVA 3ISJA 5IH7A 2EBUA 5J5CA 5TNXA 1X38A 1QH0A 4L2LA 3GCWA 4DLLA 2ARKA 3RVBA 4GC9A 1USKA 4OI1A 3KAPA 2HT6A 1N7JA 4NZ9A 4CM4B 3LKDA 4MQUA 2VCHA 1XTPA 3EXHC 4K40A 5C8YF 4G07A 1NU8A 3WLAA 1TU0A 1LQ2A 2OFPA 1Y3FE 5IJ9B 3IP8A 3MAGA 4AJNA 2GO7A 3W9UA 4MQFA 1M0EA 2GBIA 2XHEA 3D81A 5FUVA 4MV9A 1FB5A 3RS0A 1KYVA 1WV0A 3DF7A 1JFTA 4H08A 1JLKA 1L4NA 4N40A 2Z1MA 1XDDA 1XE3A 1KXJA 1U8FO 3B7RL 3EG5A 2FEXA 1LZKA 1BX0A 5C34B 2JLCA 2X0EA 4UPEA 3STHA 3FPAA 2C9ZA 3BD9A 4X3CA 5DM4A 2Y0PA 2H5IA 1QHIA 3TKAA 1MOZA 3NOXA 5MHTA 1KJ9A 3GEIA 2YQ4A 2ZRGA 4GOKA 1OKKD 1QCYA 3A9TA 3EGCA 3I3OA 3LF1A 1NNLA 1CX9B 2B98A 2GI4A 4K9PA 4U3JA 4XYEA 2Y71A 1ZNZA 4FWTA 1HZZA 1R9GA 5IK2D 1E6LA 1OWNA 3HJNA 4LMRA 3EH1A 4J0JA 3F4BA 3OOYA 3V4LA 4D6PA 1ZLXA 1KXZA 3L04A 4OD0A 5J2TF 3EXG2 4TS3A 1RYYA 1I14A 5CPFA 4YTEA 1X7YB 2XIQA 1TQ6A 1F9AA 1HL3A 3EVZA 4JNCA 4LJLA 4OLJA 4G0NA 4INOA 5C18A 2IH4A 3LUCA 3KWFA 3JQAD 4JU9A 3NOVA 1Z2DA 3ICQB 2EX1A 3G85A 1PKXA 4QTYA 1I1QB 3RVNA 1AKNA 4ECEA 5C80A 1KE2A 5BOSA 1G64A 2PLFA 2IYXA 1CUCA 2DWCA 2WYWA 4Z2YA 2PXHA 3U0BA 5LKAA 2H2AA 4FDAA 4X24A 5CW1A 1J6UA 5A4FS 4I3FA 2O0JA 2WV9A 4Y1FA 4BEWA 1QVAA 2FU5C 4LVOA 4GM4A 1CUWA 4Q01A 4RY2A 3VI3B 4DCPA 4GL4A 2CDNA 3GA5A 2WKSA 2F1OA 2PS3A 2VF4X 2LCQA 3TBKA 2CDCA 2I7CA 4PYMA 2BFFB 2UYOA 1RYMA 1NJFA 2GSDA 3ZWOA 3QFCA 2HBRA 1QF9A 3EIFA 3H86A 1MP0A 3TF5A 4MQEA 3A26A 1ENPA 4D0SA 4WT7A 5KX5A 1V1JA 3JVDA 4DLKA 1RC1A 2AFHB 4BJ5A 4R1NA 1YCHA 4RD3A 1SXIA 5L4SA 2WTAA 2C7QA 1LDEA 4P7KA 2WD8A 1C5KA 4HZUA 3F5SA 3QKWA 2AJBA 1VHQA 1AD2A 3IKMB 4HRXA 4O2AF 5K3FB 3SQOA 1N3LA 3LBFA 1JXQA 2ZRAA 3GCGA 4RHEA 4BQIA 3U4QA 2J45A 5D6NA 4JI7B 3FTQA 4FOSA 2P1RA 5IJXA 1EA7A 5JFGA 1NQUA 4Q3AA 2SECE 3W2FA 3WLSA 3KT3A 3FDIA 4QXAA 1YCFA 4MAFA 5CCBA 1UJMA 1VKHA 2A30A 5C3MA 2WU4A 4BS9A 1FFXA 4MVJE 3EULA 3BRWA 2CE7A 4MPTA 2XAAA 3OEHA 2QU7A 3DM5A 2EGUA 1IONA 2VH5R 4NJMA 3TL6A 3T5DA 5L45A 1BJTA 1IZ0A 4QSMA 1DNPA 1ENYA 5BSHA 2GHRA 1RWMA 4ZT7A 3QPWA 4Y2XA 1IZ8A 1Y9EA 2F64A 4UHHA 5U1PA 4XQ0A 4E12A 1AHHA 3C4VA 2Q5OA 1J24A 3IUNA 4TLEA 3UQZA 3DXFA 1SBIA 5BSGA 2JCBA 2WOJA 4RKWA 3RTEA 1Q21A 3NLLA 3ZXSA 2VAWA 3R6GA 1TC1A 4JKOA 4UEQA 4XX0A 5LNK1 2IYRA 3DEIA 3HQ4O 3UOGA 5KKNB 1XCMA 3FPGA 4TMFA 4ZI7F 4V0RA 1T6NA 2OHGA 1W5TA 3FTDA 1C1HA 1U2SA 3DAFA 3NNSA 4KO3S 4ME6A 3V1YA 4CM9D 5KO2A 1QTQA 3KLNA 3ZI4A 3R8CA 3ANMA 3OY7A 1FFBA 4B81A 4ALJA 1ZUNA 2ZTSA 1KQPA 4XSHA 3PFNA 2HHLA 2C3YA 2O4UX 4BBAA 2QBYA 1JFRA 3MXTA 4CHGA 1FPQA 1I3LA 2VCYA 2ODBA 4KACA 3T34A 4B6OA 3SXUA 1X7WA 3NALA 4CM5A 1WXHA 3EC7A 1I2AA 2BGRA 2QGZA 1G63A 2E48A 2PH1A 4BRSA 1M73E 2DHRA 4ZAFA 4LI3X 4PFKA 5DLYA 2YV3A 2G9NA 4B09A 3BCUA 1GKIA 3HLKA 5AJHA 4FGKA 3DPUA 3F78A 5AVVA 4G4GA 4I2VA 4I81A 2HA0A 2J9XB 1IB6A 1NW4A 1M1YE 2YHAA 4F21A 3VU1A 4X45A 3AHGA 1GILA 3EF0A 2XMGA 1SCJA 2NO9A 5JEDA 3L18A 4EPRA 3GU3A 5KQPA 3ECCA 3OE7D 2P4QA 3Q3GE 4TV9A 4I50B 3EBIA 4KU4A 3GX1A 1WCIB 3HV2A 3KAJA 4KXNA 4BIIA 4CMGA 4DR3B 3CUEF 2BEVA 3D0OA 1P44A 2ZE6A 1QH8B 2WWTA 3WLFA 5DRTA 2Z6AA 1EVJA 1GCOA 1NR7A 1GPMA 2X6TA 1IJBA 3P19A 5ESWA 3ZWPA 4HAZA 2ERYA 4OJYA 1ZM3A 3PQ4A 2NTJA 1NMEA 1VLZA 4AQ7A 1VPTA 1L4KA 3H9QA 4JLAA 4KL8S 4E1AA 1JNYA 2HCRA 2PMKA 4DDWA 3GGGA 3QXCA 2GPTA 2VUTA 1EUCA 4UM8B 1KVQA 1VCOA 2VJKA 3AV3A 3OMLA 8AT1A 1UXJA 1KJYA 1P9LA 1Y98A 3DHYA 3GMIA 3P9XA 1E1QD 4QXQA 3SDSA 3SP1A 2B7LA 3WAJA 4N5NA 2XTNA 1CE8A 2ORYA 3B12A 2ZRNA 1P2TA 1Q1EA 2ZYWX 4TVBA 5THQA 3RVDA 4X7BA 1TB4A 3IUQA 3OOWA 1R6DA 1X8KA 5BPFA 5I7RA 1N6PA 1R8SA 2HQBA 4KBYA 4ZEXA 4BZPA 1NU6A 1PYGA 2AWOA 3FVWA 2PIAA 3BGSA 4J4HA 5ALGA 3L6DA 4N9QA 4ZAYA 1S1CA 1J4AA 3UMJA 3ZV6A 1AKYA 1G0OA