2PL5A

Crystal structure of homoserine o-acetyltransferase from leptospira interrogans
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
362
structure length
362
Chain Sequence
GSIGIIETKYAEFKELILNNGSVLSPVVIAYETYGTLSSSKNNAILICHALSGDAHAAGYHSGSDKKPGWWDDYIGPGKSFDTNQYFIICSNVIGGCKGSSGPLSIHPETSTPYGSRFPFVSIQDMVKAQKLLVESLGIEKLFCVAGGSMGGMQALEWSIAYPNSLSNCIVMASTAEHSAMQIAFNEVGRQAILSDPNWKNGLYDENSPRKGLALARMVGHITYLSDDKMREKFGRNPPRGNILSTDFAVGSYLIYQGESFVDRFDANSYIYVTKALDHYSLGKGKELTAALSNATCRFLVVSYSSDWLYPPAQSREIVKSLEAADKRVFYVELQSGEGHDSFLLKNPKQIEILKGFLENPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of homoserine O-acetyltransferase from Leptospira interrogans
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Transferase
molecule keywords Homoserine O-acetyltransferase
total genus 122
structure length 362
sequence length 362
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.110 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2pl5A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pl5A01
1Y7HA 5EFZA 4DNOA 4G8CA 3H2HA 2XMSA 4MXDA 3WK4A 2ZSHA 3O95A 2WUFA 3I6YA 4JUIA 2PPLA 1EX9A 5K3EA 2PSFA 4F0JA 7YASA 3D2AA 2PX6A 4FBLA 5DNUA 4QA9A 5ALEA 1R3DA 4P93A 5CT8A 3B3QA 2ZJFA 5HKAA 1CUXA 3DL4A 4HRXA 1F6WA 1TKRA 3SK0A 1A8QA 4GECA 5DYWA 5SYMA 1TQHA 1XZLA 2X8BA 3D0KA 3STXA 5KWIA 3WK7A 3ZV7A 2FX5A 1RYYA 2NW6A 2QOEA 1WB6A 3H1BA 4EA6A 3OG9A 5AO9A 4Q3OA 3DOHA 2OQVA 1WCYA 4FKBA 4EHBA 1OILA 4AXBA 5T4EA 5HF9A 1HL7A 1U65A 3PF9A 5AM2A 2XMRA 1LPMA 4X91A 4KRYA 1ZOIA 1CQWA 1C4XA 1L7RA 1JJIA 5A7FA 5DNWA 3KXPA 2HA6A 1VJ5A 1TCAA 4UBMA 4W1QA 1EA5A 3HABA 3VJLA 2BCEA 1LZKA 4BVKA 1DQZA 4AZ0A 3E3AA 1G4HA 2J3DA 1G66A 3ESAA 2HA2A 2DR0A 1HQDA 1BU8A 2OXEA 3G0DA 1QTIA 4UBIA 4AMYA 4DYHA 3I2KA 3IA2A 3EQ8A 1LNSA 3FLBA 3ILSA 5K3FB 3V1KA 3JWEA 5AOAA 1FSSA 3I6ZA 4H0CA 5K3FA 4B0PA 2GYUA 5AKEA 4N8EA 3DNMA 2Y2VA 3EIOA 1LGYA 2XDWA 2GBCA 3KWFA 4OU4A 3JW8A 1FFEA 5CH8A 2HRQA 4OB8A 4P92A 4G8DA 4DTCA 2OGZA 4W1RA 2GZSA 5DNVA 2XQJA 5ALZA 3I28A 1RWQA 4I4CA 3IB3A 4Y2PA 1LPBB 1CVLA 1XZEA 2FJPA 1IUNA 3H18A 5EIEA 1QO7A 3DL7A 4F21A 4RE5A 4B9AA 5K3DA 2B4KA 3FAKA 3R3YA 3G9UA 1N5MA 3OOSA 3IURA 2HADA 3AIMA 4UPDA 3WA7A 3WL8A 4IH9A 4HTAA 3FYUA 2ZJ7A 2DQYA 5J3JA 3BE8A 4P9NA 5E4TA 4PV7A 5HF6A 3WK9A 2QRUA 2QJWA 4L72A 2OGSA 2G5TA 5AJHA 3BF7A 1Q0ZA 5AM3A 2B61A 3L1HA 3TJMA 1WHSA 3A2NA 3A2MA 4QNNA 3VJMA 1LLFA 3G9XA 5K3CA 1FFAA 1EHYA 4HXEB 4G9GA 1AURA 1W75A 2WQZA 3R3UA 2XLCA 5E4JA 1IVYA 1QGED 4OU5A 3C6YA 3T52A 3NGMA 5LKAA 3DKRA 2RGUA 4EY5A 5FV4A 2CBGA 4GI1A 5HQ3A 5FRDA 2HA5A 2IIVA 1OCEA 3D59A 1XFDA 1J06A 3DDUA 4K6GA 5D7BA 1MTZA 3QVMA 4GWLA 3F9CA 4G4IA 5AI6A 3W9BA 1VLQA 5D3ZA 4A16A 4Y2UA 3BL8A 3MUNA 3SX4A 2WG1A 4IH4A 2OG1A 1XZKA 5AK3A 2YXPX 1THGA 4MWTA 2GBIA 1ZI9A 4E15A 3AZPA 3I2JA 2PL5A 5K3AA 2WFLA 5LZ9A 3AIOA 4ZGBA 1SCKA 4WY5A 4X00A 4QDZA 3LS2A 5HKBA 4X7BA 4BCBA 2C4HA 1XZBA 5LKRA 5ALPA 3A70A 4PQEA 2VJCA 2Z3WA 3O4HA 1PFQA 3STTA 1BN7A 2Y6VA 4J0JA 5CTAA 1VKHA 2JF0A 2VT7A 2WJ3A 4L3WA 3I2FA 2I3ZA 2XUOA 3W05A 1VE6A 3KOOA 3AUKA 4W9RA 4XJVA 4PW0A 4G4JA 1JMYA 2I03A 3VJKA 2VJDA 3O4JA 2BJHA 3FSGA 2C0PA 3FYUC 1DT3A 5AKIA 5IKXA 4AO6A 1S8OA 2W22A 4MQMA 3IBTA 2J4FA 3WIBA 5A2GA 4OD0A 1DT5A 4B7ZA 3HZOA 3CCBA 5LZ8A 4ZRDA 4BE4A 2HFJA 1BN6A 5ALDA 3WIOA 1CEXA 2DHCA 4W1SA 4KJXA 2Z8ZA 5CURA 4BZZA 3ESBA 2X76A 3BJMA 3HLKA 5AOCA 3WK5A 4WFKA 5AIBA 4X95A 1LZLA 3H2GA 3TEJA 5EIHA 1SOMA 2PVSA 2OCGA 1GKKA 4ZV9A 2XT0A 4FBMA 2RHTA 2VAXA 4AO8A 3KD2A 5CH3A 2XLBA 1AUOA 1XZHA 3W04A 4BDSA 4BVLA 5ISMA 4ZXFA 1DWOA 1YA8A 2ZYIA 1XZJA 3DEAA 1H2YA 3DD5A 1ZI8A 3CXUA 4LKOA 4EBBA 5ALHA 5JAHA 5CH5A 3CN7A 2XQFA 4MYSA 4QEKA 3MGAA 4QDUA 5JYCA 4J0CA 2WHRA 3WWPA 3WK8A 5I7UA 3CCCA 4G1FA 3LIPA 1ACLA 2H9YA 5DYYA 4DNPA 5F4ZA 5HQ3B 5ALVA 3ICVA 5ALUA 1CQZA 1KEZA 4WCVA 1VA5A 1J2EA 1N1MA 1Z68A 1XRPA 3C5WP 5KWJA 2OCLA 4L9AA 3DS8A 2AJCA 4AX4A 4X6XA 1B41A 2WIDA 1H2ZA 3IUMA 4EUSA 4AB1A 5K5EA 2PSDA 3NOXA 2XUGA 2ORYA 3STUA 5KBYA 4MEBA 6YASA 2OAGA 1R9MA 5JAOA 2WG0A 4H7JA 2XMQA 1YS2X 1QTRA 2DFPA 3ZLVA 4KE9A 1PV1A 5JIBA 4UBKA 4Y2QA 1TAHA 3WJ2A 2B9VA 4I3FA 1BRTA 4N5IX 3WJ1A 2WM2A 3WMRA 3AILA 4LYDA 3VVLA 1XLUA 3FYUB 3WZLA 4BCDA 4FFVA 1CUUA 4C88A 1WHTA 1F0NA 4UHCA 4O08A 1UZAA 1ZI6A 4QE3A 2QUBA 5EHZA 2HIHA 5CT9A 4MYDA 3H17A 3UMJA 3WYDA 5AKHA 4BRSA 1YCDA 2QMQA 2QXTA 3FVTA 4UFPA 5AOBA 5AICA 3ANTA 1ZD3A 1BCSA 2Y1KA 1LBSA 2JEYA 4RE6A 3F8SA 5C8ZA 1UKAA 1ODSA 4X94A 2VT6A 5CXXA 5D6OA 1CUFA 1K8QA 3WA6A 4HAIA 4Y9SA 3C45A 1XROA 1W76A 2ZYHA 3OTQA 2DHDA 4M0FA 3D4LA 2XMDA 5HF8A 5E2IA 3CN9A 4Q3LA 2EDCA 4QDOA 3KSRA 3E0XA 3ESCA 2WHPA 3KWJA 2QT9A 2HL6A 1F0PA 2WJ6A 4NMWA 4C4ZA 1VOTA 1IMJA 4UHEA 4NS4A 2GYVA 1C7IA 4XX1A 3RLIA 2I78A 3V9AA 2O2GA 1W1IA 4ZI5A 1J07A 4HZGA 5FUMA 2XUDA 1CUZA 3KDAA 1XQWA 5A62A 3O9VA 4H7KA 1JT2A 4ZWNA 2WLSA 4Y7DA 5AI8A 3PF8A 3FCYA 3G9ZA 3BIWA 1RP1A 5KREA 3N2ZB 4K2AA 4XWGA 3WWEA 4L0CA 1ORWA 2J4CA 1H22A 1DTEA 5IVKA 1FFCA 5ALIA 3BDIA 2H7XA 4AZ3A 3EF3A 2QXUA 1W4LA 1ZJ4A 3R40A 1EK2A 4BTLA 2O7VA 4WDRA 1ZD4A 1QIMA 4JEIA 1QIEA 4B81A 2VATA 2I3DA 5DJ5A 2HFKA 4TGLA 2QZPA 3RK4A 4WFIA 1ZD5A 4C6HA 5JD4A 3BDVA 2YYSA 4C01A 2DSNA 1K5PA 5A71A 3F67A 3F96A 4FDMA 5FDFA 1UXOA 4UHBA 5AM1A 3TGLA 3S8YA 3VKFA 3I1IA 1AKNA 1ZJ5A 3WZMA 4C4XA 4UHDA 1Q83A 2Y6UA 3HEAA 3BXPA 1K63A 2PBLA 3LLCA 4WJLA 1QIFA 4HRYA 4OB6A 1VXRA 1IZ7A 3G0IA 4G4GA 4DM7A 4ITVA 3QYJA 2V96A 2HU8A 5ALWA 4Q1VA 1UWCA 1THTA 2WJ4A 4E11A 4QLAA 3STYA 3WWOA 1UOOA 2EDAA 3I2IA 3C70A 4Y2TA 3IUQA 5LZ5A 1ODCA 4GEGA 1ZIYA 2WIGA 2PU5A 3F97A 2QM0A 4FLMA 1I6WA 4H77A 4CG3A 4H7FA 2AJBA 2K2QB 2PSHA 5YASA 2XQIA 3C6XA 3QPCA 2H7CA 4ZV7A 2XUPA 1QIGA 1A8UA 1MAHA 5BOVA 3D2CA 3EQ9A 1MO2A 3AJAA 2CZQA 3GELA 4RGYA 4M0MA 1U4NA 2XUIA 4TPKA 1AX9A 1USWA 4GXNA 1UOPA 1WM1A 2RIPA 5AM0A 2CUTA 3G0CA 1QE3A 1JI3A 4WFJA 3WWDA 3GUUA 4Y2VA 1ZD2P 1UKCA 2CB9A 3M3DA 2WHQA 1XKLA 3Q8WA 2E3JA 4UUQA 4BAZA 3S2ZA 1YR2A 5JZBA 3E1GA 3WKBA 1E66A 4FFWA 5HFNA 2XI4A 1GPKA 1DWPA 3ICWA 4KAJA 1SC9A 4Q82A 1ORVA 4B0OA 4CCWA 2JIDA 1R9NA 4UBJA 4RNCA 3STVA 1YSCA 3RARA 4PF1A 4EY4A 1QIHA 2IX9A 1UK7A 1GXSA 2VF2A 4B6GA 4PSUA 3WLAA 1MNAA 2R11A 2VJBA 1UK6A 1CFJA 4HXFB 3D3NA 3O9MA 3L1JA 5FXMA 3OPMA 4F5ZA 3VISA 1CUEA 1UKBA 4EY6A 1QONA 1SCIA 2AJLI 4BZWA 2ZSIA 2ZVDA 2HA7A 4DSZA 3STWA 2ACEA 2XUAA 2WTNA 5BWCA 1LPPA 4I19A 4U2DA 1G5FA 3IUNA 3C87A 4ARBA 1YB6A 2HA0A 1UFOA 3G9TA 3Q0TA 5T4HA 5C81A 4Y2JA 3A2LA 3IULA 4EY7A 3RKSA 3DYVA 1QIJA 3W9UA 5JZSA 1E3QA 1E8MA 3ZLTA 4YPVA 4B85A 2JGLA 1CUJA 2XMBA 1N5RA 4BAUA 1TCCA 1GPLA 1GQSA 1MU0A 4FLEA 1CUIA 5EHNA 4EB0A 5AP9A 1ZGBA 4X90A 2JGJA 3B12A 5AK6A 5AKGA 5CT5A 2VAVA 2Z3ZA 5JATA 1EXWA 3W2TA 3K6KA 2WTMA 4HVTA 1Q0RA 1TK3A 3WL5A 4BCCA 2WILA 3I2GA 1XZFA 4B83A 3V1NA 4TVKA 1YASA 4Y2RA 1O6FA 1X2EA 1CUVA 1LPNA 5FP0A 3BWXA 4IHAA 3FOBA 2ZYSA 2WIFA 2FUKA 4JNCA 4LHEA 3ZLUA 4CIBA 5DWDA 1A88A 2HU5A 3FWHA 1BE0A 3WL7A 1MPXA 1AC5A 4X3CA 2ZYRA 3U1TA 2CKMA 4YX9A 1U8EA 1MN6A 2VA9A 3DCNA 3R0VA 4BB0A 4J03A 2AJ8A 2WUEA 5AM4A 2CEKA 1XQVA 1UT6A 4AN1A 1O6GA 5AI0A 4CG2A 2CMFA 4AO7A 4A5SA 4N5HX 2XMCA 1DX4A 2O7RA 4KE6A 4KEAA 5ALSA 3OC0A 3K9BA 4ARAA 1VE7A 1W6RA 1X2BA 3HRHA 4Q05A 5JD6A 4RPCA 1IUPA 5ALKA 4PSCA 1A8SA 2XMGA 5FPPA 4H35A 3IIIA 2LIPA 2WU4A 4G8BA 2BUCA 4E46A 4AN0A 1GQRA 1AGYA 4LYEA 3RM3A 5DYTA 4FWBA 3PUIA 1GKLA 4OUKX 4GBGA 1CUCA 2JGKA 1WB4A 4BP8A 1QJ4A 4CG1A 1C7JA 4M0EA 1QO9A 4OYLA 5SYNA 4IO0A 1X70A 4DGQA 3IDAA 3FNBA 2H1IA 2WU3A 1QZ3A 2EEPA 4J0IA 4KACA 4OB7A 4H7IA 3LP5A 3FSGD 4OSEA 5JD5A 1BS9A 2HRRA 2RI6A 2HM7A 2O2IA 4JYMA 5IVIA 1EK1A 5ALMA 2YH2A 4Y2XA 4K5QA 4QDXA 5CXUA 1ISPA 1LBTA 2WUDA 2GYWA 4DLNA 3AINA 5IVDA 4QWWA 4IH1A 5AI5A 3PE6A 5LIPA 1ZICA 3H2KA 4XIIA 5EHQA 3SC2A 2V98A 5JARA 4BDTA 3N0TA 3GZJA 5LZ4A 2PM8A 3FLEA 3PICA 1L7QA 3T4UA 2QJRA 1FJ2A 4C4YA 3VXKA 3HC7A 5A7HA 1QFMA 5AKYA 1EDBA 5JALA 2VQ6A 4N8DA 3C8HA 4Y2SA 3WL6A 3G8YA 1CUBA 2CJPA 3MVEA 4GLBA 4J0DA 3G0BA 3PFCA 3PDCA 2V9ZA 1U2EA 1QIIA 4FLFA 5LZ7A 4QLOA 1XLWA 2OQIA 1JMKC 5C7YA 3BF8A 3VVMA 2WFLB 3P2MA 1XQYA 4BVJA 2XUKA 5CW2A 1IZ8A 4GDMA 4DMKA 2FJ0A 3B5EA 3QMWA 3HXKA 5BWBA 1YAHA 4MQLA 3A6ZA 1Y37A 3G7NA 4UHHA 5ALYA 3I2HA 1NU6A 3DLTA 1EB9A 4AQDA 1HBJA 5ALJA 2J3QA 2PSEA 1UK9A 5ALQA 2W6CX 2JBWA 4BAGA 2C7BA 1LPSA 1MX9A 2VSQA 4QWMA 4CI9A 3R3WA 3O0DA 1CUWA 1HKHA 2AJDA 3ZPXA 2JGFA 3HSSA 2GBFA 5DTJA 5I9IA 4U2CA 1SCQA 3EBLA 1XZMA 4LXIA 5EIAA 2BGNA 2HHAA 3SWWA 3YASA 4BP9A 1GPNA 1H2XA 3VDXA 1N8SA 4QZVA 5LZ2A 3AZQA 4FOLA 3NUZA 5JASA 2B20A 1PJAA 4UFNA 3WK6A 3L1IA 1MAAA 3AFIA 2RONA 2D0DA 4B9EA 3R3VA 3ZI7A 2XUHA 1E5TA 3D5EA 4LXHA 4UBNA 4OPMA 3W06A 2XUFA 4J3JA 1L7AA 1CUHA 1JKMA 1XLVA 4J0GA 3D7RA 4JYPA 3H2IA 1XZGA 4X6YA 1WOMA 5AIAA 4EZIA 2QTBA 5HK8A 3QPAA 4D9JA 1GZ7A 3HJUA 2PUHA 5EGNA 1HLGA 2DQZA 5ALNA 1CUDA 4CCYA 1YA4A 1MT3A 5I8PA 5CBKA 2D5LA 1ETHA 5ALOA 1MJ5A 2QVBA 1QIDA 5AKZA 1JJFA 3AZOA 3QH4A 4BC0A 4U2FA 2G63A 2H7YA 1DWQA 1R50A 3H19A 2OLEA 1EB8A 4H7EA 3C8DA 3GFFA 5JANA 1HDEA 5AI9A 4BC1A 3M82A 1NU8A 2WIJA 3V1LA 5ALLA 1T4MA 4CIAA 1VA4A 4DSAA 4Z49A 1CUGA 4KRXA 5LP1A 1FFBA 3OURA 5D3KA 1XZCA 4NVRA 4IQ4A 3F98A 3DJYA 1OXMA 1VZ2A 3ANSA 4LXGA 1XKTA 5EI5A 5JAPA 1R4ZA 1YAJA 3M81A 1UOQA 1EVEA 4W63A 4G9EA 4DIUA 2C58A 4YASA 2XMZA 5CMLA 1W52X 1WPRA 5IH7A 3WKCA 1G42A 4YK7A 1EINA 1JFRA 4XVCA 2BFNA 2UZ0A 3PI6A 5HF5A 5JAUA 2V97A 4MJ3A 4JH0A 4BATA 3ED1A 2PUJA 5T4FA 2JGIA 3HYSA 4DMHA 3QITA 1XZAA 1EVQA 2HA4A 3QZUA 1A7UA 5T4BA 4FHZA 4DNQA 1P0QA 4X85A 4ROTA 1BCRA 4F60A 1DU4A 2G5PA 1WPXA 1QOZA 3M83A 5A7GA 4B80A 4PNZA 1CR6A 3R41A 5HZGA 1KU6A 3QMVA 2XUQA 1H23A 3DOIA 4FTWA 3H1AA 4KR0A 3WWCA 2JEZA 3E4DA 2C0QA 4OYYA 2OCKA 3FYTA 3HI4A 3WKAA 1EH5A 1XRRA 4B84A 1R88A 5ALGA 1FFDA 5HCUA 2ZJ6A 3H04A 1LPAB 3K2IA 5AK5A 1ZGCA 3WKDA 2GZRA 3IUJA 3UUEA 1TRHA 4FMPA 3FVRA 1DX6A 4HS9A 2BUAA 2OGTA 4X92A 2RHWA 1NX9A 2PSJA 4UHFA 3R3ZA 1GT6A 5DTIA 4P08A 1Y7IA 5ESRA 1TCBA 1EI9A 4J0HA 2QR5A 1CUYA 4H18A 4J7AA 2WIKA 4C89A 3O4IA 1XRLA 3PFBA 2BAGA 1EDDA 1P0IA 3U0VA 4W1PA 5FKJA 3NWOA 1BROA 5CT6A 4C87A 3DKKA 2WSLA 5ALXA 1CUAA 1D07A 2QUAA 1XRMA 5K3BA 2AXEA 2HA3A 1AMNA 4DMCA 1CUSA 1ODTC 4K6KA 5FLKA 5HK9A 4UBOA 1H2WA 1XZDA 2VEOA 1E89A 3QPDA 4QDTA 1HPLA 4ETWA 3WQHA 3QMMA 4A23A 2GBGA 1CLEA 2OPHA 4U2EA 4B82A 1LPOA 3FLAA 5IVHA 2ECFA 2Y2UA 4X71A 2Q0XA 5LLSA 4MEAA 5AM5A 3LCRA 5DLPA 4H7DA 4PSDA 4KE8A 2ROQA 1GGVA 3QBJA 1MNQA 1T2NA 2BKLA 5AKKA 3I1YA 4PO3X 3C6ZA 1TIBA 3WYNA 2WUGA 2VTVA 4Q34A 2OAEA 1M33A 1P0PA 5E4YA 4V2IA 1CV2A 4KAAA 2WKWA 1BEEA 3DYIA 4WY8A 4X6UA 3TRDA 1JU3A 4K6HA 1B6GA 1EDEA 4GHWA 4MWSA 1XRQA 2WG2A 3V48A 2DCMA 4BRZA 4Y2YA 2ACKA 2XQGA 3IVMA 2C5FA 4Q3KA 1E8NA 3BIXA 3H0CA 4DMFA 4KYVA 5FOQA 4U2GA 1WB5A 2Z5GA 2O2HA 4ZREA 4DNFA 3H2JA 1ACJA 3GBSA 3O4GA 2QS9A 1K4YA 3GA7A 3ZWQA 5C8XA 5HFAA 5AK4A 2WFZA 2BGRA 2WFMA 5CT4A 5LYYA 4LIPD 1JJBA 2ES4A 1QFSA 2Z8XA 4OCZA 5CRIA 1KU0A 2HU7A 2BUBA 4EY8A 3EQ7A 1MX5A 2DHEA 3D2BA 3G02A 1XZIA 4AMZA 5AI4A 1CRLA 4E14A 3MUOA 2RAUA 1CPYA 2XQKA 1K6EA 1IUOA 4UFOA 1J1IA 5JADA 5ALTA 2P8SA 1JU4A 5AH0A 2OCIA 3DQZA 2G4LA 3UUFA 4FNMA 2QKYA 4UBLA 4WDQA 1SFRA 4INZA 5FPQA 4G5XA 1P0MA 2XUJA 2PU7A 4KAFA 5AHXA 1R1DA 4J0KA 1XQXA 3WI7A 5C8VA 3I6MA 4H7HA 2VJAA 2HDWA 1AQLA 4GW3A 4BE9A 5JZ9A 5H3HA 3GROA 4BYMA 3WKEA 3AIKA 4CCYB 1DINA 2PKYX 5AKXA 3FCXA 2JGMA 3C43A 3LIIA 3BJRA 2X5XA 1BEZA 2C5GA 4CFSA 1E8DA 4X93A 3FBWA 3QM1A 3PUHA 2XB6A 1MX1A 2IITA 1YB7A 2R8BA 2JGEA 4BTVA 3ESDA 1CIJA 1VXOA 4S0XA 3HACA 1VZ3A 1AZWA 3X3HA 1UK8A 1XRNA 5AKLA 1QLWA 4N8SA 2XE4A 1Q84A 2WHPB 3V1MA 5ALFA 5AKJA 5ALRA 5EHXA 4X97A 1YS1X 1DQYA 2YASA 3R3XA 4U2BA 3C5VA 4HXGA 1ZIXA 2ONCA 1QIKA 4KE7A 5BV7A 4FNGA 1F8UA 3JYHA 4BBZA 5A6VA 3C6BA 4NZZA 3G0GA 3OM8A
chains in the Genus database with same CATH superfamily
2GTPA 5DHPA 5JNTA 1CQJA 5EWJB 2GN1A 4M7WA 4ZT7A 5KDOA 3QVSA 1HG1A 3KWMA 4TMYA 3FCEA 3LX4A 3NDJA 3WYCA 3H2HA 4B76A 3FUJA 2JS7A 3RK0A 2QA5A 1YQXA 3MQ4A 1G8GA 1ZN9A 4M1ZA 2ADFA 2BL4A 3KUCA 4M49A 2R8OA 4JL5A 1GO2A 3S2YA 1GEGA 2WUFA 1SOVA 3VU8A 2X5KO 2YKGA 1IN8A 1EFUA 4A6DA 1OAKA 4QTZA 1W8DA 3OD1A 2C7QA 4JJAA 5K3EA 4AZTA 4ALJA 9ABPA 1YR6A 1QGOA 2J32A 1VMDA 3HN7A 3MS2A 4P36A 5IHPA 3K16A 4JB0A 2PX6A 4WOJA 4AXXA 4FBLA 4ZAYA 2CHQA 1IZ9A 2D62A 5EMJA 1BG6A 3PZBA 5DNUA 3GNSA 4DQLA 4HEJA 1P29A 4YUZA 4RESA 1D2EA 4YALA 3WADA 4WBNB 3KAKA 1G7SA 3TSYA 2VTEA 3UWOA 3CWZA 2P6MA 3DB1A 1E1QD 2ZJFA 4HSEA 4RJJA 3MYYA 3VO9A 2H3HA 2C31A 3JD1A 4HRXA 1T9KA 1U8XX 1PT6A 3LJKA 4DIKA 3SK0A 1ECBA 4P2GA 2HX1A 4KWCA 3HK2A 1W19A 2X2OA 5DVZA 3AG6A 3DKIA 3G6KA 3PUYA 2D2VA 5G2OA 5A1TA 2MINA 2E89A 2NO1A 3TR5A 3ZDZB 1PI3A 3L7CA 4MVJF 3ZV7A 1MVOA 4A0HA 1JQBA 5BMOA 2GSDA 1J8QA 2QMYA 3KU1A 2IPLA 2QTTA 3QXJA 5LP6C 3K9HA 4Q4CA 2F8SA 4PNPA 4GG1A 5JO9A 2ZB8A 2NW6A 5G0VA 3DT8A 2L19A 1WB6A 2DLDA 3ZWPA 3LVRE 1IRIA 1X13A 2I91A 2FPGA 4Q3EA 4JT4A 1PYDA 4EA6A 3OG9A 4ODIA 4ZOLF 5AO9A 1TTPB 1KKUA 3DOHA 3NWBA 2B98A 4GR4A 1QRSA 1NI4B 2Q0QA 4H1TA 5CG2A 2FFLA 4LX8A 3IV6A 3Q0EA 2ZCUA 3CTPA 4FKBA 1T1IA 4N01A 1X3LA 3ISTA 4IQ0A 5CVUA 4AXBA 4EHBA 2C8VA 3GC6A 3ZKWA 3WIUA 4MRAA 3RVQA 4C1BA 2G9NA 4G8JA 3AEYA 3KJZA 1U65A 4HZUA 4IQFA 4M1WA 1TM3E 4P7KA 2BRUA 1QFJA 4DLWA 4JI2B 5DNAA 3F49S 4YJGB 4LW8A 3S2EA 1FX1A 4ERXA 2X23A 4ZAXA 4YUYA 5FI5A 1UJCA 3NTOA 1QGAA 4X44A 5HLTA 3CC8A 1QP4A 3IIJA 3FHCB 1K7YA 3K4PA 1N3YA 1UP4A 1I3NA 5CJ2A 4W5RA 1YCFA 3FX2A 4OLHA 2WJAA 4QKQA 4KQ9A 4M99A 3QLVC 5J2TF 4MB0A 4BEVA 2JAQA 3FW1A 5KTPA 2CVHA 4I1UA 3SIRA 4YUVA 3TCNA 2IP1A 4H1UA 1C2YA 3QVGB 4I46A 1JLSA 1TCAA 2RI0A 1C3OB 1T5DX 4W1QA 2QD4A 4D5GA 3PZRA 1VJDA 3MWEB 4CDGA 1NVBA 1DVRA 4XFJA 2JIZA 2BEUA 1PR6A 3RV4A 1F2DA 2IWHA 4AP9A 4YYZA 3VJLA 3EFBA 3LECA 3GFVA 1OI3A 2P2GA 2XTAA 3TR0A 2B69A 1VCOA 3MTAA 3I0ZA 2Q5FA 4DMGA 3NNNA 1N2CA 3IV9A 1DQZA 3FPCA 1XJCA 3E3AA 3EXFA 3GARA 4TYQA 5TX7A 2O8EA 1G4HA 3KAQA 3L4EA 4XYEA 1U2QA 4BGIA 4YT8A 5JNSA 4QOEA 2FMUA 2R25B 2QTCA 5TEVA 1JG9A 5CNIA 4AROA 3OMLA 3EC1A 1QCZA 1HQDA 1U02A 2BEKA 2PCLA 4NJMB 2P5SA 1BU8A 2LNDA 1B8NA 2NYRA 3QWIA 4LTNA 4QEZA 3TKAA 2PAFA 1QLJA 2PSSA 1QHHA 1JR3A 2OXEA 2YJ3A 3HFRA 4BQRA 2X3FA 4MKTA 4LVOA 5DGDA 2DR3A 4CIVA 1FP1D 1MVLA 1Y7PA 2GR9A 2OQRA 5EN4A 2R6R1 4MPJA 4CQMB 4DYHA 3EG9B 4F1KA 1E18A 3QG5A 2NXNA 2YWDA 1YOVA 4FXOA 5EIOA 5KJ1A 3T0IA 4D0RA 1BHSA 2Z4TA 5K6TA 1MV8A 1R37A 2FN9A 3WQRA 2YOGA 3HVKA 3NC4A 1LNSA 4J2TA 4Q4EA 2I8CA 4YRFA 5B1YA 1Q17A 2W6OA 1DZ3A 3FFTA 2OBLA 1Y6JA 5IT9A 4L4SA 1XNGA 3DMFA 4M76B 2X1LA 1WHSB 2PZGA 3I6ZA 4H0CA 1SVWA 5D85A 1PFUA 1WKVA 2JGNA 1PV4A 1V1RB 4XSHA 4K3VA 1XCBA 1E2FA 1QOQB 1WCV1 1GKIA 3C3KA 3CFYA 1VL5A 2PGIA 4F5WA 3IHKA 5IABA 4D9BA 3DNMA 1KK2A 4FQ8A 4KN5A 1JIIA 3COYA 2Y2VA 1JJVA 2WZGA 1G5IA 4OXRA 5GOZA 5JZMA 2I7CA 2OHIA 1VPDA 2JLSA 1NJ8A 1RYDA 3K1JA 2CFOA 2DCUA 4WEQA 1C8BA 2GBCA 4X54A 3QJXA 3P26A 2Y67A 2WA1A 4OU4A 4FLSA 1N0IA 2NZUG 3QI7A 5GM2A 4M0KA 2M98A 3C3BA 1ZK0A 4M37A 2Y77A 5IFKA 2HPVA 1IZZA 2HRQA 5ERXA 3WJ7A 5DOZA 4ERNA 2C3UA 2ZT6A 1Z5GA 3B7UX 1ZG3A 5LDGA 1W73A 4GOND 2QDXA 2B4QA 2V7GA 4MZDA 1U9CA 4Q4IA 2H4XA 4W1RA 4CUKA 2CCKA 2GJSA 4Y30A 5KEIA 5DNVA 1YNSA 3BJIC 2P9BA 2IKSA 1O4VA 1HQKA 3N74A 1QC5B 3RUCA 4CM8A 1O94D 1RRMA 3M7IA 4QBKA 5ALZA 3F6YA 1JEAA 2JRLA 2YX1A 3L0BA 5DM2A 5K20A 3GLHA 4A2CA 4RY0A 2WJVA 3IP5A 4I4CA 4AECA 4F45A 3ENKA 3H9UA 3L02A 1LPBB 3AFOA 3D5QA 3JYLA 5JSQA 1VI5A 1CVLA 3W6ZA 3OE7D 2LDBA 2VSNA 4Q7EA 1KKMA 1LTHR 3OZBA 4RPIA 4GX0A 4ZT3A 2FJPA 1US8A 3EW7A 2QL9A 3RFUA 1ESZA 2WICA 3DB2A 2D7DA 1GPYA 3K4HA 2BP7B 4JFRA 5DK4A 2QN6A 3W6UA 4UHJA 1G21B 1BH2A 4EG3A 1JALA 3JWGA 2D06A 3QFCA 4UOQA 1Y4UA 2O0LA 4P22A 2J67A 2X1HA 3RRMA 3VM6A 3L6CA 5FFNA 4C2TA 1JIXA 1T5SA 3LDAA 3OZVA 5K3DA 5U9CA 4FHEA 5J1SB 2ZIAA 2WWGA 4R2XA 4XUCA 3RBZA 2ATCA 2D7JA 2O2ZA 5LQCA 2YWFA 2X19A 3CNQS 1T4GA 2LVBA 4CMJA 3VDRA 5B58T 4B3XA 1JKFA 3W1EA 1OB5A 2DB3A 1R4AA 2H5EA 3GDFA 1WMSA 3WL8A 1YDWA 2CV2A 1LFAA 3TDNA 5TXGA 4FYPA 2O3SA 4I2NA 2PFKA 3GNTA 1L7MA 1TMYA 3FMVA 1AKUA 3TW0A 3Q6IA 2XZOA 2R4UA 3QJYA 2C2WA 3TSWA 3KEDA 3MFYA 3CX3A 2XRFA 1KGSA 2AC7A 3PCRB 2QL7A 3UGKA 1P91A 5JNRA 1RYBA 3H2SA 3MT0A 2BE9A 3QK7A 3V6MA 4PAWA 2XTZA 3BHMA 4RPLA 3WB2A 2QJWA 2QUHA 1C0LA 4L72A 5L7YA 4QXMA 2IF0A 4B3RB 2DJ5A 2XBMA 1EWRA 5JG7A 3AU9A 1FP4A 1L5SA 1RCTE 2B61A 1K97A 1KFKB 1Q7CA 5DRYA 3TJMA 3W8FA 5G1NA 3A2NA 3A2MA 5B3JC 2DKNA 2OUIA 1KAQA 4OP3A 3IEIA 4IJ5A 3QG1A 1X7YB 1IIRA 1F48A 2YJ6A 1L1RA 2UZ3A 1K3FA 2WR8A 3MZ0A 3JVDA 1KOFA 4G36A 2WAXA 5EQDA 4BLPA 4EQ6A 2I76A 2QRGA 1YKFA 4FFRA 3GHHA 3P8ZA 4Z4EA 5EL0A 1WR8A 1BX0A 3BWEA 2C98A 1W85A 4JNDA 2CNWD 2FF7A 3I4LA 1C29B 1XMVA 2DFVA 4IDHA 4JASB 4P83A 5K0LA 2EKZA 2CJXA 1QHIA 2YBEA 5KUTA 2ZZNA 2XLCA 5E4JA 1P9LA 3GLIE 3OLXA 1BAPA 4NJMA 1WPGA 4XNBA 5K8IA 1WXDA 1KFCB 2X0DA 3MJHA 1GAWA 4BQPA 4DV5B 2EHDA 3DGFC 5LKAA 1LNQA 2Z4SA 3TLYA 1E9CA 4RCYA 4ZTBA 3U9WA 4URWR 4O1IA 1AKQA 4R16A 5FV4A 2DWPA 2VXYA 3KXIA 3KOXA 4NCXA 2MSEB 5HKOA 5I7AA 3BL5A 4J76A 2JJ2D 4AL4A 4BNLA 1DBWA 5B4TA 5KNBH 2XEDA 3CLRD 3GGCA 4EGSA 4PHHA 4LF8B 2GA9A 4AKTA 4DREA 5T57A 1XFDA 1D0SA 3B7PA 2NUTA 4CEIB 1MZPA 1Z74A 4ARFA 3RVNA 1RRPA 5I9TA 5SZKB 4B4UA 4ZCIA 2HXSA 4K6GA 1VMKA 2MDTA 4L5AA 4ONEA 2J3LA 1V43A 1FNDA 3UWKA 1HE3A 3FSRA 1F51E 2WAOA 1FFWA 3ABOB 4TKVB 4AVYA 1KMCA 4E22A 5D51S 3N76A 5EIXA 3CUTA 3BILA 3NAQA 1L5LA 5KOHA 1HY3A 3A6LA 4RPJA 2JAUA 4AY5A 1MG5A 3DZIA 1TJ3A 4JBNA 2HW8A 4V2UA 5CNKA 2AFRA 3DBRA 4E5KA 5TPWA 4EJ6A 1J90A 2ZQYA 3PB3A 1XDUA 1BHQ1 3M4XA 5HQTA 1SXJA 2O5CA 4WUVA 4FSXA 3HR8A 3GJ5A 5D3ZA 1NGSA 2XTMA 1NUSA 4L6CA 3OCUA 4MCIA 2OGWA 4Y2UA 3SX4A 1QRUA 2WG1A 5DDIP 3Q6MA 1MX3A 1UDAA 1QYRA 3B3FA 3JASA 5AK3A 1E98A 3DA8A 5ECDA 2WT4A 2V9PA 2IYYA 1MH9A 3VH3A 2JBAB 2XNHA 3IPRA 3KR1A 1X1EA 5CCEA 3K8QA 3CZKA 3KV3O 3GA5A 4E15A 1RM4A 3I2JA 3UHAA 1HEUA 2X6QA 2PL5A 1DEXA 1O97D 2AK2A 5J2UB 3V7WA 5FPKA 1J23A 3S1LA 3G8CA 1FBTA 1F8XA 5LZ9A 1BU5A 2G0AA 3T3NA 1OLUA 1SCKA 2IXEA 1DRVA 3T8VA 1J2JA 1KXZA 1T6XA 2JFXA 2MU1A 2ZYDA 3DDHA 4JP8A 4MUYA 4FYKA 4ISBA 1JE0A 4RJ2A 5JRJA 1N25A 1IM8A 1K75A 2B5VA 2P1RA 2YYZA 4RZXA 5HKBA 2P41A 1XZBA 5LKRA 5ALPA 3E0QA 1N6PA 3MW8A 1II9A 3ZXYA 3KSBC 2VA8A 2VP5A 4UEWA 4PGGA 5CLQA 1WZCA 4DR2B 1QXSA 1PFQA 3HEMA 3JTEA 3LVQE 3O4HA 3QV1A 3LBYA 3P2IA 1TO6A 4HDSB 4KV9A 4MRVA 5F7ZA 1VKHA 2JF0A 5BYBA 3P32A 4OK6A 4MV0A 2C59A 5B4VA 2WNSA 2FW7A 2UZAA 4OQZA 3SYTA 1BWSA 2L2QA 1SG7A 2I3ZA 4MRSA 1V7ZA 2QQ0A 4ZOLB 5IC5A 3T5PA 3FE2A 3DZGA 3U1BA 1IH8A 1C0PA 1C9JA 2GWHA 3I9JA 4NBRA 2WWTA 3VI3B 3W05A 3FZEA 2CMDA 2CFTA 1XXHA 3VUEA 1W2HA 3OQ1A 5HRUA 2Q2NA 5JLAA 1EP9A 2ZPAA 3AUKA 1M8GA 1QBGA 2OV2A 3DMPA 4XJVA 5AJTA 4PW0A 3L0SA 4N54A 1OKKD 2CWWA 2UUAB 1QQ5A 1JHXA 1BC5A 3P2OA 4L0MA 3RCBA 5EFOA 4CF6A 5A5FA 1JMYA 3FTCA 1N0HA 2C5SA 4D45A 1Y34E 3TRHA 4A0FA 3OZRA 1XEWY 1H19A 1C7FA 1BDIA 2QU7A 1JFSA 1NP7A 3AUJB 2VJDA 4KKVA 4O4IB 3D81A 2AWOA 4FSHA 1U28A 4KX5A 4U9HS 3KOUA 2B1JA 5DOVA 5ETJA 1G291 4DJ5X 1B4DA 4YNBA 2X2FA 3C6KA 3QUAA 5TRTA 3RRZA 2ZBVA 3QU2A 5EXEA 5EKTA 4NG4A 4AO6A 1N2OA 3EGEA 4LDZA 1KMNA 1K4MA 5IT4A 2BTOA 4KMRA 4H16A 2FLWA 4MGIR 1YR9A 2R6CA 3GP3A 3UT0A 5GIOE 4HX9A 4GRAA 3SXPA 2EWWA 4MR9A 4P3OA 3TTVA 4CLHA 4BP1A 4TTQA 4RS3A 4YAUA 1Z06A 2YQ5A 1BTOA 1TD1A 4IDNA 3T5GA 3T1YB 3QEBZ 2CV1A 2FFRA 1AK2A 4IKPA 1QP7A 1B76A 1GSAA 4F3CA 3LLSA 2AFHE 4XI9A 1CEXA 3DZDA 1HLPA 3G9QA 3ZBTA 3FTYA 3L46A 1W88A 2BFAA 1RWWA 3CHYA 3BQ9A 2MOKA 2X76A 4KXWA 3MJVA 1TZ2A 2ISCA 3BJMA 3HLKA 4PPNA 5AOCA 1AUPA 4WFKA 4D0NA 2HWWA 4F56A 1MO3A 4IO1A 2RAVA 5M04A 4AKHA 1E4EB 3LUGA 3PR2B 4FYJA 4PPQA 3ZU5A 2PUSA 1P9NA 4C9BA 4HH3C 1LZLA 3H2GA 3NRJA 1M6NA 2IHZA 1RQGA 2W8ZA 4FYVA 4KCGA 4QULA 3KXKA 3L92A 4TROA 3VHXA 1UEIA 1OH8A 3AB7A 1SOMA 3FNGA 1FVHA 2PVSA 2OCGA 2QMHA 3GFSA 3ZWMA 4ZV9A 4FBMA 2PO5A 2J0EA 2PL1A 3ZHYA 1ZJZA 4JAVC 1MXFA 5A4DA 2ZIWB 3EVBA 1OF1A 4DUGA 3B8HA 3M6MD 3P2KA 3QX8A 3FJYA 4L2LA 2A1TS 1KOJA 3L40A 4JT9A 4CMAA 3IFSA 4BNTA 3N2IA 2AVNA 2DYKA 4S35A 4BFVA 4K5OA 2XLBA 421PA 3TXXA 4C20A 4XN7A 4DIBA 5JCZA 1U6JA 5TMBA 3ZHRA 5AVZA 4WZAB 2E6UX 2V54A 4ZALA 3O4FA 1XZHA 3RK1A 3I5XA 3PGVA 3PQ7A 4MVJA 5HKKA 3GRFA 4J90A 3WRYA 2OKCA 3LY7A 4MUKA 5HWSA 5ISMA 4OI1A 3TG2A 1Q1QA 2C1XA 1YA8A 4B4VA 3COVA 1Q0TA 1FTYA 4JI5B 1OFVA 3IQIX 4X45A 1H2YA 2OECA 1T5LA 2WJYA 4X7MA 3JAMA 4GAEA 2HZBA 2G25A 1ML4A 1SD1A 2C0CA 2ZJ8A 3PPXA 1VBFA 3CXUA 3GEPA 4DE5A 1QR2A 4CCSA 3KVVA 3W2IA 1HR0B 3AK4A 1YJAA 4J1QA 4QHTA 3ZNOA 4AJ2A 4B8WA 2BF7A 3PQFA 4EBBA 5JXHA 3DZBA 4NCBA 1KZHA 3LOQA 3M8KA 1ORDA 3VV3A 1EJ6A 4LJSA 3CN7A 1RXYA 2XA1A 4JU9A 3ZG6A 3DDZX 3KUDA 1DIRA 3KLMX 3L0OA 1KVSA 3D8NA 1EFVA 3PENA 3AF1A 1R66A 1PEKE 2F48A 3BA1A 1P8JA 3E2MA 2JL1A 4RSHA 3M1YA 4XQ9A 2WHRA 4Q15A 1BIFA 1AHNA 1QBKC 3WWPA 5A5EA 4V38A 2X6RA 2COEA 5I7UA 3MRVA 3CSUA 1IHPA 5I4BA 4DFDA 1XMXA 4DNXA 2EBUA 1S02A 2CFCA 1KC3A 2RI1A 4L4YA 3G79A 5ADWA 2ZS9A 4OBXA 5HKLA 1TUEA 3VYUB 4KPUA 1KZ7B 2HV9A 4WLFA 5FL7A 3OY7A 1AZSC 3W5CA 4KAXA 3REQB 3GPDG 3R6TA 5KHLB 2Q3EA 1IWBB 2BGUA 1DG1G 5DYYA 5BYJA 2GNOA 4URHA 3AF6A 3AKZA 5JU6A 1JH9A 2ZREA 4DNPA 4GPTA 1GTL1 5F4ZA 1PJSA 3JQDA 2PUVA 2RHRA 3EY9A 3PUVA 3SPXA 4N3GA 1KR2A 1U3WA 1XEWX 5ALUA 3A04A 3CKLA 1R74A 4ZEXA 1CQZA 2CJWA 4EEZA 3KETA 4KQJA 4HRVA 1YC5A 4Q66C 2VR1A 3EZ6A 1VA5A 3HCPA 4NJEA 4GPBA 1J2EA 2UDPA 3V00A 1Y82A 3RFCA 1RLMA 1FYXA 3P0FA 4OGKA 4QYMA 3HTXA 1WPQA 1U6KA 1XLTC 1Y98A 5K0SA 4PG8A 1NONA 3VC7A 5IK2D 1G2IA 2V7QA 4PLVA 2G71A 4JLVA 5FBQB 3S40A 3UAOA 1KS9A 4TN5A 2WIDA 3F6SA 1Y1TA 4GSYA 4JENA 4FONA 3TBKA 4UCFA 2DBQA 3FFBA 2JKYA 3UNXA 5LD2C 4LF6B 4N6OA 1YMUA 1MW1A 2XUGA 3NOXA 4E7PA 1R9MA 5IK2A 1EIZA 1YL5A 3QKWA 2YNMA 4OSOA 4B3GA 2WG0A 2ZUWA 1QH1B 2EJUA 5KTOA 4RD0A 1NULA 4TVSA 3OMXA 1ZN8A 1QRTA 2QI9F 2OCYC 3SS9X 4XDGA 4MRMA 4ZYVA 1EHIA 4L8YA 3R5SA 3N1UA 3PT5A 3ZIDA 3FUMA 3V34A 2BFCA 4OHYA 4ITUA 4UBKA 4EHKA 4DT1A 4DHEA 1C0IA 4E7OA 2HPOA 4RF3A 4DDKA 4I14A 1Z5UA 4XR4A 2FYTA 3A9SA 4EFNA 2WM2A 3EZ9A 4GI7A 2AT1A 4PX9A 3WMRA 4MW0A 5B1EA 5LQJA 5AESA 1P4GA 4ZD6A 4I66A 5H7XA 3KB1A 3B6JA 4BHTA 3PUWA 1TZKA 4UD2A 1X8KA 5DM70 2QVYX 4R9UC 1V47A 4PWYA 3V2HA 5LP6B 1A2BA 3CVUA 3FYUB 3RWBA 3TIVA 4BCDA 3PKJA 4MQ4A 4QBHA 4NBWA 1G9XA 2HC9A 3VTFA 4OBWA 1USIA 4QU5A 5KQPA 5EZYA 4IIJA 4O08A 4I36A 3C1AA 4O8CA 4AT1A 2Z5FA 2VYVD 1C4KA 1L5ZA 2YW2A 4JC4A 4DCOA 2BKEA 1LRJA 3OA2A 3AP1A 4HNGA 3SDSA 3UWMA 4QE3A 2LXNA 5ITWA 4BV9A 4CKWA 1V95A 2HIHA 4HI0E 1EK5A 4PHGA 4XASA 3AXTA 3ISVA 1LDBA 4GX2A 3HV0A 3FWKA 4OXYA 2WTBA 1Z7WA 3BXHA 4G24A 4M60A 5A3VA 4YP0A 3QKRB 1OC2A 4EIWA 2ZTMA 3UQYS 1QZTA 1ZNXA 2OMKA 5LJIA 1SIWA 1BVUA 1HDIA 3L0IB 3O8BA 4FX5A 1P7CA 4ZAFA 1I4DD 5T3UA 4BLWA 3A4IA 3SEQA 4MRMB 2DPMA 3PQCA 3RKRA 1RZ3A 2W2LA 3FVTA 2D5BA 4X7PA 3I23A 4G2NA 4TTPA 1J0XO 4KDFA 5DWQA 5IYZA 1JSRA 1O94C 2ZJ2A 4UFPA 3DAYA 4LEIA 5JH7A 3H16A 1BQ4A 2O07A 5AOBA 3TQCA 1QKIA 4B34A 5IDXA 3L7YA 1CZUA 2DLNA 3DE5X 4O2BB 1G19A 5AICA 2D2EA 5JTTA 2HTEA 4EQZA 1W4ZA 2FG7C 5LA6A 1WWKA 1ZD3A 4GM0A 2ZI7A 1BCSA 3BBLA 2HRZA 2CL7X 2Y1KA 5FWXA 3LAWA 1UC9A 1LBSA 3E6AA 4ZGWA 3V4VB 1KI6A 1CFZA 1M6EX 1QK5A 2WM3A 1WKCA 4GPAA 4WESA 4B44A 4EGAA 3GYGA 4WH0A 1GNLA 3UENA 1N1GA 3HCDA 4CQLB 5I47A 2YL2A 1YULA 3TS1A 1ODSA 4MJ7A 1I9GA 4DQVA 1Z0SA 2XZLA 2VHZA 1DO0A 3EUWA 3CPJB 4HAOA 1TOAA 2H1FA 2YDYA 1QRDA 3C3DA 3ESYA 4RVGA 4CMGA 1K8QA 2ZRLA 2A84A 3KT0A 3WA6A 5DXAA 5F1PA 3ROKA 2GASA 4IZHA 4V3BA 1K89A 1MC8A 2H5JA 4F4HA 5CCXA 2JLUA 3A1UA 3VJRA 1ZAYA 2KWIA 4R5VA 2W93A 2YWHA 2RB5A 1RPAA 1ZUNA 2P3OA 2ZYHA 4H59A 4XM1A 1VBNA 3AVYA 1U90A 3FOEC 5D5PA 4YROA 1CY0A 1ZCJA 1UC8A 1ZWLA 1DRUA 1LKZA 2R48A 3U9SA 5BSKA 2WHYA 2F3TA 2GRJA 2EDCA 4QDOA 3E0XA 4BNNA 4LAFA 3FROA 4S3MA 2WHPA 4LY3A 4MVJP 3HXMA 2HL6A 4NMWA 2QPAA 2GPSA 4F92B 4C4ZA 1VOTA 1IMJA 1IHXA 1Y33E 2I2DA 2QZSA 2VHTA 4UHEA 1R0CA 1Z36A 3V8RA 4BBAA 4B31A 2F4VB 1E9AA 4IRMA 4AZ3B 4FGZA 3VR5H 1RBQA 3GLIA 2I78A 3ITDA 1H2AS 2E4XA 2VAPA 3B1YA 2O2GA 1CQIA 4U4AA 4KOEC 5T64A 4CM8B 1W1IA 2QW8A 2XECA 1JLLA 4QJ3A 1YACA 2YWEA 4O6VA 1QV6A 3GDWA 4HZGA 2X4DA 4RJLA 4WVFA 4ZI5A 4CR8A 4ENRA 3M1AA 4R1UA 3DHVA 4IINA 3FJ1A 1V26A 3MB8A 2REXB 5A62A 3O9VA 3WB9A 1JT2A 2BT4A 2WLSA 1BSVA 2R8YA 3O5AA 1IC6A 3K2EA 3GUYA 1JLRA 3U48A 4C22A 1F3OA 1YQQA 3D1VA 4P54A 3L43A 1JEDA 3GFQA 3BIWA 3GW8A 3T38A 2W8BA 4BFCA 1RC1A 3D6JA 1X86B 4MVJG 2Q28A 4PVCA 4XWGA 4C78A 4ZCTA 3QEMB 3MOGA 4DCUA 2J4CA 1T8WA 2MYUA 2Q27A 2GBLA 3NBMA 4K9QA 4OXQA 4HPJB 1F3LA 3S5UA 3VR2A 5LMNB 1JJAA 2G5CA 2YMLA 5DK6A 1NP6A 1EFDN 4OM7A 4AR8A 3MWEA 2OBMA 5DW0A 2IWRA 5IVKA 1FFCA 3TTXA 5C8YB 1YKSA 1GPH1 3LA6A 4Q9DA 2X2EA 3TLAA 1MTOA 2ZUBA 4M0PA 4CRWB 1B93A 1AKVA 1J21A 1ZFNA 4GWGA 4L27A 3THYA 1ATZA 1MQAA 3BDIA 3Q11A 3L7BA 2V6GA 2V7XA 2GAOA 2AOUA 4CM9D 2IEGA 1Z83A 4AZ3A 5LD2B 3DD1A 3WYEA 3MLEA 1ZJ4A 3L0DA 3R40A 3JASB 2OXIA 4WDRA 2P65A 1ZD4A 4OQMA 1CR4A 1LVHA 1NSYA 2OFXA 2NZJA 3AHDA 3A4VA 2GRUA 1LH0A 2PX8A 2ZSUA 5DGIA 5IAOA 4UZFA 3VBEA 2D2FA 4EB6B 1M6HA 2FR8A 4UREA 4LBWA 2AC2A 1JEEA 1E4OA 2H31A 2HSWA 2XDAA 4BNJA 1KJNA 4C6HA 1OFGA 2HXYA 1ZUWA 5JD4A 2CD7A 4JA0A 4Q93A 2IPNA 1K5PA 4HLDA 4BO4A 3D6UA 4D56A 1NI4A 3UFXB 3F96A 3NBXX 3WNDA 4KR3A 3Q5EA 4D4MA 1UXOA 3WYGA 1R6AA 1M0TA 5FF9A 3RYTC 1YZNA 3VOBA 3VKFA 1RLOA 3I1IA 1AKNA 1AQYA 1RABA 5ICFA 3WICA 3ROQA 5SV2A 3FUCA 1VB3A 1BQEA 1AB5A 2J1LA 5FTJA 4UHDA 1CS0A 3VPCA 1TU3A 4QUOA 1KMHB 3DCJA 4LVUA 4PQRA 1HS6A 4TTIA 3BXPA 2ICAA 5E38A 4PE5B 2QYOA 1F6BA 1M2OB 2PH7A 3E9DA 4YAWA 1FDOA 2Z2XA 3GZTB 2ZUTA 3JR3A 1VG8A 2HDNB 3LC7O 4I50F 3SZOA 4YR9A 5GJCA 1A9ZA 5JCOC 2FEPA 4DM7A 4ITVA 1U8CB 2PMBA 2G9QA 2YWXA 4TV9B 2Y0BA 2IU0A 4D7AA 2CHVA 2HSDA 1NN1A 2HU8A 4YWJA 2Q3JA 3F3MA 5BPFA 4ZK6A 4PBSA 1AD2A 4QQKA 3AY7A 3REFA 4U9UA 3HUDA 1NW3A 4G5RA 4DCVA 4C2AA 1NFFA 3WV5A 1DKMA 1K9VF 3TQSA 1UXKA 1PJRA 3DAFA 3QVXA 1ZZGA 4ZT4A 3V80A 1THTA 2C7PA 2UYGA 2HRDA 5IN4A 1J2UA 1UM8A 2B4TO 3EMDA 4RVFA 1YDFA 2IU4A 4TQAA 2VPZA 4MVJM 5TSDA 4IDCA 1PJZA 4S24A 2PGOA 3O38A 1QFYA 1GL6A 1ZJYA 4JROA 3MWYW 1JSXA 3KYBA 5FO0A 3VYVA 3QE9Y 3C70A 4Y2TA 1QB7A 1LQUA 3T9DA 4ZZ2A 2PR2A 1P81A 2PGNA 4F2DA 3DFFA 4RDIA 3LD9A 1HSZA 1R0ZA 2PHZA 3ZXXA 4FDAA 2WIGA 1NMEA 4YQZA 3AVVA 1H1DA 5F3WB 1SXGA 2V6JA 2QM0A 3F97A 4FLMA 2BELA 3VO8A 4DV6B 4ITRC 1V37A 2MSCB 3UJAA 3MRXA 3ANYB 2X9LA 1U04A 1MZVA 1YGPA 4L9WA 1NVWQ 4REQA 3MTGA 4BWGA 3QW2A 2OZKA 1JX6A 4RKFA 2K2QB 2HJRA 1GFIA 1LCIA 2IVFA 3CE6A 1F4PA 2HJVA 3EXIA 4IFEA 1XEAA 2GN4A 4YLYA 3QPCA 1MXHA 3VA7A 2XOKD 3UAWA 4DA4A 1QIGA 3AB8A 2YZ7A 4N4AA 1HL3A 2GSWA 3OT1A 1QHNA 2GJ9A 3JWHA 4FXPA 5IRCD 4OG2A 4LOKA 1TMOA 3GELA 1MOSA 4QOIA 1Q0HA 5AVKA 2J3EA 2XUIA 3R09A 3F1KA 4GS5A 4X1YB 3IOBA 3INGA 4FCWA 4NABA 2J09A 2A5FA 2XZPA 2JFBA 1ZC4A 3QXHA 2D1YA 3N75A 4HR7A 2GKOA 3HJBA 5ER9A 1DJOA 1HETA 3P9CA 4HNTA 2JCXA 4LI3X 1AX9A 5IDYA 4M1OA 3MQ2A 4Q1EA 2VSXA 1UOPA 2J7KA 3KKQA 3AUAA 3JAWB 4ZQIA 1AS2A 1CRQA 4V1CA 5TJ9A 4L2IA 3DBRB 4CM6A 3SF0A 2QL5A 3NB0A 3WLKX 1QK4A 1Q7GA 2JFNA 2E9SA 4MWGA 1NBHA 3RVPA 1HNZB 2P2ZA 3CYFA 4TKLA 2L17A 4X2UA 3HEBA 4ILKA 4UPVA 2HJHA 4P3YA 3LPDA 5K0BA 1B16A 3RAFC 4D80A 2VDJA 1N8KA 3FMPB 5HM8A 1N34B 3JAKB 4WINA 2ONZA 2EZUA 1GZHB 3GUUA 4Y2VA 3WXMA 3UMMA 2CB9A 1ISFA 2EG9A 3G2JA 4UTXA 1KR5A 4FEEA 4AZSA 4S05A 2HD4A 4MR9B 3BYZA 4WZBE 3EPHA 2VBFA 4PTYA 1O03A 2CXOA 2Q4EA 1C50A 3C8UA 2GHRA 2X7JA 4UUQA 2QLTA 4ANFA 4PPYA 3N8DA 1UC5B 3RANA 1P1JA 4M8LA 3AY0A 3B82A 3UHFA 3WKBA 4FFWA 4C3OB 4DDTA 3J80A 2ZK7A 2XI4A 3L0ZA 3TLGB 4WQMA 4CM9A 4Z86A 1GPKA 3O31A 5T7BA 2QB5A 2EWMA 4PLFA 4CCAA 4F3RA 4EL0A 5EJFA 5BRAA 1RAGA 5E6UA 5JXIA 4KGDA 5JDCA 2QNIA 2ATXA 3E7PA 4Q7KA 3FPBA 3AP3A 3M6IA 4PG7A 3GUVA 4W5HA 3TF5A 2J5KA 4LOLA 4U7JA 4AG6A 4UBJA 4AICA 4RNCA 4M54A 2O5EA 3RARA 1PDWA 3TIFA 1SKMA 1C81A 4RENA 1II8A 4G41A 4WCFB 1SBTA 3PKIA 3GLIB 2G7ZA 1N8NA 1QIHA 3CH4B 1AQUA 4Q4JA 4WFQA 2IX9A 1BXGB 1UK7A 3HI6A 2AN1A 1J42A 1GXSA 3KC2A 3DLCA 4AZVA 1NN3A 1SBNE 4BKRA 2A1TR 1MVYA 1IN4A 1Z56C 1Z6QA 2BV3A 2FRDC 2NTVA 3NFRA 4CNQA 4ZANA 1KJWA 4RIHA 4NTZA 3CW2A 1BFKA 2REQA 3KUKA 4ND3A 5LOVB 2J0SA 1B0AA 4HXFB 3D3NA 3O9MA 4RQBA 4P7GA 1OSNA 4KNVA 4W4TA 4F5ZA 3VISA 2VJKA 1V11A 5IAGA 3LOPA 1CUEA 3QBDA 1JBQA 3SI7A 4ZX4A 1XP5A 1QONA 3BSWA 1SCIA 3GV0A 3L1VA 1ZUD1 2H4YA 3EIEA 2ZVDA 4N3NA 3OUTA 2Z5VA 1QV7A 3VC3A 2AEEA 2EQAA 3STWA 3TNJA 4UVHA 1TO1E 2WTNA 4M9QA 2EV9A 3PPVA 2ODBA 2G09A 4I19A 2PX5A 1EE2A 4KZPA 1D4OA 1OA1A 2EFHB 1O5OA 3USES 1W25A 5DLEA 1SVSA 2W8BB 3EDMA 5DLYA 3WLSA 4YS6A 3JY6A 1KZ4A 3F7MA 1YB6A 4IBOA 2DUUA 4QL3A 2GCEA 1V7QA 3R9KA 3NHWA 1YOBA 4XN2A 4HNRA 3Q0TA 1SGWA 3GEBA 1RHJA 1NBEA 3UMYA 5IDWA 4BGVA 1AUVA 3S8EA 3C3PA 1R8SA 3I39X 1NJ5A 1ENOA 4JVMA 4XPZA 5BNFA 2IH2A 3G7UA 4R3NA 2M32A 3FTFA 2HU2A 2N42A 5TVKA 1UMKA 3A3OA 4G37A 3C15C 3WTBA 1XO1A 3BHNA 4F60A 2A9OA 3I4FA 3RKSA 1FP2A 1E4EA 1OXSC 1HO3A 1UJ2A 3AL3A 3G2OA 3OQMA 1RXWA 3TLCA 3LRTA 4K1LA 2F55A 3IMGA 1UBMS 1I2CA 1S8FA 2LWIA 2O9JA 1CR2A 3C74A 2PGJA 1FRNA 2GEUA 3ICOA 3PQ4A 5GZ1A 3W9YA 4B85A 2JGLA 1ECPA 3JWPA 4RK4A 4OI2A 1TKCA 1CETA 3MMPA 1N5RA 2GD6A 3GGDA 4G5GA 2A5GA 1QO0D 1AB6A 4LECA 5IAEA 3IT1A 5E9AA 2R8PA 3BWYA 5EHNA 4EB0A 3GLRA 3WQBA 1I7LA 1A72A 1ZGBA 1N9GA 2JGJA 1PG0A 3GLVA 1G9SA 2NUPB 2A7QA 3HVJA 4XLTA 4KPFC 5AK6A 5AKGA 1IOLA 1OKKA 3OCCA 3DT6A 4GKKB 1VIVA 2ZJAA 3OLCX 2VAVA 4LYHA 4M9RA 1MW2A 4DKXA 2Z3ZA 2XCSB 1RWMA 2NT3A 5L8VA 1DCTA 4QU0A 3ZU3A 5JATA 1CJSA 3EFOA 2Q1SA 3PHIA 4M1MA 1KDPA 1XKXA 2E4YA 1RYEA 4EUFA 5BV1A 1KIAA 3U44A 1X1QA 1ZH8A 5JS2A 1NQXA 5G0TA 2O3JA 2X3UA 2BEVB 3CRQA 3ELDA 4GWKA 1DQSA 1IOVA 2FPRA 1TK3A 3ET4A 3MD9A 2IXTA 4X3OA 4YMSA 3WL5A 4BCCA 3AETA 2P2LA 2VKQA 3RS4A 3TIIA 3PQ3A 2C2YA 4YRPA 3ZR4B 3C7DB 4D1YA 5JVDA 4WK0B 1XZFA 3WS7A 3WLQA 4YRMA 3EIUA 4KG7A 2A5DA 1UC4B 5DRTA 1X2EA 3CONA 1AU9A 1Y89A 3GCXA 4O2BA 3U3KA 3RF7A 5JJIA 3OJXA 3RREA 3WLLA 3GJYA 3TQQA 4TM7A 4TT3D 4Q1FA 4PC7A 3BWXA 4IHAA 3T7IA 3VPXA 4BMVA 4IOMA 2ZYSA 4XH9B 1RXVA 3CGGA 1QMPA 1TCUA 4CIBA 5A03A 1UIMA 3GLFE 4GRDA 2IQIA 3I9V6 1L5MA 3HRKA 3NONA 4KMMA 4PGAA 2VNJA 4QPPA 3BMCA 3UMBA 2RJIA 3PHGA 1AC5A 4RKQA 1IXRC 4E94A 2LUOA 1N5DA 5AYVA 1YUMA 2ZU0C 3ITKA 2JAWA 4MUFA 3PS9A 3PFNA 4TLBA 1J7JA 4FX2A 4B6RA 3DYBA 1SUPA 3U31A 4HY3A 1RTTA 4F6RA 4YX9A 3SJ7A 2Y05A 2RH5A 3A1WA 1H2HA 1P4RA 2VA9A 4NXMB 2NV6A 2P2DA 3P19A 3KP1A 3PDIA 4EF5A 4YJ2A 2QX8A 5EWJA 3N0VA 2XWSA 1XQVA 3WFIA 2Q46A 3FTPA 4AN1A 2G0NA 3HB1A 1KP9A 3NV7A 4DDUA 1O6GA 1BX1A 1KA9H 2YYYA 5TQJA 4NZNA 4YV0A 5AI0A 4PEVA 1E9SA 4CM4A 4JC8A 3O2NA 3TD9A 3M3HA 3HBFA 2FEXA 1Y0BA 3P9PA 1T2AA 4G86A 1JXMA 4F8EA 4M87A 1IMOA 1VBMA 1VKJA 1WCWA 2IYWA 5GJVC 1OGIA 4PXYA 1E3WB 3KELA 5BPHA 3OC0A 2VWHA 3K9BA 3WFJA 1F7VA 3QEOA 4JN6B 3SICE 4M89A 5BSTA 2RH9B 4ARAA 1RP3A 4HH0A 5JPIA 1PQPA 3T5DA 4L5YA 1X2BA 4Q05A 3E5MA 4OHBA 4FLOA 1RHMA 3D0RA 3I76A 3KDPA 1A8SA 2XMGA 1QPZA 4PX3A 4DN6A 4RSYA 3GO4A 5J63A 5M34A 2H57A 1GLNA 4G8BA 1E0DA 3SNHA 2BUCA 1XMOB 4HAYA 4NYMQ 4U0KA 1XA4A 4X8MA 4AN0A 3U1VA 3LLUA 5A4KA 5A4JA 1X92A 2I4LA 5FUQA 1D0IA 4PRLA 4QSHA 2IV3A 2AG1A 2AN5A 3FDXA 3P27A 1WB9A 4EHJA 2SKDA 2XPYA 2Z09A 4FP9A 4QYIB 3HCBA 2COKA 3EXG2 1AKMA 1UDBA 2WEKA 4KODA 2DUNA 3HO6A 4NR0A 1QQAA 4HDRB 2FW8A 5CVVA 1FTWA 1UKVY 3M6UA 5EWLB 2G70A 8ATCA 1UXGA 1PR4A 4B6EA 4BP8A 3TOVA 4BX9A 5IS2A 4WLVA 1SK8A 1SD2A 2DPLA 2X2PA 5BW5A 3EA4A 2ZIXB 1TZJA 2IHJA 1QTQA 2A30A 3FUXA 1Y81A 5SYNA 2G06A 2RGXA 1P2BA 1YQDA 2FLVA 3G1TA 1X70A 3M0EA 1IPHA 4QBIA 5U4XA 3ABSB 4U8HA 4ZARA 4LCEA 5LQSA 4BN4A 4QQ8A 1QU2A 1KRXA 1UBOS 3S2FA 4WXRA 3GDOA 4KXVA 3RSQA 2OPBA 1P44A 1M1UA 2FUEA 2GFQA 3PSAA 3RJTA 1UBUS 4KACA 4DRZA 2NYAA 3QFTA 4ZA2A 5K6AC 4DLPA 4RZ3A 2HCBA 4DCMA 3IHLA 2FR1A 2VK4A 4HAXA 4KYTA 2HRRA 2E7ZA 2WP0A 3WWZA 4MYHA 4YAIA 4XFKA 5IVIA 4EB8A 2ZB2A 3CVVA 4KYIB 3GCZA 1BXGA 4K5QA 3MWKA 4OXIA 3TZCA 2QRKA 4K05A 5G3YA 3VR6D 3AM3A 1WMFA 3KTAB 1E2DA 1XJWA 1NG1A 1FUEA 2HDOA 2WUDA 4C03A 1W4CA 3IQXA 4C7BA 5BT9A 3ZCVA 4L02A 4B43A 4EKYA 3RSCA 3AH8A 3FI9A 3ZIUA 1PNOA 4LBVA 4UZSA 3PQ5A 3NEPX 4QWWA 5AI5A 3DV9A 2HMTA 1IAQA 1ODFA 3VYWA 2LCFA 4XIIA 3GX1A 3FU3A 2ZWAA 4ZOQI 4QM7A 1L7VC 1J25A 1WTCA 1G5QA 2B8EA 3HL0A 5BR7A 3EF1A 2LRHA 2V98A 1M34E 1BZYA 1T0IA 1SQGA 5CVEA 1A9OA 5JQGF 2WC1A 3ZTYA 3N0TA 2V0CA 4A15A 4BFWA 1ORTA 4MKXA 4NBVA 4BO8A 1DSSG 2EU8A 1AA9A 1V0JA 2OCXA 5LZ4A 4QU9A 2PM8A 3C5EA 2F43B 4PNHA 1N92A 3ZBQA 3H1TA 1UAGA 1TKBA 3IAS6 1AXGA 1E99A 3SMQA 3W7AA 4ZAVA 1P1IA 4HNQA 4DGSA 2P40A 1W4RA 1NVDA 4DEVA 1Z4IA 3HC7A 4UU8A 5HGJA 2ENUA 4CEHA 2QN3A 2ZYWX 4JJ6A 1H8HD 2H59A 3W5IA 3IPXA 3UT6A 3H13A 4RVHA 1A4IA 3UTDA 1W49A 2QT1A 3CHPA 2P2YA 1NI3A 3C8HA 1REQA 1AM4D 4GSLA 4Y2SA 3WL6A 1KK1A 1U9ZA 2FRXA 2DUMA 3VZPA 3X1KA 3RAEC 4L2IB 3TI7A 4YT2A 1SXJD 4CT5A 3C4JA 4RCZA 3A4YA 1YS9A 2Q6OA 6GPBA 4J0DA 2IP2A 1EUCA 2XNCA 3WGLA 2P5TB 3NM6B 3VV2A 1MCZA 3AETB 3A6JA 2F8TA 4BP3A 3UH1A 4MA0A 3FWYA 1OX5A 4QASA 1R5JA 3Q6NA 1S7GA 3LCMA 2C7GA 4MUJA 4Q03A 4UNRA 1U2EA 3EEYA 3O9ZA 2OA0A 1X6VA 3F47A 5K0EA 3WBFA 3L3BA 5LZ7A 3LPCA 2FFQA 3QA9A 4UVGA 4FR2A 3TX6A 4D4KA 2ECPA 2PT5A 2CVPA 4RSMA 2IH4A 4HT3B 5C7YA 4F84A 4EMUA 4KQ6A 1U3DA 3QKTA 4IIXA 1H2EA 1RJ9B 4AK9A 3SQXA 5JAQA 3DPUA 4ZCLA 3NHFA 2H06A 2I3AA 2PKWA 4G26A 4EMBA 3I9NA 2C3PA 3UIEA 1WU7A 1NBMD 1U0NA 3H0EA 2ZT8A 3P2MA 2PIAA 1VCMA 1W9MA 5CVJA 5C8YF 4L7VA 5EUQB 2IEBA 5AD1A 9ATCA 1PN3A 1Z0IA 2HGZA 3DTVD 1T8YA 3HP7A 3NWPA 4GDMA 4JUFA 5CW2A 1MB4A 1BMFA 2H2WA 3HY4A 1CE8A 4QODA 4OQXA 4DLSA 1TF7A 2CFRA 2FJ0A 1T4CB 2INGX 3B5EA 2XCQA 1KAGA 3FYCA 2HMWA 5BWBA 3X2SA 3T0FA 1JLHA 3JZAA 4MQLA 2XE6A 4IHQA 5CJJA 3G7NA 4IEEA 2P77A 4HEQA 5FI1B 1YBVA 3PEWA 3STHA 4JA2A 5EEGA 5K9ZA 5ALYA 4IDAA 2HLDD 3I2HA 4NHEA 2KS6A 1F06A 3DMTC 3IB6A 1BWPA 4KV7A 3WYBA 3A3NA 2AUNA 1ES9A 4H1VA 4AQDA 4RMHA 4GR5A 4H4CA 4QUHA 3ONDA 1G3MA 3WL3A 3JU3A 3V55A 2O8FA 4MTCA 1IYZA 2PX0A 4D3FA 3OIWA 1NNLA 2PS9A 5ALQA 4LDRA 1AQJA 3TRIA 4YRGA 4BFTA 3T5AA 3F6BX 3H5IA 4ZVUA 3R3WA 3O0DA 1M0WA 1VPEA 3TSOA 1A9SA 1CUWA 2Q0HA 3RHFA 1Y1RA 3QW4B 3ZPXA 4EH1A 2WYHA 3SD7A 5I48A 3OT1B 2I34A 1U63A 3V3TA 2PLAA 2GBFA 2ADMA 5IJXA 1SCQA 3IX7A 1XZMA 3DBLA 4L16A 1XDWA 1K3TA 1PF7E 3N5CA 2PKXA 3ED5A 4Y3UA 4RV9A 3KVRA 1W44A 5EIAA 4DRYA 5CFNA 1KRWA 3PXBA 4JL8A 4U7DA 3LL4A 1QYCA 3E7FA 2FXIA 4ZT6A 4AF8A 5E6SB 2P7IA 3HSKA 3UWPA 4QZVA 3AZQA 2GTQA 3DDCA 3OZSA 4BLQA 1EZ4A 2P9TA 1T5BA 2I0FA 3NEYA 1C7QA 5CYFA 1DXQA 2JDID 3BREA 3K92A 1UQRA 1JVSA 3FKSA 1CY8A 1U1FA 2ZYGA 2ATEA 4DG5A 3TNYA 1SD5A 2FRDA 2D0DA 4B9EA 3THOA 1YE5A 3GFGA 4RAOA 3F4BA 3TR6A 1SIOA 1PR3A 1XSEA 4U7HA 4R1SA 3LPMA 3CNBA 1JA0A 4LXHA 1GZ3A 2X42A 1T5HX 1G8MA 4PC2A 2RAFA 1ENZA 4DDWA 4RGQA 1M2GA 3M89A 1NBAA 1L7AA 1QVZA 2C78A 2PLRA 3O8QA 1GGKA 4PRZA 4KSCA 1U3CA 2HQ1A 5EWMB 1JKMA 4RKEA 3OPYA 1QVWA 4M9XA 2FSVA 3RO7A 1TXGA 4GYKA 4OL0A 3U3XA 4YRLA 3VR4D 3B38A 1O95D 4FMCF 4JYPA 3LRPA 2WIAA 3H2IA 4S0ZA 2JLXA 2IS1A 2HF7A 4LF7B 2QTMA 4DSTA 4P4NA 5J2TA 1F8YA 1MPTA 3LPNA 5EKSA 1J9GA 5EP1A 2AR7A 4P53A 3RQSA 2ZBGA 4EZIA 5BORA 4G0WA 1MIOB 2KBEA 2XCTB 3REGA 1C8KA 1V2GA 1ODJA 1ZITA 4OH1A 1OY1A 2IRWA 5G3ZA 4ENWA 1CRPA 1K92A 1KY2A 4JOQA 5KTYA 1HT1E 4ID9A 5DM4A 1XX6A 1JSZA 3R6GA 4HQRA 4QC2A 4LRUA 5HA5A 4JNKA 5I9MA 1HLGA 5KTTA 1DG3A 3H3JA 4HWRA 5ALNA 2FSGA 3R44A 5HVNA 1PNQA 5A3QA 1JKXA 4MOWA 4CCYA 2V9CA 3B20A 1XA0A 4RVOA 4ALIA 1N3IA 1IQRA 1I80A 3ELYA 2D5LA 1KDVA 5ALOA 1C1YA 4TSFD 2QVBA 5FOTA 2PUCA 1VKNA 3TD6A 2Q8NA 2C9MA 3L9XA 4LN1A 5HIAA 5EKDA 3RG2A 1AG9A 3GUHA 3W79A 3R7AA 1QIDA 4E12A 5AKZA 3GN1A 2O5VA 4D8WA 2ZSJA 2FFHA 3QH4A 4WBNF 1E5DA 4XMVA 2JPDA 2ZJBA 3O1JC 5GVRA 2EKPA 4LHZA 4JL6A 3VPBA 1LU9A 3HWX1 5BNIA 3WQQA 4H7EA 2OV3A 1AO0A 2YHBA 4B46A 5EMLA 3QF4A 4JUAA 4CDMA 5KDLA 2O3RA 4HUQA 4F2GA 3I04A 1XUOA 4FFSA 5EMNA 1KKLA 1K7XB 3NBQA 3LF1A 3V1LA 2XADA 1SHUX 3C48A 1Z45A 2BI4A 1XF9A 4OYRA 1YO6A 1SUAA 2F8MA 3VR5D 3ZUGA 4Q6BA 4CL8A 3DE7X 3FI0A 4L5BA 2FZ5A 3LUHA 1VA4A 4UMVA 3THYB 2RHHA 1WZ2A 1GDTA 1ESCA 4DSAA 4A6XA 3N8IA 3DZJA 3I58A 1PZGA 5LP1A 2O3UA 5KNLA 3P4UA 5EGSA 3PNPA 5D3KA 1XZCA 5ADUS 3FTSA 3WMFA 4IQ4A 4B17A 1K0UA 2A35A 4MVCA 1NLMA 4MITA 3KAJA 2NGRA 4MAAA 3AQ4A 3ANSA 1LRLA 5H70A 4HX5A 3BX1A 2BSXA 1GFZA 5EI5A 4F8JA 1LW6E 4TYPA 4JR1A 5JWHA 4XVQA 2C29D 1OC4A 2NZYA 2WSSD 1UAYA 2WU1A 3HRIA 4X62B 3RW9A 3GIDA 4N0QA 3TM5A 2BEJA 2QAGB 3NO4A 1XPUA 5D00A 1VL1A 5B30A 2GA8A 1O0BA 2G1PA 1T1GA 1SOUA 2GETA 4LDPA 4YASA 4CV3A 2FPOA 1W52X 3KHKA 1XXHB 3GFOA 4YGXB 1GRVA 4JP2A 5IAKA 1D2HA 1Q74A 3KTAA 4LE2A 4RLSA 4RQAA 4DV3B 3DC2A 2IK8A 4HKTA 1JR3E 1KHHA 6NULA 3ND5A 2BFNA 2UZ0A 3DOCA 1LDNA 3OP1A 3PI6A 4ND5A 3T6KA 4N0EA 3ZDCA 2D54A 1MBZA 1SO8A 4NZYA 2JCYA 3FGNA 4LRSB 4RHCA 3KJFA 3KQKA 3LLMA 5HF5A 4XWOA 1DPFA 9LDBA 4C0XA 4JH0A 2PYDA 4OAOA 4EF4A 3ACCA 3ZZTA 2A5LA 3ZXUB 1GQQA 2PUJA 2DECA 1G0NA 3SLKA 4UC0A 4HWPA 3O3NB 5K8LA 1L5RA 4IGEA 4RTQA 4CLRA 2IE8A 4HLCA 5EJ5A 2ZE6A 3NLLA 2NAPA 3PV0A 2JJMA 1JZSA 2CMKA 3JQBC 2BONA 4Q7LA 1GYRA 2J5RA 1XZAA 3L5OA 3SE0A 2AXQA 3LA8A 3CKYA 3VO2A 2Q5HA 3NJ8A 1C7EA 3B7RL 1ZX1A 1E0SA 2HO4A 1BCRA 1PGQA 4G6ZA 4MUMA 2B0CA 4P81A 4LV5B 1N8TA 4ROTA 3SFVA 3V2UA 4QGGA 3VPDA 3AM1A 1QOZA 4MO9A 1ZVKA 4HJXA 5A04A 3TSZA 1G16A 3LQ4A 4UATA 4IQ8A 5CFZA 1KWGA 2ZUEA 1BWRA 1PP4A 3IEPA 1IHOA 3OE5A 1SCJA 3R41A 2ZRDA 2N1MA 2X14A 2XUQA 4NCNA 1L5GB 1DBVO 1TO2E 2A9VA 3SFZA 3LQKA 4YBRA 4KOAA 1YJQA 4CIXA 1T6YA 3V8VA 3DMTA 1CVIA 1FS4A 4MX8A 3LUPA 1QZUA 3W7BA 3E4DA 2HUNA 1ELOA 2W2KA 4FT2A 4J1TA 2GUWA 3PA6A 4M0DA 4XN9A 3DEJA 4K8OA 4D9EA 3HMQA 4K1XA 4X20B 5EE3A 3ZLJA 3VU9B 2QP9X 4DRXA 1IQPA 2VHEA 2ZI4A 3AUTA 3Q3EA 3COPA 4GZ3A 4BE7B 1L4LA 4HPXB 4FZVA 1XRRA 2Y1FA 1SU8A 1R88A 4B84A 3VR6H 4TL6A 1U8FO 2QLNA 1FFDA 1L8XA 2CZCA 2NVUA 2XCIA 5ALGA 3SJCA 1T5OA 4BQOA 2ZJ6A 4G97A 4FGJA 4OFXA 3DE6X 3AESA 3SQWA 5AXCA 3JARB 1AV7A 4CKEB 4HZUB 1MDBA 2GEDA 5ILGA 1ZGCA 1N5KA 2SCUB 2QR3A 3CZ5A 4TL9A 1PWYE 2FMFA 1Y8QB 4Z2YA 2Q2VA 2GCOA 2PS1A 4RA6B 3NOVA 1E3WA 3LWBA 4G5HA 4KLCA 3FVRA 2BBTA 2C8LA 2OUKA 2YICA 1T3ZA 2G17A 2V65A 2ERCA 2ZBFA 3L06A 3LW7A 3MMSA 4CZ2A 5TR9A 4TLAA 3OEED 4PZUA 4QGSA 1TA9A 2NMVA 2YJ5A 4OK3A 3RIGA 4B74A 3P9XA 4PXSA 1EVIA 2YCLA 2CHUA 5I7VA 7MHTA 1CYDA 2GNPA 2G9ZA 3A1VA 3AEQB 4RKRA 5TT1A 1T8RA 2XXBA 3FUHA 1DLIA 3QYFA 4MZXA 2DSTA 4AZ0B 4DUZB 3ZNQA 2F17A 2CF6A 2P68A 3AEKA 3C5HA 4X8HA 5EJIA 3WIEA 3CXRA 1T0JB 2OV8A 1RHUA 5FTKA 2FETA 3CH5A 4J0HA 1CUYA 3EEFA 4YXWA 1Z18A 3LFTA 5FTNA 4H18A 3BGIA 4RFVA 3UXYA 1DHTA 1LBIA 2RBEA 3RB8A 1ZGGA 4UAVA 3E9EA 3KQOA 4ID3A 4KLRA 4TZ0A 1XRLA 1J2RA 3D6MA 3OOEA 1UBCA 4H60A 2X1MA 3BWMA 3KJXA 4K9KA 3MS7A 1E3SA 1OWMA 1KI3A 4W9NC 1UBKS 3K09A 1FVXA 3KBBA 3T54A 4ZAZA 1XN4A 1T1JA 3KLNA 1ONNA 3LI2A 3DGEC 3GXOA 4BLVA 1CT9A 2AS0A 2A9FA 2WUVA 4X24A 4GZLA 1O2DA 1XR3A 5IC6A 4I4TA 1F9EA 2GK7A 4WK6A 3GAFA 1J0EA 3PP8A 4DPLA 3I61A 3RVOA 2QZ4A 1YU9A 1AGPA 1UINA 2WSLA 3DKKA 3AKCA 5EXDA 2PFSA 2F2TA 4L50A 4JI8B 2EHJA 1XRMA 3E84A 5CGZA 2GD0A 1T2UA 3C3XA 3TDKA 4LJ7A 5K3BA 4A26A 3M2PA 1DBPA 3P71T 4Y6OA 3GEMA 3T3IA 4RETA 4DMCA 1ST3A 1CUSA 3D9QX 5ECWA 3V8NA 1GV0A 1KZ1A 4EABA 4K6KA 3UBMA 4W7SA 5HK9A 3CRW1 4XKJA 4YCAA 1G20E 2ZBUA 1ABBA 3C41J 3I9KA 4GNRA 3RVSA 1OHHA 1H2WA 1V35A 2AQKA 3NVMB 4H4EA 2FAXA 2QX6A 4PSVA 1UMCA 4EGQA 5EUCA 4BO6A 4ZJYA 1EX7A 3VNSA 3W2FA 5CW1A 5JYDA 4FGLA 4ETWA 2Q2WA 2BTEA 2VCEA 3MAAC 2QJ1A 5LBUA 1AKWA 3NNDA 3QMMA 3NHSA 3WBKA 4HTFB 1CLEA 1CR0A 1T24A 2ZOSA 3PPYA 4MVJE 4XIJA 3NHBA 2OPHA 4FHFA 3AOEC 2Q5JA 3FLAA 5IVHA 3Q10A 4DR5B 2WYIA 1IN1A 4WKNA 3JQ7B 4WW0A 4QOFA 3GU3A 2Q0XA 5LLSA 5AM5A 5FBWB 1WP9A 4RTNA 2VLAA 1IBCA 1K7FB 1WMDA 4WPGA 3G2NA 5EP4A 4C43A 3DE2X 3RSZA 4H7DA 1JQJC 1LX6A 1VRWA 3F7NA 1KY3A 2PZJA 1UJ5A 2W11A 3CMMA 3I1YA 2BPOA 1ZDMA 1IEXA 4L3VA 4PO3X 3VZSA 1NOJA 1Y4SA 3SIXA 5EZSA 3QWFA 2VIIA 2YZNA 1OU4A 2HBYA 4PR0A 2OHJA 3VOSA 5BR8B 1WLYA 2P6NA 2PJDA 3I52A 1WDTA 2HYDA 3B3BA 3E48A 2YVUA 2YRWA 4K03A 2DEUA 2VTVA 3VKHA 4EOGA 2YYAA 5AQEA 2PRYA 3FFAA 3QUTA 1OGJA 4K9LA 1CV2A 4MV5A 4XWWA 4L4RA 2ZITA 1FXSA 5C34B 3BZBA 1U2DC 2K87A 1DOHA 1B6GA 3PQEA 3QLJA 4KSBA 3A1DA 1PHRA 2D13A 3SZUA 4MWSA 4WT7A 1HV8A 3BQNB 5JAMA 3TL6A 3WYFA 4OXXA 4IY1A 2A0YA 4R8LA 4RTMA 3C3EA 3AIIA 4OMUA 4WMLA 5CFMA 2MMGA 3GXBA 1XNQB 1FUUA 3GCGA 1SPXA 2WJJA 4A6PA 3FCAA 3L82B 1T9ZA 3MWJA 4Q3KA 3AUYA 3NH9A 2O4UX 2F1IA 4FCAA 1I24A 1H5UA 2IZ5A 2W6ID 4RK6A 3RSFA 4DMFA 1MA0A 2Z5GA 4KTTE 3RS7A 3IMEA 4L0DA 1Y8RB 3D4NA 4DCPA 1RMYA 3KQVA 4ZREA 4XZ3A 4AP5A 4DNFA 4MRPA 3PUXA 1E9RA 4NH4A 1ACJA 2OFPA 1XDBA 2ADOA 2FP4A 3RTDA 2AOTB 1MQ8B 2QS9A 2VUHB 4YO7A 3WMWA 4CLRB 5K3OA 5HZKA 4YDHB 1YJ5A 4YUWA 3F73A 1WTAA 1S89A 2BZGA 3CRMA 1XTTA 2C97A 4ZHQB 5C8XA 4CLEA 3CIAA 3CSSA 3SBDA 4BQQA 4B33A 4XYBA 1A9XA 1MGPA 1T9AA 3F8TA 3OQIA 2AKEA 1LVUA 1DRKA 1SZPA 4O4HB 4CTKA 1Y7TA 5LYYA 5ESDA 3D6TB 1JJBA 2YY6A 1QFSA 1MB3A 4QVKA 1KU0A 3NQ41 3T99A 4OHKA 2GLXA 4LJKA 1HRDA 4LJ5A 4AJPA 1TJ5A 4ZYYA 4NAUA 1REQB 1QCDA 5AJYA 2WB2A 4GBJA 1OWNA 2E6KA 4IV0A 2C9OA 5KHAA 4ZPJA 4AMZA 5JQWA 4AR9A 5DBGA 3A3YA 2AXPA 3NM5A 2RAUA 2R0QC 5CX1A 1ND6A 1K6EA 2JH9A 4UFOA 5DT9A 2AD1A 2JHPA 3UHPA 2NNLD 4WKCA 3HB4X 4MIEA 3CLSD 4XCQA 2ZSBA 1E1LA 4ZCSA 3L6RA 1JZTA 2SECE 5EV7A 1PZXA 1DJMA 3KHSA 1E3IA 2P8SA 3QU7A 4DQ0A 2OORC 4IPTA 4HL6A 2OCIA 1LTQA 5EJAA 3L4BC 3DQZA 2G4LA 4ZC8A 4Q3NA 3WE7A 4FNMA 4KXLA 5BOSB 1NSFA 2JV7A 4INZA 3V5NA 1FYDA 3IQFA 4LJ4A 2PUEA 2I80A 1M66A 2O2EA 3CW9A 4GOJA 1CY2A 1AUQA 2QWXA 4HBGA 1SOWA 2ZIVB 3RWMB 5BSWA 2AMVA 1P0MA 1E2KA 4IDDA 1QGYA 5EERA 4XYLA 4IIUA 5KX5A 1UBTS 1E7RA 1ZJJA 4L07A 2PU7A 2EJVA 3CVJA 3LDGA 1YU6A 2GK4A 4GE0A 4U3JA 4GH5A 5LM3A 2Q4TA 3WGKA 3OBIA 1CR1A 2QVCA 4MWDA 4B2PA 5C8VA 2A5YB 2VP0A 2AR0A 3I6MA 4QHYA 5BN4B 3ADDA 2NUBA 1GN8A 3N3AC 3P2JA 5J47A 2R7KA 1WBBA 3ID6C 2W0MA 3E58A 4NCKA 4ENTA 3FPSA 1AQLA 2ODAA 4NX2A 3RS8A 5B3LA 1I4EB 2HHJA 2I33A 4M7RA 3T3PB 1XMSA 2IBMA 3QFSA 3Q8LA 4FZ3A 3U37A 3NHK<