2PL5A

Crystal structure of homoserine o-acetyltransferase from leptospira interrogans
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
362
structure length
362
Chain Sequence
GSIGIIETKYAEFKELILNNGSVLSPVVIAYETYGTLSSSKNNAILICHALSGDAHAAGYHSGSDKKPGWWDDYIGPGKSFDTNQYFIICSNVIGGCKGSSGPLSIHPETSTPYGSRFPFVSIQDMVKAQKLLVESLGIEKLFCVAGGSMGGMQALEWSIAYPNSLSNCIVMASTAEHSAMQIAFNEVGRQAILSDPNWKNGLYDENSPRKGLALARMVGHITYLSDDKMREKFGRNPPRGNILSTDFAVGSYLIYQGESFVDRFDANSYIYVTKALDHYSLGKGKELTAALSNATCRFLVVSYSSDWLYPPAQSREIVKSLEAADKRVFYVELQSGEGHDSFLLKNPKQIEILKGFLENPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine O-acetyltransferase
publication title Crystal structure of homoserine O-acetyltransferase from Leptospira interrogans
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Transferase
total genus 122
structure length 362
sequence length 362
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.110 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2pl5A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pl5A01
1YB6A 4X97A 1H2YA 5LIPA 4W1SA 3DDUA 5ALNA 1LNSA 2HA0A 5IVIA 3FYUB 3QMMA 1IUPA 4P93A 4AB1A 4BAUA 2OXEA 4KRXA 4MJ3A 4DNFA 1X2BA 5K5EA 5BWBA 4H77A 2ES4A 5JD4A 1BCRA 4QA9A 2WU3A 3D0KA 3WL8A 3D59A 5IVHA 1HBJA 4BVJA 4PO3X 5AM4A 4CG2A 1TCBA 4BZWA 5DNWA 2RIPA 5A7FA 4I4CA 2O2IA 3G7NA 3AIMA 3WWOA 3QM1A 2VQ6A 1XQVA 3IUNA 1XRNA 4GW3A 4X00A 1JFRA 3HABA 5ALJA 5DTIA 3BIXA 3O4HA 1XZBA 4P08A 4KJXA 2GBGA 5A6VA 5JIBA 4JH0A 5ISMA 1XRQA 1YSCA 4JYMA 1CUFA 4RGYA 1QFMA 2OCLA 2DQZA 2V96A 4H35A 3WK4A 3G0CA 1QIHA 3BIWA 1E8NA 3ESDA 3Q0TA 5AM3A 1JMKC 1MO2A 2XMCA 3LIIA 5KBYA 3CCBA 4H7KA 4BBZA 5IKXA 2BFNA 2W6CX 1MPXA 1H23A 2WUDA 2AXEA 3GROA 1P0PA 1THTA 2XMDA 5ALTA 5CH5A 1B6GA 1ZJ4A 4UPDA 2ZSHA 2HU5A 4BAZA 4X7BA 5A7HA 4WJLA 3A2MA 4AQDA 2IX9A 1UK9A 2I78A 1X2EA 3HEAA 5DLPA 3U0VA 2AJ8A 2ECFA 2FX5A 3HRHA 4FMPA 5IVDA 5JAPA 4AXBA 4KR0A 3ZLTA 3KSRA 5ALVA 3WMRA 1QE3A 2AJLI 4FBMA 4LYEA 5T4FA 2HL6A 2QXUA 2JGKA 4MXDA 4H7DA 5C8VA 2C5GA 2ROQA 4DNOA 4OB8A 2X5XA 4MQLA 5FXMA 2JEZA 4C87A 3LS2A 2EDAA 2EDCA 1LZLA 1H22A 4UFNA 5FLKA 4RPCA 2JGJA 5AIBA 3DOHA 3IUMA 3RLIA 1XZIA 1EINA 5K3DA 2CEKA 2BJHA 4MYSA 1THGA 2GZSA 3I6YA 1R88A 1QO9A 3DNMA 2JBWA 1LPBB 3O4JA 2VJBA 1YCDA 1W4LA 4B83A 4EY4A 1YS2X 2J4CA 4G8DA 3ED1A 1C4XA 5AI6A 1AMNA 1G66A 1XZAA 4QLOA 3WYDA 2CB9A 1DT5A 5JZSA 2AJBA 3WZLA 3AUKA 2YH2A 4RNCA 1GT6A 1GKKA 2C58A 3STVA 5J3JA 3B5EA 1X70A 3AJAA 3S8YA 4EUSA 5ALPA 4IH9A 1QIGA 2Y2UA 2OQVA 4NMWA 1FSSA 4H7EA 3WK5A 3E0XA 5AKYA 4BYMA 4X94A 2QRUA 4GEGA 1AX9A 4Q82A 1A88A 4IO0A 2J3DA 2YASA 3WYNA 3STTA 2XMGA 3PE6A 1W76A 3BXPA 4JNCA 3H2JA 4QNNA 4CG3A 4TGLA 1DX4A 3RM3A 5AI5A 4JEIA 4HXFB 5ESRA 4X3CA 1QOZA 1ZD5A 3C70A 3DEAA 1VE6A 4HRYA 3OPMA 4BC0A 5HK9A 2HM7A 1LBTA 5AKJA 3I2FA 1VJ5A 5HQ3B 1UK6A 4DYHA 2WKWA 4I19A 1LPSA 4X92A 1QJ4A 1UFOA 1GQRA 2XUGA 1VZ3A 2OAEA 4J3JA 2PKYX 1PFQA 1ZI8A 2AJDA 1SCKA 3O4GA 2XQKA 3C8HA 1SCQA 2WJ3A 4PNZA 1QTIA 1L7RA 4BE4A 1YS1X 2QUBA 1P0QA 4BTVA 4KACA 3ICWA 4KAAA 2ONCA 5ALRA 5LLSA 4OSEA 4BTLA 3M3DA 5ALWA 3C43A 4M0MA 2VTVA 2B4KA 5ALGA 1WM1A 5AKHA 3ZWQA 4M0FA 2O2HA 1CV2A 3V1KA 4K6GA 3VJKA 1W52X 3C6BA 1GXSA 2BUBA 5ALQA 1SC9A 2OG1A 4LXHA 1OILA 5AK6A 3BJMA 1XLUA 2HHAA 4BP8A 4BRZA 1CR6A 2HIHA 5CH8A 2VEOA 1LBSA 4I3FA 1MNAA 2CUTA 2ZJ6A 2WIJA 5F4ZA 4B0PA 5DYYA 4F21A 5HFNA 1U4NA 4CG1A 1KEZA 3JW8A 1Y7HA 3K9BA 3M82A 1QLWA 1R3DA 2DHEA 4IH1A 5LP1A 3R3UA 5EIAA 4AMYA 4AN1A 2QM0A 3H04A 1HDEA 2WIGA 2WQZA 3IBTA 4UHDA 3HLKA 1EXWA 3HJUA 5D3KA 3STUA 3LLCA 2PSFA 2GYWA 2BAGA 5I8PA 3BDIA 4PF1A 4Y2VA 2XQGA 1E66A 4IHAA 1VLQA 3R0VA 5K3AA 4FFVA 1TK3A 4MEAA 5A2GA 4W1PA 5E4JA 3I2IA 1MU0A 3EBLA 4FBLA 1W75A 3V1LA 4G4JA 3RARA 4XWGA 5JAOA 1F6WA 2OCGA 5K3CA 3BE8A 3C6XA 3O0DA 3I1YA 1WB4A 5E4YA 4UBOA 4E11A 1AGYA 4FNGA 5EHZA 5AICA 1ISPA 1CEXA 5K3EA 2QVBA 1BU8A 2XLCA 5EGNA 2B20A 5CRIA 5K3FA 4FLFA 2WG1A 1G42A 4HAIA 4WCVA 1U2EA 3UUFA 4DSZA 4IQ4A 3W05A 3WKBA 4XIIA 1BEEA 4OD0A 4BB0A 4EBBA 1L7QA 4AO8A 5ALKA 1KU0A 4N8SA 1BEZA 3WL7A 2WG2A 3C6YA 2WUGA 1J07A 3G9TA 4UBIA 1TAHA 4KAFA 2YYSA 4O08A 3SWWA 3D3NA 4U2GA 1BE0A 2Y6UA 4NZZA 1FFAA 3DLTA 3TEJA 4CIAA 3R3XA 5I7UA 4FOLA 1C7IA 1UK7A 5A71A 3G02A 4LHEA 4PSDA 1EVEA 4DMHA 3GBSA 3WK7A 1HLGA 2CJPA 5CT9A 1J06A 3ZV7A 5EIHA 1CUJA 2C0QA 2GZRA 2IIVA 3K2IA 2HFJA 5FPQA 1HKHA 3WK8A 3PF9A 3AIKA 4MEBA 2WFLB 2PSJA 1CUUA 1CFJA 3STYA 3FLBA 2H7XA 1FFBA 3I28A 1ORVA 4UHHA 3L1JA 4G4IA 1EDBA 1MAHA 4N5IX 3AIOA 1D07A 4G4GA 1CUBA 4YX9A 2G5PA 2Z8ZA 3BDVA 4B85A 3WWPA 4EZIA 1I6WA 2XUIA 4B84A 4ETWA 2OAGA 3BJRA 3WK6A 2Z8XA 5HQ3A 4N8EA 5LKAA 5CXUA 4A5SA 4OU4A 1E8MA 4Y2JA 2RONA 2WHPA 5K3BA 1E3QA 5JD6A 4DTCA 4OUKX 5A62A 1GPLA 3DKKA 4U2FA 4AO6A 4DM7A 3WA6A 2Y2VA 3H0CA 1ZOIA 4BCCA 5C81A 3HYSA 4KEAA 1UXOA 4LXIA 3F96A 2J4FA 4YASA 4EY6A 4AZ3A 3RK4A 3QPAA 3FNBA 4UUQA 3VVMA 3PF8A 4B9AA 3V48A 5JALA 1T4MA 1A8UA 2XUHA 1R50A 3RKSA 1TIBA 5CW2A 2EEPA 3CN9A 4HRXA 5AKZA 3I2KA 5T4BA 2HA2A 2X76A 3GZJA 1MAAA 2WIFA 4ARBA 1WHTA 2PUHA 6YASA 2G4LA 4OYLA 2I3ZA 2ZSIA 4ZI5A 3MVEA 2O7RA 3IURA 1YR2A 4Y2YA 2ORYA 2PU7A 4C6HA 4CCWA 1DWPA 2BKLA 1WPXA 2PPLA 2B61A 2XE4A 4UBKA 3BWXA 2K2QB 3WWCA 2DFPA 2WILA 3WWDA 4W1QA 5T4EA 4WY8A 1T2NA 2XUAA 2O7VA 3KDAA 2WUEA 1A8QA 1P0MA 2P8SA 2BUAA 5DNVA 1E8DA 3VJMA 5AM2A 3D2BA 5I9IA 4Y2UA 4Y2RA 1XZKA 3F8SA 4QDXA 3WZMA 4WY5A 4PSUA 3V9AA 4MWTA 2XUJA 2XQFA 3W2TA 4BZZA 2ZYSA 2GYVA 2ZJFA 3PFCA 3W9UA 1CLEA 2HADA 3ZLVA 4BDTA 3FLEA 1USWA 3IVMA 2XUKA 1CQWA 1DQZA 1GKLA 3GFFA 1UKCA 4DSAA 4HXEB 5HF6A 2XMSA 1XZJA 4N5HX 1QIFA 4BVKA 4GECA 4WDRA 2ZVDA 4X90A 5JARA 2HA7A 1S8OA 2V9ZA 3STXA 2QS9A 1JU3A 5D7BA 5FP0A 5K3FB 1TRHA 5AI0A 4P92A 2WSLA 4OU5A 4B0OA 1CUEA 1CUAA 3AFIA 5FOQA 3PICA 1BCSA 1J2EA 3WL5A 1GPKA 2I03A 4F0JA 2PM8A 4HTAA 3IUQA 1MX9A 4DMFA 1VA5A 3FAKA 4J03A 3WKEA 3KXPA 2VT7A 1JJBA 4BATA 4FFWA 2Q0XA 1ACLA 4C88A 5KREA 2WIKA 3QMWA 3A6ZA 1ZD4A 1XLVA 4Y2XA 4ZXFA 2RAUA 1JI3A 1XZEA 4DMCA 1EDDA 3FCXA 5HK8A 2VJDA 3KOOA 4U2BA 4W63A 2BUCA 1FFDA 4ZV9A 4E14A 1UOQA 3AZQA 1QFSA 2XB6A 3N2ZB 2WTMA 2JIDA 4ZWNA 4Q3KA 4MWSA 4GHWA 4V2IA 5LZ4A 2QUAA 2OCIA 2WFLA 1TQHA 2QT9A 4QLAA 2XDWA 3H18A 1HQDA 1G5FA 2XI4A 1XKLA 4X71A 1LGYA 5EI5A 1FJ2A 3P2MA 2XQJA 5YASA 3SC2A 5JD5A 3YASA 3I6MA 1VOTA 1O6FA 1IZ7A 4JUIA 4P9NA 1WOMA 4UHEA 4G9GA 3IULA 2H7YA 5AOCA 1XZFA 2JGLA 1G4HA 2WFZA 3QH4A 1MTZA 5HFAA 5CTAA 3DCNA 2RHWA 4GI1A 3LP5A 1FFCA 1YAHA 2QMQA 4Y9SA 4UFPA 2GBIA 3MUOA 3ZPXA 2WHPB 5CT6A 3F67A 4B81A 1MN6A 3WK9A 4MQMA 2QKYA 4ARAA 2PVSA 3OM8A 4C4YA 2RGUA 3AINA 5ALSA 4OCZA 2PUJA 2PSHA 4CFSA 1CIJA 4BP9A 3M83A 5KWJA 4XX1A 5JANA 3MUNA 3G0IA 2QJRA 3HXKA 4NVRA 4BE9A 5E2IA 3OURA 2QOEA 2OQIA 3TGLA 3CCCA 3WIBA 2ZJ7A 4Q3LA 1ODSA 1W1IA 4H7HA 1CPYA 1ZICA 1CUDA 5JADA 4PSCA 3QZUA 1ZI6A 2JGFA 1LLFA 2JEYA 4KRYA 2Z5GA 1XQWA 3ZI7A 4KYVA 5CURA 2FJPA 4J0JA 2HA6A 2PSDA 3C87A 4KE6A 2WM2A 5HCUA 3G0BA 5BOVA 1QIMA 2UZ0A 4B80A 5C8ZA 1ETHA 4N8DA 4DIUA 3ESCA 2XMQA 3SK0A 4XVCA 3PUHA 3GUUA 4J0HA 1YB7A 1EHYA 1AUOA 1CQZA 4Q34A 2XLBA 1DWQA 3W9BA 4FDMA 3DOIA 1JJIA 3ANSA 3JYHA 4YPVA 4ZGBA 4Y2SA 2O2GA 5DYWA 3R41A 3FWHA 3HSSA 1SCIA 1O6GA 5C7YA 5FV4A 5JYCA 3WJ2A 3NOXA 4AX4A 3VVLA 1M33A 1JU4A 2C5FA 2H9YA 1BN6A 1QIIA 2C4HA 2B9VA 4M0EA 1R9MA 2C0PA 2WHQA 1UT6A 2V98A 3G0GA 1XZDA 4J0CA 5LYYA 3I6ZA 4W1RA 3UUEA 1R9NA 4F60A 5ALEA 1DX6A 3C6ZA 2FJ0A 3I2HA 5DJ5A 3EQ8A 1R1DA 3G8YA 2QZPA 1N5RA 1GGVA 1XKTA 4C4XA 1CUVA 3TRDA 2VA9A 2Y6VA 2QTBA 3MGAA 1XROA 1ORWA 4B82A 4K6KA 4Y7DA 3H17A 3H1BA 1XZGA 5CT5A 3E4DA 3LIPA 5AKEA 3QPCA 3IB3A 5ALYA 3ESBA 3U1TA 2VJAA 1ZIYA 5AJHA 4X6XA 1KU6A 5KWIA 1ZD3A 1ZJ5A 4K5QA 1XRRA 1GQSA 5C8XA 1L7AA 3D2CA 1RYYA 3H2KA 5AO9A 1IVYA 1RP1A 3QVMA 2RI6A 2ACEA 1JMYA 1QZ3A 3FSGA 2AJCA 5EHXA 1UOOA 4U2DA 3PI6A 5AOAA 5HKBA 1VXOA 1WB5A 2ZYRA 4WFJA 3FSGD 3DJYA 2WJ4A 1Q0ZA 4QWMA 4INZA 1WB6A 3DL4A 5HF9A 4QDOA 1OCEA 4HXGA 4AN0A 3AZOA 2FUKA 5DYTA 4LYDA 4L9AA 2XUPA 1DTEA 1VXRA 2ZYIA 4KE9A 4Y2TA 3KD2A 2J3QA 1LPMA 3IA2A 3O9VA 4B9EA 1NU8A 1UK8A 4EY7A 5FKJA 4E46A 4BVLA 2PL5A 4ITVA 4OPMA 5ALLA 1EH5A 1Q84A 1MNQA 3R3YA 4Y2QA 5D3ZA 4K6HA 3LCRA 3T52A 4U2EA 4B6GA 5AOBA 5LZ5A 1XQYA 2PU5A 2XT0A 1YASA 5FPPA 2ZYHA 1EX9A 3B3QA 4UBLA 3D4LA 3B12A 3O4IA 2BCEA 3C5VA 3KWFA 1J1IA 3ANTA 3R3ZA 2JGIA 2PBLA 3QPDA 1F8UA 3R3VA 4U2CA 5AP9A 3DQZA 1UOPA 5CH3A 2CKMA 4MYDA 2XUDA 4HVTA 2VJCA 5LZ9A 3NGMA 2CZQA 3BL8A 4PV7A 3I1IA 5AKGA 1ZI9A 3JWEA 4ZREA 4LIPD 4ZRDA 3OG9A 3WKAA 5LZ7A 2JGEA 1MJ5A 5AM5A 1Z68A 2VATA 1ZD2P 4QE3A 4S0XA 3S2ZA 3C5WP 2I3DA 3Q8WA 1K4YA 5JZ9A 2VAVA 2D5LA 1E89A 5FDFA 4G5XA 3FYTA 5LZ2A 4X95A 2E3JA 5LZ8A 3BF8A 4UHBA 5A7GA 3E3AA 2BGRA 4FLMA 2DQYA 2OPHA 3GELA 1P0IA 4FKBA 5DTJA 2HA5A 1K63A 4J0DA 5AKXA 1QO7A 3HZOA 4K2AA 4EA6A 3G9ZA 2Y1KA 4EY8A 4DNQA 2WHRA 4AZ0A 3FVTA 3TJMA 1HL7A 5IH7A 3W06A 3AILA 2G5TA 4FLEA 2WIDA 4QZVA 3NWOA 1AZWA 1YAJA 5EFZA 4Y2PA 2PX6A 1OXMA 2HRRA 4E15A 1CUWA 5AM1A 3OOSA 2VAXA 4OB7A 4X6YA 1VE7A 3E1GA 4PQEA 1GPNA 2WLSA 4Q3OA 4WFIA 5ALXA 2IITA 2QJWA 1K6EA 4CCYB 1NX9A 5JAUA 2HU8A 5ALHA 3H19A 3I2JA 2HDWA 3NUZA 4TPKA 1SOMA 5AKIA 1IUOA 1JKMA 1Q83A 4L3WA 1WCYA 5AK3A 1BROA 2WFMA 2R11A 4Q1VA 5CBKA 2V97A 1CRLA 1MX1A 4AO7A 2BGNA 1F0NA 2LIPA 1C7JA 1EI9A 7YASA 5AKLA 3DKRA 3DD5A 1VKHA 2DHCA 4H18A 3ILSA 5LKRA 1N1MA 3VISA 4C4ZA 4D9JA 2QR5A 4BAGA 2XUOA 4H7FA 5AM0A 2DSNA 4X6UA 3WL6A 1PJAA 2VSQA 3FCYA 1FFEA 3WLAA 1XRMA 3A2NA 1K8QA 1TCAA 1AURA 4H0CA 1QGED 5ALFA 1AC5A 1QONA 1YA4A 2WUFA 4J7AA 3PDCA 3D2AA 2WJ6A 3F98A 2WU4A 3FOBA 5AIAA 4J0IA 4FHZA 4Z49A 1LPAB 5ALMA 3PFBA 3H2GA 1N5MA 1LPNA 4W9RA 2W22A 2YXPX 5EIEA 3SX4A 3L1IA 3CN7A 3OC0A 5JATA 2WG0A 3F9CA 1CUGA 4UFOA 5HF8A 1VA4A 4A23A 4NS4A 4FTWA 5D6OA 1EK1A 1DU4A 4WFKA 5HF5A 3KWJA 5JZBA 3WA7A 1AQLA 2RHTA 3X3HA 4QDUA 2OGSA 4BC1A 1XLWA 3QBJA 2XMBA 1IUNA 3C8DA 1A7UA 3K6KA 5CT8A 5ALUA 5HZGA 1IMJA 3WIOA 3IIIA 4IH4A 4BCDA 4H7JA 2DHDA 2D0DA 3V1NA 2OLEA 2HU7A 2XQIA 4J0KA 1JJFA 3DL7A 4J0GA 1EK2A 2XUFA 1ODTC 4C89A 4G8BA 3WI7A 2R8BA 4RE5A 1ZIXA 4GBGA 3N0TA 4B7ZA 4F5ZA 3M81A 3ZLUA 5DNUA 2OCKA 4DNPA 3FYUA 5SYMA 1CVLA 4L72A 1ODCA 2CBGA 4H7IA 1EB8A 3D7RA 2QXTA 4FNMA 3V1MA 1B41A 4WDQA 4UBMA 1EVQA 3BF7A 1EA5A 1W6RA 4HZGA 2G63A 1CUYA 1UWCA 5BWCA 4KE8A 3EQ9A 2NW6A 3WQHA 1CUZA 5T4HA 4QDTA 1ZGCA 3HACA 3T4UA 3O9MA 2XUQA 1H2XA 1H2WA 1H2ZA 3FBWA 3R40A 4UHFA 1VZ2A 4G8CA 3WJ1A 3OTQA 1DWOA 3H2IA 4UBNA 2H7CA 3QYJA 4EHBA 4L0CA 1IZ8A 2JGMA 4X85A 1DT3A 1XRLA 1QIJA 4C01A 3VDXA 4AMZA 1DINA 3STWA 1LPOA 1AKNA 4RE6A 3AZPA 2ACKA 1U65A 5AH0A 5EHNA 4KE7A 1EDEA 3G0DA 4HS9A 4GXNA 2WTNA 4GWLA 2CMFA 2C7BA 3W04A 3HI4A 5HKAA 1XRPA 4BDSA 1CUHA 5H3HA 4QWWA 4DGQA 5JASA 1XZCA 4JYPA 4TVKA 1QIEA 3VXKA 1DQYA 3C45A 1A8SA 4GLBA 3F97A 1Q0RA 4X91A 3HC7A 1UKBA 3CXUA 4A16A 1Y7IA 2OGZA 2OGTA 4UHCA 5CMLA 4XJVA 3EQ7A 5CXXA 4CI9A 2GBCA 1BRTA 3D5EA 4QDZA 1XQXA 4CIBA 2HFKA 4CCYA 3O95A 1U8EA 5FRDA 4GDMA 5DWDA 4ZV7A 1R4ZA 5ALZA 3H1AA 2HA3A 2GYUA 5AHXA 1MT3A 5AI9A 1TKRA 1XZMA 2JF0A 5AI4A 5SYNA 5JAHA 1F0PA 3GA7A 1ZGBA 5CT4A 3R3WA 3EIOA 3G9XA 3PUIA 1K5PA 1TCCA 1Y37A 3FVRA 5FUMA 1QIDA 3FLAA 3IDAA 1N8SA 1LZKA 3UMJA 1QTRA 2HA4A 1SFRA 4UBJA 3DYIA 4BCBA 1XFDA 4LXGA 1EB9A 5E4TA 3WKCA 3WWEA 4YK7A 3VJLA 5AI8A 5AK5A 4Q05A 1CUSA 4G1FA 5ALDA 1WHSA 2X8BA 3A2LA 4LKOA 3G9UA 2GBFA 2DR0A 3EF3A 5AK4A 3DYVA 5BV7A 5ALIA 1XZHA 1BN7A 1ACJA 3VKFA 1XZLA 5AKKA 1RWQA 3I2GA 3L1HA 4DMKA 4EB0A 4DLNA 1WPRA 3QMVA 3H2HA 1LPPA 1JT2A 3ESAA 3A70A 1MX5A 3FYUC 4G9EA 1CUCA 2PSEA 3ICVA 2VF2A 1GZ7A 5IVKA 1CUXA 1QIKA 3WKDA 1YA8A 4KAJA 1BS9A 1CUIA 3DS8A 4BRSA 1E5TA 3QITA 2Z3ZA 2XMZA 4FWBA 4QEKA 2VT6A 4X93A 1UZAA 4ROTA 5EHQA 4PW0A 4EY5A 4OB6A 1NU6A 1PV1A 4OYYA 3IUJA 5ALOA 2XMRA 2H1IA 2DCMA 1UKAA 2HRQA 2Z3WA 1HPLA
chains in the Genus database with same CATH superfamily
3S2FA 4EZEA 2QAGB 4X97A 2BMDA 3MJFA 5JS8A 1H2YA 4MKRA 4W1SA 3VUFA 2IYQA 1JEDA 4NMLA 4PLYA 2BFOA 4GM4A 2OC4A 4UTNA 1SBIA 2R87A 2XY4A 3HN7A 4B6JA 5IM4F 2OLKA 5F5XA 4WINA 3ENKA 2XCUA 2HV8A 4R01A 5EPEA 1NJ1A 4C7BA 3K94A 1WSWA 4TSFA 4MVJM 4DZTA 3D8HA 1Z47A 3A4TA 3NBMA 3W2FA 1LTKA 4AY5A 2CK3D 4IIUA 2V8OA 1LJUA 4DNFA 2B1IA 1KYIA 4RY0A 3DFIA 1J5PA 5EXSA 3SXPA 4H77A 4YDHB 2HI0A 4BB9A 5HOQA 2ZUUA 2HRCA 1JLSA 2DY0A 3AEUB 3LUKA 2HJ9A 2ACVA 2QR3A 4KYIB 3HR8A 2HXYA 4XSHA 1KQPA 2R97A 2OHFA 1BCRA 2QM7A 1JFFA 2AG5A 2VTDA 3GJ0A 4BNDA 2MYUA 2W71A 3VDRA 4E2ZA 1Z2PX 5IC5A 3D59A 5BSRA 1IY0A 5EIOA 2OV6A 4EA8A 4IZ6A 3ZTTA 4MQ6A 4A6PA 4BVJA 4EAAA 3SVLA 1P8JA 2B8TA 4MQ5A 5DNDA 4LMBA 3D6AA 1QNFA 2YN0A 1YL7A 2J3JA 1T9HA 2HK7A 3MQ2A 3B6JA 1TCBA 1OB2A 2H5JA 4BZWA 1M8PA 2QLLA 1MO4A 2JFNA 3Q9SA 5DNWA 3BGDA 3DDCA 2MDTA 3O91A 4I4CA 4BLPA 5A7FA 1QH8B 4B87A 2JJ2A 2W37A 1G21E 1FFYA 2G6TA 2AKEA 1TPZA 2PZ8A 5I4BA 5KHLB 3MJCA 2WKQA 3AIMA 2F1RA 3MXOA 4YLGA 3RREA 4G0OA 4RADA 4OI1A 3W3ZB 4TMVA 4FE3A 3OM9A 4FUTA 3TIFA 4BFXA 3B3JA 3Q9UA 1P0CA 2HMSA 3BXGA 3DBOB 3KZ1E 2MCFA 2OO7A 1BKSB 4NBTA 3THWB 3N0VA 3PEWA 2CJXA 5ALJA 3GGOA 5KO2A 5LDGA 5BOSA 4ZTZB 3KKMA 1Y8QA 1NW9B 3BIXA 1XZBA 2GT1A 3MMZA 2X1MA 3O4HA 3P0HA 2JI9A 2IL1A 4IXNA 4KJXA 1ZGHA 2FX2A 4U0KA 3ZE7A 5HJEA 1H1LA 1QJCA 4IV8A 3G8BA 3GP8A 4FEEA 3SM9A 2AVDA 1QBGA 3G85A 2RFLA 1YSCA 2IH2A 4JYMA 1F48A 3WLRA 3BD9A 1LXCA 4JCOA 4TMXA 5I4KA 1CF9A 2EHJA 2R66A 2WF8A 4H35A 1UEIA 3G0CA 3I3SR 3KAPA 3NCHA 4QIHA 5EGSA 1Z5NA 4TYQA 3ORYA 4GU5A 1PBNA 2WE7A 4JJZA 4PHHA 2OFFA 2H18A 1YACA 4XPZA 3ESDA 1OC2A 3Q0TA 1JMKC 2MSDB 5AM3A 3LW7A 4GVXA 3W78A 4BMSA 3GZ4A 4LZLA 3PD0A 3PWTA 4MW7A 3JVUA 3IALA 1YDGA 4E12A 1ZVJA 2VYNA 3MTBA 2F67A 2X6TA 3CCBA 3CSUA 2WABA 3L79A 2FMXA 1VI6A 2FF5A 2G7ZA 1U0GA 3L82B 3X1JA 1RWKA 3RS4A 2PLRA 3GYBA 3NUQA 4BHTA 2PMFA 1JKXA 3L6OO 3NAGA 3GWGA 3L8FA 5I9TA 1XX6A 3BHNA 1SUCA 2QL6A 2CYAA 4XDGA 1W29A 5MGNA 4FKZA 1M5RA 2ZJ4A 1JAYA 3DTVA 3NR2A 3O3CA 3ZDRA 1QP0A 1DAGA 1W6UA 1MEJA 1THTA 1YMQA 5EHGA 1XAJA 1NQTA 5KKAA 3MG9A 4ZQIA 2XMDA 2YZMA 4EHKA 3W8RA 3BRCA 4CW7A 5IKEA 3WIEA 1F2UB 2GF0A 4P4SB 3CG0A 3NVAA 4NS1A 2ZSHA 2HU5A 4HSEA 3L77A 4BUZA 4YAUA 4X7BA 1HFJA 1RPAA 3A2MA 2R70A 3DBLA 3HB5X 3N6VA 1DBWA 1TB4A 4JEUA 1X3WA 4X1YA 1KP9A 2VHTA 4GBED 5TC4A 2B21A 2ZYVX 5L3VA 1LBQA 2IX9A 3HR7A 4WBXC 5GP1A 3RG2A 3GG2A 1YBAA 1G9TA 2FOLA 1U8AA 2I78A 4YP7A 1X2EA 3B3FA 4NXNB 2XXAB 4D8XA 2PJZA 3DMHA 4HB2A 1QQ6A 5GONB 4JD5A 2CD9A 1FQOA 3T5MA 2Z0MA 1JG6A 1RWBA 3B8EA 4K3UA 4W5JA 3K9FC 3HXLA 4NZNA 1L4EA 4IIJF 3K9NA 1ABFA 4DAOA 4LZJA 4C1NA 3CM0A 1WKCA 4KR0A 2O8NA 3H5WA 2JRLA 3B6MA 1X3ZA 3AG5A 4WZAE 3WGLA 1QE3A 2EJTA 1Z4PX 3DEYX 2AJLI 5EKXA 4P3YA 3DM9B 2HMWA 3SQDA 4Z5XA 5G02A 5C1PA 2JGKA 3DE5X 3VNVA 4KXMA 2MSLA 3AWIA 3BAZA 4MXDA 2HQ1A 4D46A 3L5KA 1FDVA 1RBZA 2G17A 3TBHA 3SZLA 2X5XA 2DTXA 1ZQ1A 1D2CA 1JSLA 3V8VA 3ZXXA 4C87A 3LS2A 4I9NA 2EDAA 1XKXA 4DIMA 3P2OA 1WNTA 4OJYA 1KZ1A 2JFQA 1P19A 3O7WA 5BQFA 4BZQA 2Y3IA 4HG2A 2XX3A 3I0NA 4UMDA 2IV3A 1JB9A 1KF0A 1Z2CA 2ZU6A 5AIBA 4L9WA 1NWCA 1SVNA 4TM8A 4MZXA 3EARA 3KLMX 4D43A 5BN1A 3GC6A 4WZBA 5FLYA 2Y1OA 2DH6A 4XWKA 2NVWA 4AWBA 1EINA 1BTOA 1PR0A 4GXTA 2IYWA 3SMQA 3B9PA 2CEKA 1RJDA 4U5XA 1QPBA 3REQB 3TLEA 4C0BA 1L5OA 2XJ4A 3JQGA 3GZNA 3JZAA 3KQVA 4NY1A 1D2AA 3K1JA 4N6GA 1LDYA 2ZCUA 3DAHA 4QFCA 3U62A 3X44A 2Q29A 2AI1A 2V4ZA 3RAGA 2WQ6A 1VSUA 3MWYW 5J47A 1U80A 2LIVA 3I61A 3TFQA 3PJRA 1E2BA 1U7UA 2ORVA 4MDHA 1KIFA 2DBVO 2OZKA 3R20A 2ZTVA 1OKKD 5ARCA 3WDMA 5TEWA 4FUQA 1V35A 3H1GA 1P5JA 4BL5A 4QNMA 5EJMA 2GFIA 3PUUA 3N7UA 4FLSA 1M1NA 4Q3AA 4A10A 3SYLA 5IWCA 4CGYA 1O7JA 5COAA 3GRYA 4NESA 2FQYA 5A5GA 4OLFA 3HCNA 1VLMA 2QSJA 2JBAB 3FFXA 1XZAA 3FR7A 4AD8A 4BV2A 3AERB 3EE6A 3KOMA 4QOHA 3NGLA 4D5EA 1MVNA 3TLGB 2CB9A 2OQ2A 5DSZA 1DJMA 4XVHA 4RLHA 2ZK7A 2VBIA 2MSEB 3EPPA 5K6RA 3OEHD 4DABA 3EPKA 2H16A 5B55A 1W35A 3LCMA 4JLMA 5A02A 1AU9A 3AUKA 5DE3A 3WLIA 2H1WA 3LVBA 3ZCSA 1ENOA 4JI7B 4ZCSA 2A30A 2JATA 2PWAA 3OIWA 1SM4A 5K6AC 3A9RA 4GKJB 2UAGA 3DV2A 3JPYA 4PPFA 4Q7EA 4RV4A 4Y9TA 3JSXA 1CY7A 1CDZA 3NVDA 3DZGA 1NMQA 3NHLA 3PDJA 1US8A 4OQNA 3VH2A 3R8CA 1BMFD 1GKKA 1QF9A 2BBOA 2FSVA 3AHFA 4MWBA 5AFSA 1DHTA 2BEWB 5J3JA 1Z56C 4WKCA 2DKFA 3Q7SA 4NSNA 2WNSA 4ED9A 5C5EA 1DNPA 2HPAA 1W0CA 1X70A 1ADFA 4GP9A 1X0XA 4DPLA 4US1R 1A5BB 3HTXA 5C5CA 3TW0A 3GLGB 1GQ2A 1TW3A 2D74A 2DUWA 4M4SA 2HQBA 4RIEA 2IXTA 4KLNA 4Q9DA 3QXJA 4P3OA 4N3AA 3VNBA 1QIGA 3IUEA 1PE0A 1NPTO 2QNBA 1GPH1 2Q2QA 5HNHA 1YJXA 2Y2UA 4MV1A 2A84A 3KWMA 4QC2A 4RGVA 4X6LA 2OQVA 2HO5A 3MHTA 5EZYF 1VPLA 5F5NA 4JWTA 3PEVA 1S2DA 5AW5A 3BJZA 1GYRA 2QRHA 3K30A 2AUTA 2I1QA 3FR8A 4X94A 5DHTA 1OR8A 2IYUA 3EIXA 5ELMA 3WYFA 3PNKA 1WU8A 4FMBB 2B92A 3TCXB 1XPUA 2J3DA 2YASA 1XTKA 4NV0A 3WYNA 2D0OB 3EUWA 4RVFA 4H17A 3EBPA 3HVUA 3IS3A 2CE7A 4S1PA 1HDRA 1FS6A 4UW9A 3FUKA 3KJNA 2ZJZA 3SZGA 3BXPA 4GM1A 2H1SA 1G7TA 3I9OA 3TJRA 721PA 4F7WA 2P8JA 4QICA 3VI4B 1P9RA 4HD8A 4LJ6A 3F3MA 3H2JA 3KV1A 4NOLA 1V6SA 1N8TA 2IOQA 4L5CA 4XTRA 1GP2A 1KDRA 1VRVA 4NONA 3BKWA 5GZ3A 4BMPB 4LBVA 2OZVA 2W6JA 5C1OA 2IX3A 3ZKWA 1DX4A 2H4JA 4HUQA 4RKYA 5FUXA 2IHTA 2FTKE 4JEIA 4XXHA 3RM3A 1E9EA 4A6DA 2BH2A 5E95A 5ESRA 2G0NA 4XR9A 1PFWA 1W46A 1M2GA 1KSJA 1QOZA 2H0AA 2X1HA 2QRVA 3H86A 5FI0B 3ZH2A 3DPUA 3IDOA 4Y30A 3I9JA 5LUAA 2X5NA 1R7RA 4GEKA 1T0UA 3OUZA 4GPD1 5GVRA 5KJFA 2XYGA 1V3UA 1YCGA 3OPMA 1GSHA 3ZE1B 2N75A 4MYHA 2HM7A 1QQ7A 1BXZA 2WAYA 3INYA 1YFZA 3H6GA 1VJTA 1VJ5A 2N1MA 5DNEA 5LA6F 3WB1A 5HQ3B 4DYHA 3FB1A 5T6MA 4D4JA 1JIUA 1ADJA 2ZT8A 4MW9A 1NUSA 4I19A 2XHZA 4US0R 4TKVA 4I1IA 1W8DA 1Q1EA 4RHTA 2RGGA 4NAHA 4XGNA 4XGIA 2PUDA 1RFGE 1E7RA 1Z5VA 1KHTA 4PRZA 2OAEA 2IIPA 2PKYX 1XWWA 5A05A 1BOFA 3TB6A 3EGXA 1ZI8A 3K3PA 1BCRB 1JFFB 2IU6A 3GCGA 4BNDB 1PJBA 1R8QA 1T5HX 4OX9B 5T8KC 1MO5A 1C7ZA 1NM5C 2J85A 3QLVC 1Z5OA 1QVZA 2I6XA 4DJDC 3OQNA 4TZ6A 1X3SA 5AVOA 1EJ0A 1GPAA 3Q8LA 2P5YA 1EFPA 1IVNA 4E5UA 1RLMA 3SQMA 3IP5A 2OKGA 2VDOB 1N0VC 5LQKA 4EHJA 1K2VN 1U0JA 1YCFA 2IY8A 4PWYA 5KVCA 3UGJA 4RD1A 1RXCA 2ZW9A 4KACA 5I5EA 3KVVA 2FN4A 1CVIA 4KAAA 4G0MA 3WE7A 1J2TA 1RYMA 1CDDA 2Q6IA 4OMCA 4F9GA 4OSEA 3D3WA 2XIQA 5THXA 2HY7A 2E5FA 1LEHA 1HLFA 1IOWA 1HZJA 1OVGA 2FDXA 1C7EA 2C1EA 4G5RA 2B4KA 2JFGA 4QAJA 1DG1G 4EHFA 2Q5HA 5EWMA 2Q9AA 1G18A 4ZI7A 1EUYA 3EEQA 3HADA 3IUBA 1DV1A 4ZFNA 2H92A 3CSDA 3AVOA 2J3HA 2FWNA 4G1UC 4M0FA 5G41A 4YUZA 5BOSB 2IHNA 3EK2A 1EFDN 4FYIA 5GY7A 1RMTA 3T95A 1H1LB 3H5TA 1K0UA 4OLJA 5DFAA 4CFZA 3GHYA 5IXSA 2NADA 4DM3A 1KOGA 3C6BA 2QYSA 1S3GA 5KYUB 4P0QB 1GUYA 5LQRA 4FKMA 4Z3OA 2QQ5A 3WLLA 5JI3E 4OFXA 4HS4A 3FU0A 1P81A 4IUYA 4RCZA 4ZDKA 1B43A 1P4HA 2EFEB 2OGWA 5IJ0A 2K7FA 3SAJA 4BNHA 4P3PA 5JHHB 1NXQA 4BFTA 1TO1E 4QFMA 2FWRA 3ZK8A 5E7JA 2LUOA 2HHAA 4Q01A 1UBEA 3K0AB 5BN5A 3WSVA 3TECE 1AK1A 1RAFA 5H4GA 4TKUB 1Y6RA 3A7EA 3AW8A 1SGWA 2Q4BA 4I50F 2HR1A 2E37A 4FWTA 5CH8A 1W36B 1OWPA 3NVMB 1LBSA 3NC4A 2C96A 4I3FA 3ER8A 2LGJA 3V2UA 2WIJA 5F4ZA 4F1WA 5DYYA 1KP3A 4F21A 4ZYYA 2UUAB 1NJSA 2ZWVA 3HDJA 1U4NA 4JR0A 3T35A 1WVIA 3AYXB 1QB8A 4R5XA 2GHIA 3DTVB 3GUVA 4IRUB 5CLGA 1OLOA 4DLAA 2NO7A 4QRDA 4RTMA 4J9VA 2IIQA 2EKPA 4DCMA 2F3QA 1W7AA 3NAMA 4Q00A 2H4FA 1ZSYA 1JIIA 2DHEA 1OR7A 5EKTA 3KQQA 3U9WA 3DEIA 1G5IA 4PX9A 4U7WA 4C3VA 5LP1A 1T1SA 1E2IA 3DONA 5GV7A 4AMYA 3NJ8A 4KL8S 1SVOA 2QM0A 5E6UB 3FUWA 3QKRB 3DBLB 1EGAA 5IPFA 3CKYA 4K9LA 2WIGA 2WQZA 1P4RA 3I01A 2NVUA 4N3CA 3FI9A 1G7RA 3HDQA 4RHUA 1I01A 4RTQA 3FDIA 1SIUA 3ECCA 1T4DA 5KYWA 5D3KA 2ZUVA 2V3VA 2PKQP 2Z43A 4PHGA 1KXJA 1G0OA 2XAAA 5BSFA 2IW3A 2V7UA 4YDRA 3GLFA 2CC2A 4LF4B 3STUA 3LLCA 4LGMA 2B82A 4V0RA 4QJBA 3PWKA 4I55F 2BAGA 4U6QA 3LC1O 1PLKA 4V0QA 4Y2VA 3UV7A 5K4GA 2XQGA 4ZV4A 3NO4A 1A77A 3H5IA 2BFMA 3KLBA 4IJ5A 3TPCA 1BHQ1 4U63A 2Q1YA 1VLQA 4W7SA 3F7TA 2J5QA 1G9SA 2FQQA 2Z08A 4EUHA 1GG5A 2ZRPA 4OM7A 2BP7A 4RA6B 3B78A 4QYTA 4ZW6A 1Z25A 4ZGWA 1OFTA 2B0CA 1AUPA 3MWJA 2I3BA 1T1RA 4FBLA 3FSEA 4ZMBA 2D7DA 3N8HA 5IJWA 4QU5A 4RHXA 1RP3A 2P65A 4KXNA 3S0JA 1L8OA 2QAJA 2I7TA 5JAOA 2ZE7A 4JLNA 3WGUA 4HH4A 2Y0EA 3VR6H 3U7GA 3FFBA 5U9CA 4S05A 2GK6A 3CHPA 1U1IA 2R8PA 1L4UA 2NTNA 3O0DA 1QUFA 2LDXA 3R3JA 2YFYA 4UMEA 5JPCA 5TS2A 5J2UA 2IVZA 4UBOA 4MP3A 4E11A 2PVPA 1DKRA 1PWXA 4TZ0A 3R4CA 2WD9A 2HCTA 1KI1A 3NHPA 5L8VA 4WZBB 4DQ0A 2QN2A 2YJ5A 4I6GA 1V43A 1XJQA 2OYSA 1GGMA 1M6NA 1DCTA 3R5JA 2CVHA 1ZRHA 2XLCA 4E21A 3M3HA 1POXA 4ABTA 4BN0A 2ZQZA 1CK4A 4DQUA 5BRNA 2VPQA 2IY9A 4JLWA 4LHSA 4KXYA 1J20A 3P4XA 2DT8A 1U2EA 1L7XA 3NT5A 4HAIA 1JYFA 4MUAA 3MB8A 4UUMA 4U2KA 4F92B 2CXSA 5EJAA 4HPWA 3TUJC 4IV0A 2IZ0A 1U6KA 3ROTA 1WP9A 3UY4A 4MS3B 3W05A 4CXMA 2O2CA 4OD0A 3LQ2A 3CZQA 2ID7A 1C81A 1K8ZB 4BB0A 1SPXA 3ORHA 2OUIA 3UWPA 4HEA1 4AO8A 3V7WA 1EJBA 1VRCA 4MS4A 3R7DA 4E1BA 3AC0A 3H2SA 1M1NB 3J81A 3N70A 1BCSB 2BGWA 4DIBA 5AJUA 1VCMA 4N8SA 1L5SA 4DDWA 1E3DA 3UH0A 3C6YA 4L6CA 4FW9A 1I1OA 2Z83A 2Z6UA 3TS1A 3GNQA 1OJLA 2EKDA 3EIFA 1DLJA 1Z37A 1FS4A 2C2ZA 3G9TA 3H05A 2LCFA 3T1QA 3EVEA 3PHIA 1TAHA 5M04A 3IX7A 1Q16A 4BWFB 2ZOSA 3D3NA 3MCWA 3SWWA 1YQWA 1OB5A 4KHPB 3CHQA 3BWEA 4U2GA 4XZ3A 4C3OB 3ONVA 2F55A 2BGMA 4NZZA 5CVDA 2FUEA 4CI0B 4NCIA 4PXYA 5FWAA 1CDOA 1FFAA 3DLTA 3K8QA 1QUEA 4GKAA 2XB2A 4XX0A 2A0WA 4JYAB 3U6KA 1UM9A 3SFZA 1MQ8B 1XL0A 2P69A 5EE3A 4LJLA 3TEJA 4EB3A 1P6UA 4RNDB 3FUEA 2GF2A 1US8B 2R4QA 3RS8A 1GNTA 1RT9A 2ZRAA 3GW8A 4I4TA 1J1UA 1C7IA 1CS0B 4R0MA 5A71A 5DIFA 4P0TA 3TX6A 1AJEA 2W70A 1EVEA 4DMHA 1UXKA 4BKQA 3CUYA 2QJFA 1Q14A 1Z5UA 2YZ2A 4IS2A 3FZQA 3LI2A 3JVEA 2N3ZA 1A71A 4RTOA 1EVIA 3BN3A 1VPEA 3DZDA 4WQMA 5CT9A 3OZ7A 2L69A 2H1FA 3ZV7A 3DD1A 1DPGA 4JA0A 4NBLA 3VZSA 4AR1A 2XTJA 3EEFA 1VJCA 1L5VA 3IEUA 1C8KA 2GZRA 2IIVA 3R7FA 5EP4A 3JAWB 5GJCA 3VU0A 3K2IA 2AC7A 3DSRA 2F43A 4KGVA 3GDHA 2AUMA 4E4TA 3ZNPA 4WXRA 4J07A 3JR3A 1TYAE 1OFVA 3IVRA 5ITZA 3WP1B 3RQSA 4Z4FA 4PRYA 2ZU0C 3AWDA 3Q40A 3DVSX 5I3CA 3C7DB 1D2NA 3FTQA 3JYNA 4MEBA 4PYOA 2PSJA 1ZSVA 3U3XA 3QU7A 1I4TD 2RHRA 2Q6KA 1VMEA 3R5FA 1BOOA 2L17A 4BYGA 3IC5A 2PRKA 3CLUC 5E9JA 5I7FA 2IV2X 4I4LA 3L1JA 4TQAA 1D4FA 3EUFA 4D41A 1WXFA 3IBYA 3UIEA 2ZJYA 4F1KA 4N5IX 4ND6A 1YDEA 2MOKA 1N6RA 1Q91A 2O05A 3CZ5A 5T41A 4F8YA 1TVCA 4QOIA 4FGLA 2ODAA 4HUQB 4EUNA 2WAMA 1CUBA 4YX9A 2BLLA 1Z4NA 1UJ4A 2PJUA 4DCOA 1JDJA 2W98A 1JPVA 3ZDBA 4AWXA 3VFDA 2QRVB 3BDVA 2YQ5A 3HA2A 4IMJB 3SD7A 3WWPA 4B85A 3UMMA 4EZIA 1EHCA 4L07A 4TZKA 1SH7A 4J7UA 5DH9A 5FV7A 2ZKIA 3K73O 3WMWA 1AKUA 2OZEA 3WK6A 2Z8XA 4WA7A 5KAMA 1FMLA 2X0DA 3DFFA 4H0FA 3IIMA 3OLCX 5CB4F 3SIPA 1YH3A 3ZW7A 3M1AA 2GARA 1ZIOA 1EDZA 2P3SA 3UWKA 4DV1B 4TKVB 4IIDA 5C51B 2VO1A 1MW3A 4XJTA 1NJ8A 4A5SA 2PANA 1M2FA 5DN6A 1RWWA 2VP3A 1N78A 3RFXA 1U7TA 2FN3A 2RONA 4JI6B 1E2GA 3M89A 1V47A 3AF4A 3PJGA 1PTJC 3EGXB 4K0RA 4M0UA 1E3QA 4ZPXA 5K3BA 5JD6A 3T9CA 1C2TA 4LPSA 1GPLA 2ZCVA 1Y0BA 4U2FA 1J24A 4DM7A 1TA9A 3ZHZA 2OV4A 3BWDD 2L82A 4CETA 1EFPB 2JD0A 1R6AA 4L95C 2V1XA 5IKPA 2RAPA 4D9HA 1KY3A 4R3UC 4RD0A 3QBTA 2IHKA 1G5TA 4WLEA 2QW0X 2IYSA 3EWNA 3L2OB 4BCCA 3HYSA 4KEAA 1UXOA 4LXIA 3VKUA 3EPHA 2O54A 1U8UA 4UMFA 3TG2A 5FUQA 4GQAA 4DV3B 4YASA 3L6UA 4AZ3A 3D3WB 2HHLA 3RK4A 4JX9A 2Q28A 1WPQA 3FNBA 3SGLA 3C24A 4O4JF 4EJ2A 3DV0B 4Q39A 5T7BA 3H0KA 1WZUA 3LWBA 1E9CA 2P3QA 3KZMA 4R69A 3UAVA 2EATA 1C8VB 2TS1A 4M0CA 2XUHA 4BEBA 5EWMB 2DF8A 2BZ1A 2FR8A 1R50A 3KE9A 5F7JA 2O5RA 2JJ2D 4BQFA 4ZI7B 2CNWA 1IJFA 2F9MA 3E3LA 2VQSA 2J59A 2VF8A 4RTKA 3MT8A 4ZQFA 1CQIA 2IUEA 4NU0A 5CW2A 4HRXA 2FRVA 2VC2B 3I2KA 2ONYA 4IDGA 4LCJA 3GPLA 4A03A 1OE0A 3OEWA 3BTOA 2P9CA 1DMSA 1T24A 3U31A 1PQPA 2NZJA 3GT4A 5KIAA 4AS1A 4HX9A 3NPMA 2MAPA 2GPAA 5DISB 1E3SA 5B57C 3S4YA 4ARBA 4BO4A 1WHTA 1X1CA 2RH8A 4ZQCB 2B8NA 2YWRA 1MORA 2HRZA 2XE8A 3BBPA 4R1OA 4HLNA 3OQJA 4N9WA 6ADHA 1H6CA 5IJ0B 2Q4RA 2JLVA 1KKUA 1N7IA 4RZSA 1WMFA 3VKVA 4QYIB 2CSUA 4XB2A 2ECPA 3IURA 2P41A 3LRPA 2DULA 2O3SA 2ODTX 3AHIA 3GRZA 4DCUA 4CU2A 5BN5B 5CVEA 2MSWA 2PU7A 3PEYA 1YQGA 4TXNA 4V1CA 1J49A 2Z1MA 3OSZA 4HDOB 4QFDA 1HE2A 1YKFA 3KKEA 3O0TA 2ORWA 5KTNA 4TWZA 1B15A 2XCQA 2BKLA 1I4OA 1M2EA 1WPXA 3L7IA 4S24A 3W5SA 4E70A 4F4FA 4L2IA 1TZ2A 2ZIXA 2DWCA 1KI8A 2ABWA 1MVYA 1K8XB 3BWXA 3DLAA 3OPQA 4R8LA 4KXUA 3V1YA 5JNSA 4S12A 3ZU4A 2PS3A 1YZNA 2VYND 3HP4A 1ZM2A 3WWCA 5BQPA 3ZXYA 2X9QA 1KP2A 1SMKA 1Z6AA 2DFPA 1BKDR 2HXSA 3VNQA 3B7UX 1AH2A 4V03A 2OB1A 1EA7A 3NTLA 2RBKA 2GTIA 1W36D 2D0PB 4W1QA 3K70C 4WY8A 2E1PA 2XUAA 2AHOA 1ZBDA 2IXFA 2VJOA 1ZL2A 4JB0A 2O7VA 4DR2B 1Q12A 3AL2A 3OHPA 4WGGA 1L5NA 4QO8A 2Q1UA 4ND3A 5FOUA 4CTKA 1UKZA 2IU3A 4DT1B 1P0MA 3DTVD 3FYSA 4RJJA 4ZO9A 5FAXA 5DNVA 2BUAA 4G9BA 1AS3A 4EIWA 2NVUB 5J2UF 3EIUA 2PXXA 2EU8A 5AM2A 1VLJA 3D2BA 3RK1A 1O1YA 4O59O 4ZKEA 1X8XA 4HPXB 2W90A 2X14A 3KC2A 5KYWB 1N33B 5KSOA 3JU3A 3EWIA 1XZKA 3A27A 1XU9A 2VK1A 4KUEA 3GLFB 3WQRA 1Q1NA 3WZMA 3IJ5A 1RLTA 3A1EA 4R9RA 3V9AA 4MV0A 2A88A 4YAOA 2XDYA 3E3MA 1RQLA 3LLVA 4WX2B 1UKEA 2RJIA 3KU1A 4HDSB 4X20A 2GYVA 1XTJA 1N34B 2ZJFA 1EIZA 3HM2A 1JFLA 3PFCA 4KIUA 2BP7B 2ZS8A 3CEHA 3ZW9A 1KJWA 1XWIA 2FMKA 1BRMA 4M1YA 2HADA 5EXPA 2HC9A 1QU3A 2IH5A 2YZNA 1KNXA 1OI3A 3SVZA 1DJOA 4POAA 3RSQA 4DA8A 5LM3A 4PZCA 3IV6A 2FN8A 4HQLA 4DRYA 1GKLA 3KFXA 3NBZC 5FNVF 3RTDA 2VJPA 1UKCA 4NG4A 4ERXA 1HXHA 2BGGA 5D5QA 5HF6A 3CHSA 2OYRA 2BM9A 3GEDA 4HH3C 4TWAA 1ABBA 2B8JA 2J9XB 2JCXA 3LA6A 1ILWA 3CLKA 5IP5A 5TQJA 1GGNA 1QHYA 2PH3A 4PLTA 4BVKA 5I4IA 4GECA 2HBRA 2BD0A 1ANKA 1GCAA 1UJNA 2NU6A 4L8YA 3R9IA 5JARA 2BC9A 3GWZA 4I81A 5F12A 3PHHA 3QUSA 3U3OA 1F4LA 3RVRA 2RGEA 1CHDA 3G2PA 3GLHA 3H5OA 1S1MA 2BPOA 2V9ZA 3STXA 4UM5A 2V3CC 2AS0A 4DSNA 5EZSA 2Q1TA 3ZDDA 4YDSA 2X22A 1TRHA 2WAOA 3C4VA 2YFKA 4NNOA 1NPYA 1BFUA 4AFNA 4E6PA 4E88A 5IC4A 3PIIA 5LWHA 4P92A 10MHA 5GOTA 5CCBA 2HD4A 1VPVA 3K70B 3TW4A 1EG7A 1JWAB 1QRRA 2YWFA 3EJ6A 3P2JA 4FC7A 1PUIA 4Y6GB 2OYCA 3QBVA 1CR1A 2R8RA 3TD9A 2EP8A 1E4YA 4QYSA 4RV5A 2BOVA 1BVYF 1PS9A 1U7ZA 4IJVA 4QODA 4DL9A 4ETNA 5LZ9A 4QULA 1GAWA 3RLFA 4JKYA 5BV1A 3HWWA 3KCQA 4NBKA 2NUAA 1J2EA 3TGWA 4YACA 5IJAA 1J0AA 3PFNA 3LDAA 3RE1A 3WSWA 1Q0UA 2XVYA 2I03A 2R1TA 1TM5E 2PM8A 4KTTE 5IF9A 4LWZA 3SFTA 3P9YA 1VA5A 4QBKA 4J03A 1TLLA 1ZH2A 2WSIA 3OZWA 2VJMA 2C1XA 3LMKA 3NDBB 5B1EA 3OD5A 4BATA 3LSYA 2Q0XA 2Z1NA 1ACLA 2AFHA 5JNTA 2W6ZA 1LDGA 2WWTA 1T2FA 2W2VA 4R1TA 1PWEA 3ZCUA 4BV8A 3JWPA 1LFDB 4IHKA 4RF3A 2HK6A 2Z5FA 4RSHA 4Z1MA 1KDYA 5D3QA 3ANNA 3T5GA 1KMMA 3CRNA 4XX0B 5KNCH 1TYDE 1UM9B 5IMBA 3W5UA 2VVTA 3ZXIA 1BX1A 4P4TA 4DFDA 5GINE 2YN2A 3UANA 1ZRSA 2XB4A 1JI3A 2YFHA 3E5MA 3ODGA 3OFSA 4CCAA 5JSQA 1NFRA 1J97A 2PKRA 3WRVA 2QE6A 3KKLA 1EDDA 4DMCA 1V2HE 2UKDA 3F4BA 3K5IA 3A9SA 3Q2OA 3E9NA 4ESOA 4CL8A 3R0IA 2L0XA 1U31A 1Y5RA 2CXPA 2R4TA 3A04A 4K1LA 4QFBA 4QX6A 4CIXA 3PUWA 4W63A 1FU4A 1RQRA 1WULS 1NVMB 2IZZA 3MYRA 4LGYA 4W8GA 4E14A 1C0LA 3E70C 4KPFC 3G8DA 3AZQA 3FUTA 4XOUA 4EL5A 1NXSA 2OK8A 2JIDA 2LXNA 1ZUD1 1E63A 2PGDA 5D1HA 2I4IA 2ZSKA 4BN5A 4QDJA 4WBNA 4GR5A 2FWBA 2G09A 3FTUA 4GHWA 3K09A 2GASA 3M1LA 4Q6BA 2FW1A 3DDSA 2QF7A 1IB6A 1Q1QA 2PUWA 2FPLA 3SYNA 5ITZB 4YBZA 1QGUA 2J46A 4KX3A 4X24A 2WV9A 3T12A 4B4UA 3N0WA 1JT9A 4CNQA 3P0RA 1X86B 2X58A 3H18A 2XTMA 4F8JA 1WA5A 5FBLB 3OE4A 1QK5A 3DDNA 3UQZA 3V5NA 3ROGA 1HQDA 2FFLA 1MQSA 2QQ0A 5EOVA 3DAPA 1RE1A 2XI4A 3EVBA 5BMVB 3CRW1 5G4LA 4H1WA 4EO7A 4LJ4A 4QUKA 5KNBH 1N32B 2NV2B 1WNFA 1NRXA 2DTDA 4ZQGA 5HA5A 3D6FA 4FYHA 5YASA 4XWOA 1CDEA 2OZPA 1A97A 4BMCA 2QX4A 4Z4EA 2IDZA 3AR8A 4LRQA 5EHIA 4JUIA 2C4MA 3UKOA 1GPDG 4MB2A 5JNUA 4O2RA 2J45A 1WXXA 4HNSA 1WOMA 2VP2A 2EYQA 4EX7A 3THXA 5JQGB 3BJEA 3B6ZA 1S2IA 3UICA 2VDVE 5DSTA 1TIKA 4MUKA 1FNSA 3G6WA 1L8QA 1DUVG 2W6JD 2DZDA 2J48A 3CX4A 1IIRA 4BNLA 1K7CA 1KAGA 1MTZA 2FYTA 2I34A 1DTWA 1GZUA 4N0DA 5E1OA 1OASA 5HFAA 3IP1A 3R7BA 5BRAA 3ADCA 2B8WA 1SQ0A 2OM6A 3ZHOA 1N6HA 3ZHSA 2P9JA 4ZJZA 1E6KA 4EGQA 3GFQA 4KWTA 2FU5C 1OF1A 1YAHA 2GCPA 3QFSA 4I9UA 4E33A 1G17A 2IXAA 1IJBA 1DO8A 4BB5A 1L5RA 4GKBA 4P81A 1XE3A 4IDQA 3IR5A 2VT2A 3EXHC 5EWJA 3OJFA 3AP3A 3H4VA 3Q4GA 4QXOA 1N7HA 2EQ5A 4MIOA 4BKOA 121PA 1OPXA 3B9BA 3W1EA 5HNFA 1Z8FA 2JS7A 4NYMR 5DT2A 4B81A 4AMVA 4ZYXA 3PD7A 3MMXA 4Z7NB 2GSDA 3AF3A 2H8KA 2O57A 1K7FB 4QTTB 2IEDA 3TOXA 2ZTLA 3CNQS 4LPKA 5CM9C 3SJBA 1T0PA 2GZ3A 1T0JB 2NVOA 1NTOA 2QK4A 3AINA 2PUJA 3L4EA 3O2NA 2PSHA 4OHWA 4CFSA 2A35A 4ZQEA 1U3TA 3UT0A 2PKCA 1JH8A 3EVAA 3UFBA 2OO3A 4LQDA 3QHQA 3PNSA 4Q12A 1DRUA 4IOMA 3RYCB 2LCQA 3D43A 2QTHA 2D5BA 1SU4A 2O5VA 4F71A 2JCYA 4XX1A 1GGKA 4EGAA 1DL5A 3E18A 1ZS9A 3MUNA 4GP7A 3WG9A 2BV3A 2F4NA 2KW5A 3GFBA 1H5NA 4HAWA 4MLPA 3L0CA 1QHHA 4I2NA 4K8OA 5E2IA 4BE9A 1NVWQ 1YIDA 3AY3A 4S1NA 4TX1A 1KR5A 4BVHA 5B1HA 5DRYA 1MO6A 4L50A 1PVDA 1I2DA 3Q0IA 4FMCB 2LDBA 2R4UA 4B48A 4XJSA 3GEHA 1EZ1A 3OKCA 2R6ZA 4YAJA 3TDKA 4MR9A 1CQIB 4JFRA 2J7PA 1YVPA 4DC1A 1HFWA 2YCBA 3H5VA 2EOAA 5DT9A 1NQVA 1PWZA 2J09A 3DMPA 4JDUA 5BPFA 2CLHB 3F78A 4R40A 4Z0TA 5JADA 1E18A 4BUJA 1WHTB 1Z0JA 1LLFA 3IT3A 4JITA 4G26A 2RHOA 2A7OA 2JEYA 2O23A 4HDNA 1QH0A 5KYYA 1DE0A 2IK8A 2V6BA 4HDMA 4UARA 3ZI7A 1IHXA 1V3VA 4J0JA 3CTMA 1I51A 2HA6A 3V1UA 4C29A 5B7GA 5JVDA 2PSDA 1CJTC 4PLHA 2OESA 1Y1LA 2POCA 3NWEA 4FE4A 3PNBA 4JT8A 4D6PA 2XODA 5BOVA 2FP3A 3GMSA 1RRPA 2WPGA 2GUWA 2GK4A 4LQLA 3IKJA 3SM3A 4PN7A 3LC0A 5A3SA 4BNXA 1BH2A 2ZIXB 3LM8A 3JQ6A 5FOXA 1GG8A 4OEHA 4HNAA 2DU8A 3CNOA 4CODB 1Z9BA 3EFEA 4DJAA 1I33A 2ZI7A 5DX1A 1KOLA 1WUYA 3SDBA 4E32A 4N3GA 4ZW5A 4DMGA 2J3KA 1AUOA 3VI3B 5EINA 2E2WA 1B00A 2Q2NA 3AI1A 5FBQB 2ANCA 4BOYA 1EM8A 3T3NA 3SP1A 3TMAA 1YOVA 3QIAA 3W3AH 1KH1A 4J49A 5FUYA 2OC9A 1N6LA 3SYMA 4URZR 4BJ6A 3ANSA 5B7QA 4DR3B 4UDYX 2O1EA 3QMPA 4EENA 3IP6A 2ZUWA 4Y6RA 3MELA 1BGVA 4MV9A 2BT4A 3ETHA 4I8DA 4ERNA 5EC8A 3PNPA 3O5AA 4K87A 1KRWA 3QLUC 3GBVA 4G81A 5FV4A 3QVXA 3UB4A 2G9QA 5IASA 4HEJA 4XLZA 2KBFA 4X61A 3IT0A 1PP4A 3BA1A 4WI1A 1QCCA 4BE7B 1L1QA 5KPJA 3ITKA 3DKIA 4CL2A 5EJ8A 1LF0A 3CUKA 3DLCA 2Z9DA 3G2KA 5BSVA 4AQ7A 3GPBA 4I55B 3O8RA 2AMLA 3EPJA 2WJYA 1QFXA 5B6JA 1HQKA 1X7ZB 2I5PO 4FS8A 4X20B 2IQIA 4JI2B 1GAEO 4IZIA 2B9VA 5L40A 1EYZA 2Y77A 3NTVA 4WLUA 5BT9A 1X1QA 1FNCA 4BECA 1I5OA 2C0PA 3V7UA 2KLHA 2WHQA 4GWGA 1IJEA 4PPYA 4Z3DA 3MOGA 1M5UA 2GKSA 1TU3A 3G0GA 2EV9A 3FUNA 1VP3A 1F8YA 3T5PA 4BEJA 1I3CA 4UQLA 1PQYA 3LYAA 3N76A 1FEZA 4W1RA 4Q7KA 4CLEA 4F60A 3KDSE 1U0TA 3V8QA 4UTRA 3W90A 3RFVA 2WIAA 1XTQA 1VQ1A 4GIBA 4X65B 3NBXX 3FU3A 5I7AA 3PQ6A 2XGMA 4B2IA 5K0GA 1ORRA 3H3FA 1C4OA 5KWSA 5SZHB 1E6UA 1HRKA 1GY8A 1QE0A 2CLEB 2V6FA 4C4XA 1CUVA 3BMXA 4UAVA 4KLZA 2C97A 1NTRA 1PJQA 3GXBA 3FPSA 3LVFO 4H7PA 4Q5IA 4AU1A 1G8YA 1FJHA 5DN9A 1SOAA 3KQOA 3BD8A 3DJFA 3IVGA 5BNFA 3TCKA 4OA8A 4TWBA 1FUEA 4DIOA 2KYRA 1ORWA 1U0FA 2GEBA 1A8PA 2YZKA 3H1BA 3I30X 4L85A 1YONA 5GTDA 5LNK6 2COEA 1YE5A 2QRQA 5DLDA 3QPCA 1GPMA 3ZWKA 4E1VA 5HR5A 1M1YE 2NUAB 4TYNA 4KU4A 1KOJA 1FJXA 2PFKA 5ALYA 2HT6A 2ZRQA 4EATA 3K70D 4K0KB 5JYDA 3ETJA 2MMGA 1CJKC 2R1TB 1ZIYA 2F90A 4AK9A 5BSKA 5FWXA 3F7OA 1OXSC 3FVQA 1KZHA 3KUXA 5LQSA 1KU6A 3L7OA 2EZUA 1ZD3A 2QUHA 4BNNA 5A4FS 1Z45A 3DOEA 2VJMB 3FGOA 4L4XA 2QVCA 1PQWA 5JLAA 3I62A 5FLEX 2YDYA 5C8XA 3A6PC 2AFHB 3EYAA 1U28A 2P9QA 3E5RA 2I7VA 3OQPA 1ILEA 2R68A 4QNRA 1IVYA 1RP1A 3QF7A 3V8NA 2ACEA 1JGTA 4HB4A 4XB1A 2JFWA 3KLPX 3SLKA 4AL4A 1BD3A 2A5JA 2XGJA 1GEGA 2FUNB 3G2QA 4CZ2A 3AHJA 3L84A 1V26A 4KQHA 2PZBA 2FXIA 3VSBA 4K5NA 2ESRA 4X8MA 1VYTA 5DB4A 3DP7A 4ZAFA 1SC3A 2IZOA 4G01B 1KH3A 2CF5A 3DC7A 5J58A 5JAMA 3ZK7A 5LBTA 4K9OA 4IGIA 4PTZA 4A2CA 3L9XA 2EIXA 4OJQA 5JISA 4JLOA 1VXOA 2GM9A 2F6RA 3HL0A 4G5QA 3AT1A 3CE9A 3GN1A 3LDHA 4BP3A 3K05A 1Q0ZA 3LU1A 2A58A 1NVVR 4LX0A 1AA6A 3VM6A 3K71B 5SY4A 4JJ8A 5JZOA 2HH9A 1HDCA 1UF9A 4W5OA 3EGDB 3M6FA 5H9VA 2IIBA 2QWXA 2WKSA 4DWJA 1G8PA 1M2OB 1Z8DA 1DOHA 5HF9A 1YR8A 2E4XA 4KQWA 4C0JA 1OCEA 2PEZA 2TMDA 2C82A 1EQ2A 3FDZA 4OO3A 4E5DA 5JOQA 1QGUB 1YZYA 5JCJD 5EJIA 4YWJA 4EGSA 1ODKA 3BFKA 5JXHA 1L8XA 1SRQA 3MJRA 4MVJI 2J0VA 1BS2A 2ZIWB 4LYDA 3FPAA 5ESWA 2OV1A 4KE9A 2IYLD 2R7MA 5HEKA 4YYZA 5K2OA 1EZZA 3IA2A 1RKQA 2N46A 3L8MA 4L4SA 1NU8A 5TQ2A 4B9EA 5E6RB 5HBGA 2B25A 4DZRA 5B6IA 4E46A 4DLYA 2HKIA 4WD3A 4P54A 4BVLA 3NV9A 3DOFA 1WZIA 4NR0A 1EUCA 1CKEA 4I1YA 3L6EA 1IXZA 2OFOA 5ALLA 4CLRA 3PRYA 4MVJG 1A7JA 1XC7A 4L0DA 3R3YA 4LZOA 2OGUA 4G23A 4Y2QA 3HY3A 5EUMA 2BHNA 4BWYA 2NT4A 1QHXA 1T25A 2J30A 4X45A 4L73A 1AIPA 5AR1A 2PUAA 3BSWA 5DPMA 1H9AA 3UMVA 3AFHA 3UMCA 1SZDA 3HZHA 1YJ5A 2Q62A 5J5AA 3U7EB 4IBOA 2DOKA 1P2GA 3IAUA 3AOEA 4XUGB 1P4GA 3OO0A 1U7DA 3RABA 2AQKA 4FQ5A 1R10A 1U7HA 2BEUA 2FW7A 2XT0A 2IOHA 5CNKA 2NSDA 2C2OA 1EX9A 4U9IS 2B5OA 3B3QA 1UPUA 3EMVA 1WL8A 1D4ZA 2JAOA 4AKEA 4M8LA 4D80A 2WVGA 3GFTA 4Z8XA 4TUYA 5K0NA 4JJAA 3ZQUA 3O4IA 2A1TR 1NSYA 1Y3IA 3S28A 3L07A 5CDGA 3E9ZA 4QOGA 3KWFA 3OFJA 4JYZA 1J1IA 2J41A 1I7SB 4B3TB 2JH8A 4P7FA 4CIWA 2FPPA 3R3ZA 1R3UA 1YI0A 4YBRA 6NULA 1L1RA 1ZSNA 3HB9A 2X15A 2P90A 3TTYA 3H11A 5DN6D 3RAPR 1EQAA 1ZITA 1GGJA 3IMEA 1FU7A 3NHYA 5I7OA 4IDCA 2AI3A 2GZAA 2VZLA 4O63O 2VJCA 1V45E 1KI6A 2EFGA 2DTEA 4FFMA 5D7NA 3KBOA 2CZQA 4JT4A 4ZU6X 1Y9JA 2BGLA 2NOAA 3KG2A 2QV0A 1BSVA 3FXAA 1Z3CA 4IDAA 4S1VA 4D8YA 4FFRA 2YYZA 1ZR2A 1UIRA 1YS7A 1Q7BA 3EG9A 4KUHA 4W5NA 3MBIA 4ZREA 4ON9A 4CMCA 3EGVA 5HVNA 1EVYA 3U0BA 8MHTA 4B4VA 3DCIA 1OAOA 4ZQHA 2I7XA 2NU9B 4HAZA 4ACBA 5I51A 1QHHB 4M8IA 1TJNA 4ENPA 5AJVB 3WKAA 3QVTA 1SC6A 2F7SA 3PVZA 1XP8A 3ASUA 1GDDA 3OHMA 4GD3Q 4J16A 4DA9A 4CEHB 3MS4A 4GI2A 3IPAA 2QL7A 2ID4A 2VP4A 5CGQB 3A14A 2VYCA 4FYJA 4H1HA 1JR6A 1D8AA 1UFQA 1BJTA 3AHGA 4MR9B 4U3JA 4XQEA 1YVRA 5K0BA 1G8HA 3AKZA 3IAAA 4EYKA 3LY7A 4CL3A 2JIMA 2HIMA 1IK4A 1M2HA 2J87A 3Q0EA 3T9EA 3PB3A 3IP3A 2I54A 4QE3A 2GM5A 3S2ZA 5BSWA 3A6DA 3C5WP 2I3DA 5TDHA 4L08A 4DLUA 3O2QB 3P71T 2FG7C 2CNWD 2ZLBA 2VHCA 2JGRA 1XDDA 2WM9B 1WVMA 3E84A 3GK3A 3O21A 4HDNB 4OQYA 3WXBA 1A5ZA 3ZY2A 4Z2AA 4G5XA 5KYYB 2H2DA 1KAOA 4HDMB 2QUZA 2L19A 3DULA 1NBWB 5LZ2A 4X95A 1I6LA 3K4QA 1DJNA 5E2AA 1GKYA 3BF8A 1X7DA 2NZUG 4CPDA 3AUUA 4L74A 4U00A 2PN1A 2IF2A 4LDPA 1NV9A 3HU2A 1SIBE 3C74A 3GELA 4G0YA 3D3QA 4JXZA 3QE9Y 2UZAA 2EJUA 3SG0A 3KJFA 3OJEA 1IK6A 4F3YA 4ZYTA 2F62A 2CNKA 3OX1A 3ST7A 1JAXA 3IQWA 5DI3B 2IGTA 3CC8A 4QT0A 4G0VA 2R8YA 1QDEA 1JSCA 2G83A 1KEPA 4BNIA 1JG2A 1M67A 4RTRA 2VJKA 3OIDA 2B4QA 1JKFA 5BNIA 3C3BA 2W8BA 4YQEA 3MMNA 3OX3A 5DHFA 1DXYA 1D7OA 4K2AA 4HH1A 4EA6A 1OXVA 1KQNA 1QVRA 3G9ZA 1X39A 4QDKA 1T8TA 4BO3A 5GOZA 3LRTA 4ZK6A 1LRKA 4DNQA 4R1NA 1J90A 4O8ZA 4D56A 2WMNB 1EM8B 1NI4A 1NW8A 1TW2A 4EWLA 1XG5A 2FVXA 4YJ2F 1YOVB 3SJ7A 2RE8A 4XWAA 1HL7A 1LD3A 3EZ9A 4OK3A 3X1MA 3WFZA 4X63A 3MW8A 2GTPA 3OJWA 5BN4A 1IEQA 3HEBA 4Y2GA 3V00A 4FLEA 3RC8A 1X9IA 3CF4G 2IYAA 3IYLW 3LD9A 3NBFA 4GMXA 2IZ5A 1DPFA 1NDQA 1XL1A 2ATEA 4ZVKA 5M2QA 4KR2A 2WJIA 4M8SA 1J8FA 4R8RA 3W5IA 3CUSA 3ACDA 2KJQA 4MYCA 3T5TA 4QKQA 1GARA 1YAJA 2ZSAA 3PNVA 4CFYA 4JY7A 1F20A 4CKZA 1OJ7A 2HHCA 4KIJA 1RE0A 3H9QA 5JXWA 2PX6A 3HSKA 3G68A 1O96A 3M6AA 5I4CA 5CM2Z 4ZP1A 4JC5A 4UNRA 1KYQA 2C5AA 4CT4B 2Z58A 2FGKA 3UJ6A 3CGGA 4CR7A 3ANMA 1U7OA 4X8OA 3ACCA 4KO8A 2JKVA 5B2EA 4HAYA 3JQ9A 3PNOA 4X6YA 2PL3A 1GRRA 1KI7A 3H7AA 2I65A 3A9TA 3FUVA 4NXMB 1U28C 2AXNA 1CP3A 1FZQA 2Z4SA 2DERA 3RT9A 1V4NA 1N5JA 3C1TA 4LGVA 2IITA 1MJNA 3MWDA 4FDUA 1JEJA 1M73E 4IW3B 4KQGA 4RX1A 3PEFA 5FUWA 4W8HA 3ECAA 5TQVA 4CCYB 3NGXA 4I8XA 5KOYA 1A69A 2HF8A 3C7TA 3BXHA 1NLUA 2C5HA 2JA1A 3GDGA 3I2JA 4QGBA 1WQ1R 3LE8A 2X8LA 3B60A 3M6XA 1JKMA 1V9CA 1JLHA 3AEQA 2PWBA 3QHAA 1G7SA 5CNJA 3VZQA 2YJ6A 3RC2A 2VJ8A 4UTZA 4CMBA 2H29A 3AETA 5JRJA 1ECPA 3IHLA 3MPOA 4L3WA 5AK3A 4DCNA 5L9AA 5KQGA 1P1IA 4PSKA 4DSOA 4HDQB 5JCPA 1C8LA 1RC0A 1XEWX 2H63A 5CBKA 1E2QA 4F96A 3QRWA 4LJRA 1NBME 2BGNA 2E55A 2IY7A 3OVMA 5BSUA 1C7JA 2C1ZA 4DDVA 1PK8A 5K0CA 4QEZA 4AS2A 3BBLA 1T9AA 1RXEA 1WRBA 4MB6A 4K6FA 2WUWE 2GTHA 4LRWA 1HLPA 1E3EA 2DHCA 2YVUA 5JCOC 1YL5A 4FYMA 4H18A 4I7EA 5BUQA 2EFHB 2JD2A 5ENDA 1Z0DA 3VISA 2IYVA 3G3EA 3IGFA 3QEOA 1X7XB 3G6KA 2R5NA 4E4YA 2CL6X 1RQGA 4YAKA 1U2TA 2XUOA 5AM0A 3U3DA 3HNOA 2XPCA 3WL6A 4UE2A 4EP1A 2ODNA 3HHPA 4PYMA 4IVPA 1FFEA 4C4PA 3DDWA 1ZJWA 4XTCS 5FWXB 4EPTA 4H0CA 1XXHE 2AIRA 1KFBB 4AZSA 5JFOA 3L93A 2A1TS 4A91A 3VAAA 3BWMA 1N3IA 1BX3A 2RHHA 5TVGA 3DZBA 3KEQA 2I99A 3MK31 5TQ0A 2HMAA 1UPAA 3EOBI 5HUQA 3A3YA 2WJ6A 1EX6A 1VP9A 3PA6A 5EQJB 3RTBA 3JYLA 3D1LA 3O03A 3QA9A 2F8SA 1NRWA 3UNXA 5CD1A 5CM8B 5EMJA 2PUGA 2O0JA 5AIAA 4F7DA 4QQ8A 2YRFA 1S3FA 3UK1A 4M8KA 3CWCA 1I6MA 3I4CA 3WGJA 4C7XA 5A4MS 1CY8A 4UXHA 3H2GA 1N5MA 3CEMA 1LPNA 1W19A 3T7RA 2W22A 3FUDA 2YXPX 1QYXA 1T35A 3N8NA 4NHOA 2HWUA 1U2PA 3EQ6A 1HUQA 3CN7A 4BEVA 3AK4A 3OC0A 3DE1X 2WG0A 3V4SA 1CUGA 1PW5A 4UFOA 4Z1MD 1NSFA 4G24A 4RIHA 2OZLA 3RNOA 3COYA 5H02A 3VPFA 1Z0SA 2B9EA 4OM8A 1F6DA 2A3NA 2YOGA 5D6OA 4X66B 1E1LA 3IE0A 3GFPA 2PZMA 4EVQA 2V5UA 1M2NA 2VNAA 3G2LA 3GRFA 4LC9A 1CZNA 4B35A 5FWYA 4MPDA 3T5BA 2G3YA 4XUEA 2RHTA 5AK0A 3Q44A 3ZXUB 2ZPAA 5ELXA 2G8LA 4P36A 1QG2A 2OWDA 5GMOA 4KLAA 1ID1A 621PA 1SIWA 5AWFC 1PR4A 3A4VA 2IYYA 4C0KA 2IU0A 3B7WA 2I4RA 1BWRA 1QK3A 5HDQA 3HBAA 3PQDA 5A9SA 3OT5A 2GRJA 4JC0A 4D8TA 1F8XA 2NO5A 1U8TA 3BWCA 3K6KA 4MYRA 5CLHA 4GE3A 3TLMA 2PXAA 4PLPA 1NXPA 5HZGA 2ZROA 3I8OA 2EFDB 4UNSA 3TZ6A 2J3LA 4D9GA 3WIOA 4DCPA 4GBMA 4B43A 1A8HA 2YV1A 3IIIA 3QQ5A 2ZBFA 2HSEA 4H7JA 4J16C 1D0SA 5TPZA 3HW2A 3RB8A 4EHHA 2XT9A 3IHWA 1E4VA 1N2OA 2R5WA 3FULA 1EUCB 3PV0A 4RESA 1C1XA 2OLEA 2QZJA 3V1NA 1S0UA 1LSUA 1RDFA 4U7HA 5KSWB 2PFSA 4HADA 1R0KA 3FH8A 2GZDA 4Y1EA 4OLBA 2HQRA 1QR2A 2ZB8A 3TNDA 3BT7A 4NCJA 4MKGA 3R23A 1Q17A 2A14A 3DL7A 1YQDA 3OJ0A 4JLDA 2VLBA 4LHYA 3V3KA 1YUNA 4IQGA 4LWPA 4A8JC 4XN2A 3I34X 3WGZA 4OXRA 1L7MA 3ENZA 3HMKA 4FZ5A 2AYZA 1EK2A 2XUFA 1D5CA 2H7VA 1ODTC 3BGWA 2Z6VA 3R76A 2BEUB 2OD9A 1YDWA 4HVAA 5JD3A 4E0BA 4G8BA 5L7WA 1AV6A 1FDTA 2R8BA 3HB7A 4CMAA 4RE5A 1ZIXA 2J5XA 1Q6ZA 4GBGA 4ZT5A 3KHTA 2X2OA 1U3DA 4J3BA 4FSHA 3M81A 5TR9A 4DUZB 3GOHA 4DA4A 2PH7A 1ZIPA 5DNUA 3HCCA 1K4MA 3RYHA 4X0EA 3HY6A 5C5DA 2RH4A 4KPEC 3L8EA 4JIMA 3HCAA 2I2CA 1PQUA 3FYUA 4MZDA 3UTCA 3BMQA 4HPJB 3VR4H 1PW7A 4AQYB 3BIJA 1EB8A 4PX3A 1Q92A 3RT1A 3H8SA 2FPPB 3E23A 1N5IA 4Q18A 3CYFA 3V1MA 3I4LA 2O1XA 3ZD6A 5DM1A 3A2KA 1JBKA 3BGOS 4WDQA 1G7CA 1OH7A 3VBEA 3U39A 1ZCFA 1VJ0A 4NULA 1UJ5A 2RBEA 4HNGA 5G0UA 5HIMA 1EVQA 3BF7A 3WDLA 4QUIA 5JCXA 5L6LB 3RKUA 2DWOA 3WBKA 1N25A 1KI6B 1ZA1A 2IXEA 1YVDA 2YV4A 3B1FA 3T94A 2G63A 2PL1A 3ZOZA 1NJFA 4MVXA 1XTVA 1CUYA 2FEMA 3CW8X 4CM6A 5IK2A 1ODJA 3IAS6 3EQ9A 4KE8A 4HWGA 4C21A 3MHPA 3UPTA 3ZDEA 1A95A 4GGOA 2I67A 3EG9B 3L02A 4DAEA 2AN4A 3ZUPA 5EZYB 4IDEA 4YGXB 3J81k 3OKPA 1EE1A 4LRXA 3CEPB 2P6RA 2G70A 4NOMA 1E6WA 3T4UA 1S2LA 3O9MA 4M87A 1OD6A 1ZMXA 4CNBA 4HGZA 4H1UA 4NAUA 1B2LA 3GD5A 1E98A 1JAZA 3WJ1A 1V8BA 2A9PA 3NDRA 3SN6A 4F46A 4JASB 2NPFA 1DWOA 4U3JB 5BYBA 4DQXA 2DQ6A 1RWXA 2DP4E 3H2IA 4UEQA 4XDZA 3UUGA 2UZ1A 3VPHA 3UHJA 3GU3A 1IZ8A 2JGMA 3L05A 3KL2A 4MQFB 1CZRA 2RC5A 4AUNA 1DT3A 1X94A 1QIJA 3FROA 3JQ9C 1I7QB 1U2DA 4F72A 1U1EA 4A8JB 5K03A 2PQ0A 2EJVA 4D9BA 4UCWA 3HUTA 1NXOA 1UBLS 4KVGA 4PZUA 3STWA 1TMOA 1R12A 3P0EA 1RHMA 4DEVA 1T5BA 1Z7BA 1DQNA 3ME5A 1Y48E 3F6CA 3QK7A 2W2PA 1FQKA 4LJ7A 2F3UA 4CN9A 3AJ8A 3AZPA 4RTJA 1F5SA 3MQFA 3SOZA 1ZNXA 3OCJA 2P30A 5AH0A 5G4KA 3OY2A 1REQB 2HBYA 2P1DA 4B4WA 1SCNE 3ASZA 5ER6A 3NDJA 4LF7B 3PYMA 4HS9A 5AHWA 1GGFA 2WTNA 3HBJA 4OIFA 5LA6B 4M3NA 1OBCA 3DR3A 3LUFA 4B79A 8ABPA 5HRAA 4Q7MB 1WUHS 3E9YA 5SYAA 4AZTA 2E6KA 2QLNA 1WDMA 2R7KA 3PGJA 1Z3IX 4BDSA 1QAMA 2GDJA 4C43A 4L9SA 2FSIA 2W8BB 3KL4A 4X1OA 4EQZA 1E1DA 4YDQA 1B4DA 3VTAA 1ZRNA 3RYFA 4DGQA 5KOJB 1TQDA 2UYOA 4AN4A 4UAGA 1NQWA 1EP3B 3SHWA 2Q3HA 2YBDA 4TXMA 9ABPA 1IG0A 1MLDA 5FPYA 1SC4A 4EYSA 5HTKA 1E3TA 4AVYA 3CPSA 4FQ7A 3FOFC 5LB4A 4QTUB 3A0UA 3H2BA 3MN1A 5BN4B 4KH1A 1FXUA 4W9MC 2F64A 3C45A 1VPWA 2Z56A 2D54A 1K98A 2E1RA 3F97A 4B6PA 1SOVA 1T15A 2EW1A 1Q0RA 4WXPA 4WFQA 1NGSA 3H83A 1MVLA 1JKIA 3NP9A 3BRSA 3RJMA 3KYDA 3U4QA 2DLDA 1UKBA 4JOSA 2AL7A 3PT5A 4A16A 1Y7IA 2FDRA 2OGZA 4ZT6A 5IF3A 1T2EA 3COZA 4UHCA 3T8YA 2RAVA 4BV9A 1J0CA 2I9PA 3BS4A 3LHIA 1O96B 1QOPB 1L2TA 2BEKA 4IUCS 3Q3HA 1KAQA 1E9RA 3FCAA 5CK5A 2D7CA 3H9UA 3K1AA 1XU7A 2HLNA 3D31A 2OSVA 3I04A 4LYYA 4CI9A 1ID8A 4B3BA 3JATA 1XQXA 4P83A 1K7SN 1JLMA 1NMEA 1Z4LA 1B0ZA 2GO7A 3PBKA 3NORA 3ZK9A 2DPHA 3Q3JB 3MWDB 3O95A 2OFWA 2XZOA 4Q21A 2ODQA 2GAJA 1MMFB 2ECOA 5DWDA 4ZV7A 2XCIA 5J2TB 4OF4A 4DMUB 5A4AA 1EAYA 4HFRA 4AY4A 5FTNA 4ND4A 3AEQB 3KQKA 4A0QA 5HILA 4ALJA 4B6EA 3HBMA 1TKRA 3VX4A 3AETB 1IHPA 1W5SA 3PDHA 3RF6A 4DZZA 3IQEA 3GA7A 4O4IA 1ATIA 4F2HA 3WAGA 2IS1A 1ZGBA 4XVUA 3LFHA 3MUEA 4ZO6A 2YHSA 1T36B 3CH5A 1GFIA 5K0FA 3PENA 821PA 3AUTA 2PH5A 3CT4A 3D7MA 2J0EA 4LSMA 2Q6TA 1X1RA 2RJOA 5FUMA 1EFUA 2WB4A 1N8SA 2ZREA 1I3MA 2ZI3A 3JT1A 3L0PA 5CVJA 1VBNA 5AQ1A 1JLKA 2C7VA 5KDDA 2JAXA 4U7FA 4NEGA 1RZRA 1II0A 1SFRA 2J9ZB 2QORA 2CXTA 3N3AC 4PFQA 3TBKA 3W6NA 5IZCC 4RTNA 5JG7A 3U40A 4I6EA 5IG2A 2AR0A 3I9LA 3PT9A 3N2YA 3SJCA 4IG9A 1R5OA 2BMFA 4Q19A 4PYLA 1EB9A 2RCYA 2ZT5A 3LQRA 5E4TA 3UW3A 1MH9A 3WSTA 5AW1A 5FOWA 3WWEA 1FK8A 3S2UA 5AI8A 4ARVA 1GCOA 3K2BA 1MC4A 3AM4A 3ENWA 4MICA 4P38A 5F21A 2CL0X 3T7EA 4RPLA 3TNYA 2A33A 4BGUA 2QN9A 4ZX3A 1SCAA 3DUFA 1OH6A 1U2GA 4G65A 1SG9A 1J9EA 2PQ6A 4II2A 1PEYA 4B5KA 1VMKA 4P5PA 4MMXB 3S2SA 2D2EA 4ZU3A 4O4HA 2NAPA 3BWBA 5LNK1 4JJFA 4TKLA 3DYVA 4AUKA 2W2KB 4YMWA 5ALIA 1XZHA 2GX6A 4BJHB 3OA0A 4RCYA 5EJ5A 3RTEA 3VSAA 4A8PA 4D45A 1N2HA 3VKFA 1DADA 4ECAA 4U7PB 4J4HA 1P2BA 3KU4A 1JEYA 4CHGA 1KRHA 1FZTA 1ST3A 5C8YA 3I2GA 4M8NE 3FN4A 4DMKA 5EZQA 4DWWA 1RAAA 3RWOA 2VTEA 5B58T 1DIGA 2P77A 2ZBQA 4BO8A 4PO1A 2JFZA 3QMVA 1BGWA 3C1AA 5JNRA 3PIDA 4U9UA 1JDNA 1F12A 3RFUA 5IHPA 5JRDS 3R9XA 5CLFA 3U4DA 2K5UA 1WEHA 3ESAA 1ZU4A 4TMFA 4L5IA 1DHRA 3QBEA 4TV8A 4E2YA 1GTRA 1JHQA 5KI6A 5FFMA 1RJEA 1V3QE 3NAQA 3ENNA 4BN4A 2OY0A 4XIYA 3E8MA