1R0LA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
378
Chain Sequence
b'QPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
total genus 123
structure length 378
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0lA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0lA01
5AYVA 1GEEA 2ZB3A 2PR2A 4ZQHA 1E77A 4RF4A 3W1VA 3WGHA 4BNZA 5TF4A 4CMJA 3KSZO 2QQ5A 1JWBB 2P5YA 3RUAA 3RVDA 5TIIA 5JCXA 4ZICA 2NVBA 1U3UA 2O3JA 1O6ZA 1U28A 3D4OA 4N18A 2BI7A 1ZXBA 2DT5A 3GAFA 2G1UA 1BXGA 1K0UA 3ONDA 4PCVA 2D8AA 3DZGA 4NH4A 2OFPA 3OA2A 5TSDA 2OZPA 3QRWA 3WDSA 2PTGA 1PR3A 4XYEA 2PKQP 1RM5A 3W4KA 2Y1FA 4CMIA 1E3IA 4CQMD 2I67A 1SEPA 3G49A 4NBVA 1T2DA 1U1IA 4TROA 4B8ZA 4C7KA 3QWAA 5ES3A 2R00C 1GZ3A 2P68A 4UVEA 5A5FA 4YTEA 1W4ZA 3O38A 4BO8A 3HHPA 1YVEI 2XF8A 1C3VA 1SOWA 3FR8A 3V1UA 1ADGA 1HZZA 1KVRA 3MWDB 1LQUA 1WNTA 4J4BA 1UDCA 3OSUA 4UULA 4WNIA 2VWQA 5GY7A 1KYQA 1Y5MA 4JGBA 1P1FA 1ONNA 1YJ8A 1VSVA 4FB5A 3QVTA 5KOIA 5LC1A 3BMCA 3BYZA 4Y6RA 4JP3A 2V7PA 3GHHA 5A04A 4M86A 1ZEJA 4AJ4A 1JVSA 2GERA 4GLLA 3DB2A 4YDRA 1FDSA 1SAYA 1QV7A 1I01A 3VPXA 4FDAA 2FWMX 3BIOA 3NTOA 4IY1A 1KETA 2ZYAA 2VRCD 4WLUA 2X86A 4JBGA 3V5NA 4O0LA 1GTMA 1YB1A 2A94A 3ICPA 4YJHB 4D43A 1I3KA 2Q99A 2AG8A 5KVSA 5B1YA 4DLAA 4E33A 1BW9B 3FCOA 2HJSA 2D2IA 3RASA 5A1TA 1BXKA 1GR0A 4ND2A 5CDUA 5IF3A 2DPGA 2O4UX 3F1LA 1N92A 2X9VA 3DAFA 2B4QA 3ZWPA 2W2KA 3HNPA 4WOJA 2BI8A 2PGDA 1ZSVA 4E2WA 4QUKA 1ZFNA 4JJFA 1HDYA 3ETDA 3ASVA 3RUFA 3ZN2A 4BNMA 5I8WA 1LX6A 4OQZA 2PLAA 4L9RA 3E8XA 3JQ9C 1NBOA 4LSWA 3OQ1A 4BO1A 1Y81A 2WM3A 3E6AA 1CDOA 5C7LO 5DT9A 2Z1NA 4YQZA 4BB6A 2P4QA 1Q0QA 2CDCA 3CINA 3FRJA 2EGHA 1ENZA 4KTTE 4ROSA 4U7WA 3T7EA 3V8BA 3BTSA 4CMKA 3OJEA 1E3WB 3RC7A 3P2OA 3T4XA 1VJ1A 4BKUA 5EL0A 4CM4B 4EZBA 2AEJA 4GSKA 3JD0A 4R1NA 5BNTA 2YQ4A 1EFKA 3LC2O 4MVJE 3SJUA 3WNQA 1A4UA 1H2BA 1ISHA 4U5QA 4DPLA 5BQFA 2FPPA 5JDIA 5DBIA 4XJSA 2BGKA 3ZHZA 4GPD1 3MOGA 4PLPA 1UXKA 1LRJA 4BKRA 3LZ6A 5L7WA 1Q0LA 4C7JA 2Q4BA 4M8SA 3ZW9A 1PGQA 3WLFA 3AU8A 4Y67A 3EY4A 3GGGA 3ICCA 4PFJA 1I33A 2BELA 4HADA 4JN6B 1WZIA 1T24A 5FFFA 2VWGA 2W2LD 3C1AA 1T1RA 4BO5A 4R1TA 2YYYA 4WCFB 4GI2A 2V6MA 4BNVA 1MLDA 3QLJA 4XRRA 4O5OA 4GGPA 3GZNB 3KLMX 1PWZA 3WX0A 1PL6A 1ZEMA 3WBBA 4EUEA 3TWOA 3WSWA 4B7CA 3DBVO 5TQVA 3CIFA 3JYLA 3QP9A 4D3FA 1GFSA 1O94A 1JU9A 2H63A 2UYYA 4N5LA 1A4IA 4GSLA 3OFSA 1E7YA 2ZK7A 2RIRA 2QX7A 1GV0A 1DRVA 2E49A 1A9YA 2AMFA 1YE3A 4DLLA 1X0VA 4BQPA 3TZ6A 4YQYA 2C0CA 3KYCA 2D5AA 1M75A 4BO6A 4PZEA 1JVBA 1YJQA 2C59A 3TF5A 3E5RA 5G2OA 5CHEA 4UUMA 1P0CA 1V3UA 3HE3A 4GX5A 2AQIA 4RJTA 1R12A 3TQHA 4WLOA 5JO0A 4HX5A 1HTBA 3DONA 2V6GA 4M54A 4MJLA 3AM5A 3L9WA 4I9UA 1AGNA 3VH4A 3MEQA 4LK3A 1YB5A 5JCJD 5MDHA 4DIFA 1B14A 2W4QA 1EBUA 3PVZA 2VZ0A 3ONFA 5A9SA 1B26A 2G82A 2YFQA 3JQCA 3S2FA 1R6DA 4B4OA 1ZK3A 3UFXA 3S2IA 2H6EA 2NU7A 3Q11A 3TSCA 4BIIA 3V1TC 1QSGA 4D42A 1BWSA 2HK8A 2PZMA 1YBMA 7MDHA 4ONEA 4E3ZA 5K6AA 3DWFA 3RQSA 1LDEA 3H9EO 2ZTLA 3H3JA 1IHXA 3M2PA 1PU2A 3ZNOA 1J6UA 1EVYA 1L7EA 2AE2A 3H5AA 2VOEA 1GPJA 2B83A 2WTBA 1P74A 3S55A 1SBYA 3TFOA 4GVLA 2VYNA 2ZB4A 5BR7A 1LTHR 4Q3BA 1CQIA 2NUAA 4J1NA 4WEQA 5CEJA 4JBHA 4J0FA 2FR0A 1HSZA 3FBGA 1GAEO 4BO7A 3OH8A 1NWHA 3RSHA 3CUKA 4J91A 1PZHA 3K30A 3L4SO 5U9CA 4CV1A 1U3VA 2V6FA 3JQ7B 5H83A 4NPCA 3PRJA 1LSUA 2CDAA 4E13A 4ZHSA 3UW3A 1WXDA 3AJRA 4B79A 4BO2A 4TRMA 2HQ1A 4MOWA 4RLHA 3L77A 3PFFA 4CR7A 3GFGA 4XIJA 5BNIA 1V9LA 4G5HA 1DHTA 2NSDA 2B0JA 4UVHA 4BNHA 1ENYA 4NJMA 1DPGA 1VJTA 2X22A 3I9KA 4WLEA 1UUFA 3ZGYA 4PLZA 1DFIA 1ENPA 4PG5A 4R51A 4XJTA 5L45A 1NVGA 3LQFA 1DFHA 3CZLA 4IJWA 3CXRA 4ZRNA 1JA9A 1GD1O 4CM7A 4XQ9A 3HDJA 3W6UA 3K6JA 2FSVA 4QEDA 2YQ5A 4FQ8A 3GG9A 4BUCA 5G0WA 3NGLA 4IDDA 4G65A 1H3LA 5CPBA 5I7FA 4PN3A 4WKGA 3SJ7A 4L4XA 1J4AA 2CMDA 1OR7A 3KLPX 4XX0A 1DHRA 2RBEA 2RCYA 2NVWA 3I6QA 4AFNA 3U4IA 3KHUA 3BA1A 4YAEA 3F6YA 1V6AA 2XPCA 3CSDA 4GLOA 1ONOA 1CIVA 3TNLA 4OM8A 1I10A 3K92A 1ISIA 1L1FA 1W6UA 3D1LA 2PKQO 1PWXA 1SO8A 4YPOA 3DBLA 3N74A 2J6IA 2WD7B 3EC7A 4NJOA 2FN7A 2PK3A 2ZB8A 4AJHA 3V2HA 4DIOA 3Q2KA 5KKCA 3NT5A 3ANNA 1PQUA 3PFWO 3QWFA 4XA8A 4OQYA 1Y8QB 5DOZA 1GQQA 2QRLA 2ZQYA 5JAZA 4IDFA 1QRRA 3L4BC 3DZJA 4XYLA 3M1AA 4DPMA 1MV8A 1I24A 3DTTA 1VL6A 2HCTA 3U0BA 1N5DA 3LF2A 5B4TA 2CUKA 1LRKA 1HDXA 3RROA 1NQAO 1P77A 3ZHYA 5ER6A 5L53A 2CVZA 1CERA 4CLRA 2C82A 3JD2A 3JYQA 4JLWA 1HE5A 3FWZA 1N7HA 2O3RA 1CWUA 1QV6A 2GUGA 3FNEA 3WXBA 1XR3A 3I9MA 1SOVA 1NPTO 5HRUA 1ZZEA 2BF7A 5JFOA 4NNJA 1QP8A 5JC1A 5ILGA 4MVJH 3PJFA 1XG5A 1R4MB 2EEZA 5F21A 1NP3A 3ETEA 3O9ZA 5JPIA 3EMKA 3QWHA 5TRTA 5JSFA 1SZJG 1ZH8A 2Q1UA 4XGNA 1PGJA 3HN7A 5JE8A 3JQBC 4I5FA 3T4EA 4EJMA 1GV1A 5IN5A 3KSDO 5FYDA 2GDZA 2OHXA 3RUIA 3A14A 2B5WA 4CM6A 3QWIA 1G6KA 5KNLA 4R9SA 4GX0A 4WE3A 1ZMOA 3MJTA 4O6VA 4NFHA 4B7XA 4B7UA 5EMHA 4CM5A 3GPIA 1EE9A 3R1IA 3DBHA 3FBTA 3KTDA 1ZSNA 2POQX 2VHXA 3IJPA 2X7HA 1CETA 1TLTA 2D3TA 1W0CA 2GCGA 3PI7A 4FOSA 3WQQA 1ZK4A 1YL5A 2PZJA 3NYWA 4GVXA 4D7AA 3PDUA 3H9JA 2WSBA 4FR5A 4OOFA 2GGSA 4KUEA 3UCEA 3W8FA 3SBOA 3BMQA 1PQWA 3D3EA 1NASA 3ADOA 5J23A 4H16A 1A9ZA 1E1LA 3NJ8A 3RFVA 4KDFA 4J2HA 2ZKLA 4FN4A 5EPOA 5CEEA 3BMCB 3U5TA 5A4DA 1IPFA 4RPLA 4RVHA 1PGPA 2VYVD 3I83A 4XD2A 1KOLA 1CQJA 3INGA 3T0YA 4NIMA 4YVFA 4UVDA 4MVJM 1X7GA 4Z0TA 3DOOA 2X5OA 1EMDA 3JYOA 3K8ZA 3TZKA 4BNFA 3UEQA 4EITA 3VTFA 3BMOB 3O03A 1PQPA 4A73A 4O1MA 3WICA 2IRWA 4J90A 2JD2A 1E1NA 1M67A 4RO0A 5G0UA 5IDWA 4MP8A 1PJLA 1VJ0A 1XLTA 1YB4A 1C0PA 2Q46A 3JQ8B 3RWBA 1JN0A 1X7DA 4EGFA 1D3AA 2D0IA 2NNLD 1KBZA 4OJNA 5HTOA 4XKJA 4YT8A 4Y6PA 4FBGA 4D0RA 4MVJI 3UERA 2BGLA 1P0FA 4TRJA 1DBVO 1FK8A 1DIHA 4GAEA 2I3GA 4MVJP 2QYTA 1PJCA 3BMNA 1WP4A 4AJOA 2JCVA 3JQ6A 1O5IA 4YCAA 3BZUA 3Q2IA 4IS2A 3PLNA 2WMDA 3E9NA 3W4IA 3ZWWA 2VNSA 1O9BA 1BHSA 3M2TA 3PQFA 3AY3A 3NTRA 4FFRA 4HFRA 1MC5A 3JQAA 4CL8A 1A27A 2J3IA 4CR6A 2IEBA 4CMGA 2E48A 1LEHA 2NADA 2Y1DA 3L07A 3N7UA 4R3WA 1OAAA 5C37A 3MOIA 2Y1EA 1LLCA 3H4VA 1NQTA 2QYSA 2EKQA 1HT0A 5JMPA 3DXFA 3INRA 2E6UX 1DAOA 3JD1A 4BNYA 3INTA 1DLIA 1E0DA 3A1NA 1ISFA 3FR7A 2NLOA 2O3TA 1PX0A 1RM0A 5T57A 5H81A 1NPYA 1P1HA 2VHVA 4LSMA 4DQVA 4EUFA 5KJ6A 2C7VA 1HDOA 4R69A 4ALNA 1VC2A 2DC1A 2G5CA 3KBOA 4CM1A 4CMCA 5KJEA 2IXAA 2H1SA 4J1SA 3RD5A 3PHIA 2BFPA 1DIAA 4XGKA 4CXFA 2EG9A 2GPTA 4OXNA 4E2YA 3V1YA 2I3AA 1GUZA 1HEUA 1NYTA 4Q3NA 1KEWA 1CEQA 3AI2A 1KY5A 1PJ3A 4F45A 1NNUA 1OZAA 4OMUA 2BHLA 3ZWMA 2HSDA 2YHIB 2A4KA 2DBQA 3VKUA 4B4WA 4W6ZA 2GR9A 4XQGA 4YJFA 1UXGA 1ZSYA 3ZNPA 3S8MA 3ZWBA 1ADBA 2DLDA 3V2UA 3GH3A 3PHGA 3QY9A 3RKUA 1KVUA 3JQFC 1ZMTA 4BO3A 3AWDA 4J9VA 4M87A 2RHRA 2GN8A 1E6EA 1F8GA 3D3WA 2PH5A 2CY0A 3VH1A 3SLKA 1I30A 1WWKA 3CE6A 3I4FA 2EP5A 1IZ9A 4IXWA 1RPNA 4XYGA 4JNKA 4NQWA 2EW2A 2PWZA 4KQWA 2GF2A 4JROA 3JQBA 4NK4A 1MP0A 5JC8A 3PK0A 1T26A 3ZDFA 4CV2A 1BDBA 3FTNA 1P45A 1I3NA 2AEMA 3PYMA 4CM9A 4DGSA 3VZPA 2YJZA 4RVUA 2GN6A 3PWKA 4I1IA 3RI3A 1B2LA 1LI4A 5JY1A 3VZSA 4EYEA 5T6BA 5IG2A 5KVQA 4LGVA 2UDPA 4HY3A 5EJ2A 5T8KA 1U7HA 2FZWA 3AUSA 4L74A 1Q1NA 3DHEA 1UZMA 2J8ZA 1TB4A 4QX6A 3HG7A 5I7SA 1NR1A 5TC4A 4DTIA 2RAFA 3GF4A 3OEYA 4I5GA 1Y1PA 5A05A 4N7RA 4BMNA 5AQ1A 1B0AA 3C7CB 3Q0EA 1CF2O 2FHSA 2C20A 1RYEA 4TVOA 4AJPA 4CODB 1YWGO 4B4UA 1H6DA 4UUNA 3RU9A 4FSHA 1HDZA 1AE1A 2ZCUA 3UCFA 1DC3A 3H2ZA 1N9GA 1VL8A 1SC5A 1NM5A 2X1HA 3MJVA 4OHUA 1ML3A 4BO0A 2EF1A 4OAQA 2HAEA 2C5EA 3FWNA 5GZ1A 2FP4A 3P2YA 4MDHA 1LXCA 4UUOA 4YB8A 1WAMA 4ALIA 3VZQA 1GQ2A 3F4LA 4IGEA 1LBEA 2PGJA 1C1DB 3KYDA 1QKIA 3AOEA 3RC1A 2AW5A 3LSYA 5KCZA 4IDBA 4D45A 2WDZA 3K2BA 2DTEA 4PLVA 4RLSA 4B3HA 1PS0A 4D3DA 3WGIA 1EVZA 1DC4A 2GSDA 3X2EA 4RGBA 4BNKA 3CZGA 5KVCA 4E0BA 1NPDA 1NR7A 3GLQA 2HDHA 1N1GA 1O0SA 1H2HA 3BTUA 4CUZA 5A03A 4Y8VA 3RJ9A 5THKA 1U3TA 2HMVA 5LDGA 3GVPA 2JD0A 2PNFA 4GGOA 3E9QA 3F47A 1LJ8A 2X9NA 3E48A 3KYBA 3QQPA 5TT1A 2PZLA 3GVIA 3ULKA 2OMEA 5BNFA 4QO8A 2O3SA 2WEKA 3WGTA 3DQPA 4IJVA 4MVJD 4JXKA 1VPDA 3ITKA 4W4TA 1EBFA 4WCDA 2VT2A 2VUTA 3OQ6A 1R0KA 4U0KA 4BB5A 3I9OA 1B16A 2Q45A 1YXMA 3VOSA 4AJKA 1R4NB 4Z9FA 1W73A 4LVCA 3IS3A 2CSUA 4GX1A 4IJKA 1F0YA 1C0KA 4XR9A 3SX2A 3QJ5A 2E4AA 5TJHA 3VC7A 4Z3DA 5LDHA 3RFXA 2NTNA 1FDWA 3I9NA 4K1LA 2JHFA 1MG0A 4YJGA 2CVQA 1ZUD1 1ULUA 4BNJA 4NFYA 1ZK1A 4XYMA 3QVOA 1CRWG 2JJYA 5L3ZA 1HDCA 3A28A 1FXSA 1Z7EA 1EUCA 4D41A 1K6IA 3ZU2A 1DIRA 4OIMA 4DBZA 4IMRA 4MVJG 5B37A 3BAZA 1YDEA 3UICA 1DRWA 1P9LA 1QYVA 2VHZA 2GN9A 1PJTA 1DRUA 2EV9A 4P4GA 5COQA 1GU7A 4J43A 3JYNA 4IQ8A 3JQGA 4CL3A 4AJNA 1GYQA 1PJ2A 4BKPA 3QIVA 3EZYA 4CLRB 3U49A 2JAHA 5U4QA 2O2SA 2HK9A 1EUDA 1BG6A 3A4VA 4CLHA 5ITVA 5ILOA 5DP2A 1A5ZA 4GKVA 4OYRA 4DL9A 1KY4A 4WLVA 1C1XA 4AYSA 3H9UA 2HMUA 4NDNE 4A0SA 1WVGA 5ICSA 1I2ZA 5KTKA 3F1KA 3KVOA 2Y1GA 2IODA 3DMTC 2H5LA 3HFGA 1U7TA 1TT5A 2WYWA 2O4CA 5FWNA 5FF9A 2JFGA 4FJ2A 4CPDA 4FLOA 1P1IA 1QYDA 3ROPA 1UXIA 5I7VA 2CNBA 3ADPA 3COSA 4NBRA 1DC6A 5ENDA 1ZNQO 2Y99A 5CDGA 2OXIA 2SCUA 3PZRA 1OOEA 2YY7A 3RC9A 4UREA 3AOGA 3ST7A 1D1SA 5BSFA 2VT3A 1IYZA 3TOXA 2UVDA 3FSRA 1VRWA 1UDBA 1HSOA 3G79A 2ZATA 1GYPA 2VTEA 2Y93A 3QE3A 3GY0A 3PHJA 1R15A 4LUPA 2B4TO 4CR8A 4F46A 2Y67A 3GEGA 1LDNA 1GPDG 3EHEA 2EERA 3GEMA 2ILTA 3ROQA 2X5KO 1T25A 5IDQA 2EKPA 2FZEA 3RCBA 2X8LA 3U09A 2C7GA 1V3VA 3VPHA 2PH3A 4E31A 1K89A 4H15A 4ID9A 4FFMA 5DZSA 1UH5A 5HWSA 1Q7BA 4RQUA 1ISJA 1XHLA 1FDVA 4JCOA 3U4HA 3TL2A 2GZ1A 3WR5A 2A92A 3B1KA 2X0NA 3EZLA 4ND3A 4MIYA 8LDHA 4D44A 3DOJA 2Q1SA 2O48X 4DBVO 1V3TA 4IINA 1XDWA 1U5CA 2OBYA 2IZ0A 3O8QA 4FFPA 3OP4A 4J0EA 3B20A 1LSOA 4YAKA 2EXXA 1MW2A 3VDRA 2A9FA 5G4KA 3AM3A 4Q3AA 5G4LA 1U4SA 2HRBA 4H7PA 4RDHA 2UAGA 4YJDA 5U1PA 3RUEA 5L4SA 3TL3A 3P5SA 1JW9B 4MKZA 2O3QA 3GHYA 1GUFA 4UAGA 1E7SA 4R1UA 3ROKA 4BNTA 5H82A 3CTMA 2QW8A 4IQGA 3VZRA 4FC7A 2JCYA 3IC5A 3PXXA 1X14A 2QZZA 1MB4A 3E1KA 3PYLA 1GZ6A 1T4BA 4LCJA 4J4HA 1DIBA 5DCWA 4MP6A 1UZLA 1JKFA 4L75A 4L4SA 2EHDA 5JYDA 2R00A 5L95A 1YRLA 3GVHA 1PEDA 1Z73A 2PKRA 1LSSA 2O7SA 4CUKA 4CLEA 1PGOA 5F5LA 2P4HX 1YBVA 3UAGA 2HLPA 2EJVA 2RH8A 1X13A 4NBWA 2I76A 1R0SA 4WCFC 2B5VA 3NTQA 3CKYA 2P2SA 2HUNA 4R54A 4Q3EA 4FLQA 1ZVMA 2AE1A 2Y66A 3I23A 3GMSA 3UVEA 3LDHA 1NFQA 1QXSA 4TZTA 1I0ZA 3JD3A 1Y8RA 4J1QA 1OFGA 4CQLA 2TMGA 2Y0EA 2O23A 3ZHXA 4WPGA 3K31A 1LUAA 4CQMA 4YRDA 5EN4A 1E1MA 1I3MA 5I9NA 1E3EA 4XQCA 4ND5A 4AJLA 2BFAA 4LISA 4N5NA 1HE3A 3HN2A 5AXBA 2DBZA 3GNQA 2J5QA 2V6BA 2JL1A 3HDQA 1FJHA 1JKIA 1PS8A 1LA2A 2FY8A 2XXBA 4F3YA 3PHLA 2CVOA 1I32A 1RWBA 1U2DA 3G3EA 1DLJA 5TT0A 3VVCA 4CM8B 5F5NA 3LC7O 1GEGA 3C85A 3GGOA 3WG9A 5DBGA 4RCVA 2AXQA 1ISGA 4AL4A 1A7AA 1RKXA 3OEWA 4RPKA 4R5MA 5CG1A 1ZIDA 4E21A 4TKLA 3EVTA 5HM8A 1Y6JA 4R68A 2WYVA 3WFIA 3FHLA 5F1PA 4EI2A 4YXFA 2VNAA 2Y1CA 1YQDA 3H8VA 2ZB7A 5A5EA 5CDSA 4GMGA 1Z6ZA 4KZPA 3JQ9A 3PJDA 3O26A 2Y05A 4K26A 4XB1A 4YR9A 2OORA 1X15A 4AVYA 1T2AA 5K9ZA 1JLLA 3GOHA 3GRKA 5GZ6A 1ZCJA 1H6AA 1B8UA 1WDMA 2VRCA 1C0LA 3QVXA 2FSSA 4ND1A 4ZD6A 3WQSB 1UP6A 1YDWA 3LLSA 2Z95A 5CG2A 1VM6A 1GDHA 4BKQA 1ZXLA 4JIGA 3ZWCA 1YOVB 5L4NA 4L73A 1HF3A 1TI7A 4ILKA 4RQTA 4QQRA 4A03A 5TNXA 3D3WB 1NVTA 4OKNA 1HZJA 1LQTA 3DBRA 1H94A 3U4CA 1IB6A 4TKMA 2VRBA 2QZ9A 2UUOA 2DTDA 1NQ5A 3ZV4A 4R5HA 4CLOB 3K73O 1JQBA 3WWZA 2C54A 2GD1O 3AFMA 4IZHA 4BV9A 3PWZA 4DQXA 4ZQEA 1MX3A 1BVRA 4KUHA 3EDMA 1LDGA 2J5RA 4CMHA 2ZCVA 3OJFA 1KEUA 4AG3A 1Y9EA 4UVGA 3WMXA 5DF1A 4E30A 1ZKMA 5JAMA 5C7IO 1VKNA 3OA0A 3RU7A 3VDQA 8ADHA 4P8RA 1JTVA 4RVSA 5C5IA 1EEHA 5CFZA 4E2ZA 2IYPA 3DHYA 1ZJZA 2OL4A 1U5AA 4C4OA 1OMOA 1YQXA 1LDBA 4YJHA 3IDSA 4MO2A 2I99A 5I8ZA 4M1QA 3UCXA 4YT4A 1NHWA 1I8TA 3DOCA 1BW9A 4D79A 1SPXA 3KUXA 4BNLA 2X58A 1Q7GA 1YBAA 4E12A 4P22A 4FLSA 1IHYA 1Q7CA 4NZ9A 1WDKA 3I3OA 3OIFA 4KWHA 3S2GA 3H6KA 4Z0HO 1PZGA 4KTVE 5GZ3A 1JKJA 2DTXA 4FFOA 4E2XA 1G1AA 2BFOA 3R3SA 5EQFA 1XEAA 2W2LA 4HXYA 5AOVA 4O63O 2IDZA 3AY7A 1KVTA 3DC2A 3ZWAA 1GZ4A 1XYGA 5THQA 4TVBA 1N8KA 4ZVVA 2ZTUA 3DAPA 3WTBA 2QRJA 2R2GA 1AXEA 1BXGB 4CM4A 2IZ1A 3WGYA 3F4BA 4MIEA 3GRPA 4FS3A 3UHAA 1BRMA 4QECA 2Q3EA 4J7CA 3HQ4O 4CMIB 4ZU3A 2HMWA 1LLQA 4UEJA 4TRNA 3BXXA 5A3JA 3G0OA 1QG6A 2C2YA 1MG5A 1DDOA 4TMFA 1K3TA 3U9LA 4BNWA 1XGKA 2DUWA 5ICMA 3CMMA 2Y68A 4F6CA 4XZ3A 3ONEA 1PIWA 4EBFA 3C1OA 5K0ZA 5B4UA 5I9MA 4IDEA 3MJCA 1P1RA 4GL4A 5A3VA 5JMWA 2Y0CA 3PIDA 4NG5A 3QSGA 4PLFA 5DDIP 2PD3A 3LC1O 3DO5A 4G81A 2VUUA 2RHCA 1CYDA 4XYBA 1I2CA 3ZWVA 3OJ0A 1U3WA 5DBFA 3OM9A 3ZCXA 5L40A 2G17A 4P4LA 4EJ0A 5JCJA 4CMAA 2X0JA 3CPSA 4RF5A 1T1SA 4LVUA 4LCEA 3FNGA 4BS9A 3VPSA 4CLXA 4PLYA 2X9GA 1H6BA 1WDLA 3TN7A 2QIOA 1XELA 3KB6A 1EDOA 2O50A 3MTGA 4FFLA 4KOAA 4KUGA 4XQEA 3NV9A 4FIZA 1S7CA 3FPCA 4A26A 1Z45A 4J4TA 5EINA 4DLBA 4GX2A 3LT4A 3WSVA 5T5QA 1FF9A 4L76A 2GLXA 3DHNA 2OBNA 1DB3A 2YV1A 1ENOA 1NFFA 1R66A 2VWHA 1X7HA 5COAA 3DZHA 5A06A 4PIVA 1AN9A 4A2CA 3G1UA 2W2KB 2VZ8A 1ARZA 4URFA 4WLFA 3ITDA 1YL6A 3AM4A 3D5TA 3H2SA 4II2A 5TS3A 3KOUA 1F06A 4QXMA 4YRBA 1BVUA 2VZ9A 4R9RA 3WB9A 3AU9A 2E37A 5IN4A 5IDYA 4Y6SA 2HJRA 3LYLA 4FPXA 3C24A 3L6EA 5BSGA 4XDYA 3KO8A 2JKVA 3VPGA 2BKAA 3EAGA 1P33A 3I5MA 2FOIA 1U8XX 4YT5A 3WIDA 5KWEA 4BNXA 1LC0A 1TA4A 1WMBA 3WGGA 1NAHA 1T2FA 1KS9A 3GNTA 4YACA 1MC4A 4PVDA 2PFGA 2XOXA 4HBGA 4E6PA 2X5JO 3HUDA 4Q9NA 5IXYA 2C07A 3DMYA 4CM3A 4ZJUA 3DDNA 1P1KA 4UUPA 4XGIA 3VPFA 2X0RA 1KIFA 1KVQA 3MTJA 1D4FA 3NGXA 5HA5A 1ONPA 2Y0DA 4Z0PA 4IDAA 3RBVA 1C14A 1MW1A 2GZ2A 1S46A 3IKVA 3PHHA 2OGUA 1F17A 1TEHA 1UAGA 2CF5A 3GN2A 1UP7A 1OI7A 3L6OO 2JFFA 3PTZA 4R1SA 1LDYA 4F6LA 1WZEA 4LRTB 3L4BA 3JQ7A 5IAAA 3KEQA 4IJUA 3ZI0A 4EDFA 1XQ6A 3KSUA 4WLNA 4OSOA 4PG6A 5HBRA 2VOJA 2ZJ1A 3IQDB 1LSJA 2F1KA 5JAIA 5A9RA 4XR4A 4E5KA 2CZCA 1JDJA 4YWJA 2VN8A 5AXAA 1PSDA 4Z3KA 3R0IA 5CDYA 1EE2A 3ETGA 4B3IA 4OGWA 4HV4A 2D5CA 3PDJA 1KC1A 2NQ8A 4DA9A 1PZFA 4IS3A 4NR0A 1AHHA 5KIAA 2B4RO 5LCXA 1HDGO 2DBRA 3VAZA 2LDXA 2HK7A 4DC0A 1VL0A 1HLDA 3KYCB 2VHWA 3D64A 2W98A 3GG2A 2NTJA 1MFZA 3R3JA 1H9AA 4QT0A 1UDAA 1S6YA 4B4VA 4DRYA 1I5RA 3H5NA 3ANLA 3NT2A 3C8MA 4Q39A 3OMLA 4XDZA 2WE7A 3M6IA 4DUPA 2TMDA 1E7WA 1PJ4A 3CZEA 1I2BA 4DQUA 1D1TA 4S1VA 4R3NA 2FPGA 5JBIA 1NWCA 1MUUA 2UUPA 5F1OA 4GWKA 2NU8A 5A9SB 3UGKA 5JDIC 5ER9A 1XU9A 3AUAA 3WQRA 4IQ0A 4RV9A 1EDZA 3ZWXA 4BOYA 3I52A 2HU2A 2X4GA 3M1LA 1PZEA 4S3MA 1EK5A 1LDMA 2WD7A 3IL2A 1R37A 3FF4A 4TWRA 1SB9A 5COBA 4BO9A 5G0SA 1NXQA 2Y1OA 5HS6A 2B69A 1X1TA 4DYVA 4IGFA 2Q4EA 4JQCA 4R41A 2C5AA 3CZRA 1Y8QA 4D3SA 4PG4A 2WJPA 2EGGA 3FNFA 3JTMA 4IIVA 1HYHA 4CJXA 4RF3A 1R0LA 1Y8RB 1P31A 4YA6A 4J1TA 4AICA 1IUKA 1E7QA 2EKLA 2EP7A 4ZRMA 3FTPA 4BGVA 1ISMA 3I9JA 5EESA 1LRLA 2PD4A 3RUHA 5KJCA 3TZQA 2VTDA 4I5DA 3NUGA 2EIHA 3HDHA 3GDFA 4ESOA 4WJZA 3F5SA 4GMFA 4ALLA 2B36A 1KEVA 1EQ2A 2D1YA 4FCCA 2DBVO 1M6WA 2DUUA 1EVJA 3JSAA 2RH4A 3AI1A 1FDTA 1R4MA 4FFNA 4M89A 5HS4A 2NWQA 3F3SA 5C7OO 4J2OA 1T2EA 3TZCA 4NJMB 4RORA 1ZK2A 1E7RA 2IXBA 3GFBA 2OOSA 4MIOA 4MINA 4NBUA 1E5LA 1TVEA 2ZTMA 1OC2A 1MW3A 1E6UA 5F1KA 4D46A 2VYVA 4P4NA 1RJWA 2VYND 4MVJF 2O7QA 1NVMB 4A5OA 1AXGA 4DIBA 1BXZA 3ZWYA 3AUUA 3TPCA 3LU1A 2AQHA 3PQEA 1Y5RA 5L7YA 1MFPA 3I1JA 3L6DA 3LT1A 1OBFO 1PL7A 4UVIA 3BTVA 9LDBA 3IUSA 4KDEA 3SC6A 4JK3A 1U2GA 3NDJA 2P9EA 1ZS2A 3E03A 4EEZA 1VE9A 4I8XA 1KVSA 5K6AC 1N1EA 1GCOA 5AXDA 4KQXA 3GGPA 3NAQA 1SNYA 3TDKA 3VHRA 4BMVA 2OP1A 1HXHA 4X54A 4BKOA 5AXCA 4PRLA 3A9WA 3A06A 4FJ1A 4Z9XA 3DBRB 1SMKA 4XWYA 3GVXA 4ALKA 3MZ0A 3TFQA 3DBLB 4QFCA 5TGDA 3D5QA 1ZJYA 4XRGA 2DQ4A 4XEHA 4AJEA 1FDUA 4CMBA 1B15A 4R01A 3DAGA 1ZW1A 4YT2A 3H5RA 3E18A 3U62A 3MCVA 3GT0A 3ZH2A 4BVAA 3MJ4A 4QSMA 1H93A 4NFSA 1YH3A 4EEXA 3AW9A 3PEFA 1IULA 3N58A 3ZV3A 3ZNNA 1PJBA 4A27A 3ZW8A 3WMWA 3BMOA 4M55A 2C2XA 2IYOA 3JCZA 4A10A 1A7KA 1V35A 1NHGA 3BHJA 3WGOA 4CLDA 5CAEA 4FC6A 4OOEA 4OO3A 1EK6A 4E5NA 1PL8A 3CEAA 4ALJA 3JQ8A 3KXDA 4RL6A 2VWPA 1G0OA 5ITWA 3NRCA 4KWIA 4I5EA 1MXHA 4TSKA 2DM6A 3RBZA 1GYRA 1DO8A 4FGWA 3Q9NA 3WOHA 3FN4A 3C3XA 2DVMA 3JQFA 3E9MA 4RPHA 3QVWA 2ZQZA 4ZA2A 4BNNA 2NTVA 4I9NA 3RUDA 2IE0A 2P5UA 3NDRA 5L51A 1W8DA 2CD9A 2B37A 4NMHA 2XXJA 1QLHA 2IEDA 4J6FA 2YHUA 4OKIA 2JCXA 3LK7A 4M49A 3B70A 1M76A 3WJAA 4DYDA 3FI9A 4HKTA 5JO9A 3JQDA 2VUSA 3ABIA 3HB4X 1UP4A 4BGEA 3H3FA 1ID1A 3DBHB 4FOOA 4KP7A 1K6JA 4HP8A 4PVCA 1NX6A 3BHIA 3L0DA 4BO4A 2PD6A 1R16A 5BSHA 4U8GA 3SLGA 2ZJ0A 2O3UA 4HNGA 4JJIA 3DL2A 4FD3A 1E7MA 2D59A 3IP1A 4II3A 4O59O 4PGFA 4RDIA 4W99A 3ANMA 1VKOA 3PWSA 1X1EA 1BDMA 1B3RA 5TX7A 3BMQB 3LT0A 3OIDA 1PS9A 1KEPA 3GAZA 4MP3A 4BQRA 1G0NA 1O89A 2DFDA 3VKVA 3I9LA 2CFCA 3D0OA 3HZZA 1IZ0A 1L7DA 3CZKA 2GYYA 2OUIA 2P9GA 3ZWOA 2ET6A 1E5QA 4WOKA 1HYGA 1M2WA 1V0JA 2F00A 3E5MA 4U6SA 3DFZA 1GADO 1DJNA 5B4VA 1HE2A 1Z75A 2YHIA 3HADA 1PJSA 4RPJA 2AQ8A 4RF2A 4E4YA 1HETA 1T4DA 3EK2A 2NU9A 3DFUA 4I9HA 4WUVA 1DFGA 2YV3A 3IUPA 1NAIA 2YDXA 4ND4A 1G5AA 1HWYA 3WIEA 1PJQA 2VCYA 3NT4A 5KJFA 3I4CA 6ADHA 5JLAA 3KRTA 5EERA 1HL3A 3PZBA 3V2GA 4PG8A 3UKOA 4LRSB 1I3LA 5L4LA 2Q2WA 3FPLA 2VHYA 1EZ4A 1EFLA 4MKRA 4HFMA 5IZCC 4IPTA 3BMNB 3C1TA 3GZ4A 3G1TA 3OICA 4NQZA 5B12A 1O8CA 2WWRA 3NDIA 4Y98A 1X0XA 2OO5A 4LW8A 3BTOA 3WYBA 4N54A 4DXHA 1FMCA 4WASA 4BHTA 5CDTA 3JQAB 4JP2A 5DCYA 3TOZA 3W4JA 3ZZNA 4IM7A 3ZV5A 4YAGA 1H0KA 1HE4A 1O95A 3UCQA 5G0VA 3OHSX 3P7MA 3S1LA 3ZU3A 4Q3CA 4OSPA 4TRRA 4PLCA 4W7HA 4HWKA 3ZNQA 3STHA 4FGSA 1RYDA 4IXTA 4BMSA 4E5YA 2B35A 4RVDA 5EIOA 4E5MA 2JAPA 4K6FA 4NU5A 1F8FA 1H6CA 4BGIA 3GN1A 1UXJA 1PTJA 3AK4A 2Z1MA 4PLWA 2NVUA 2FPIA 4HUJA 2JD1A 2GN4A 2Q50A 3GC6A 4JJGA 2EW8A 2Z5LA 2Q2VA 1VSUA 2GZ3A 1AUPA 4GBJA 4ZQGA 4WNCA 3H9GA 2ZYGA 3SEFA 4J3FA 3EUWA 5I7EA 5IDXA 3EVNA 2DFVA 5JDCC 1VI2A 4YAJA 3ZU4A 2DAPA 2PY6A 2Q1WA 4CV0A 4AJIA 4ALMA 4OXKA 5JXWA 2IZZA 4MVJA 3Q3CA 4U0JA 3RUCA 5DCUA 3WYEA 1SC6A 1XA0A 3EYWA 3OIGA 3JQAD 4XIYA 3RFTA 2X6TA 1C1DA 3AUTA 1ZBQA 4AJ2A 1RM4A 4TZKA 1P44A 1LC3A 3PLRA 1XU7A 2BMAA 3H7AA 1EUZA 1RM3A 1BTOA 5DN9A 3JQEA 3I6IA 3QW2A 2I5PO 4IBOA 4AJ1A 1WLYA 3RKRA 2O7GA 3OECA 5DOVA 3B1FA 4UEOA 3WJ7A 4YJFB 3OF2A 4IZIA 2I65A 4Y9DA 3W8EA 5BSEA 2X0IA 2HRZA 3MJSA 3K96A 4LMPA 3DMTA 2HO5A 1U4OA 4QTZA 1MA0A 5IZ4A 2I6TA 2ZTVA 2P9CA 1V8BA 3FD8A 1F14A 2YUTA 1RP3A 3ZV6A 4J16A 4K9DA 4MPDA 2WPGA 3X2FA 4FLRA 3TZHA 3NJ4A 3ENNA 2YFHA 1TT7A 4OH1A 1YKFA 1ADFA 1B8VA 3WGZA 4Z6KA 5A02A 3GR6A 2C29D 2AHRA 1R4NA 2NQTA 4BV8A 5KJ1A 5DP1A 1ZK0A 4YRAA 3AFNA 2CDBA 2WYUA 4PG7A 4BL5A 4L4RA 1XSEA 3OJLA 5JAQA 3WGQA 5DNAA 3ASUA 2NM0A 2QG4A 4WK6A 4EJ6A 4RPGA 3HDYA 4WECA 2R6JA 4XB2A 2J5KA 1TXGA 2W90A 4UEKA 3Q6IA 5FI3A 3O4RA 3PIIA 3RIHA 1ORRA 3WS7A 1IY8A 3HB5X 3QVSA 5IJZA 4RVFA 3MJEA 4KMSA 3VH2A 3WBFA 1BMDA 2FR1A 4DREA 1GL3A 3GUYA 1LU9A 1XCBA 2PA3A 2AQKA 3OJOA 4GWGA 2AEFA 3D4NA 1IL0A 1I36A 1D8AA 1E3JA 3ORFA 1N9GB 1E92A 1IE3A 1WW8A 4GQAA 3WTCA 3OQBA 1YO6A 2PV7A 4NBTA 4WEOA 2G0TA 1B3BA 4OL9A 3B1JA 3DZKA 4CM9D 3HSKA 1PGNA 2O2YA 1C0IA 1EQUA 2HKIA 5CPFA 1UXHA 5FEUA 1E3WA 1MGOA 2I9PA 1Q0HA 2E82A 3AI3A 3BHMA 3GPDG 3KEOA 5TJ9A 3KYDB 3UH1A 3RC2A 4ZQBA 3UOGA 4E32A 3HJAA 3GUCA 4E5PA 2QRKA 1LLDA 3UF0A 2NACA 3IOYA 2UV8A 1UR5A 3GEDA 4PLTA 1N7GA 2G76A 3TRIA 3HFSA 4NU6A 3D7LA 1DSSG 1JGIA 1A71A 2Q1TA 4U6QA 3G17A 2FR8A 5CEFA 2V65A 2A35A 2GO1A 1P3DA 2BRUA 3L9XA 5IZCA 4BGUA 4CMEC 3CMCO 4QFDA 2DPHA 1JWAB 4DMLA 3OETA 9LDTA 5JYEA 1NQOA 2Q49A 5KKAA 1DJQA 1K6XA 4W9NC 3B6ZA 3MWEB 1H9BA 4WCFA 1HKUA 1MW0A 3GDGA 4G2NA 2JHGA 3PPIA 2XAAA 2BD0A 4LN1A 3GZNA 2X23A 4PLGA 1QLJA 3PYXA 1XKQA 2EWMA 4W7IA 4YBZA 5T8KC 7ADHA 4ITUA 2I66A 3Q9UA 6LDHA 3GMDA 1D7OA 5T64A 1VLLA 2BGMA 5AVOA 4EUHA 3EGOA 1J0XO 1B7GO 3RAJA 3IJRA 4K28A 1Y7TA 3GQVA 5JS6A 1SCUA 1YL7A 2J3JA 2BFMA 4YJGB 5BT9A 1XQ1A 3ROMA 3IKTA 5MGBA 4FJ0A 1XWFA 1MXFA 3KZVA 3C7AA 4Q3DA 4IIUA 5JNLA 1BGVA 5T67A 2NU6A 2OP0A 5JDCA 4W82A 5EQDA 4NK5A 1KC3A 4CUJA 1F12A 2CF6A 3NKLA 4WGGA 1YGYA 1YONA 5ADHA 4RZHA 5C3MA 3T7CA 1Z74A 2JFHA 4YAIA 1QORA 3PGXA 3AOEC 3NEPX 2Q2QA 3CH6A 3JQGB 4PLHA 1U8FO 5L7TA 2ZIZA 4TQGA 3QWBA 1ADCA 3VTZA 1DXYA 4B3JA 4AJJA 3JV7A 3LLVA 1M6HA 3LVFO 2HMTA 3PGJA 4J9UE 2GASA 1HRDA 1GUYA 4IDGA 5L9AA 1C1XB 1PR9A 3IP3A 4J7UA 3WFJA 2H9IA 4GKBA 3PJGA 5CP8A 3F46A 4MKXA 5ENVA 1TT5B 4ZGWA 2HMSA 3UN1A 3QA9A 2P91A 2J3KA 2AG5A 1T2CA 3IIEA 1DEHA 4CV3A 4J7XA 5G0TA 1IOLA 1HYEA 3D4PA 1IPEA 1NTOA 3DZBA 3F5QA 4IMPA 4B8WA 4EW6A 1K5HA 1YS4A 3DEYX 3LF1A 2MAOA 1A72A 1Y9AA 2BH9A 2LDBA 4PZDA 5F3RA 3GA0A 3PP8A 5TLSA 4IDCA 4GH5A 5JY6A 4YEDA 1AHIA 1ZO8A 1K2WA 1E3SA 4BNIA 3IMFA 4JBIA 1HLPA 3CZMA 1MVYA 1H5QA 1YQGA 3F9IA 3KV3O 4PZCA 2YDYA 3GNSA 1QYXA 1EVIA 3QV1A 3SXPA 5IFLA 1SEVA 4CM8A 1OC4A 4LMRA 4OXYA 4DVJA 1DAPA 3GK3A 3ON5A 1GQYA 3PJEA 4XCVA 4N5MA 2FMUA 4ZQFA 2D4AA 3GDOA 1QYWA 2AA3A 3EW7A 3OBBA 4JX8A 3ZHBA 3DZIA 3UUWA 4ZN6A 1WMAA 2MAPA 3K9QO 5FI5A 1Z82A 1DC5A 2EJWA 3WYCA 4BNGA 3U3XA 4I08A 3VH3A 4YYZA 3O8QB 3SVTA 4DC1A 2BLLA 2J3HA 5A9TA 4DPKA 5DULA 4L0QA 5G4KB 1NFRA 3U4DA 4K6CA 2WE8A 1LLUA 4R4JA 5JW6A 1JG9A 1LNQA 1QMGA 5I9LA 3JYPA 2WD8A 1UAYA 3RBXA 3W6ZA 1Z7BA 1Q2XA 1J5PA 1GY8A 2DKNA 3Q1LA 3C7DB 4HFNA 1CJCA 1JAYA 3SC4A 1YOVA 3IAHA 1E3LA 1B8PA 4J49A 3WLEA 4BNUA 4PRKA 3VVBA 4INAA 1WPQA 3S2EA 1J49A 1N2SA 3E82A 1HDRA 5KVVA 4CLOA 3RJ5A 3NX4A 3H9QA 5GMOA 3WNVA 4IUYA 4D0SA 2NV6A 4HNHA 1E1KA 2PGLA 2YW9A 4FW8A 3GVCA 1DIGA 1U9JA 4CMEA 1KERA 2VQ3A 4DMMA 4NI5A 1QYCA 1M66A 1E6WA 2QHXA 2DU8A 2FRDA 1SB8A 1UJMA 2YV2A 1ULSA 1BSVA 3ENKA 4HFJA 4W9NA 3WWYA 2GRAA 3K2EA 3KETA 3AY6A 3TJRA 3W8DA 1GCUA 3KM0A 3H65A 3PQDA 4Z9YA 4R16A 5IXSA 3UXYA 1UZNA 3ZU5A 1DOHA 3QHAA 4CQLB 4DWVA 1P1JA 3K5PA 3FNHA 4L8VA 4P38A 3P19A 2GNAA 4NHEA 4CQMB 1JAXA 3HWRA 4QO7A 3R6DA 1XIVA 1QR6A 2PZKA 3LT2A 3DTYA 4H3VA 4RZIA 2W8ZA 3DR3A 2NVUB 3JD4A 3ZWNA 2YZ7A 4RVGA 4A7PA 3DZFA 2ZYDA
chains in the Genus database with same CATH superfamily
2OO7A 3PC2A 4O2RA 1CUGA 1GEEA 4F5EA 1YVPA 2WQZA 4BNZA 4MVYA 2BMVA 4ZC8A 1T36B 5DGDA 3PENA 2VSYA 5KQPA 1XHFA 4D8UA 2Z5VA 4U00A 2SKCA 2IU0A 4Q1CA 4UHKA 5D7NA 1O6ZA 1SFRA 1U28A 3D4OA 4N9WA 4UHDA 3SVZA 1YQWA 3E7FA 3GX1A 2P6UA 1TO2E 3PT9A 1J33A 1YI1A 2BFDB 3HZHA 4I0WB 1BXGA 1K0UA 2HBZA 3ONDA 4UBNA 5F76A 5IBCA 2DG2A 5TSDA 3DZGA 3OA2A 3EH1A 1XXHA 1MABA 2JFYA 2PO7A 1JFFB 2PTGA 2Q3LA 2X8WA 2XQKA 3LFHA 4XYEA 4C07A 4IFIA 3W4KA 5EGNA 4B48A 3GFPA 4LJRA 4B3BA 1A8IA 1K3UB 1EESA 3W5JA 1JLLB 4QU0A 4I50A 1EVKA 3GRCA 4C04A 1SCBA 3RS0A 2QTBA 5FR1A 4C6TA 4QWWA 1YA4A 3ASZA 5A5FA 3BCRA 3FYUB 3MJHA 4J0DA 1W4ZA 4J03A 4YTEA 5EJAA 3GRZA 5FO0A 4BO8A 3HHPA 1G4HA 2CK3A 5CX1A 1JQJC 3SIRA 1CZHA 4KN8A 2XF8A 1G8AA 1ZRNA 4LSGA 1TQ8A 4HGYA 1FFAA 5D6NA 4UBJA 3VDXA 1J5EB 4H1UA 3MWDB 2VP9A 1LQUA 3Q7EA 1WY5A 4O5AA 4OP2A 4WNIA 4IHJA 4QBHA 4YS6A 2VXCA 2XMRA 3E9CA 1YZYA 3CSUA 421PA 2JJ1D 3AETB 5LJIA 2WP8J 1WOMA 1Y5MA 4GYWA 1P1FA 2OB1A 4MCJA 1YJ8A 4LTNA 2XVAA 2HV9A 5KOIA 1LJUA 5B2ZA 2BH2A 3KBBA 1DAGA 1Y6RA 3PGA1 4Z1OA 2ZRIA 4IUDS 2ZSJA 2JGJA 1V6SA 3RM3A 1BOOA 1ZEJA 1TX4B 2IOQA 1ES9A 4ANFA 1R0YA 1JVSA 2GERA 2HA7A 2VJAA 3D2AA 3NC0C 1TPZA 3DB2A 3FUFA 4X3PA 4YDRA 4EY8A 3WK8A 9MHTA 1QV7A 5TV2A 1EDBA 4X6LA 4FDAA 1YJCA 3BIOA 4LK2A 1E9AA 5KYVA 1AGYA 1TK2A 1FNSA 2JW5A 2FZGA 5DK4A 2C7PA 4WLUA 3V5NA 2RHTA 2ZRQA 4EFNA 2DEUA 3V33A 3WMEA 3CVUA 2LZ0A 2Z09A 4PV7A 2Q99A 3QPUA 1K9SA 2Q27A 4GI7A 1QK3A 1XN1A 1Y8CA 3UQYS 2D2IA 5A1TA 1BXKA 3KSBC 3CWCA 5JANA 2D7DA 1N5KA 1V5FA 3QMVA 1G41A 5IAOA 1N92A 3DAFA 1XLVA 1DARA 4JH0A 4O4JB 3UK1A 4AY3A 4RMJA 3HKBB 4H2DA 1YJBA 4WXYB 3PQ7A 3FLMA 2CUNA 3W3ZB 3IIKA 2G9ZA 4Q93A 4QUKA 4YC7A 1ZFNA 1W44A 3ETDA 3ASVA 2VR1A 4OJQA 3RUFA 5I8WA 3IXMA 5A6VA 3Q4GA 4MI9A 1ZD3A 4JLNA 3UWMA 4PSDA 4MRRA 4ZX5A 5E6RB 1E59A 4PHCA 4CVNA 3LVBA 4G0XA 3FRJA 2CDCA 1AGRA 4BLRA 2IEYA 4FLFA 2IYFA 3T7EA 1GDDA 3GJTA 2VATA 3T9FA 1TPYA 3HJGA 3TW6A 3H84A 4IIXA 4BKUA 3LPCA 2IOFK 4CM4B 3WHPA 3U6BA 3RR2A 5FH9A 3NVMB 4GSKA 4R1NA 5D1HA 3GARA 5ABPA 2WW8A 4B82A 1A4UA 4WBNA 2G08A 3BD8A 2VRWA 3CNBA 4IOJA 3IILA 1QV9A 1T34A 4XJSA 3S28A 5JVDB 3I6YA 3DXYA 3VV3A 4QUBA 6AT1A 4BKRA 4NNPA 4WD3A 2FCRA 1OZHA 3SC3A 1WE2A 2C8LA 2VHJA 3PC6A 2ZB2A 1PG5A 1DQZA 1Q16A 1YA8A 1TJ3A 4O3FA 3ZW9A 4LKRA 2JA1A 4P7GA 5JMTA 2VPQA 2ES4A 1CZLA 3KZOA 3ICCA 1XTPA 1CUJA 4MIKA 4N0PA 5CT5A 3KP1A 3DTNA 5DTIA 4XO4A 1BCSB 1DCKA 2OK7A 2WHYA 5CGQB 3C1AA 5FFFA 1T1RA 4YPFA 2R1UA 2LKDA 3INYA 4R1TA 3NBAA 4UMEA 3NVKI 5ALSA 1MX5A 2GNPA 4O5OA 1QTNA 2XUDA 4MUYA 1E8MA 3HHEA 1QVVA 4OQMA 4OTZA 4P35A 4EUEA 4BEWA 4MGIR 4GG1A 5DW0A 3WSWA 4H0CA 5TQVA 2MINA 4B7CA 3FZGA 4EB3A 4TKVB 1TNDA 3R5FA 5F9HA 3DVAA 3PR3A 5DASA 4FDLA 3S40A 5DRYA 2DY0A 4N5LA 2O14A 3OFSA 4HXFB 3FUCA 1QOZA 3U62A 1W29A 3X44A 5H0IA 2QN2A 4QU9A 4UTZA 2IUUA 1X8LA 3QY0A 2QLFA 2V7QA 3KXKA 3OIWA 3NFRA 5KUTA 3C0KA 3NR2A 5LBIA 3TZ6A 2ZUSA 1K7SN 3L05A 4CU5A 4DEYA 2J6HA 4ZVNA 4RPIA 3P2JA 5TS2A 4F2WA 1ESEA 5KKNB 3VKGA 1C4XA 4R7ZA 4PZEA 4ZOLA 3AUXA 1G60A 1ZVQA 1FNMA 1X77A 2QUZA 2WTEA 2ZU6A 4UUQA 3FNRA 5AM5A 3EJ6A 4C2TA 3BN3A 4UUMA 3IXQA 4AN0A 1V3UA 1ZRMA 2XB8A 3OBIA 5U4XA 2OFXA 1MF7A 1HRKA 2X76A 4YV2A 4RD6A 3T7RA 4RJTA 5HF9A 1JWLA 4US1R 4WLOA 1AF7A 2X42A 2W6OA 3AGQA 1HTBA 4BJ1A 1ZA2A 3LY7A 4RSMA 5F12A 4BVFA 5C18A 5I9IA 3OEHA 5JNRA 4QYIB 4IV0A 2NT4A 4FD2A 2JJQA 4R8VA 1JKXA 2DZDA 1E5XA 3WK9A 5JCJD 2I8LA 3L8EA 5KI6A 5C7LO 1SKYB 2IGTA 4ND6A 4O4LA 4INPA 3VR4H 4OHZA 3ONFA 3CHYA 4WN9A 4DCMA 4XVHA 4OHBA 4BY9E 3QPDA 3S2FA 1RKQA 2V7EA 4X45A 3SYMA 4B4OA 1CZNA 2H6EA 3IXLA 4WH0A 2JI4A 3LJKA 1T8SA 3TSCA 5LOVF 3G0BA 2BHNA 1VG1A 2VPPA 4BWFB 3BGWA 4DLPA 5EXEA 4QZVA 1AKNA 1H2ZA 2W22A 4U2EA 1CDZA 1U8TA 2YN2A 4GUDA 1DO2A 4JZKA 4RHYA 1J2EA 2HK8A 1N2BA 4TUYA 5FBZA 4D42A 3L79A 1FRVA 4ONEA 4E3ZA 4LZJA 3DWFA 1LDEA 3H9EO 1IHXA 1DWQA 3UIEA 3OESA 1J6UA 3DV2A 1L7EA 2Q2OA 3H5AA 1GPJA 2I7CA 5KQSA 4CEJB 1ZGBA 1UQTA 5FTKA 3KZCA 1F38A 4M1MA 5JV5A 1M8PA 5JASA 1NOKA 4HZIA 4D9IA 4D9KA 1GSOA 2ZYTX 3FGZA 3BX1A 1IUPA 1BFKA 4NV0A 3CBGA 4Q3BA 1XQWA 2C4NA 3FTVA 1IY1A 4BDSA 4IIDA 2Q4OA 1SUEA 4D8TA 3D5EA 4IRXA 4RZXA 2FR0A 3SAJA 5KYGA 5C1PA 3I2FA 1JQ5A 2VH1A 3IVCA 3OH8A 4JLPA 4YXWA 5PNTA 3U17A 4ZEVA 3IEUA 1TMOA 1PZHA 3K30A 4J91A 4YMGA 3ESYA 4XNDA 3KD3A 1K75A 5H83A 1A0OA 2W71A 1KSGA 1NBWB 3HVHA 2R8PA 4Q21A 2LCQA 3SN6A 4I46A 3UAVA 3UW3A 2VNKA 1EGAA 4TRMA 2YN4A 4UDNA 3T4UA 2QAJA 4PRZA 3AVVA 2EL7A 5FNVB 3AP1A 1SCDA 2KBEA 3PFFA 1Q7RA 1WR8A 2F8TA 2JBAA 1Z15A 3AEKA 3GFGA 2X4DA 4UASA 5HXAA 5AOBA 2MSEB 2P9HA 1DC7A 5BNIA 1NG9A 4MKIA 1KDTA 2ZJ2A 1UBEA 2B0JA 3M6LA 3PDHA 4U9IS 3I8SA 4H31A 2C9ZA 3I9KA 1UKVY 3H11B 3NOQA 4HDKA 1UUFA 1UPBA 2W43A 4G4SO 4OJTA 4PLZA 4WLEA 4A0FA 1KI7A 1MZVA 1OYVA 1ZL0A 4L0CA 3TAXA 3FOFC 5E9JA 3VOAA 3GCXA 3N0VA 2IXFA 3LQFA 4IJWA 1C2TA 3TJMA 3MGKA 5ALIA 3W6UA 5CDHA 2B1RA 3K6JA 3A9UA 3LA8A 1CUZA 2FSVA 5CA0B 2GF9A 4WFQA 4A0GA 4LY3A 5F52A 4A92A 4CEHA 1PRYA 5E6UA 2OCAA 3SJ7A 2WFZA 3QFSA 4B87A 1PEAA 1XVVA 2PX8A 5IANA 2RGWA 4F60A 2F4NA 1IIRA 4OUDA 1DHRA 2VDWB 5YASA 5FWQA 3MA0A 3LHIA 4EY6A 4NFLA 1KWKA 3I6QA 1DDIA 3BG5A 1NJ2A 4JJAA 4B5LA 1XT6A 2A5JA 1PR2A 4K9NA 1TJNA 3GT7A 2DHDA 3KHUA 3PITA 4HR7A 5FBVB 3NNDA 3H04A 3R23A 2QSUA 2VAWA 3PFNA 4W1RA 5LLTA 3K92A 5LP6B 3LGAA 1L1FA 3LPNA 4TZ0A 1SKYE 1MO2A 1W6UA 3D1LA 5AJYA 4GAAA 1SO8A 1RRMA 3PUZA 4B6JA 5DTJA 3FOZA 4JI7B 2EIXA 2XHEA 1SD5A 3EC7A 4GLBA 5E9AA 2DSNA 3WLAA 2ZB8A 1QP4A 1L7QA 1JAZA 4C7XA 2AI2A 3V2HA 2P5TB 1A9PA 2J3MA 4IFTA 3TB6A 3NT5A 4UZSA 5DHAA 3H3XA 3ANNA 1PQUA 1MVOA 5JRZA 5EZ6B 4XA8A 1OA1A 1Y1TA 5CTJA 1C8LA 1T15A 1U3FA 3A1FA 1KSJA 1QRRA 3PUHA 1SGWA 4IDFA 1T4MA 3I53A 1G8HA 3DZJA 4XYLA 3MGCA 4IJ6A 4J3JA 1N2OA 1L7BA 1N5DA 3ABZA 3FKSD 3LF2A 4FFDA 1SVIA 2QAGB 2CUKA 2I55A 3A1SA 3ISTA 1LRKA 5B1IA 4C1NA 1SXJA 3HZOA 1NQAO 1P77A 1Y98A 4DLXA 3ZHYA 4EQZA 3QKRA 5EJ8A 1U0GA 3A0RB 1ODKA 1PWHA 1A9SA 2QVCA 3GMIA 2XQVA 1V1RB 5DB4A 4EX7A 5KSPA 1QV6A 2A14A 3DSRA 3IT2A 4MYCA 3WXBA 5JSHA 2QPLA 2BAGA 3H0EA 4TMWA 1K4MA 4EA9A 3Q7TA 5LQDA 1ZZEA 3BSFA 3DCJA 4QDUA 3Q6NA 4P32A 1FMFA 4D2IA 4IH9A 2BF7A 5LQSA 3DEFA 2VZEA 1QP8A 3HCPA 5FPYA 1TQ4A 3SZMA 4BC0A 2J4FA 3CN7A 4D92A 4LZWA 3K3PA 4HNUA 5AUOB 3PXBA 4MVJH 4F12A 3PJFA 5IK2A 5AVJA 2AOVA 5F21A 1ZJ5A 4URVR 1EJ0A 4YCBA 3UPTA 3HXQA 3BXOA 1T6ZA 2DFLA 5BW4A 1TCCA 3EMKA 2G9UA 3X3HA 3R3VA 3BH6A 1ZH8A 1WW2A 2Z9BA 3PSHA 2Q1UA 4BFLA 4REMA 1MRSA 1PGJA 1JDUA 2R72A 3EEBA 5K0TA 1RWQA 2B61A 4RK4A 3F6EX 4UXJA 4YBRA 1KOFA 5EVJA 1KY2A 4RWEA 2VHEA 3VDMA 2I2DA 1M0EA 1G6KA 1HNZB 3IE0A 5DM60 2GM3A 4GX0A 1ZMOA 3E8SA 4O6VA 2R6FA 1M5UA 4Q47A 5ICEA 1RLTA 3UGTA 3N2ZB 4RJ2A 4CM5A 4OHWA 1EE9A 2NZUG 3FBTA 3MN1A 1MAVA 5I5GA 1IVSA 1ZSNA 2POQX 3IJPA 3PUIA 4UHBA 3EWIA 1G7CA 1TLTA 3PI7A 4Q7MB 1I2MA 3WQQA 4WKNA 1ZK4A 1NVAA 1YL5A 4X71A 1TD1A 1ZD2P 1UOQA 4GVXA 3FZNA 2OECA 4L3WA 4PYRA 2DBYA 1FIUA 3R5XA 1VGQA 3GFFA 3FU6A 1V8ZA 4DUGD 1MGPA 4S0ZA 2GEUA 2J9RA 4HDOB 1KO5A 2AC7A 3OY2A 3R3YA 4IRMA 2W2VA 3QEJA 4QIRA 2XWJI 4RUKA 1II0A 1ZWKA 2G77B 2QQ0A 2A5GA 3BORA 4MHOA 4KDFA 3B36A 4J2HA 1NZDA 2GAOA 2ZKLA 3SR4A 4KLCA 5CEEA 3U5TA 3CFYA 4I9GA 4RPLA 3DLIA 4JBLA 1PGPA 2VYVD 3B3GA 4XD2A 4XI9A 2C5GA 2GM5A 1SM4A 4MS6A 1L7RA 3OZEA 3OAAD 4NIMA 5KHLB 4J07A 4MVJM 3ZLJA 4BNFA 3JYOA 1EMDA 1MTOA 3K8ZA 1RQLA 4ZW3A 1IVYA 2FW0A 5BN4A 3VTFA 3M89A 4TXLA 1PQPA 3UJ6A 4WNAA 2B1JA 5REQB 5EUCA 2HUPA 2NUPA 4U7PB 1G3IA 2A33A 3DTVB 2PX0A 3BBLA 1KI8A 1G3UA 4LYDA 3WO1A 2Z6UA 2BBOA 1I4LD 5LOVA 4OQQA 4OGLA 1C0PA 4Z7JA 1P3JA 1F2UA 3IR7A 4Y3UA 1D3AA 5A4AA 3I2IA 4ZI2A 4EPTA 3CVYA 4XKJA 4YRNA 4YT8A 1DAEA 3E61A 5K8CA 1VHLA 2BGLA 1P0FA 3O8CA 4KAJA 4B35A 3AB3A 4D8YA 5C4IA 4GAEA 4X8HA 4PWYA 4R2JA 3IEXA 1RWVA 2VL7A 2JCVA 2DULA 2V5VA 4AUKA 3L1KA 4IS2A 3ZUGA 4FX5A 4JLUA 3SEQA 3MD0A 3F0TA 2FFLA 1L5SA 3FB1A 4HFRA 4FFRA 4CL8A 3A4YA 3KJGA 4O8ZA 4QBGB 2R47A 2J3IA 2QJRA 1EX9A 3LIPA 2E48A 3TTUA 1LEHA 5CLJA 3L07A 4O08A 2P30A 2KW5A 4QVKA 4B2LA 1YT5A 2AMLA 4QARA 4R3WA 1Q1BA 3H4VA 3JR3A 4LZLA 3DTVD 4US0R 2IV2X 2FPPB 3V6MA 4EHJA 4RSYA 3HDGA 4UXHA 4PSUA 4R9NA 3EGCA 4EKNB 1OW3B 3ZLBA 4Y6GB 2ODQA 2E6UX 3CKLA 2P75A 3JD1A 1NUSA 2J6CA 1KAHA 1RI4A 1R6BX 3INTA 2KQUA 5AK4A 2I2AA 1G42A 3EBHA 1ISSA 2NLOA 3E3NA 3L4JA 2ZSKA 4P4SA 4Y2JA 3I58A 2C5SA 1HEIA 5H81A 4BFUA 4L4ZA 1NPYA 3KQMA 2VHVA 5WRFA 4EUFA 5T41A 1OA0A 4N0QA 3HUEA 1HDOA 2HX1A 5KJ6A 2RJOA 2QUAA 3LW7A 2NSLA 4RDXA 1UM9A 2DC1A 2G5CA 3EMBA 3K35A 3KBOA 4RMIA 5SZHB 2LIPA 3TLYA 3VQTA 3ASYA 2NQ2C 4CM1A 1U2RA 2BONA 2Q2NA 2X9QA 3EEIA 4CCWA 2H1SA 1EH5A 1KIMA 4JQOA 4WOPA 5BV0A 5JQGB 1DIAA 3MJFA 4QEKA 2F3TA 1FTSA 2AOWA 3SPXA 4DSZA 1GUZA 4GYKA 1Z2OX 1UBNA 1UINA 1GNQA 2I91A 1PJ3A 1ZGAA 4D80A 1R74A 2I4LA 5HE9A 3D9QX 3KE8A 3VHXB 2BHLA 3K0FA 4BPBA 1M2GA 2DBQA 2UXDB 3RT9A 4UDXX 5BY2A 4OSEA 2H1IA 3EJWA 1UWVA 2EVWX 2H57A 2OGZA 4XQGA 5CH8A 2LR0A 1UJ6A 1X6VA 3ZNPA 4GPEA 3QKIA 4NBNA 3LOPA 4W5RA 1RJ9A 3GH3A 2QRMA 1Z3IX 1EFCA 3FVVA 3GJ3A 3L6UA 3OEED 3A4NA 3L7NA 4OQLA 1L5LA 4BMPB 1XPUA 3QVMA 2PUTA 1HLGA 4LGCA 5KWSA 4O29A 1E6EA 3W34A 1SKBA 2F43A 2PH5A 4GMHA 2R3SA 2OQ2A 3HXKA 4F38A 4DBLC 4YLEA 5KTOA 1XEFA 2EP5A 4G84A 4RHTA 3UWDA 4LE1A 1IZ9A 4H27A 4JNKA 4C0SA 2BFBA 1N3BA 3L0OA 2GF2A 4PC1A 1VE6A 1ZAYA 3PK0A 4EAQA 1GGFA 3GJ5A 1MAUA 1Y3AA 3ZGNA 4CV2A 2YQZA 2H2WA 3AVXA 1BDBA 4G5YA 1ZRSA 2AEMA 1RLIA 3FUDA 3H6HA 5F7XA 1E1CA 1CS0A 2JCBA 4CM9A 4H7EA 3MRVA 2KBFA 4PW0A 3TSZA 3U19A 1WSBA 2GN6A 2HO4A 5EUBA 3RI3A 2DR0A 2ZBVA 1QDLB 3BFKA 4QUIA 5ADVA 2HA6A 3ZE8A 4MUIA 2WFAA 1JGTA 1FP4A 2EKBA 3LY9A 1A1SA 1CZOA 3FKJA 3RSQA 4H7KA 1WBDA 2J09A 5AJHA 3UXEA 4LJ9A 1JQEA 2FOLA 3ELYA 4L74A 3P71T 3LCMA 3O7WA 2J8ZA 1KSFX 4D98A 4JCCA 1TB4A 1WIWA 4LOAA 1KGDA 2QD2A 2IUFA 3HV2A 2OV3A 3T8YA 2Q21A 5TC4A 4IHKA 5C80A 4S1NA 1GPH1 3HGMA 2CGEA 2RHBA 3AHIA 1IXYA 4ZTUB 1TZMA 4EHFA 1B0AA 2FZKA 3Q10A 4LQCA 2KE5A 3Q0EA 4BEBA 4H6WA 2FHSA 1FVHA 2C20A 1RYEA 1JSXA 2HK6A 2BW0A 2PBRA 4JFRA 5BURA 1FJ2A 1Q1EA 2JLBA 4EJSC 3IHTA 1SUAA 3IRUA 4FYYA 5H9WA 1WJGA 2PBZA 3RB8A 4LHZA 4N01A 4OHUA 1NM5A 1XMPA 2GXUA 2X1HA 1ML3A 4BO0A 1IY2A 5AVQA 1RHMA 2A5FA 5H02A 3REQB 1V5EA 1SHUX 1ZJ4A 2FP4A 4NDAA 2XYRA 1I51A 4ND8A 2QS9A 3O9VA 1WAMA 2ZP1A 3VZQA 3OUTA 3OWHA 1MHPA 1LBEA 5DNWA 1L4FA 3KYDA 1QKIA 4IICA 1O95D 1WCYA 1TUBB 2AW5A 3M83A 4XLLA 1Z13A 5KCZA 2NSYA 5EZQA 3UTDA 4D0NA 4PLVA 1P17A 4MV3A 3QE9Y 5BUZA 5T4FA 1K5DA 4P53A 4JLVA 5H4GA 4COKA 4HAYA 3W77A 1KZHA 1AK2A 2GSDA 3PS9A 5D6OA 4BNKA 3CZGA 4L3VA 3SC2A 4H7IA 2AEEA 4K87A 3Q43A 1JYFA 1G5HA 1NPDA 1NR7A 3IA2A 5FBHA 1KZ7B 1P2VA 3THXB 3GLQA 3F78A 1O0SA 5D3QA 2O5CA 5KWIA 3ME5A 2VKTA 1XJCA 3CWQA 1DIOB 2B9VA 3ZTWA 5CLHA 1OYYA 3SQDA 4IV8A 1U3TA 3RVBA 3ED1A 2WSSD 3GVPA 2JD0A 3PDIA 4KSYA 3ZCVA 3H5WA 2X9NA 3KYBA 3DZCA 4O2BF 3WAJA 2FEXA 3SMVA 3ULKA 1TKBA 5KTTA 1OXVA 3VR6A 2J3QA 3NCHA 4DR5B 2O3SA 1AKYA 3NWOA 2OBLA 1YB2A 3DQPA 3M6UA 4IJVA 4JXKA 3A6PC 1US8B 5P21A 1YXMA 5EZYF 3HXLA 5JIBA 3VOSA 1FFSA 1R4NB 3ZD6A 4CE6A 2DECA 1W73A 5TQ0A 3ITNA 3HBFA 5J1TB 3P0IA 4IJKA 3RAPR 2F3SA 1C0KA 1F0YA 2QXTA 1Y4DE 2E4AA 3AGPA 3UAWA 5TJHA 3CT6A 3VC7A 4K46A 3BS4A 2Q5QA 1M83A 4CKBB 5JZOA 3NWPA 4MDYA 1S8NA 4EM6A 2B5OA 1NYLA 3HCNA 2H1FA 2SHKA 1JNYA 2XTJA 3WC4A 3QVOA 1OTHA 4I1VA 4FZJA 5H59A 3A28A 3KU4A 1G1MA 3SJCA 4LHSA 3GJ0A 5A0TA 1Z7EA 2VP0A 3FTFA 2VVTA 2D7CA 4YP9A 3QG1A 2ZUBA 1DADA 1IBSA 3H5LA 2IHNA 2FEKA 4NCAA 1DIRA 2B2CA 2GD0A 4IMRA 1T8WA 1I0LA 1YDEA 2ZR0A 1ZYUA 3BAZA 4KHPB 3NUZA 1SOMA 3PXDA 4B76A 2AKEA 5AIAA 1PJTA 4HWTA 3C48A 5COQA 1GU7A 3AYXB 4J43A 2I71A 1YGPA 3LFUA 2GDJA 4GC9A 1PJ2A 1D09A 4K2AA 1N4AA 5IULC 2AK2A 3U49A 3WAKA 5KYWA 3EPRA 4AMZA 1KK2A 2ZSDA 3VU3A 2Q5IA 4TYWA 3OKPA 1EUDA 3A4VA 2FJ0A 1J2YA 3BD9A 7AT1A 1R0ZA 1A5ZA 2PX4A 4TXHA 1CTQA 5DP2A 1JT9A 4PHTA 1KY4A 1HG0A 1LCIA 3KLNA 3FYUC 4B6RA 3GEIA 4ILEA 1X3LA 4NDNE 2MYUA 2F62A 3F90A 1WVGA 4JYBA 2XD9A 4ZZ0A 1P39A 2FETA 3AV0B 3OX3A 3KVOA 2Y1GA 3O47A 3IJEB 5LWQA 5ESWA 1ABBA 3ZDEA 3MYYA 4Z7OB 3ELWA 2R7AA 3UK0A 2WKRA 4LVNA 1GRRA 4FJ2A 4FLOA 2CEAA 2QV7A 1FUEA 1P1IA 3EPHA 1X7WB 3GLIA 2MR6A 3CKKA 1ORHA 4IEIA 1FMLA 4IXNA 4NOLA 1RPAA 3RSFA 5KVAA 1ZNQO 1BCRA 2Z8YM 3H4MA 4Z4IA 5KOJA 1VKZA 4QYWA 1JE0A 4JELA 3MWLA 3IUQA 5TEVA 1XTIA 1DKMA 2YY7A 3LP6A 4RTQA 1PP4A 5DX8A 3SXJA 1LLFA 2WJZB 2E18A 4DR3B 3ST7A 1D1SA 2VT3A 3U7QB 2UVDA 1XZJA 4UNRA 1A8UA 1C4KA 1HSOA 1OUMA 1MAAA 2MYNA 3G79A 3HWX1 3ZJYA 3FG9A 4B7AA 2Y93A 2Q3BA 3BJIC 3G82C 1XNHA 2JIOA 3GY0A 4BTLA 2MSDB 3P96A 2B4TO 3PHJA 5FTLA 4F46A 1X1QA 4KXNA 2AWOA 5HUJA 1XRSB 1FU8A 3WJ1A 3L5OA 2FPLA 1R4ZA 1GGMA 2ILTA 2WF9A 3GEMA 2V9CA 5TPZD 4S1PA 3V1NA 3SWWA 5IDQA 3CHPA 2DQKA 2G04A 3PSAA 4XWWA 1D04A 2J59A 5E8JA 3COYA 4PPYA 4MLZA 4RANA 5HGJA 5DZSA 4AX8A 1JB1A 1UH5A 1QS0A 1ZOPA 3HKEB 3QFHA 4YMSA 5EJ9A 4RQUA 2UYQA 3ZDDA 4JCOA 3RNLA 4W9MC 1EU1A 1P6XA 1RFLA 4Q6WA 1MNAA 3TL2A 3RANA 3GBPA 1J20A 3WR5A 2CLMB 2X0NA 3B1KA 3EZLA 3MQ4A 4ZV9A 2QGFA 2FP3A 3RGGA 2OQIA 2YASA 1A3CA 4R5XA 1G6OA 1QIFA 3OZXA 4OQEA 2BJVA 1KP2A 3MWYW 4FDMA 4IINA 4S2EA 2CWDA 1QGUB 4TT3D 1U5CA 3C3BA 2VP4A 2IZ0A 4GXTA 3ONVA 1NVVR 4J0EA 4CGYA 3E2IA 4YAKA 4FYJA 2XPYA 1WLSA 2Q4RA 2BHSA 3AM3A 5TVKA 3P0JA 5G4LA 1XDUA 1U4SA 1YS2X 1H1LA 3WRWA 4RVBA 1THTA 5F5XA 1LKZA 1J2JA 2WSIA 1WXEA 3GHYA 1GUFA 1VSTA 3L1JA 3QBEA 4V0QA 1OU4A 3IRVA 1BE1A 1VI5A 2O8VA 2QW8A 4X6UA 1V8OA 1XX6A 4YYEA 4DZZA 2WTXA 3HVJA 4DOMA 2PWYA 4DQKA 1Q21A 3GJSA 4R2IA 4ZV7A 5TY0A 3CLUD 1PV2A 1ULHA 1UWKA 5EYPB 5BYJA 4CQJA 4OHMA 4LCJA 4PAGA 2ZT7A 3ZYZA 5DCWA 1KJ9A 5JG7A 1ZZGA 3TNJA 4MROA 4G97A 3WO0A 4U1RA 4ZOEA 2APJA 3VC3A 2XVZA 1J5XA 1YRLA 4LJAA 4R1MA 2CHVA 1Z73A 4KGZA 1LSSA 3ZXYA 4CLEA 2BR4A 4F2DA 3GLHA 2Y71A 5F5LA 1R6TA 1XD2B 1YBVA 1AS3A 3SGLA 2VTBB 5JJKA 2HLPA 1NVEA 3EISA 1W5EA 5JS2A 5INTA 3RADC 2RH8A 3FTQA 3MMZA 1BVHA 5T4EA 1R0SA 4F9TA 2JLCA 4N48A 4EKIA 1M5RA 4U63A 1PLJA 2CFTA 2ZI3A 3B8EA 1YRWA 5BOSB 2Q6OA 3LDHA 4UNIA 1NFQA 4HCJA 4TZTA 1ONBA 2PYZA 1I0ZA 2XE7A 4I9FA 4CQLA 4EFDA 4AWXA 5AJVB 3ER8A 4B34A 4FYMA 1CC1S 4RSRA 3REQA 3SDSA 3HL0A 1EVQA 3I01A 4EPRA 4DJAA 5G1NA 2FK8A 4P08A 1KI6B 3AO0B 1E3EA 4C22A 1BE6A 1GPUA 1OWOA 3HVKA 1O6GA 3P9RA 4ND5A 3HTXA 4E5VA 4Y2UA 2O1XA 4MR8A 4Q4JB 4UNSA 3FHEA 4ZCSA 2R7MA 1JKIA 2ASVA 1LA2A 2J0UB 3QXSA 4NMLA 4R40A 3N2LA 2R6AA 3PHLA 5GVRA 4ZCPA 4DV3B 1I32A 2OILA 3G3EA 4TXJA 4XE5A 1FDIA 2VP6A 3LQ2A 4CM8B 3D6UA 1KQNA 5C1BA 5CFMA 4LI0A 3LC7O 1T36A 3DVSX 3C85A 4W8OA 6ABPA 1BMTA 5AW9A 1ISGA 1WV1A 4F5DA 1MAWA 8MHTA 1JIVA 2JJ1A 3ITEA 4E21A 4KBGA 5LZ2A 2YHAA 4HAIA 4UNQA 2IXGA 2PX5A 3V8MA 5F1PA 2PYDA 1J8DA 2FW8A 3HMKA 4PU0A 2Y1CA 1YRBA 4PQRA 2BFDA 5CDSA 4OHRA 3GD5A 4A8HA 4AMUA 1IHUA 4O2BA 2NZXA 3PRKE 3D2CA 1SKAA 1X1CA 1Y8AA 4RIFA 1JFFA 1UKYA 4KV9A 5CVDA 1SIOA 3H86A 2ZYSA 4RS3A 4LBZA 1TMYA 3EXEB 1T2AA 1V5GA 1JLLA 2IYAA 4G9GA 2PMEA 3FH7A 4JNCA 4F5ZA 5K9ZA 1T9AA 4M0PA 2GJ4A 5JJCA 3BUSA 5LKAA 4M22A 1B8UA 1WDMA 2VFAA 5FNVF 1H0SA 1RRKA 3DEAA 5EZYA 2XCOA 5BR1A 4DAEA 3QPAA 2CNKA 1KQGA 1XBTA 3FYUA 4KAFA 4M9QA 1YDWA 3Q7IA 2Z95A 4MR9B 5BSRA 5TARA 4BKQA 4DV6B 1ZXLA 1PN3A 2AX4A 5D8DA 5ARCA 3NTLA 4MQBA 4AMBA 3FETA 1IN5A 4URUR 4BVJA 3WMFA 4CRWB 3QUCA 1MIOA 2G9QA 1E6MA 3MWDA 2N9UA 4A03A 5TNXA 2IHZA 2GZRA 2PCJA 3L0BA 1BN7A 4OKNA 3OIYA 2K7ZA 2A5LA 1H94A 2FUCA 3DBRA 4I4IA 5DBOA 4E5DA 1L9KA 4INOA 2DTDA 4Z4HA 3ZV4A 3AIOA 4C7BA 4RZ2A 2QTMA 4LF7B 1KAMA 2OUKA 3WWZA 3DBIA 5CA0F 2HNBA 1XMQB 3ESCA 4XCXA 1R27A 3OTGA 2QTZA 1BVRA 1YACA 4C4PA 4CMHA 1M8JA 3VTKA 4AG3A 4LYFA 4UUAA 1Y9EA 3FCSB 2I4RA 4QHSA 3PR2B 3TCNA 5DF1A 1HURA 2ZI6A 5KYYA 5C7IO 4F9EA 1BWRA 2P2ZA 3OA0A 5BUQA 8ADHA 4JBNA 4P8RA 3TSYA 3LTNC 2XNDD 1JTVA 1KAQA 2GYUA 2UYGA 5C5IA 2RCNA 2A0UA 4A36A 5AKHA 1H2AS 2CXQA 1NVKA 3PUWA 3SZRA 2PHZA 2VI5A 2REXB 4C4OA 1QQ6A 5LP6F 2QTVB 1QCCA 1HOXA 1Z34A 1ZI9A 3IDSA 4YT4A 2PO5A 3NW9A 2QJOA 3UCXA 2C5ZA 1NHWA 5KPJA 1I8TA 1K86A 1RRPA 2GZAA 1S8OA 3DOCA 1OIVA 3ZIAD 2WV9A 2OV2A 4I4NA 3LD9A 2PH7A 4F85A 2X58A 1Q1AA 1Q7GA 1IG0A 3EA4A 4J0CA 4P31A 1OX5A 2RC5A 1ATIA 1M6VB 1KFBB 1OLSA 1U7UA 3HEBA 1CHDA 3HKBA 3VU0A 4YJ3F 1Q7CA 2O8EA 2OZVA 2CHQA 2I7XA 1WDKA 4KWHA 1JEYB 1XTJA 3R8XA 1PZGA 1XO1A 1JKJA 1XMJA 1YU6A 4FFOA 4PX9A 1DBRA 1YR6A 5E6RA 2CL0X 2BFOA 4G9EA 621PA 3THWB 4HXYA 1XAJA 4ETWA 2XKAA 4I6GA 4BVEA 4GVPA 3KSMA 2CEKA 4HRYA 4DSAA 1O58A 1Z4MA 2AWNA 1JLSA 4HVCA 2FSIA 5C8ZA 1TZCA 5TXGA 1ZQ9A 1AUQA 1QHEA 1JG7A 3DAPA 4KXYA 4QPEA 2YUIA 4AWBA 4CM4A 2IZ1A 4OXIA 3UC5A 3WGYA 2FF7A 1Y82A 3A1TA 4I4LA 1IZ8A 4MDFA 2FRXA 1RBQA 3INNA 2GJAA 2QRHA 3OX1A 3DF7A 4OXXA 5E2AA 3HYLA 4OAOA 4F3RA 1H2RS 1UXOA 3HQ4O 5C1OA 4OBEA 5EJMA 3GAMA 1QTRA 1T1JA 4TRNA 5FPPA 3NM5A 4FYPA 5LP6C 3SFVA 5DXAA 2OAEA 4MUHA 3RKSA 1RJEA 1IY0A 1QG6A 4UAUA 1VOTA 5AVRA 5HUHA 3TZLA 1Q3KA 4LFCB 2D1QA 5CK5A 2N42A 1NRIA 3BQMB 5AHKA 2HN9A 2HSZA 1QIDA 2WICA 3CXUA 5K0ZA 2GTPA 1VYVA 3N70A 3SHFA 3KB8A 2H31A 4P80A 4BRUA 2ATEA 4RIHA 2QX4A 1P1RA 4LDPA 3G0CA 5JMWA 4PLFA 4C6HA 1FJXA 1ZD8A 5NULA 1BCSA 3UB4A 3FTUA 3AX6A 4KJZA 1ZNWA 4XYBA 2B99A 1B1AA 2ERCA 1F6WA 2EZ4A 2J7KA 2WAAA 3JVIA 3N2YA 1NDUA 4MRSA 4QPNA 3OM9A 4IUCS 3ZCXA 3FLBA 2G17A 4AG5A 4C06A 4LY9A 4O8CA 1M7BA 2RHDA 5JCJA 2O5EA 1VPTA 3STTA 2QAGC 3O75A 1V11B 3HCCA 3QEOA 4FWIB 4JUBA 3SJBA 1QQ7A 3KIPA 4KRGA 4M0UA 1RPZA 1UDWA 4FDVA 3U44B 1WF3A 5JJ5A 4TKVA 2LRHA 2Q9UA 1H6BA 1P18A 3FFTA 4BLSA 1XAHA 4JBWA 3BQ9A 4F6RB 1U7OA 5LYJB 3MPUA 4ZMSA 1UBHS 2V4ZA 4J0KA 2WUEA 3B3BA 4KDRA 4KUGA 4MDEA 4IGIA 4L16A 2Q9BA 3FPCA 4PYJA 3M4XA 1G5TA 13PKA 3HCFA 4N40A 5EINA 4DLBA 4GX2A 4ESVA 2MTBA 3R0ZA 3KKEA 1NW5A 2QK4A 1I6MA 2G5GX 3AG6A 2OBNA 1DB3A 2RKBA 4PYQA 2QL5A 1IOZA 2ATXA 2V55B 1U2SA 1BROA 2VWHA 2JBWA 1IJKA 3L92A 3KVRA 1H4QA 4MUFA 1E2UA 1AN9A 1SIWA 2RGUA 3STVA 2GYVA 5DYYA 4DV1B 4WLFA 4ER3A 1ULBA 5SY4A 4EY3A 1W5TA 2KJQA 3ITDA 4QQ8A 2WT9A 4QYIA 4RELA 2ZULA 2P69A 2VSFA 3H2SA 1ECJA 2BZSA 5TS3A 4QXMA 1BVUA 2VZ9A 4R9RA 3WB9A 1F7UA 3TMYA 3LDUA 4PPFA 1M7HA 3I0MA 2P7HA 3D8SA 4Y6SA 1N78A 4F1WA 3L04A 1QAQA 2R48A 3LYLA 3L6EA 4FPXA 3D6VA 4JEHA 1N5OX 1WZCA 1KI4A 2CFOA 2JKVA 3H99A 4K3UA 4N65A 4WZBB 3SZUA 5BQ3A 4TWJA 2GSWA 1TTHA 2YC4C 3H1AA 4GOJA 2FOIA 3BIJA 3T94A 4YT5A 3WIDA 4MJXA 4F8JA 3CNOA 1T8TA 2G7MC 4AO7A 4K3VA 5C52B 1TA4A 2HHLA 3MLEA 5BWLA 4A2QA 1U2GC 3WBKA 1T2FA 2QIPA 1NZJA 4YACA 4C6RA 4B85A 3R6LA 3AF6A 3U2QA 5T4BA 2YJGA 1N0WA 5IXYA 5KTMA 3Q7PA 3OZIA 2WIDA 2B98A 1ZGJA 3FPKA 1O54A 4X24A 5I6DA 4ZMBA 3RTBA 2FXIA 1RYBA 2EGUA 3F8WA 4UUPA 1FU7A 4CCAA 4CEJA 3QKUA 4GPIB 3GJRA 2J33A 4HEJA 1ONPA 1BN6A 2BC9A 3L7BA 3P8ZA 1J0AA 2C5FA 3AUFA 2FLWA 4EIWA 2VK4A 5HZHA 3PHHA 1UQUA 4OMDA 3Q88A 5AR1A 2ASEA 1GARA 1N8NA 3CO5A 1X3ZA 2CF5A 1UP7A 2WOJA 4RIEA 2PKWA 3TE6A 3TH5A 5HNKA 4DUYB 5LJLA 2GVDC 1KEEB 3L6OO 4Q4IA 2BZGA 2CMKA 3PTZA 4IX9A 4KQMA 3L8ZA 4QOGA 5AKKA 5DTRA 3UKDA 4PM4A 4F6LA 4NVRA 2CJWB 2VJYA 4QHPA 3BFPA 3KEQA 3KQHA 1EM8B 3PEVA 1XQ6A 2MIIA 4I66A 1TVMA 4WLNA 2VRNA 2R70A 4OSOA 5HBRA 3IQDB 1QK5A 4C4XA 3LHSA 4JXJA 4LYYA 4P9NA 5A9RA 2XHZA 4XR4A 2HSEA 3I39X 5HF6A 1NF2A 5FNVA 2Y76A 1PSDA 5DX1A 2HJ9A 1EE2A 1BMFD 3ETGA 1N5IA 3FYCA 4OGWA 4RCZA 4DLVA 2D5CA 4ZMRA 3B7RL 1KC1A 3EEYA 4ZT3A 4ZT4A 3RHFA 3ZZ0A 1PTKA 1ODIA 2Y1KA 1HDGO 1A8PA 2LDXA 2PZBA 3H11A 2NZYA 3EQ8A 1OD6A 2D1TA 3ROTA