1R0LA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
378
Chain Sequence
QPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 123
structure length 378
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0lA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0lA01
1OBFO 2Q3EA 3H9JA 1S7CA 1ZZEA 3OA2A 3E8XA 4YPOA 4Y9DA 4WCFA 3U4DA 2WEKA 1LRJA 2F00A 1DIBA 4IIVA 3P5SA 4PVCA 5KVVA 5K0ZA 1X0XA 3ZHXA 1LQTA 2HMSA 1KVQA 1DPGA 3TDKA 5TQVA 2ZKLA 2XPCA 1EDOA 2EKQA 2X5OA 1AXGA 1J4AA 1ZW1A 1H5QA 4EYEA 4M54A 5CDSA 4DMLA 1XKQA 1DEHA 4XA8A 3LLVA 2GNAA 4E2ZA 3DBLB 4YA6A 4ND4A 5DULA 2WSBA 3L4SO 5ES3A 1DSSG 4JBHA 4NNJA 3H9QA 2G17A 4IDDA 1RKXA 2O2YA 3NUGA 1N9GA 1RM5A 4RPHA 2O2SA 4XYBA 3LF2A 1U4SA 5KJ6A 3RKUA 1MW3A 4GKBA 4ND1A 1MX3A 3GLQA 1NWHA 3FCOA 1XSEA 2TMGA 4PZEA 1QP8A 3ZV5A 4KTVE 1IHXA 3JQCA 4Y8VA 1NVGA 3LZ6A 1O8CA 2OMEA 2JHFA 2V6MA 4P4LA 4R9SA 3T7EA 1ZFNA 4BNXA 3PFFA 4BGEA 5COQA 4BNZA 4W7IA 4HXYA 1YBAA 3W4KA 1FDVA 4AVYA 3ZW9A 2IXBA 1Y8RB 4E5PA 4KDEA 4YQZA 2BRUA 3SBOA 3WBBA 2I65A 3AUUA 1XU9A 4PLFA 4DREA 4EGFA 1GCOA 1ZXLA 2Y0EA 4MIOA 3F46A 2PD6A 1I3NA 1XHLA 4NG5A 4PLWA 4KP7A 2BH9A 4DLLA 4DRYA 3WR5A 3BHIA 3ZW8A 1E7WA 2WPGA 1YOVA 4ZQBA 3RROA 4EJMA 4YAKA 1P33A 1NQ5A 1M67A 4NJOA 1IY8A 1LX6A 3DWFA 4KTTE 2YFQA 4EW6A 3PP8A 4E5MA 3PVZA 5CPBA 4BO7A 3KETA 4NFHA 1DB3A 1E7YA 4FR5A 1LJ8A 1M6WA 3HDHA 1R4MB 3QWHA 4EZBA 1Q7CA 2Y99A 3HSKA 3Q2IA 5J23A 1G5AA 4L74A 3PHJA 7MDHA 2YFHA 2J3IA 3SJ7A 2X6TA 4FLSA 1NX6A 3IOYA 1X14A 1ZIDA 4KWHA 1Y8QA 3WB9A 1VJ0A 1TLTA 4HKTA 5KJEA 4CV2A 5A03A 1SBYA 4W6ZA 5EPOA 2PGJA 3H4VA 2J3JA 4R4JA 5IDWA 4HADA 1B16A 1GV0A 3RUDA 3V2HA 1AGNA 5T64A 2GDZA 1TT7A 1XWFA 2AA3A 2FSVA 3MWEB 1WW8A 4CPDA 4WLUA 2C54A 4CQMD 1YB4A 4IDGA 1PJ3A 5JW6A 3JQ6A 4IIUA 5G0UA 2Q1WA 4CM8B 4D44A 1E1MA 4M86A 5G0VA 3SEFA 3WOHA 3ZWAA 2HRZA 2Z1MA 1UXIA 5G4KA 2HUNA 4BMSA 1LQUA 3OHSX 2OO5A 3QVTA 4XB2A 2D0IA 1N7HA 1RYEA 4IZHA 4XX0A 4WJZA 4RVUA 1K6XA 2FMUA 2RHCA 4MJLA 3TZ6A 3ZWMA 3W4JA 4KOAA 3FD8A 3W6ZA 4WEOA 3QIVA 4L76A 4S3MA 4LISA 1QORA 3F6YA 4YRBA 5THKA 3KYBA 1HDXA 3OECA 3QY9A 1UZMA 4MO2A 4J9UE 1ENPA 3ZNOA 5U1PA 4C7KA 5F5NA 2ZYAA 3L0DA 1ISIA 2YYYA 5L7WA 1H2BA 2UDPA 3DZKA 1QKIA 1HDRA 1XQ6A 2F1KA 4KUHA 1DAPA 1HE5A 2P9CA 1IL0A 4NK5A 3HDYA 4XQ9A 3DONA 4J7UA 1KS9A 2C0CA 1QYWA 5A04A 3TFQA 3C85A 3FNFA 2NTNA 5L45A 3WSVA 4OKIA 4Q3NA 3LQFA 3R1IA 1SC5A 1E3WB 3Q1LA 4RORA 2C59A 2ZK7A 3ETDA 3D4NA 4W82A 1EQ2A 1EBFA 2RH4A 4K6FA 2ZB4A 5EIOA 1C1DB 3INTA 4F45A 4KMSA 1I3KA 3QW2A 3ZWYA 3EMKA 3GFBA 4JQCA 1UDAA 4HFJA 2VTEA 2PH3A 5DBFA 5IXYA 1ENZA 2VZ0A 4J1QA 1SPXA 3GEMA 5CEEA 2C07A 3W4IA 3DAGA 4OQZA 5CDTA 1H6CA 1GU7A 4DIOA 1K3TA 2RBEA 1A9ZA 3LYLA 4FFOA 5I7EA 4E4YA 5JYDA 2O3SA 1ZEMA 2VYVD 4BOYA 4ZQEA 3ABIA 5IXSA 1WWKA 1PJSA 2GCGA 1VJ1A 4N7RA 1ZCJA 4J2OA 4UVEA 1KY4A 2JKVA 4BNFA 3JQBC 3GGPA 1BDMA 3JQEA 1PSDA 1EVIA 1FDTA 1VC2A 3KOUA 3RUEA 3VC7A 1C1XA 4Y98A 1XLTA 1LDEA 4RF4A 5CDYA 4PLGA 4DVJA 3E03A 3ASVA 1HE3A 2PZJA 1U5CA 1RWBA 3IAHA 1PIWA 1WZIA 1T26A 2QW8A 4UUPA 5EN4A 4PLCA 4XYEA 5FFFA 1N1EA 4MVJE 2YQ4A 2QRJA 5HM8A 3ULKA 3LC7O 2C29D 1OZAA 5L4SA 3A28A 3CTMA 1EFKA 3GDFA 1U7HA 2NU9A 3DBHB 2ZQZA 2FR0A 1K6IA 4YR9A 5IZ4A 5DBIA 1C0LA 1F0YA 2GERA 4IBOA 4G65A 2FY8A 1I33A 3ANLA 2WE7A 1NQOA 4DGSA 3UAGA 2PKQP 2B83A 4YXFA 1I5RA 1UDCA 1NP3A 1QG6A 4GAEA 4CM1A 6LDHA 2UUOA 3I3OA 5KJCA 1GADO 3DOJA 4O6VA 4YVFA 5JBIA 3E1KA 4CQMB 4YT5A 3VH4A 2DTXA 4ZQHA 4E12A 2VYND 1MW1A 4YT8A 3QV1A 2V65A 4MVJG 2A4KA 4KUGA 4YRDA 1MUUA 2I76A 1BTOA 3K6JA 2C2YA 4YJFA 3H3JA 1P0FA 3G49A 3VTZA 1IE3A 4J1TA 4OIMA 4FJ2A 5B4UA 4XCVA 3TZHA 1CQIA 3WQRA 1B0AA 2NNLD 4TKMA 3KSUA 4NMHA 1D4FA 1B7GO 4S1VA 5HS6A 3ZDFA 1T2FA 1LC3A 1ZK0A 4D0SA 1EE9A 1YXMA 4XQEA 4FGWA 4IPTA 4BNHA 4JIGA 1DXYA 4P38A 2HRBA 1P0CA 3R6DA 5DN9A 5F3RA 1H6BA 4JJGA 1ISFA 4L8VA 2IE0A 4CLOB 1QXSA 1Y8RA 4PG4A 1LXCA 1KYQA 2Q2WA 1M66A 2PR2A 4FS3A 1PJQA 1XGKA 3BHJA 4I5EA 1BMDA 1DIRA 3DHNA 3UEQA 3TOZA 2ZTVA 4FCCA 1O89A 4E30A 4YT4A 2Y1DA 2JFGA 3W8DA 4XQGA 3NDRA 1P45A 2IZ1A 2P9EA 4CV1A 3OQ1A 2HJSA 4FD3A 4NBWA 5A3JA 1A7KA 2I3AA 3WQQA 1PEDA 1IB6A 3QVXA 3FWNA 2O50A 4MVJI 5FF9A 2JCVA 1QV6A 5KCZA 3RBVA 4WCFB 1KEVA 5ENDA 1HYHA 2Y05A 3BMOA 4HNHA 4OHUA 4OMUA 4HWKA 5FYDA 4YT2A 4A26A 1TA4A 3WGIA 1GUZA 2NTVA 3WGTA 4Q39A 4J49A 4K1LA 4LMRA 2EW8A 3WSWA 2NQ8A 2YV1A 5JLAA 4R3WA 5EQFA 4L4SA 1OC4A 5JCXA 4MKZA 3SLGA 4OGWA 4TZKA 5F1KA 2ZATA 2B36A 5H81A 4NDNE 1H0KA 4BV9A 2AHRA 2XF8A 4MKRA 1Z45A 1AXEA 3DFZA 2DU8A 2CZCA 3LLSA 4ZU3A 5DBGA 3IL2A 1O0SA 4D43A 1YRLA 2DBZA 4UUMA 1PTJA 1VSVA 2VTDA 3GN2A 3LT1A 4MVJM 3TZQA 4XWYA 1I01A 3TL3A 3Q11A 3I9LA 2O23A 4ALIA 1VL8A 1PR3A 3HB5X 4CV3A 4BKPA 5JY1A 2DFDA 4CM8A 3AUAA 2OORA 3GVHA 4QO8A 2BF7A 1FF9A 2BFPA 3DDNA 3GNTA 1WLYA 2EP5A 2RHRA 3OJOA 3AUSA 2X23A 3V2UA 3RVDA 1KETA 5L7TA 5IZCC 3H3FA 3X2FA 1JWBB 3GG2A 3WLFA 1WXDA 4BNYA 1KEWA 4CR8A 3TL2A 2ZTUA 2X5KO 2VNAA 2DC1A 1SEPA 2NU7A 3BHMA 3UVEA 1NHGA 2UYYA 5KOIA 4DC0A 3GZNA 3GK3A 4LW8A 3A14A 3Q2KA 4OSPA 3ROMA 3QA9A 2MAOA 5FWNA 3TNLA 5L4NA 3WTBA 1PZHA 2E6UX 3JSAA 1A4IA 2X8LA 1MW0A 4H3VA 3NV9A 3D3WA 5L51A 2D3TA 1YOVB 4A7PA 4CM5A 2PK3A 1MFZA 3B1FA 2JAPA 4QO7A 1DC4A 3JQFA 3Q9NA 3M6IA 4KWIA 3KLMX 5F5LA 2P68A 1YB1A 1ZUD1 2RH8A 4PGFA 1O9BA 3HN7A 4RPJA 2VT2A 1PZFA 1PL7A 4ZD6A 1LTHR 1D3AA 3S8MA 4GX0A 3I9MA 1O95A 5I9MA 1TB4A 2EW2A 1YBVA 2XOXA 4MP3A 2DBQA 3AM5A 3H5NA 3HFGA 4EJ0A 1E3WA 3NKLA 5T8KA 3WGZA 2VRBA 4IDAA 1SNYA 2AQ8A 3KHUA 2X9VA 3KUXA 3GGOA 1GDHA 1LC0A 4UUOA 5TRTA 2Y68A 3MJ4A 4JP3A 1LEHA 5A3VA 1ZJYA 1LDGA 1WDLA 1P1IA 3AY7A 1T1SA 3KEOA 5ILOA 2H6EA 3E18A 4KUEA 2PGLA 4WASA 4G5HA 1YQGA 1A71A 3ONEA 5I8ZA 3CSDA 2OL4A 3QP9A 5BNIA 4FC7A 2AQIA 3UN1A 1XCBA 3FNGA 2B4QA 4GX1A 2DQ4A 4CMAA 3PLRA 2AXQA 3P2OA 2WM3A 1VI2A 1V3TA 1E92A 5KJFA 2R00A 4L75A 5G4KB 4BHTA 5BNTA 2CVOA 2JL1A 1SOWA 2VUSA 2FR8A 4E5KA 1AHHA 4NFYA 3INRA 4MVJF 2PD3A 4AJ1A 3UW3A 1VL6A 2NACA 1HE2A 2GN6A 3LU1A 5I9LA 1V6AA 4RF2A 1GZ4A 3Q0EA 3QE3A 4IGFA 4JJFA 4B3HA 4CMHA 1P1FA 2X9GA 4PG6A 4FFNA 1BHSA 1LSJA 1NPDA 5ICMA 2C7GA 5JDCC 1U7TA 1YKFA 1ISGA 2OXIA 1ZNQO 3DO5A 3RC7A 4LSWA 4Q9NA 4BO4A 3MJCA 5K6AA 4PG7A 1VKOA 2X22A 6ADHA 2WTBA 1E1KA 3E5RA 1KIFA 1MXHA 2BFOA 3OM9A 3JYNA 4JBGA 4ROSA 3I9JA 5B37A 5KVCA 1PJTA 1SB8A 2OBYA 3M1LA 2IZ0A 1DLIA 3T0YA 3GRPA 2Y1FA 2DUUA 2VCYA 1ZSVA 1ISHA 2WJPA 3UCEA 2ILTA 1Q0HA 5CG2A 4RLSA 1LUAA 3SVTA 3GPDG 4A27A 3U4CA 1SAYA 4JGBA 3UGKA 4A0SA 1EK6A 2Y0CA 4AJKA 5A5EA 1PU2A 3A06A 5I7SA 4H15A 1E6WA 3BMCA 2XAAA 1HDOA 4W4TA 3K31A 1Q1NA 1HEUA 5ADHA 1VKNA 2PGDA 3OIGA 1EUDA 4J6FA 1KVRA 4FPXA 3KRTA 4YRAA 1H6AA 1UUFA 2W8ZA 4DQVA 2HSDA 2X4GA 3HN2A 5FEUA 1ADBA 3QWIA 2EF1A 1I8TA 5F1OA 5KKAA 1NM5A 3L4BC 3RU9A 4GX5A 2X9NA 2EIHA 3JD2A 4PCVA 3K5PA 1CJCA 4PLPA 1JU9A 2Y1GA 1IZ0A 4O63O 4WPGA 5IDYA 3ZGYA 3VVCA 3ZNNA 1Y1PA 3VPFA 4DLAA 5ENVA 2BI7A 1O5IA 4U0KA 3G0OA 2HMUA 2YJZA 4XEHA 4I8XA 5EESA 1JQBA 1C1XB 4I5DA 4OOFA 2YUTA 5BNFA 1NPTO 4YYZA 4UVDA 5KVQA 4B3JA 1KY5A 1MG5A 1OMOA 1UP6A 2BELA 4GVXA 2EKLA 3AOEC 3AU9A 1UZNA 3I1JA 3JD3A 3OFSA 4O5OA 4Q3BA 4ZJUA 1K6JA 5T6BA 1E7MA 1UR5A 3BMQA 5KJ1A 4DA9A 3ZWPA 2JD0A 3R0IA 1I36A 1ML3A 1T25A 3V8BA 2P5YA 3VDRA 3ICPA 3PWKA 4NU6A 4WECA 5DCYA 2O3JA 2OGUA 2PV7A 2VOJA 3ZN2A 3CZGA 2GASA 4B7XA 4QTZA 1N1GA 1W73A 4M1QA 2GD1O 2JD1A 1XEAA 1CYDA 4CMGA 4RGBA 1CETA 1HXHA 5FI5A 2D8AA 1P31A 4B4WA 3MJEA 1M75A 1UDBA 2P91A 2Q45A 3WMXA 4EITA 3COSA 1KVSA 5KWEA 4RF5A 2NSDA 1DFGA 1XG5A 2O7SA 3PDJA 1U2DA 3MWDB 4LSMA 5TF4A 2Y67A 3U5TA 3B1JA 2IYOA 1J0XO 2V6FA 3VZSA 4DTIA 3K92A 1H2HA 1EVJA 2EG9A 2VYVA 4LVCA 3FHLA 4YEDA 3F5QA 1NAHA 1SO8A 5F21A 1QLHA 1PGQA 1T2CA 4YJFB 1ARZA 3T4EA 3RUHA 1EVYA 1DO8A 3K8ZA 5T57A 3FPCA 4YBZA 1VL0A 5JC1A 2E37A 2NLOA 4CJXA 4E21A 4J4BA 1ZBQA 1JVBA 1WZEA 1QV7A 4A73A 1JKIA 4GWGA 4BNKA 2GZ2A 3FWZA 5IN4A 3RSHA 1CDOA 5I7VA 1DOHA 5CHEA 1XYGA 3GZ4A 5KNLA 5KIAA 3GH3A 4R16A 3HB4X 4UVHA 4BNIA 4MKXA 4NBRA 1QMGA 5L9AA 4RVSA 3NT2A 2JJYA 1J6UA 3D4OA 3RCBA 3RUFA 4UREA 3DMYA 3CINA 2B69A 1VPDA 4B4VA 1QR6A 2WDZA 3GMSA 4TRNA 1LSOA 3GVIA 5A9SB 2HU2A 2ZQYA 1QLJA 4P4NA 2R00C 1ZSYA 4G81A 1A27A 1AE1A 2V6BA 3I5MA 4GPD1 1B26A 5DDIP 4PIVA 3UERA 1V9LA 3OBBA 3F9IA 3HUDA 5A05A 5JMPA 4B4UA 4DLBA 1GPDG 1PGPA 3CZKA 1SOVA 2AE2A 5KVSA 2PZLA 3KB6A 1DHRA 1R0SA 2G1UA 2VYNA 3BMOB 4URFA 2C5AA 3VAZA 4FC6A 4F6LA 2HO5A 2P4HX 1LDYA 4ZRNA 4W9NA 4D3SA 4RDHA 4BNNA 1WDKA 4PLTA 1MC5A 1MXFA 2VWGA 3VOSA 3H5AA 5G0WA 1DFHA 4I5FA 3UF0A 1K2WA 1B8VA 5TS3A 3TWOA 4XZ3A 5TLSA 4IQGA 4R01A 3GAFA 1VLLA 4OO3A 2YY7A 4WCDA 1GV1A 4YQYA 1LA2A 3WS7A 2CSUA 2VRCA 3ADPA 4YB8A 5JC8A 4IS3A 2BFMA 2P5UA 4BNGA 1NQAO 2BKAA 3BTOA 4PRLA 8ADHA 4BNVA 5B1YA 1P1HA 3H9GA 2BGLA 1PGOA 3LK7A 1IHYA 3CZLA 3RU7A 1P77A 4RVGA 3A1NA 5L7YA 2FWMX 2WYWA 2J3HA 4TMFA 3A4VA 5TIIA 3H2ZA 4N5LA 3DZFA 3JYQA 5A02A 3V1TC 3VDQA 4CV0A 4DYDA 3OICA 2DBVO 3AOGA 4EEXA 3ZU2A 4BQPA 1LRLA 3GDGA 4NJMA 5JAMA 1KC3A 2HDHA 2W2KA 1DC6A 5ILGA 3K30A 3BMNA 2GN8A 3GZNB 2EGGA 3JQDA 3C1TA 5I7FA 3OQ6A 1G1AA 3QSGA 2GYYA 3JQ9A 2NWQA 3ASUA 1KOLA 2OFPA 2DKNA 4RVFA 1D7OA 4R3NA 5BT9A 3SJUA 3D3WB 1NFRA 4L73A 4N54A 1KBZA 4Y67A 5EJ2A 1DDOA 4LUPA 1AN9A 1B15A 2YHUA 1E7SA 3QWAA 4BMNA 3D64A 5C7LO 2WWRA 2HK8A 3AJRA 4RZIA 3DEYX 4B8WA 3RC2A 2NTJA 3GY0A 4A5OA 1F12A 2VUTA 1E77A 1ZK3A 2B5WA 4IJVA 1Z6ZA 5MGBA 1PWXA 2CDBA 2QRKA 1F14A 3KV3O 1CRWG 5ER9A 4WCFC 3MJSA 3VKVA 1UAGA 2UVDA 4J4HA 3DFUA 4LRSB 2GSDA 5JDIA 4FLOA 3CEAA 3S1LA 2NUAA 3WLEA 4OXKA 4QX6A 5CAEA 1ZJZA 2I99A 1GQ2A 5JAQA 2HJRA 5C3MA 5A06A 1JKJA 1UXKA 2W2LD 1J49A 3DMTA 4L0QA 4R51A 2EKPA 5A5FA 2OZPA 4ND3A 1DLJA 1GR0A 5TNXA 4XYGA 3JQAA 2H1SA 2EGHA 3P2YA 2DVMA 4DQUA 3K73O 3K96A 4IJWA 5AXAA 1E7RA 3VKUA 3Q3CA 2X0RA 1ZVMA 3ZV3A 4ONEA 4BNWA 2CVQA 3EDMA 3K2EA 1PQUA 2Y1EA 2J3KA 3STHA 3PZBA 2DFVA 1NASA 1CERA 4BNMA 1A5ZA 4NBTA 4L4XA 1JWAB 3D5TA 1LNQA 1X1EA 3OMLA 4HNGA 3RBXA 1R16A 3WGOA 3DZIA 1GD1O 3PGJA 1EE2A 1RM3A 5L95A 1BDBA 3RI3A 3RWBA 3LVFO 4BMVA 1GEEA 2P9GA 9LDBA 4NU5A 4WEQA 3GVXA 1HDGO 5HRUA 3EUWA 2PFGA 3RUAA 3GHHA 2H9IA 4XGIA 1UAYA 2QIOA 3LDHA 4OJNA 1TT5B 3AM4A 1YS4A 3NX4A 1TI7A 1YL7A 5AXCA 4CMBA 1ADGA 1CIVA 5L3ZA 2HQ1A 4Z9FA 3OETA 1V0JA 1GQQA 1Y5MA 3GRKA 4XR4A 2D4AA 2CUKA 3PWSA 1X7GA 1UXHA 1H3LA 1EMDA 2GN9A 2NVBA 3CKYA 1RJWA 3HHPA 2AG5A 2VQ3A 2IRWA 4CMEA 4PZCA 4ZHSA 1N8KA 1F17A 4RPKA 1S46A 1NFQA 5L40A 3C7CB 4CL3A 1J5PA 1PZGA 4R68A 3NJ8A 1Y7TA 3DBRA 3U4IA 1B8UA 1C3VA 4TRJA 4WNCA 1HSOA 2D5AA 2FRDA 4DBVO 2AG8A 2HMWA 3BMCB 3GGGA 1HKUA 1RPNA 4UEKA 3INGA 1GUYA 2X0NA 2GN4A 3DOCA 5GZ3A 3LT0A 4OAQA 5IAAA 4E32A 4YJDA 3E9MA 3EGOA 1GQYA 3RFTA 3O9ZA 3TOXA 4PLYA 2NADA 2GF2A 3NT4A 4W7HA 4E3ZA 3E82A 2VWHA 4RVDA 1R66A 1UJMA 3D1LA 4IMRA 5LCXA 1KVTA 2VRCD 4E5NA 4BKUA 1Q7BA 1M76A 1HL3A 4R5HA 2RCYA 3PI7A 2X0IA 4WNIA 4WOJA 7ADHA 1SZJG 3NT5A 1B3BA 4K9DA 4PZDA 3SLKA 4M55A 4IM7A 4X54A 3LSYA 4MINA 2R6JA 4IY1A 4YCAA 2QQ5A 3GFGA 4E5YA 4DPKA 1KVUA 5JMWA 4RJTA 2NVUA 5A1TA 1BXZA 3UH1A 3Q9UA 4RPLA 4WE3A 1ZK4A 2B37A 2QRLA 2VNSA 3RC9A 1W8DA 5A9SA 4CMCA 5JFOA 1CWUA 5A9TA 3BMQB 3VH3A 3SXPA 3JQGA 3GEGA 1UH5A 1YDEA 1YJQA 4WGGA 3CMMA 1WNTA 4J1NA 4UULA 2PD4A 2I6TA 4R5MA 2QX7A 4CUJA 5JS6A 3FF4A 4ITUA 3HWRA 4OXNA 3O38A 3W8FA 1MC4A 1NR1A 4TQGA 5H83A 5BSEA 1BW9A 3VPXA 1A4UA 4LGVA 3O4RA 1E0DA 4A10A 3L6EA 4TROA 4WLOA 4R9RA 2ZTLA 3W6UA 3NGXA 3H2SA 1KEUA 1L7DA 4BNJA 4ZQGA 5A4DA 2POQX 2X7HA 1RM4A 2JAHA 5LDGA 1JTVA 4XB1A 1FXSA 1IULA 4OXYA 3F1KA 3UCQA 3QHAA 4BO6A 5AOVA 2VZ8A 2Q1SA 3IUPA 3B20A 3IP1A 1OC2A 3L07A 1C0PA 3E9QA 2B4RO 2I66A 3QLJA 4J4TA 4OL9A 4HFNA 1E3IA 1E3SA 1LSUA 2ZB7A 4AFNA 2Q1TA 4CMIB 3VH2A 3AFMA 4D41A 3I4CA 1BXGA 3M2TA 3VPHA 3I52A 2WD7A 4IDEA 3TN7A 3IQDB 5CEFA 4CLHA 5DZSA 1ENOA 4FOOA 2J6IA 2HK9A 3S55A 1DJNA 4G2NA 1FDUA 1MW2A 5GMOA 1AUPA 1U9JA 3KEQA 2VWQA 2O7GA 1I2ZA 2UAGA 4D7AA 4DUPA 4BNUA 1I2BA 3ZWWA 3OQBA 4PLHA 4D46A 3GUCA 4F3YA 4TRMA 1P74A 1WP4A 1EK5A 3WFIA 1T2DA 1E1LA 5U9CA 1JGIA 3IKVA 3C8MA 3NYWA 4HFMA 1ZMOA 3JQAD 3WTCA 2B0JA 2DM6A 3RC1A 3FNHA 1A9YA 1DRUA 2V7PA 1YQXA 3MTJA 3EY4A 2X1HA 4AJ2A 3TQHA 1C14A 2JFHA 2OBNA 1S6YA 5ER6A 4MP8A 4AJOA 4BO5A 5GZ1A 4YAIA 2HCTA 1XDWA 1E1NA 4I1IA 4IJKA 1PJLA 1DIHA 5G0SA 5IG2A 3JQ7A 2O48X 3UFXA 1QYVA 1KC1A 5CG1A 3WJ7A 2CDCA 4RQUA 2DLDA 1E6EA 3V1YA 3WGYA 3NTOA 2O4CA 1WDMA 4TVBA 4CM4B 1JDJA 2VHZA 1DC3A 2W4QA 3AW9A 3MTGA 3VPGA 1GYQA 4CM9D 4OSOA 4R1UA 4CM3A 1I10A 4CUZA 3KO8A 3MEQA 1U3TA 4HX5A 4E6PA 2CMDA 1JLLA 1Z73A 4PLVA 2VHWA 1E5LA 1PQWA 3PDUA 5CP8A 3ZU4A 3H8VA 4ESOA 3JQ8B 1ONNA 2CDAA 4P22A 1MLDA 3K2BA 5GZ6A 1HZJA 4TKLA 5HBRA 4RF3A 1YH3A 4ND5A 4DIBA 1PL8A 3P7MA 5DCUA 4YAEA 4WLVA 1IYZA 3UUWA 3IKTA 2ET6A 5CEJA 1NWCA 4Z9XA 4D3FA 1F06A 1ONOA 3KYDB 1HE4A 4NK4A 3GHYA 4BO1A 3QWBA 4CODB 1DFIA 3IC5A 4NHEA 4RO0A 4J7CA 3RIHA 4KDFA 3QVSA 2DTDA 4TVOA 4EUFA 2W90A 4LMPA 3OJFA 2BI8A 2NQTA 5TC4A 4DMMA 3AFNA 2DBRA 5JNLA 1LDNA 3WWZA 4UVGA 2DT5A 3ZHZA 1DIGA 4NJMB 4ZN6A 1PR9A 2W2KB 4GLOA 3BMNB 3PJEA 4IQ8A 5GY7A 4Q3EA 4FN4A 4FW8A 4JNKA 1T1RA 4A03A 5TGDA 1O6ZA 1ZSNA 3BTSA 5BSGA 2R2GA 2Y0DA 3M1AA 5L53A 1FJHA 4AJPA 1KERA 4CR7A 2VHVA 2J5RA 4DBZA 1P3DA 3KLPX 3A9WA 3FBGA 3EC7A 2VT3A 3EHEA 1LDBA 4E31A 1ZMTA 4GBJA 3WDSA 4JN6B 2O7QA 1GZ6A 4PG8A 2VUUA 2IXAA 1TT5A 1GZ3A 4R1NA 5JYEA 1GPJA 3ZNQA 4GSLA 1X7DA 1NVTA 4Y6RA 4AJIA 1SB9A 3G1UA 4KQWA 3I23A 4XYLA 1BGVA 3HDQA 4JX8A 4HY3A 4M89A 1PS9A 2CF6A 1NNUA 2G76A 2RIRA 4AJ4A 4MDHA 2Y66A 1LSSA 2VZ9A 3T7CA 3VZPA 1CF2O 3G17A 5G4LA 5KKCA 5THQA 1ISMA 4FJ1A 1B2LA 2I3GA 3ZWVA 1MV8A 2CF5A 4U6QA 4BKRA 2OP1A 2EV9A 3CPSA 2QZZA 3PEFA 2Z1NA 2ZJ0A 4GGPA 1N5DA 4BO9A 4XRGA 5IDXA 3DAPA 4J2HA 3GG9A 4PN3A 3KSDO 1U3VA 2CNBA 2YHIA 2AEMA 3P19A 3JQAB 1G6KA 1QYDA 2P2SA 1PJCA 5IF3A 4K26A 3IJRA 4BKQA 4YAJA 4TSKA 4U7WA 3ETGA 3OEYA 5DOZA 3MOGA 4NR0A 3VZQA 3PYXA 4II2A 1EUZA 1RP3A 3PYMA 1W6UA 4GLLA 1NQTA 1NAIA 3S2GA 3I9OA 1YVEI 2AQHA 2CD9A 4IQ0A 3ZV4A 4E2XA 5JAIA 2PA3A 3U4HA 2FN7A 3PYLA 4FQ8A 3HG7A 2E49A 4YTEA 4JROA 1C0KA 3WG9A 3DHEA 5JY6A 1BVUA 5HA5A 2A35A 4C7JA 1EQUA 3AWDA 4MPDA 3DXFA 4I9HA 4J9VA 3RJ9A 3GPIA 1U3UA 4CXFA 2OHXA 1G0OA 1GYRA 2I9PA 4BO8A 3E48A 2CY0A 1MFPA 4FFLA 4GWKA 2ZTMA 5HTOA 1ZEJA 3ZHYA 5DP2A 3GEDA 1EUCA 4N5MA 4Z0HO 2BD0A 3FSRA 3MCVA 4LN1A 5EINA 1ADFA 3OH8A 2FPGA 3ROKA 1HYGA 2QHXA 3KBOA 4UVIA 2C20A 3RD5A 4FFMA 1R0KA 3LT4A 3PHIA 1XR3A 2W2LA 4JK3A 4IJUA 3PQDA 1MGOA 4Z3DA 4II3A 1EFLA 3RASA 4NH4A 4CM6A 3NRCA 1A72A 5ICSA 2PZMA 2Q1UA 3JQFC 3DBRB 4XDZA 4IZIA 3GVPA 2PTGA 5BQFA 3UCFA 4CQLA 3X2EA 4BNTA 4L4RA 4BV8A 1FDSA 4ALLA 2VWPA 4CMIA 4J7XA 4ZGWA 2MAPA 2G0TA 3L9WA 4MVJA 2CFCA 1ZK1A 4RZHA 1Z7EA 1XIVA 2ZIZA 3HE3A 3SC4A 4NQWA 1ZK2A 5B4VA 5IDQA 4GX2A 5T8KC 4J91A 4KZPA 4FLRA 3N7UA 5CPFA 1LLDA 3UOGA 3E5MA 3ENNA 4HBGA 4IXWA 1PL6A 1JKFA 5C5IA 5HWSA 3QJ5A 3JQBA 1O94A 3B70A 2Q2QA 5COBA 1XELA 4MOWA 4CLDA 3ROPA 2Q46A 4CLXA 4E2YA 4AICA 4XKJA 2QG4A 3FPLA 3E6AA 3I6QA 4H16A 5KTKA 2Q4EA 3AM3A 4K28A 2TMDA 4I9NA 3BZUA 3U49A 2NVUB 5T67A 3PFWO 1PWZA 1Z75A 3BAZA 2YZ7A 1PS0A 1T4BA 1R6DA 1N2SA 3JQGB 3NTQA 3PRJA 3PGXA 4H7PA 2D59A 4CMJA 1AHIA 3WIEA 4ND2A 5TT1A 1U2GA 3ON5A 4ZICA 3WGHA 1Q0QA 3ANNA 3UCXA 2PKRA 4EI2A 3JTMA 1BW9B 5JSFA 1DBVO 1QSGA 3W8EA 2OP0A 3F1LA 1ADCA 4QQRA 5H82A 3WYCA 2JD2A 1H9BA 4RLHA 1EDZA 1PJBA 4JBIA 4CM4A 4HFRA 2GZ1A 2O3QA 4Z6KA 5JCJD 4AJNA 2I5PO 1VRWA 2W98A 4BS9A 5K6AC 3OJEA 4U5QA 2QYTA 2FPPA 4QUKA 3TRIA 1MP0A 4B7UA 1HF3A 1JVSA 4XGKA 1QYXA 1UXGA 4FGSA 3LF1A 1I0ZA 4MIYA 1DJQA 2X5JO 3JQ8A 3KVOA 3IDSA 4YWJA 2YV3A 4NIMA 4BNLA 4RQTA 3OIDA 1VM6A 4TWRA 3HDJA 4C4OA 5DNAA 3L77A 1BXGB 1HRDA 2AMFA 3ZV6A 1VE9A 1YB5A 4WLFA 2BGMA 2PH5A 2WD7B 1SMKA 3QVWA 5B12A 3L6OO 3H65A 4R54A 1V3UA 4IMPA 2WMDA 3FTNA 1PS8A 3F4LA 3KYDA 2HMVA 1T4DA 2IEBA 3GT0A 2EHDA 5K9ZA 3VTFA 4IUYA 2VHYA 3DHYA 4M87A 9LDTA 2YQ5A 3BTUA 4YDRA 1FMCA 1I30A 2GLXA 4U6SA 1U4OA 2GUGA 1ZXBA 3GVCA 3E9NA 3ITDA 1VSUA 4L9RA 3RFXA 4IINA 3OA0A 4AJHA 2GPTA 5G2OA 3VZRA 1P1KA 4TRRA 1HLPA 4LCEA 4EDFA 1LLUA 1HWYA 4NZ9A 1RYDA 2FP4A 2XXJA 3PHGA 1D1SA 1HSZA 2AE1A 2O3UA 2ZCUA 1E3JA 3HFSA 3S2IA 4AJEA 3EYWA 2NU6A 4EEZA 4AJJA 1B8PA 1NR7A 2G5CA 2H5LA 4U0JA 4M8SA 3TSCA 1B3RA 1M6HA 1V3VA 4LK3A 3PZRA 2X58A 3QWFA 1ZKMA 1WMAA 1P44A 1YDWA 3JQ7B 4N5NA 1H93A 5CDUA 5F1PA 3M2PA 3WFJA 4DPMA 5A9RA 4CLRA 2E48A 3ORFA 3ONDA 3NDJA 3PIIA 3PLNA 5G0TA 4NFSA 3V2GA 1LDMA 1UP4A 4JXKA 4BO2A 1FDWA 1Z7BA 4FB5A 4WUVA 4GSKA 3D7LA 3ANMA 3G3EA 2LDXA 3ZHBA 2Y93A 3FR7A 1OFGA 2HMTA 1XQ1A 4Z9YA 3EVTA 3VH1A 3I6IA 3JYLA 1DAOA 1XA0A 1XU7A 3DAFA 2FZEA 4JLWA 3NGLA 3V5NA 3DR3A 3D5QA 3DL2A 3PWZA 4RVHA 4D3DA 1EVZA 2FR1A 1YWGO 3HJAA 3EZYA 1YGYA 2GRAA 3F4BA 4CR6A 3AUTA 4ALJA 2B5VA 4CL8A 1T2EA 3O03A 1Y6JA 3CH6A 4IGEA 1TEHA 5JO9A 2JCXA 1PQPA 1LLCA 4NBUA 5TJHA 3KXDA 1Z82A 2IZZA 2PZKA 4U8GA 3WICA 3R3SA 1I3MA 1YE3A 2WYUA 1X0VA 4BGUA 3FNEA 2X0JA 3GNQA 2WD8A 4QSMA 4DXHA 1PJ4A 4BGIA 3MJTA 4CUKA 1R37A 3GF4A 4BL5A 5IZCA 1SEVA 3ZI0A 4FFRA 4MVJD 4Z0PA 5BR7A 1M2WA 2JFFA 2Q99A 4WK6A 2IDZA 4I08A 4BB6A 3FR8A 4UUNA 3F5SA 1Y81A 1MG0A 3AU8A 1W0CA 1YL6A 2AQKA 3DBVO 3DZGA 4FBGA 4PVDA 4BUCA 1R4NA 1UXJA 2FOIA 4Y6SA 1HDYA 2B4TO 4J1SA 2IYPA 4CM7A 4J0FA 4CM9A 2PLAA 5DP1A 4YJHA 2Q2VA 3RFVA 2J5KA 3WXBA 3LT2A 2XXBA 4EUEA 1R15A 2I67A 3HADA 3I9NA 4R1SA 4AG3A 4DIFA 3H7AA 2GO1A 3ZWXA 1HYEA 4YJGA 4LCJA 1CQJA 4OYRA 4XYMA 2BLLA 4RL6A 1U28A 4NQZA 4FLQA 1NFFA 3AI2A 3MJVA 5EERA 2AW5A 1OAAA 2GR9A 5I8WA 1I32A 3WYEA 3GUYA 4Q3DA 3GDOA 3IIEA 3ITKA 3PHHA 1JW9B 2DUWA 3ADOA 3CZRA 2NV6A 1U5AA 3KYCB 1I24A 1NTOA 2ZJ1A 5JPIA 2WYVA 4RCVA 1GYPA 1DIAA 2UV8A 3VPSA 3VVBA 4BGVA 4ZVVA 3RAJA 3U3XA 4GMFA 4W9NC 1A7AA 1NXQA 4GH5A 3QVOA 1LI4A 3PJFA 2Q50A 3K9QO 1WPQA 2J5QA 1OR7A 5AXDA 4K6CA 3ST7A 3TZKA 2O4UX 5EMHA 1PGNA 4Z3KA 4HV4A 2D1YA 3ONFA 2YHIB 3ZNPA 2BMAA 1BSVA 3DBLA 1P1RA 4B79A 3O8QB 4P4GA 1RM0A 4FOSA 4J0EA 3FRJA 3RJ5A 1LBEA 5C37A 3U0BA 3OJLA 2RAFA 1N7GA 3ZU5A 1TXGA 3WX0A 1ID1A 1E3LA 2PWZA 3H5RA 4QFDA 1QYCA 5COAA 5IN5A 4CLOA 4LVUA 4E13A 3ZWOA 3SC6A 3EVNA 4IDCA 4ZQFA 3JCZA 3PQEA 4P8RA 5CDGA 1BVRA 1P9LA 3FTPA 5JDCA 2E82A 1BG6A 1BXKA 2Z5LA 2D5CA 4DQXA 1IZ9A 1DRWA 1LRKA 2C7VA 1Y5RA 3C3XA 1U3WA 4GMGA 3S2FA 1R0LA 1GUFA 4PG5A 3TF5A 3TZCA 1IPEA 4GI2A 4BO3A 3GNSA 1HDZA 4OQYA 2NU8A 1PZEA 4XQCA 1MB4A 1ULUA 3BA1A 3CXRA 5TX7A 2ZYGA 3NJ4A 3G79A 2O3TA 4N18A 1Q7GA 2HLPA 4ZRMA 1YL5A 1JAXA 1HDCA 3FBTA 2AEJA 3NTRA 2C2XA 2PKQO 4ZA2A 1P1JA 4E0BA 1G0NA 3JQ9C 5AYVA 5EL0A 1F8GA 3D4PA 2NVWA 4E2WA 4M49A 5U4QA 1GTMA 2YW9A 3MOIA 4TZTA 3WIDA 1NBOA 4FSHA 4IDFA 5ITWA 4GQAA 3WGQA 1X7HA 3D0OA 2A94A 3TFOA 4FFPA 4CQLB 1H94A 2SCUA 2HKIA 3BYZA 1K0UA 2Q49A 4XD2A 2PNFA 3KZVA 4BVAA 1CEQA 2QZ9A 1GY8A 3GC6A 4GGOA 1PX0A 3IS3A 3WGGA 4NBVA 2UUPA 4YAGA 2V6GA 3JYOA 1JN0A 2JCYA 1HTBA 1KEPA 2HAEA 3C1OA 3C7DB 5JXWA 4AL4A 5JO0A 1F8FA 1R4MA 3NEPX 3BIOA 2DAPA 5LC1A 1EZ4A 4ALKA 1ENYA 4NI5A 5CFZA 4OM8A 5C7IO 3L4BA 3AY6A 1FK8A 1I2CA 2ZYDA 2VOEA 4DYVA 4HP8A 4QECA 3DTTA 3T4XA 1IOLA 4E33A 4BO0A 1NVMB 2ZB8A 3RUIA 1Q0LA 1I3LA 4HUJA 3WYBA 5JDIC 4EUHA 3CIFA 4QFCA 1N9GB 3ETEA 3G1TA 2GGSA 4INAA 4WLNA 4BKOA 2EWMA 4QT0A 1ZH8A 2BFAA 3DMTC 3QQPA 1R12A 3EZLA 3ZU3A 3WNVA 3U09A 3AOEA 1U1IA 2AEFA 3I4FA 1BWSA 3B6ZA 1L7EA 1UP7A 4DC1A 5BSFA 1WMBA 3JD4A 3DOOA 4Q3CA 1ORRA 1C0IA 1D1TA 4NPCA 2FHSA 2G82A 3BTVA 1YBMA 3F47A 4ALMA 3ENKA 3AI3A 4GVLA 1X15A 4MP6A 4AJLA 4WLEA 3UKOA 1ZO8A 3TPCA 5DOVA 3Q6IA 4J90A 2D2IA 3JD1A 5LDHA 4BQRA 2EEZA 2QYSA 4OKNA 4R41A 4XDYA 4FJ0A 4MIEA 4O0LA 1L1FA 5I9NA 4OOEA 4CMKA 1GAEO 3ICCA 3O26A 1Q2XA 2Y1OA 3C7AA 4XRRA 5AVOA 3H9UA 3DZHA 3GR6A 1HZZA 2LDBA 3NDIA 1PJ2A 1YONA 3DB2A 1NPYA 1GCUA 4B4OA 4XIYA 3DQPA 4FIZA 3HQ4O 2YDYA 4DPLA 3OJ0A 3C1AA 3DC2A 2GZ3A 3WJAA 3FN4A 3U9LA 1MVYA 1GL3A 5T5QA 1W4ZA 1JG9A 1E5QA 4CMEC 5AQ1A 1IPFA 2ZB3A 3GAZA 4ALNA 1YJ8A 3ZH2A 3I9KA 2H63A 3OSUA 4PFJA 4WOKA 1DHTA 2EP7A 4D79A 3L6DA 1Y9EA 1ZS2A 1C1DA 1QRRA 1LLQA 3LC1O 1Y8QB 1VJTA 1H6DA 3PTZA 5DT9A 3ZWNA 5FI3A 1E7QA 3EAGA 3R3JA 5TT0A 3I83A 3FI9A 1NHWA 1JAYA 3RBZA 4F46A 4ID9A 3MZ0A 5MDHA 3F3SA 1E6UA 1WVGA 3RKRA 1X13A 2J8ZA 3WQSB 4B3IA 1T2AA 4JCOA 4O1MA 4UEJA 4IS2A 3PPIA 4B7CA 4EBFA 3OIFA 4D42A 4KQXA 5JCJA 4RDIA 3UHAA 4XJTA 3DTYA 3AI1A 2B35A 4EJ6A 2C5EA 3GN1A 1U8XX 2VHXA 4WKGA 3WMWA 2VN8A 4CLRB 4DL9A 1IUKA 2OOSA 3OF2A 3DZBA 3S2EA 4QXMA 2WE8A 5TJ9A 1GEGA 1YQDA 2HK7A 3IP3A 3JV7A 1V35A 3EW7A 4BIIA 4OH1A 4Q3AA 5JAZA 2JHGA 3DZJA 2OUIA 1PGJA 1GFSA 4QEDA 3VHRA 1H9AA 1YO6A 4YACA 1UZLA 3UICA 3ZCXA 3NAQA 3PJDA 2EXXA 2PY6A 4CLEA 1HETA 3DBHA 3BXXA 2E4AA 3PQFA 3AY3A 3U62A 3C24A 4JJIA 3KYCA 4UAGA 2FZWA 3TJRA 3N74A 1LU9A 3CZMA 5IJZA 3WNQA 3N58A 3PXXA 3CUKA 3H9EO 1EBUA 3WWYA 3CZEA 4Z0TA 4J16A 3L9XA 4A2CA 2YV2A 5AXBA 1OOEA 1SCUA 4MVJP 2Q4BA 1Y9AA 4XJSA 4I5GA 1X1TA 2DTEA 3PJGA 4DWVA 1BRMA 5DF1A 3IUSA 5C7OO 2DPGA 1B14A 3OP4A 3RUCA 2BGKA 4AYSA 3SX2A 4CQMA 1ULSA 4D0RA 1ONPA 4IXTA 5ITVA 5L4LA 2Y1CA 3O8QA 4PRKA 1HT0A 1WAMA 4ILKA 5DCWA 2EERA 2DPHA 2FPIA 2YDXA 1ISJA 1Z74A 4GL4A 4XGNA 3JD0A 4IDBA 2A9FA 3D3EA 3PIDA 4B8ZA 1HLDA 4R69A 3JYPA 3OEWA 2EJVA 4BB5A 3LC2O 1DRVA 1SC6A 2A92A 1TVEA 4FDAA 2IEDA 2FSSA 1E3EA 1R4NB 4LRTB 4RPGA 5EQDA 3RQSA 3ZZNA 2C82A 3KM0A 4RV9A 2X86A 3QRWA 1NYTA 4I9UA 2P4QA 3GOHA 4GKVA 4D45A 5HS4A 2CVZA 3AK4A 4R1TA 3CE6A 3IJPA 1N92A 4J43A 3WBFA 3HZZA 4YJHB 2O3RA 2Z95A 3ZWCA 8LDHA 1U8FO 2EJWA 3PHLA 5JE8A 1MA0A 3GQVA 4UEOA 4XIJA 3PK0A 1V8BA 4PLZA 1JA9A 2BHLA 3B1KA 4F6CA 2ZCVA 1EEHA 3CMCO 3H6KA 4YJGB 2NM0A 4O59O 1K89A 3EK2A 3UXYA 1K5HA 5BSHA 4XR9A 2IODA 1OI7A 3HNPA 3IMFA 4MVJH 3ROQA 3ZWBA 3GMDA 1D8AA 4J3FA 3GA0A 1DC5A 5TSDA 5B4TA 3KSZO 4JP2A 4W99A 3V1UA 5IFLA 3W1VA 4Y6PA 1T24A 3KTDA
chains in the Genus database with same CATH superfamily
1LPOA 3IKJA 5AOCA 3P9SA 1CPYA 3FOBA 3AV3A 4R2XA 4CF3A 1CTQA 1TKAA 4WCFA 2B61A 1L4NA 1OYWA 2F00A 3OT1A 2QDXA 3P20A 5ALUA 1U1FA 8AT1A 2R0QC 1E64A 3WGLA 3EUAA 4CTKA 1X0XA 5KWJA 1LQTA 1QQ5A 2XA2A 1P4JA 1IY1A 2HMSA 1W96A 1RJFA 2ZOSA 4O2LA 4TMKA 2XCSB 2YRXA 2ZKLA 5LNK1 2XPCA 3WVNA 2EKQA 4G1CA 5EUMA 4K5NA 2O8CA 4EG7A 2AFIA 3BB4A 5H5JA 5K2MA 1EM8A 5EXEA 4GFDA 4M54A 1WZCA 4TMVA 1U0TA 2GNAA 3S3TA 1F0NA 1L1QA 3TZEA 4AO8A 5UKDA 3BVPA 5DULA 1T1JA 2PQ6A 1VA5A 1DSSG 2W4MA 3LY8A 3UUEA 1Y4AE 2JGJA 3A1SA 4YUAA 5DU2A 1T2UA 4WBSA 5FOVA 1HMPA 2P6UA 3PQ5A 1N9GA 1TYAE 1U4SA 2G40A 2X1LA 3EA0A 4LRQA 1MX3A 2REQA 1NWHA 1PEAA 1N5JA 4BYMA 4NCHA 5LSAA 1CUXA 4UOZA 1TO1E 1XTUA 2CXOA 3AHDA 1JZQA 3HJUA 4H7FA 1WB9A 4XN7A 2JIDA 4LC1A 1FNCA 3LZ6A 5K3OA 1BS9A 4PSDA 4BXOA 3OM1A 4CCWA 1TC2A 4BNXA 2G80A 1ZC4A 2FPMA 3FU0A 1UOEA 4FP9A 1Z07A 4BNZA 5BV1A 1WTCA 2JI8A 3W4KA 1NVDA 1FDVA 2ORYA 3IA2A 3HXKA 3X44A 4NCXA 3LCCA 1E1RA 5DGTA 2NU8B 3ZVRA 1NJ2A 4KVFA 4QTXA 5A7FA 2BRUA 2FEAA 3SBOA 4DM7A 4PLFA 1GR1A 1FSGA 3G8CA 3C98A 4EGFA 1JHAA 4TMTA 2JPDA 1QQTA 2O1XA 4MIOA 1NSTA 4MW1A 4BDSA 3CF0A 1TD9A 2YX1A 5K3FB 4X62B 2PD6A 5REQA 4CCYB 3UMFA 1C7QA 1U0FA 1NI4A 1GKLA 1XHLA 1M2EA 3OC6A 3DUFA 3OVMA 4NG5A 3SE0A 4AO7A 3IQWA 4ZI7B 4P0PB 1ZCBA 5IKXA 4CL0A 2XAUA 4UATA 3T3MB 4IHKA 1NBAA 1S3IA 4CGZA 4OEHA 4AI6A 4KX3A 3RROA 4HZUB 4LKOA 4EJMA 2J7PA 2VK4A 3DAHA 3QA3E 3SYTA 4NJOA 1AKTA 2WHPB 2P4SA 4LTNA 5AK6A 3SG0A 3QUTA 4E14A 2VQDA 4KN5A 2BCEA 4WFJA 4RULA 3PRHA 4EW6A 2XNKA 1ZOSA 4E5MA 4QUOA 3EIFA 4F7DA 3COJA 1X74A 5CPBA 5E3HA 1M5UA 3N2KB 4UCXA 2JASA 3KETA 2BWJA 1DQRA 2DHEA 2Q5CA 3G2KA 4FR5A 3OQIB 1DGQA 1KAMA 3EH2A 4HH4A 4Q19A 4EFNA 1G38A 5TQ0A 2XNCA 5J23A 5K3BA 4RTMA 2Z8ZA 3HRKA 2QJ1A 1LW6E 2BE7A 7MDHA 1UMBA 3VPDA 5AI5A 5BUQA 3G8YA 3SJ7A 4JLNA 3BK2A 4LC9A 2P30A 5BVGB 4B17A 3U6KA 3ZVKA 1EVKA 1Y8QA 4EHIA 3WB9A 1VJ0A 1TLTA 2J0VA 2WAXA 3BM5A 4FQ5A 4BLWA 4CV2A 2RHMA 3JASB 1FYVA 1OLXA 3NH9A 5EPOA 3FH5A 5EJ8A 4ZDKA 3A6EA 4OLFA 3D2CA 3I6YA 4R2WA 3V2HA 2GD6A 2GDZA 3BXHA 4FN5A 5AKGA 1NATA 5EE1A 5H16A 5HF6A 5T64A 5EHGA 3DEJA 4UBOA 2C54A 4WLUA 4X71A 5FBRB 5L3QA 4IDGA 3PD1A 2ATIA 3LUAA 5BSKA 2TS1A 2BSAA 4IIUA 5G0UA 2Q1WA 3OEEA 5LMNB 3HKEA 1A9SA 4G5RA 1XRPA 3A37A 3EARA 4Q6WA 5G4KA 5FL7A 3QUAA 2HUNA 1JS1X 4M1TA 1L7BA 4XTRA 5TMEA 2IZ5A 4ZYVA 1PEYA 1VCHA 5ALKA 5K0SA 5SZHB 4XX0A 3I8XA 1MKYA 2MSWA 5TARA 2D74A 1DCFA 1Y4ZA 1K6XA 4MJLA 2JC3A 4YJ3B 3QHQA 5ALJA 2BFEA 1OXKB 1DP4A 2HCRA 3FD8A 4KOAA 4DZTA 4L76A 2Z30A 4LISA 1QORA 2QNIA 5JBQA 1WY7A 2UXDB 5EKSA 1UZMA 4KPUB 2AMLA 3NBKA 3T54A 4DVGA 3Q6NA 5KB3A 3QPAA 3BK1A 2HDOA 1B8NA 1XMXA 2FX3A 3BWDD 2PRJA 4GI3A 4CQJA 1PWHA 4FHEA 3ZGZA 2YYYA 5L7WA 1IZYA 1H2BA 3DZKA 3IURA 1ZISA 5TV2A 1Y5IA 1HDRA 1WUJS 1XQ6A 1H22A 5JG7A 1TQHA 2QZSA 2H4ZA 3G2HA 2W6JA 4X3PA 3GFRA 3KOXA 4L9SA 4XOIA 1QP0A 4OXQA 2P9CA 4UBLA 4HVCA 4IKEA 2WF7A 2IU4A 2P77A 3RFUA 2HA2A 2JZCA 4H7EA 4ZDIA 2C0CA 2R86A 4X8HA 5LLDA 2GCOA 4PPGA 2NTNA 3QV2A 4JA2A 4TL9A 1X42A 2RKOA 5JJIA 2R85A 5JU6A 3R1IA 3W5VA 4EHAA 4ZV9A 4W8GA 1I7SB 1HTWA 3IQEA 5C8YF 4HUTA 2ZK7A 3ETDA 3D4NA 1KPGA 2RH4A 2GPJA 2WG2A 2C8KA 2ZB4A 2G06A 1XTPA 4F45A 1VE7A 1OH7A 4C01A 4IP0A 1I3KA 2GEBA 4KO8A 2ZRJA 3T7JA 5LB4A 1HLFA 4N3BA 2WB4A 1NXOA 4HWOA 4LF7B 4LI0A 4DUZB 3VV2A 1ZVQA 2PH3A 4B6GA 1ENZA 1X9HA 4K86A 3VM6A 1FFGA 1VIYA 4AT1A 3OUTA 2I9KA 3GEMA 3R6TA 4H0NA 3H0CA 3KEDA 1EIWA 3OEHA 5KS2A 3HGTA 3SNHA 1JECA 2ZGVA 3I2FA 1EDDA 5FWQA 2CKMA 1K3TA 2UYOA 5BQ5A 1RMTA 3TRFA 2JI4A 4DIOA 2YWFA 5JYDA 5I7EA 4E4YA 3E23A 1BMFD 1ZEMA 2VYVD 3LBNA 3QBDA 4MV1A 4H3KB 2SICE 2G67A 4I1RA 4R2MA 2CE7A 1PJSA 2E55A 3OZTA 3KJNA 4FQ7A 1CC1S 4MQFB 1MABB 2ONCA 3I04M 4J2OA 4N7RA 1G9XA 1XZDA 3L6UA 4KEAA 4UVEA 3O84A 3JQBC 5HK8A 4AZ3B 4KR3A 3GGPA 2Q3JA 2C5FA 3E0XA 3N2NA 1BDMA 1DOZA 1RQ2A 3HJTA 1C50A 1PSDA 3STXA 2GPSA 2WSLA 3CUEF 3VC7A 1C1XA 1NT4A 3HCCA 1NJ8A 2P9HA 3G2PA 3W9YA 2FMTA 4BPRA 2RK3A 2WAMA 3IP5A 3M82A 3NVMB 4H6PA 4DVJA 5KYWB 5BXYA 3E03A 3OX4A 3WDMA 3CSUA 3NPMA 2ASEA 3PF9A 4QYMA 1UJ2A 4DLVA 1PIWA 2QW8A 4NVRA 1B6SA 2Q5FA 4XLTA 2ZAGA 4UUPA 1Z22A 5EN4A 3RSQA 3WISA 2YOFA 5CURA 4XYEA 1NVUQ 4MS4A 3CJQA 1L7NA 1YVUA 1N1EA 1W75A 3QENA 4B3DA 2ISCA 1DKPA 4PU2A 3CTMA 1U02A 4TTPA 3E3LA 4KGZA 1EFKA 3LFUA 2NU9A 1QIJA 2ZQZA 4FYHA 1OROA 2FR0A 3CO0S 4X41A 3T3GA 4J94A 5IZ4A 3SXUA 2FYTA 3EIWA 1JJIA 4IG9A 4J75A 2QMHA 4DGSA 2NAFA 4CW7A 5JYCA 4ARZB 2BEUA 2EKDA 4AMZA 1OYYA 3CHRA 4GAEA 2FJ0A 5CDFA 3U26A 6LDHA 2AJBA 3ZG6A 4BFXA 2CYBA 4WX2B 4O6VA 4MO9A 1JH9A 3E1KA 3F97A 4KWTA 4QPEA 3TM4A 1VXRA 2AT1A 4HEJA 2DTXA 3VFDA 5ADWA 3GH1A 1JEQA 4BWGA 4DRXB 4E12A 3A3YA 4IFTA 4FFBA 2E5LB 1F38A 2JLAA 1B4DA 1Y89A 2CNWA 5G1PA 3BRCA 3QV1A 3EBLA 4MVJG 4XM2A 1KHTA 3G89A 4YRDA 4F2GA 2EOAA 2C2YA 5JWRA 1P0FA 1RHUA 2NUTB 1O1YA 1G7SA 1IE3A 1L3CA 2Y4NA 3G49A 3JY6A 4G37A 4HQKA 4J1TA 4OIMA 1Q0TA 2G77B 4KAJA 2IHNA 4XCVA 5IKPA 4UNPA 4NYJR 5AJUA 3RHZA 3TZHA 2LCIA 1ZX1A 1CQIA 4GMKA 3RU3A 4TLCA 3GRYA 5IYZA 1ZXXA 2XTMA 1Z56C 1YJXA 3PCTA 4NBSA 1NF8A 4UMVA 2JFBA 1J99A 1ECPA 2GF9A 4NV1A 5EIFA 2EG5A 3NIFB 1RBMA 4FXOA 3ZDFA 3U7HB 4D0SA 1RSZA 2HHCA 3MHTA 1QQ6A 2W42A 2GRJA 1KDZA 4TS1A 4IPTA 5EP1A 5CCEA 1YU9A 5JARA 1AMUA 1OZFA 1JWLA 1DVRA 5F3RA 4HQOA 2D62A 3O9MA 2JB9A 3CUVA 4JJGA 4K9KA 4L8VA 3SFTA 5NULA 3DVAB 3SOZA 3UGTA 2IWHA 4X93A 2Z58A 3DS8A 1YJCA 4DV6B 1RZRA 4HUQA 3BHJA 3F5FA 1QP4A 3ZPXA 1RYBA 1P5FA 1Z0IA 3UEQA 2RB4A 3KR9A 5I7AA 3TOZA 4BASA 1FRNA 4YMTA 2QOEA 2IIQA 4A82A 2V55B 1OR8A 1DWOA 5H4HA 4YT4A 2W6QA 4LMBA 1QH8B 5BWMA 3IQIX 2IX9A 1TEVA 4FGLA 4Q6BA 1P45A 2XJ9A 3IKLA 4FHCA 3OQ1A 4RM2A 1OVGA 1SXJD 3G82C 4NBWA 4RS4A 3EFOA 4IG4A 3WQQA 5TB5A 4FCVA 4DIEA 4X7RA 1T3TA 2H1IA 3QVXA 4MVJI 3A1DA 3HI6A 1Q77A 2JCVA 5GADl 5D86A 2GZMA 5CHYA 3RBVA 4EHJA 4WCFB 2QLFA 1KEVA 5FBKA 5ENDA 1RQLA 4DJAA 1HYHA 2Y05A 5M29A 5CNMA 2C00A 4HWKA 4WN3A 5FYDA 3V4SA 4A26A 1KBOA 1TA4A 4HLUC 1P5JA 1XMOB 4OXXA 3T9BA 2EFEB 4Q39A 3VHXB 1T35A 3PHBE 1GUAA 3PTLA 4K1LA 4NS1A 1K6EA 2EW8A 5ALFA 1EE1A 1WJGA 4ZFNA 3WSWA 4L5IA 3T5GA 3PQCA 1SUSA 5F23A 2AFIB 1EM8B 4TXJA 5EQFA 3V4VB 1OC4A 4BMYA 3S7TA 4KPEC 4OLAA 2NV2B 2ZATA 4C4RA 1TCCA 4RMHA 1OGIA 3LUGA 1XPOA 2J87A 2OEPA 3QOYA 5BQ3A 3UOWA 4X91A 5BW5A 1QRAA 1J25A 1EXVA 3THSA 3AJAA 5EXPA 2DU8A 1AO0A 1ORTA 4HLQB 4QPDA 4ZU3A 2C2MA 1QCCA 4FDTA 3V6LA 3CIAA 3ZCRA 1ZGBA 5I4KA 2J5XA 5JD4A 2O23A 1R2QA 1PR3A 1PL0A 2A88A 2ZYHA 1Z15A 2QTVA 4ENWA 3P52A 5KQRA 2JANA 3FHOA 4AX4A 2ZJFA 2IZ6A 1CJMA 2OCGA 1ESEA 3DDNA 1WLYA 5TPZD 5A2QA 2EP5A 2VRWA 4MDYA 4RVNA 3GPLA 2X19A 5C5DA 4MHOA 2HSWA 1KETA 4DPRA 1EFPA 1LVGA 1UK8A 2FF7A 2QI9F 4D74A 5KQMA 3WLFA 4RFVA 4O0MA 4IOKA 1EP9A 1UC9A 3IT3A 1KA9H 2W37A 4S2UA 3NHZA 3E9YA 1SEPA 2NU7A 2QVBA 1XRJA 4JLBA 3S28A 3UVEA 5LQCA 2FPSA 4DC0A 1TPYA 4QDOA 3GK3A 4OFXA 4UW9A 3LWNA 2ZQ5A 3WGKA 3LDFA 3ROMA 3QA9A 2ZJ8A 3NQ41 4MAAA 4EUSA 5HM6A 3IHLA 5IBCA 1NI4B 3BCSA 4WFQA 4XB6B 3WTBA 3DUFB 3DT8A 3JSAA 3AR5A 3OY2A 1SIOA 3E3MA 1MA3A 1U11A 4KR7A 1RWKA 2Y2UA 2GA9A 2O8VA 3A9CA 3NV9A 4XUGB 4U2GA 2FSPA 3NKVA 4F84A 1EWQA 3GRVA 2JLXA 2PK3A 4LDQA 5A7GA 1E0AA 2PL3A 3Q9NA 2DSTA 5AUQA 2UZ1B 4RQBA 5BUSA 3VX3A 2F55A 5BW4A 5DXJA 3X1KA 2AWOA 4I50A 2AC7A 4E6PA 4RPJA 2BL4A 1UIMA 1U28C 1B6GA 1PL7A 2OD9A 4B75A 3N6XA 1QBGA 1Z3IX 3OFJA 1R27A 2GCPA 1FTGA 3EFEA 4H4CA 4LTMA 3D6FA 4HN4B 4NLLA 2XOXA 1GZSA 3AM5A 3AY0A 5HZMA 3SOPA 5ALDA 2CLHB 3EXIA 2KE5A 3PNLA 1V4BA 3MMPA 1RC1A 2Z9DA 2HSGA 3C48A 5L3VA 1RKVA 4DB2A 2CFOA 5DGXA 1GDHA 2VS1A 2YXLA 3BWMA 4L28A 1IBCA 2O07A 2QRQA 3W9UA 1MAWA 1PR6A 2WC1A 3U81A 4G0MA 4UQPA 2JI6A 3LG2A 5IUNC 1ZJYA 1VB5A 1UODA 4BKMA 4R6XA 1OLXB 2ZW9A 3DMNA 4CUKA 3WRWA 1P7CA 1WD7A 2OCBA 3I34X 1WSDA 4KQIA 1BYIA 3K0FB 4QA9A 3THXA 4LHXA 2XCTB 3L7AA 2PGLA 1A8HA 3T7KA 3H8SA 1Y8ZA 4XGRA 2FDCA 5I8ZA 4AF8A 4AYXA 1BOFA 4B3FX 2WG1A 2OL4A 3QP9A 1H2EA 3V1LA 3IE2A 3UN1A 1EVLA 1REQA 1XCBA 2B4QA 3G7UA 2DQ4A 4GX1A 1J0EA 1BE8A 1J7JA 3FCEA 3HKEB 4KE6A 5D87A 4M0MA 3SZGA 1KP2A 3L82B 2F90A 4ICIA 3P0IA 5KJFA 1OJLA 3EOAI 3RC3A 4IZ6A 1S2NA 3R41A 4JS0A 4OGLA 1N57A 5G4KB 4IJ5A 4BX2A 4GOLD 3A1CA 4KRGA 2BGTA 4E5KA 1AHHA 3P4XA 4JI3B 1ZICA 2YQZA 5AI6A 4MVJF 1CNEA 2YVUA 3HP7A 6REQA 1PSZA 1RCUA 1PK7A 4XH9B 1VL6A 1QVVA 1Z5GA 3BERA 3LU1A 4XX0B 3T5BA 5I9LA 5JI3E 1GZ4A 3Q0EA 5CCBA 4IGFA 4E70A 2QRPA 4B3HA 3I5YA 5FBWB 5FXMA 1HORA 4W5TA 1BHSA 1I9CA 4CTMA 1HG0A 4YRNA 1NVFA 4FMCB 5JDCC 2NUPB 1N3IA 3F67A 3BGSA 3HN6A 4JLKA 1RJ9A 4PBTA 3B6JA 4DR3B 2X7XA 3RVKA 4BO4A 4WD3A 4KPFC 3ZJUA 1UKZA 5I9BA 1P80A 3CH7A 1VKOA 2X22A 4PG7A 3CRZA 3GARA 1GKYA 3RK0A 2ZZMA 1PYGA 2DHRA 2WTBA 3DM9B 3E5RA 2BFOA 1MXHA 2V4UA 3IXQA 3JYNA 3NBYC 4JBGA 1N5KA 4ROSA 1XJQA 4WKNA 4Y2YA 1M7GA 7AT1A 5KVCA 1ECJA 1PJTA 3GD5A 4X6UA 3MG9A 5AFSA 1TQ6A 5KHLB 1Y3IA 2AJCA 1ZPDA 3NORA 3OMXA 4JITA 4RWEA 5JAPA 2ZM6B 4MVCA 1JDNA 4KFTA 3EUEA 4OVKA 2GCOB 2Y1FA 1ISHA 2Q2OA 5T3YA 5C9ZA 4I1OA 3E70C 1A8UA 1AURA 2X7JA 4KYUA 5HXAA 3DW3X 4RD0A 1LUAA 2QL7A 2H1HA 1SELA 2BV3A 3CGGA 3LY9A 2C78A 2Y0CA 3IVRA 1JZSA 4FUQA 3TI7A 2R8XA 3A8TA 4D4IA 1M2HA 2XAAA 5KWIA 2CV1A 1LS6A 1WB5A 5HOEA 2P9QA 3IHTA 3AL3A 1Q1NA 1HEUA 1VKNA 2PGDA 2NUAB 3L02A 1OFUX 3KPYA 3WK9A 3STVA 1TJ5A 1KVRA 3LM8A 2F17A 1H2WA 1Y1SA 3OZEA 4F1KA 5FV4A 1OXBB 2PWYA 4HNQA 1OIVA 4OUDB 4JUBA 2X4GA 5FEUA 3QWIA 5KKAA 1AUOA 2CBXA 5ALOA 5AKEA 4WPGA 2XB6A 1Z17A 4TS4A 1IZ0A 2FUEA 1Z26A 5M3BA 5K3EA 2JLCA 1K66A 5DX8A 1NN0A 1T8WA 1RCFA 2B98A 1R6AA 3VVCA 1Y1PA 3ZNNA 4YRSA 2J31A 2QVZX 2HL6A 2BI7A 1O5IA 2HDNB 4U0KA 5IH3A 3GP8A 1E9FA 2KS6A 3MFYA 5EESA 2CSXA 5CLLA 4DMKA 1JQBA 1C1XB 1K8ZB 4I5DA 4BAUA 2Y9PB 2YUTA 3CW9A 5CMLA 3MJHA 5INTA 2GBIA 3CUUA 1UP6A 2PAFA 4UARA 4CMEA 4GVXA 1WCV1 1PNTA 3PIRA 2VHJA 2EKLA 4UMEA 1JHRA 1UZNA 1WUTA 2F43B 3KKPA 3PTAA 2R7AA 4ZJUA 1VL1A 2CZQA 4IRMA 2UVQA 2LUOA 5T6BA 2JJ1D 3ACCA 2BBWA 4JCCA 3SSOA 2RGNA 4XWGA 1UR5A 4Z4EA 5JJKA 4LXQA 3RE1A 3BMQA 2CNOA 4EFDA 2FMHA 2QPAA 4MS4B 4NL4H 4PVBA 2JA1A 2YCLA 4FTWA 4OK3A 1T25A 5LA6A 1ML3A 3A7EA 2P5YA 1U0GA 4OQLA 5K99A 4UTNA 2DXIA 2I6XA 4J7AA 3DSRA 1NW5A 4JLAA 3O3MB 2M6KA 3VNVA 3VSDA 4NZMA 4KRYA 1D6JA 2HF9A 3ET5A 3FGNA 3DG9A 2ZLBA 4B7XA 2AMVA 1H8EA 1W73A 1NLFA 4M1QA 2GD1O 1INLA 5IBRA 5K0NA 5K0EA 3QYFA 4CMGA 5LFAA 4DOMA 1A8IA 1YI8A 1OXVA 3W3AH 1U5BA 5SYAA 3MWLA 1CUSA 1M75A 3HY4A 2O1WA 1N0WA 2BEUB 2CHGA 2WIJA 2NVOA 3RRBA 3E1SA 3EVZA 5L3SA 5CGZA 1UMCB 2MSKA 1AKWA 3B1JA 1RI5A 3CB4A 2V6FA 4Q1VA 2CK3D 3VZSA 2QYOA 4N39A 1H2HA 5JPDA 1GILA 1P2FA 4AR1A 1QNLA 4NONA 2VYVA 4XO3A 2EG9A 5GQSA 1TYEB 5B64A 1JEQB 1A96A 4B09A 4M83A 4FFBB 1NN1A 4FEEA 4HB0A 5KWVA 2O19A 3F5QA 1UEJA 2ZRNA 1NAHA 3BWYA 4DLRA 4JBXA 4Q01A 1ULZA 2IIVA 5IT0A 3B1WA 1MRSA 1T2CA 4C4SA 1ARZA 3EIQA 2ONKA 2Q7XA 4EX7A 4Z49A 1DO8A 3CLRD 3LFHA 5T57A 1LW7A 2FFJA 1MB0A 4GI7A 4NOKA 1D4ZA 4OGGA 2P2NA 4LBVA 4AO6A 3JAKB 3EJWA 5IYZB 2E9SA 1TMYA 1QV7A 2H18A 2XLBA 1JKIA 3LLMA 4GWGA 4CF6A 4BNKA 1OBVA 4E09A 2ROQA 3K6RA 3DLTA 3FWZA 3OOWA 2PMKA 4O4LF 4QXPA 3DWEX 4IVNA 3VR5D 5IWCA 3RRJA 2XYVA 5FD8A 2C4TA 3WGMA 4B32A 1CNFA 1F2VA 2WHRA 1K08A 3IALA 3LCRA 2IS6A 1U3GA 3LPAA 4MKXA 5DM4A 3T35A 1FUIA 1XL1A 1L5ZA 1QMGA 2O8NA 2D13A 1NZJA 3ZGOA 1O57A 1MOSA 1BWQA 1C7JA 2BFBA 4IMJB 1Z6PA 4HUQB 1A97A 3UBTA 2J3EA 3PRYA 4DA4A 4OHZA 1SVSA 1PFKA 2B69A 4QUJA 1G21A 3KALA 5FUYA 3FYDA 3TM5A 1THMA 1HDIA 2F3PA 5KSZA 3AXSA 1ZVVA 1C7EA 4LSGA 1NMXA 1W2HA 2COEA 2H85A 1UJCA 2V6BA 3EFOB 4JEUA 3T8YA 5JXHA 1VLQA 4U2CA 2AOUA 4YP9A 4PIVA 4KVZA 1JG4A 3PGA1 3OCXA 3D5EA 5A05A 2BEWA 2O2IA 1KKMA 4EB0A 2K6GA 5F98A 2DPXA 1B0ZA 2II6A 5FIUA 5F35A 2PZLA 3QF4B 1R0SA 2YWBA 3HVKA 4J0CA 3VGPA 4COKA 4F2WA 2GF0A 4KFSA 4H27A 3U39A 4D3SA 2CFIA 4RDHA 4DR6B 1WDTA 2FW9A 3CRRA 3V1KA 1UKAA 2B7BA 1LTQA 3I45A 5E3JA 2JLUA 1GAJA 5K0LA 1Z36A 2EWVA 3VOSA 3PHCA 4PWZA 1IBKB 3B37A 5AJWA 3OWXA 721PA 1AKEA 3UF0A 2SKCA 3W2TA 3KZ1E 5TS3A 3V8NA 3HV2A 4X3OA 4L8LA 4OQPA 5E3IA 4EO9A 2YIVX 3O0TA 1YI0A 4ZO4A 2HA6A 2ZBEA 1QKJA 2UZAA 2VRCA 1OKKD 3HB1A 1MOZA 3NB0A 4KE7A 3B7WA 1B00A 2ATVA 4OJTA 1F6WA 4XM0A 4YB8A 1K4MA 2Q5IA 3BL5A 3UENA 1ECGA 4Q1AA 1ZD5A 1ZVKA 3WLJA 4D56A 8ADHA 1E2EA 1N6PA 2FPOA 2PRZA 3CEHA 4BNVA 2IDMA 2JJ8A 4LZAA 4C3VA 1DXOA 3TTSA 2O54A 3IB6A 2FEMA 5EUBA 1YR8A 3CZLA 3ANYB 5EHQA 1DARA 1E3TA 2AV6A 3UGQA 2A9VA 5L7YA 1VPTA 4NULA 1IZ7A 2J3HA 3F0TA 5FBHA 5BW6B 5KOYA 2QTVB 4D4GA 3FMPB 1HOXA 1XZQA 2VDLB 3RK4A 5BR1A 4EX6A 2EVWX 4Z1OA 2ZUVA 2Z5VA 3GEHA 2FNAA 1BYUA 4HDRA 4PX9A 1IVYA 1EP1B 2CUTA 1SXJA 2XOKD 1EFPB 3DD5A 1C30A 3DV0A 3OICA 1SU6A 2DBVO 3OZSA 4D6PA 3AOGA 1G42A 2R66A 3EODA 1LRLA 2QLJA 3N7TA 4J8PA 3D6VA 4NJMA 4Y7CA 5J9FA 1OB2A 1IXRC 3DLIA 3QOXA 1DC6A 4Q3OA 3K30A 4K9NA 5E1MA 2A5FA 4INJA 1GL9B 4E7OA 2EGGA 1XO1A 1G1AA 2PJUA 3F5DA 4ARSA 3RHTA 1FCJA 2NWQA 2X42A 4I8DA 1RTTA 2XVAA 1W5SA 4JHLA 2JGKA 1P4AA 4RVFA 5LMCA 2VJMB 3FHJA 3F71A 1AB6A 1J39A 10MHA 3TCNA 4X20A 4D9CA 3S99A 1MIHA 3I64A 3NIWA 1CY4A 3DCIA 4IRUB 3HMKA 1GSIA 2H52A 1W8IA 4RKWA 4F9TA 1E7SA 4EW2A 1D7AA 1JG1A 4IHAA 4UDOA 5CT4A 4Q15A 4WY5A 2MCFA 2QVCA 2WWRA 3IAFA 3NATA 1CT9A 4RZIA 4EA6A 3PQ6A 2VDMB 3D8SA 4CEJA 4A5OA 4JJZA 1NNLA 1G9TA 2C3MA 4FR2A 5A4AA 1J2RA 2B5WA 4QOIA 4ASUD 4PBRA 5CXXA 4BQIA 1O0BA 4LF8B 3ZX4A 3EXIB 1OQAA 3ZIAD 2A58A 5AW5A 3KV3O 1CRWG 5ER9A 1B2RA 2GK3A 5C4GB 3CZQA 4G97A 3T3EA 3VKVA 1FRFS 3DT6A 2UVDA 3BT7A 3DFUA 5TPZA 3T3NA 1CG6A 5JDIA 2EZTA 4HDKA 3EXFB 1OBOA 1ELOA 2QR5A 2B34A 1AGRA 4EY3A 5CAEA 5JATA 3W5BA 6YASA 3C74A 4B6SA 1AVTA 2HJRA 2JBHA 2OE2A 1SPBS 4AZVA 3DF7A 5C3MA 3THXB 2VK1A 1U0BB 1JKJA 2J07A 3DMTA 1K0FA 1CUYA 3ROXA 1R6UA 3UC5A 4DCVA 4UFNA 4C30A 4YCMA 1DLJA 2QUJA 3G9UA 4E5UA 5L6LB 1EXDA 1ODKA 5J4LA 2J67A 4CIBA 3Q44A 3QPDA 5J4VA 4E2FA 2W8BA 5DI9A 2WJAA 3P2YA 5IC5A 3SSMA 1SVOA 3K73O 2VO1A 4IJWA 1MO3A 3DUWA 5AXAA 4O8CA 2X0RA 1ZVMA 3ZQ6A 3ZV3A 4CEIB 5DHQA 3AIOA 1FFWA 3WLKX 4B84A 3AB8A 4K9OA 6REQB 1H69A 4PNPA 4D02A 4U1RA 3EY9A 3IQFA 2ICAA 3TSYA 2OHFA 5A6VA 4LOJA 1NASA 4DLXA 1YMVA 1YR1A 3TUJC 2VF2A 4TV9A 1A5ZA 3UPDA 4NBTA 1KFCB 4TZ6A 4L4XA 1JWAB 4JIMA 4W5JA 4G24A 3WGOA 4CF5A 1KKLA 1I3CA 2DWQA 3NNNA 1EE2A 1RM3A 3MPUA 4XD7D 1P8JA 4PX2A 1UDXA 1EXWA 3VYTB 3FDIA 1GEEA 1RHJA 2BZ0A 3IPRA 3L6BA 4X94A 9LDBA 1VLJA 4PYIA 4W6QA 3WK6A 4AQ7A 4HDAA 3IA7A 4JOSA 4Q9AA 2PFGA 2MT9A 3LYHA 1SVUA 1UAYA 4HRYA 3BIXA 5DGIA 2QENA 4MWSA 5J4YA 1IK4A 5A3RA 4DNQA 1T9CA 1EFUA 3MRVA 1AK2A 1OTHA 3OQHA 1NBIA 5L3ZA 3VSAA 3OETA 2ERXA 1GQQA 4XR4A 3GRKA 4LRWA 5FR2A 1ZINA 5ESRA 2WJIA 5DXAA 3ZZ0A 4DG9A 5KTRA 3N70A 2X0KA 3I2IA 1C2YA 4DV2B 2POCA 1SUWA 2Z0MA 1G41A 2CUZA 1RJWA 2Q1YA 3O3CA 4NQRA 5L40A 2R7LA 1DC8A 2VEOA 1PZGA 2PVSA 3C3PA 4KLZA 1Y7TA 5EJGA 2QA5A 4M3NA 4TRJA 4A15A 4BMPB 1FDRA 3VYWA 4ZI3A 2QD3A 4GPTA 2ID7A 1FTSA 1ZG3A 4K7JA 1K7FB 3INGA 2VDKB 3D54D 4NNPA 1NRIA 4Q9KA 1QP7A 2GN4A 1UEIA 4XIIA 5GZ3A 1FXWA 1IC6A 2HJ9A 5IK2D 4LI3X 2P2ZA 2A4MA 3EGOA 2C77A 3O9ZA 1BX3A 1GG8A 4PAQA 3KK0A 1DTSA 3T9CA 1NV9A 3E82A 4X00A 5KTMA 4E5SA 3IR5A 1UJMA 2P6NA 5LCXA 1UIRA 4Y9RA 4JV5B 4LXYA 1TPZA 9ATCA 2VPQA 4F4JA 3RRYA 4E5NA 4CF4A 2VJLA 1CF4A 1M76A 1E2HA 5EVCA 4WKBA 1K9SA 4R5HA 3PI7A 3D3QA 4WNIA 5K8JB 2BM1A 3H7IA 3K2IA 3TQOA 5HOQA 4G0PA 5IS2A 1EWYA 2RIPA 1NE2A 2OAQ1 2AGVA 4S2EA 3NANA 4IY1A 4BRUA 3F73A 4JC8A 3JRXA 4K9LA 3O3NB 2QVWA 4QDUA 1E32A 1I4WA 4Y0AA 3T6KA 2D0DA 3QFCA 5GP1A 1K97A 2NVUA 4NPHA 4X8OA 1IU9A 1P9NA 1TZ2A 2FB9A 3Q9UA 4G1FA 2E1RA 4P82A 3SF0A 3PE3A 4KI7A 3FB1A 4F8JA 5JV5A 4WE3A 2B37A 1TRKA 2JGNA 3G6WA 5A9TA 3BMQB 1WMFA 5LA6B 4G4JA 2WQ6A 4BWFB 2R97A 4KBFA 2I6TA 2QX7A 2F8SA 1R1DA 4LPSA 4CUJA 2AOTB 5D1NA 4FZ3A 4ITUA 4OHWA 3W8FA 4S04A 1MC4A 4XMWA 1QWSA 1SG9A 2FJUA 2OZKA 5EE9A 2GMWA 5ICCA 1A4UA 4AM8A 1X1DA 3O4RA 1XZEA 5DK4A 1PNRA 4ZRDA 3WMGA 1EUCB 4OBXA 3KBBA 1U5BB 2A7XA 3N2IA 3H2SA 4OI0A 2YL2A 2WDPA 1KEUA 1RYHA 3GXBA 4NAUA 1ZUIA 3ZXUB 4ZQGA 2IHKA 5SY4A 2POQX 5LDGA 5L3SB 4W5NA 1JTVA 2Z57A 4XB1A 2P2CA 3UCQA 4BO6A 5ANRB 4BWYA 3WL6A 3IUPA 3B20A 4OXRA 1OC2A 4YLEA 1C0PA 1FJ2A 3LW8A 5G02A 5HGXA 2ZWOA 5AKKA 1OZGA 2WU1A 5LOVA 1E3SA 1XNRB 4RD6A 3OD5A 3KFLA 4B82A 1ACMA 2SHKA 5EZYF 4UU8A 3GUVA 3AFMA 4D41A 2ZSIA 3WIOA 1BXGA 3N2GA 1H5UA 4DGQA 4G0VA 2JIMA 3GA5A 1UBOS 5HIIA 2Q28A 3AF0A 4QPNA 1XB2A 3A27A 3IQDB 3NYQA 5YASA 2CL6X 4CLHA 4C1NA 5EQJB 1YZQA 1YRWA 5H02A 3CW8X 2BMJA 2H5EA 1VL5A 2QUZA 2GKGA 4KACA 1P2DA 2DKOA 4WZAE 2YJGA 5D7BA 1U9JA 1PK9A 2JFQA 5DGHA 2O2JA 3OE5A 2UAGA 4D7AA 5D7NA 1KQOA 4LXGA 2XQ0A 1XRSB 4G3XA 4V2UA 3FF1A 4OFBA 3A36A 3ZWWA 4C08A 4DLYA 4MUNA 4EB8A 4GXNA 2BN4A 1M83A 2DY1A 3EHDA 4YPVA 4BECA 1JEYA 5K3SA 1MN6A 4M7OA 1XCLA 2MMCA 5JCPA 1EHIA 4BFZA 3G5TA 5KYYA 2RK4A 3UMMA 4MNTA 2ZBVA 1B1AA 3RWOA 2C31A 5JS1A 5KWSA 1THZA 4LOIA 1VZ2A 3U62A 4NCNA 2DCUA 1DC7A 1G21B 3NYWA 4HFMA 4L2IB 4QHSA 3AVTA 4XN5A 1FU4A 1XJ5A 2B0JA 2DM6A 1I7QB 3AM1A 3SYKA 2RI0A 3FNHA 5CFOA 3IEMA 3G9XA 3EY4A 2NW6A 5DMXA 4NOMA 3HCFA 3F8SA 4BFUA 3FTDA 4AJ2A 1C14A 2JFHA 1LV8A 1AV6A 2QP3A 1HA3A 2AOUB 3PI6A 5ER6A 2PL1A 4FYMA 2Y77A 4LDZA 2CK3A 2W93A 1XDWA 4IJKA 4JP1A 1PJLA 3GCZA 4K6GA 4IDHA 2HA5A 3JQ7A 2MHCA 5DHUA 4LKRA 2WFAA 1L7MA 2DY0A 3O7WA 5GGXA 4MVWA 2BH2A 2CDCA 5D1HA 1ECCA 1RXIA 4P5PA 3LHFA 3MM4A 2O8EA 2QTFA 4JQZA 1G8YA 4CM9D 4ESHA 4OSOA 1MDFA 2J48A 1ZONA 2IUYA 1U3TA 2CMDA 1XTZA 1JLLA 1D1QA 1ZN9A 1QVZA 2J4DA 1Z5VA 1PQWA 2VHWA 2WKPA 3E5HA 1A7JA 3F9CA 3PDUA 1AMOA 3L8DA 3HUUA 1O54A 4L8WB 1ONNA 2Q5HA 1OTYA 3MRXA 3C5CA 2C7PA 5K8LA 3SQOA 3VR5A 1NP7A 2XSZD 3RREA 1V1MA 3E4DA 3VU0A 2CL0X 4TKLA 1PT6A 3FKQA 5CU7A 5HBRA 1YH3A 2WTEA 3Q10A 3HCNA 1FFXA 1E79A 1CUUA 1MT0A 4RY9A 3GEIA 1TTTA 1OF1A 4E07A 2WMOB 3OLXA 1HR0B 1D2CA 3N53A 1NWCA 5DKFA 1F06A 2HIGA 4PW4A 2FVYA 1EG2A 1OXUA 1HE4A 1WHSB 2VJOA 4OM7A 4WNAB 5TVGA 2XVMA 4BO1A 2VAPA 1RQNA 4RESA 5LU9A 1GU1A 1KR2A 1N3YA 3DZCA 1PQYA 4NHEA 4RO0A 1GRCA 4MUKA 5LJIA 4J7CA 3K20A 4EUFA 4EVIA 3I04A 1K4YA 3CUWA 3EBGA 3CH4B 3LOQA 3A0UA 2ZVPX 3AFNA 4DMMA 1GLNA 2ZJ2A 1JAIA 2PA0A 4LJKA 2BHSA 4HEA6 4NJMB 4X61A 4EGJA 2JFXA 4CF7A 1UDRA 1CU1A 2VSQA 5HR5A 4IQ8A 4AN4A 4FYIA 2C7OA 5CW2A 2PJZA 5BRNA 2Q4TA 1D2MA 1UJBA 1FVXA 3A4YA 2XD9A 3K9WA 3BTSA 3TBFA 4QU8A 2I4OA 2BEVA 1YCDA 4HT3B 2PQMA 4LE1A 4RC9A 1J8QA 1QZUA 1FFSA 1FJHA 3MC1A 5L53A 1V8DA 2I33A 5KPJA 1W36D 2VXOA 4S1PA 1ZA2A 4Q7EA 1P3DA 2IPMA 2FX2A 3R5FA 5H1YA 1K68A 3QPVA 4X20B 3TD9A 4GBJA 2R4UA 4RTNA 1TKRA 2AF4C 4PYKA 1QFMA 3WDSA 2BM0A 1IHUA 5EVJA 4MDEA 4XMTA 2IXAA 1HO3A 1IXSB 1TT5A 2PT6A 3GLHA 1GZ3A 2YBDA 4RHUA 2DPYA 3DDUA 2CCJA 3I6BA 4M1EA 1LPPA 4KJZA 2Z8XA 4Y6RA 3CEJA 4DDVA 2B4KA 2F3UA 3AJ9A 4XO4A 1R0RE 1SB9A 4KQWA 2DERA 3AJDA 3JT1A 1CZNA 2CDNA 3R24A 4PNZA 3LO5A 2ZIGA 4KX5A 1XZHA 2G76A 1RJGA 1NNUA 4BB0A 2OECA 1Z0SA 4MDHA 5AJXA 1XZMA 1P9WA 1ICIA 1LSSA 5E4TA 1OBCA 2X1VA 3WYGA 3S70A 4GVPA 1XD8A 2DFTA 4Z8YA 3VZPA 4LYHA 4WDQA 3RV4A 5KDDA 1JNYA 5IULC 3A4LA 3TXYA 3ZKWA 5HCIA 3NJRA 3FROA 5FUMA 4FNAA 1U0SY 1Q3KA 3MBKA 3ZWVA 5CAEB 4U6QA 5AVVA 4UM7A 3OLZA 2A8YA 2CWDA 2E4ZA 1RADA 2JCGA 2ZR0A 1V45E 1RI1A 1M2OA 2A57A 2BKLA 3I30X 1E4VA 4BJ3A 4OATA 2XXAB 3U44A 4IEEA 3DAPA 3OPMA 4RA9A 2DWCA 2IWRA 2ZXGA 5F2EA 5JWHA 1U3VA 3F8TA 2GHRA 2AFHB 2IF2A 4H31A 3S7ZA 2XDQA 1O5TA 1G5QA 4O08A 2YHIA 3RO7A 3P19A 3R5KA 5J2UA 5IKMA 1G6KA 3J80A 1V8OA 3VZRA