1R0LA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
378
Chain Sequence
QPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
total genus 123
structure length 378
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0lA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0lA01
3MTJA 4TRRA 1WDMA 1P0CA 3GMSA 4R4JA 5DP2A 4GL4A 1FXSA 2D5CA 3BMCA 3GHYA 2GF2A 2FR1A 3Q9NA 4TKLA 3D3WB 2VHXA 1MV8A 3EVNA 3KETA 1HSOA 1P1HA 1EUZA 2CDCA 2Q46A 1AHIA 2NTVA 2DKNA 1ZH8A 5ENVA 2XPCA 3QW2A 3PWKA 2DUUA 3AY3A 1F12A 2X5OA 4EUEA 4CM3A 1E3EA 2HDHA 3IMFA 3OETA 1PGQA 3PZRA 4Z3KA 1F06A 3DEYX 4BMSA 2PZMA 1E0DA 1SB8A 4CQMD 4KWIA 3DZKA 2P68A 4I5EA 4NK5A 5FFFA 1SC6A 4G65A 4R9SA 3VC7A 4ESOA 2VZ0A 3H8VA 1ONPA 3WGIA 2B69A 3IAHA 2X9GA 3ZU2A 4LRTB 3ICPA 3CZEA 5CDYA 1ZW1A 3AFMA 3O38A 3QQPA 3KEOA 1V6AA 2UDPA 2EF1A 2B35A 3TRIA 4DLBA 3JSAA 5U4QA 3WGTA 5CDUA 3JQCA 3I6QA 4PLFA 3TFQA 1HDZA 2GR9A 1QV6A 4FLQA 4DQXA 1PJCA 3OICA 3M6IA 1DLJA 1DIBA 4WLOA 3RQSA 1Q7BA 1N1EA 3E8XA 4TVBA 3BHMA 3UVEA 5A3JA 1XWFA 1UUFA 3GNQA 1KEWA 2CDAA 4BL5A 4E5YA 2ZIZA 4II2A 4CMKA 3KYCB 4ZJUA 4YAJA 5TNXA 3PLRA 4LVUA 1LEHA 1T26A 5F1OA 5G2OA 1XU9A 2HU2A 3E48A 3WGOA 1KEVA 4IJKA 5ILGA 5HS4A 3IIEA 1CERA 1X15A 4E13A 4H7PA 3H9GA 3GZNB 5EPOA 1I2CA 3FWZA 2I67A 3OHSX 1G1AA 4NH4A 2CMDA 5MDHA 2EP5A 4IUYA 1U8XX 2E48A 3WNVA 5IF3A 3K8ZA 1CJCA 3AI1A 4BNIA 1TT7A 4GGOA 1KY4A 1NWHA 2Y68A 3ZNPA 7MDHA 3F4BA 3WQRA 3FNFA 3VZSA 5FF9A 1EK5A 1Z82A 1L7EA 3GDOA 1TXGA 4CMIB 3D64A 1LLQA 3DONA 4OKIA 3LF1A 4GH5A 4M1QA 4FOSA 4WCFA 1ISIA 3P19A 2YDYA 5EINA 5L53A 2HCTA 5MGBA 1B14A 1HSZA 1EDZA 1MW2A 2VWHA 3RKRA 1YJ8A 2GNAA 1YE3A 3MOGA 3DQPA 3U0BA 4D79A 3ZNOA 5K9ZA 2PKRA 3PHHA 1B2LA 2OUIA 3KYDB 1B26A 4K1LA 2B5WA 2YJZA 1Z6ZA 4RL6A 3TZHA 5KKAA 5F1PA 5AYVA 2WEKA 3F6YA 1ZMTA 3VDRA 3WYBA 1DBVO 5HBRA 3ZNNA 3NDIA 4A5OA 3LZ6A 3NX4A 3FN4A 2OGUA 2JD2A 3ANLA 1NASA 1A7KA 1AN9A 2OBNA 5KJ1A 5KOIA 1IY8A 4O1MA 1YGYA 4C7JA 3TJRA 4ZA2A 4YRDA 2I66A 2X0IA 1TEHA 3Q3CA 1XR3A 5GZ3A 2Y1EA 4NFHA 3PIIA 1XLTA 4YT5A 4OO3A 5F21A 5DP1A 4DA9A 1VE9A 4NIMA 1BW9A 3QWBA 3ROPA 4IDBA 3OFSA 4LISA 3BXXA 3AU8A 2Z1MA 5T8KC 4ZHSA 2O50A 3HADA 2MAPA 2HMSA 4XB1A 3EW7A 5TT0A 4DTIA 2X4GA 2WD7B 4INAA 5CPFA 5TIIA 4IPTA 4UUNA 1H6CA 3PJDA 1R37A 2PH3A 4B79A 1VKNA 2JD0A 3DB2A 2XXBA 5KIAA 2OO5A 2GZ2A 3PP8A 1A7AA 1NAIA 4PLTA 4A10A 2DBRA 1BXZA 1ISMA 3EYWA 3C8MA 3TOXA 1E6UA 1E7MA 4P4NA 1ZJYA 2TMDA 1LRLA 1UDBA 3DMTC 5FYDA 3PDUA 3PIDA 5A9TA 4AJ1A 3IJPA 3GH3A 3H7AA 3IC5A 4J91A 4D0RA 2AG8A 2P9GA 4IIVA 2JJYA 4I8XA 1N7GA 3ZV3A 4R3WA 2Y1GA 1QLHA 1KETA 1ZK2A 3C24A 5L3ZA 5KJCA 1PR3A 5B37A 4CLXA 2O3RA 4D3FA 2EGGA 3LYLA 2P4HX 1ISFA 4OOEA 3TZKA 1T4BA 1N92A 1MFPA 1PEDA 3ZWOA 1M76A 1DOHA 1HE2A 3KV3O 4RF5A 4CLEA 1FK8A 3AI3A 3K2EA 4AJPA 4CM9D 4F45A 2VOEA 2VOJA 3VTZA 1HWYA 1SNYA 4FDAA 4AJEA 1PGJA 4RPJA 3GNSA 5JAZA 3FD8A 4CM5A 2C82A 1LDGA 4Y6PA 3DO5A 3ZWBA 4DLAA 3GMDA 2GZ1A 1U3UA 4G5HA 4NI5A 1F8FA 4D46A 2X7HA 3PWSA 2CY0A 2AXQA 1Z74A 3DTYA 1NVGA 3K92A 1PSDA 3SEFA 4W7IA 4R41A 3NTRA 3RCBA 1GYQA 4YAGA 2C7VA 1U7HA 3IKTA 1HETA 4O59O 4IGEA 5JLAA 3O8QA 5KTKA 4Q39A 1XELA 2W2LA 1LSJA 4MDHA 4YEDA 2IE0A 3CTMA 1UZLA 1YOVB 5I9MA 3JYNA 1X7DA 3NUGA 4NQWA 1A5ZA 1E1LA 3S55A 4EJ0A 3RUAA 3OIGA 1ZEJA 3WLEA 1HZJA 2B4RO 3NT5A 1H6AA 4A0SA 1PL7A 1P44A 4GGPA 3KLPX 4WE3A 2IODA 4BB5A 4BNLA 4RPLA 2NNLD 1Q1NA 4F6LA 3AY6A 2BI8A 4BMVA 1YQGA 4WLFA 3V1TC 3GA0A 3DOJA 4DGSA 1GFSA 3KB6A 3MJTA 2CZCA 5DDIP 1MX3A 1O6ZA 2PA3A 3DXFA 3BMNA 3RC2A 2OHXA 2E37A 2NU6A 4R51A 1XSEA 1NNUA 1ULUA 1XQ6A 2ZCUA 1PQWA 3DHNA 4RF3A 3VKVA 4FR5A 3PQEA 4RVHA 2EJVA 3VPSA 2Q2QA 5KVVA 4MKXA 4KQWA 4BNGA 2EG9A 1HLPA 4J9UE 4OXKA 1JWBB 3OJLA 3V2HA 1D7OA 3PHGA 3JQ7B 3E9MA 4PLHA 1H94A 1E5LA 3C7DB 5C5IA 3UKOA 3M1LA 1EFKA 3ETGA 3GVCA 3NAQA 3EMKA 3D3WA 1ISJA 5AXCA 4FD3A 4WGGA 4RQUA 3MCVA 2DVMA 5TQVA 1QYVA 2JAHA 4CMEC 4N5NA 4B4VA 2J3HA 4CQMA 1SB9A 2Q3EA 4L73A 4CLDA 4BNWA 2JCXA 4U6QA 2W98A 4TVOA 2G17A 3OIDA 3WSVA 4WLVA 1E92A 3I23A 3DBHA 3OMLA 1TVEA 3L77A 1SOWA 2WE7A 1A71A 4UEKA 4DUPA 3SLGA 1UXIA 1MC4A 3NYWA 2ILTA 4UUMA 4I5GA 5JC1A 4MKRA 2HJSA 4OQZA 2GASA 3GFBA 1YQDA 3M1AA 1NQAO 1C0KA 3MJVA 1GUZA 2BD0A 3ASUA 1YBMA 3WWYA 3RSHA 5KVSA 3G3EA 5A02A 4TWRA 3RUDA 1GEEA 3ZWNA 3PFWO 3KVOA 4DMMA 1VLLA 1GQYA 2VNAA 1N9GB 2NLOA 4H15A 5G4KB 4W4TA 3W8EA 4TMFA 3GF4A 3WB9A 3E03A 4CMJA 2VQ3A 2YFQA 2ZYDA 4NQZA 4EUHA 3A06A 1Q7CA 4Z9YA 5I9NA 1SEPA 4JN6B 1DRVA 2PLAA 3QP9A 3ICCA 1R4MB 2YYYA 4PG8A 3NTQA 3WJAA 3ITDA 3ZWYA 3JQBC 4R1UA 1G6KA 2I9PA 4IMPA 2RH4A 4YJDA 3FNHA 1S7CA 1PTJA 4FLOA 4PCVA 1YL6A 3L6EA 1HZZA 4NHEA 1DFHA 4PRKA 1LU9A 1B16A 4QXMA 3VOSA 4A7PA 4OHUA 5IZCA 3KYBA 5F5LA 3PK0A 1N7HA 4N7RA 2YHIB 3RJ9A 1DAOA 4FOOA 3MOIA 2C0CA 2NVWA 3NRCA 1EQUA 3GZNA 3GZ4A 1C1DB 5ES3A 2JFFA 3TL3A 3VH1A 3T0YA 4TRMA 1HDCA 2AQIA 3NDRA 2Z5LA 3TDKA 2IZ0A 1ZJZA 2PKQO 2UYYA 2W4QA 3HFGA 8ADHA 2J6IA 3A1NA 3SVTA 4NFYA 4BVAA 2AW5A 4XRGA 5U9CA 2B4TO 2PGLA 3F47A 2A92A 3WG9A 2Y1FA 4E30A 1P1FA 2GPTA 1MXHA 1XQ1A 4ND1A 2F1KA 4LSMA 4CMIA 1DPGA 4NBVA 4TZTA 3RFTA 4ID9A 4RGBA 4GWGA 4J90A 5JAQA 2D1YA 2POQX 2ZCVA 4JNKA 1N2SA 3TOZA 1WZIA 4AFNA 2X8LA 4JX8A 1RYDA 1P74A 1O5IA 4L75A 4QFCA 1KVTA 3LC2O 1RM3A 3GDGA 3KYDA 2DC1A 3QVOA 2C2XA 4A03A 1ZZEA 4KDEA 4CXFA 2J3JA 3E82A 2E4AA 4Q9NA 3L4BA 3RUEA 3ZN2A 4E0BA 3I1JA 5ICMA 3DZGA 4BOYA 1X14A 1PWZA 4BNXA 1GADO 4KZPA 4JIGA 5G0WA 1ADCA 1DIAA 1BG6A 4BKQA 3K31A 1VL6A 4M86A 4E5KA 5A06A 4WEQA 1PJQA 3RUIA 3WTBA 5FWNA 4MIOA 1YXMA 1NQTA 2VWQA 4I9NA 1QLJA 3CIFA 3W1VA 1G5AA 4AJ2A 1VJ1A 4LUPA 3C3XA 2O4UX 3IOYA 4E5NA 3JYPA 2P2SA 1N5DA 1RP3A 1E6WA 2UVDA 2Z95A 3D5QA 4GX2A 2AA3A 2DPGA 4XGKA 1IZ9A 1GD1O 1R12A 1UDCA 4J43A 2GCGA 3DBRA 2WD7A 2P5YA 4W82A 4YA6A 2GN6A 1HE3A 3PQDA 3W4IA 3WIDA 1NPTO 1UR5A 3RBXA 5JAIA 3OQ1A 1TI7A 3KO8A 4HKTA 1B7GO 5JBIA 1ZCJA 2E49A 3AU9A 3R6DA 2FY8A 2Q45A 3GQVA 4PLPA 3O03A 3K2BA 3ZZNA 1K89A 3PYXA 3B6ZA 3GVIA 4BB6A 4CM9A 1OR7A 3NTOA 1PWXA 4PZCA 1Q0HA 5IZ4A 1NQ5A 1X1TA 4O5OA 3UCXA 1V35A 2PD3A 4L74A 2Q1WA 3UICA 2IZ1A 4XIJA 4HBGA 2AQ8A 3BTVA 1LQTA 2Y1OA 5JMPA 4Q3BA 1JU9A 4H16A 1WPQA 1H6BA 4XR9A 3HB4X 3WGGA 3GGPA 5DNAA 3WS7A 3TPCA 4CQLB 1GUFA 5JCJD 5TC4A 1KY5A 5L9AA 1E3WB 4J0EA 4R3NA 2OFPA 2C59A 4J2HA 2HK9A 4I9HA 3CMMA 4NJMB 2VCYA 4U0KA 3R3SA 4ZQBA 2PZJA 1R0LA 1QKIA 2EKQA 1OI7A 3H9JA 4UVEA 1JG9A 1YQXA 1KBZA 2DU8A 2H9IA 3GNTA 2GUGA 4D43A 4ZU3A 1JN0A 1OMOA 2FZEA 5THKA 5IXYA 3ZWXA 4J1NA 3VZPA 1EK6A 1RYEA 2AQKA 4N18A 5LC1A 3ZW8A 5JDCA 4PLGA 4ZN6A 5L7YA 3W8FA 2Q1UA 3HDJA 5KJ6A 1IL0A 3E5RA 2RHCA 2RHRA 3PHLA 3BMQB 1G0OA 1GV1A 3ZU4A 4XWYA 4AJJA 2W2KA 2RIRA 2Y0DA 3T7EA 3RU9A 3BIOA 1U4OA 5COQA 4BO3A 3C7AA 4X54A 1Q2XA 1XCBA 1GCUA 3E9NA 5IJZA 1ZO8A 1NHGA 9LDTA 2B4QA 3MTGA 4FFLA 3DAGA 1P1KA 2NVUA 2O3QA 2BI7A 4Y9DA 1EDOA 3DBLA 1SEVA 4IXWA 4J0FA 4B7XA 3QSGA 3TWOA 4KTTE 4RVSA 4DPLA 3ULKA 2ZJ1A 4XQCA 2W8ZA 4F46A 1LJ8A 1Y9EA 3JQ7A 4KP7A 3KSZO 3QWFA 1OC4A 4YQYA 5TSDA 3Q2IA 5L51A 1DRWA 1JWAB 1O8CA 3E18A 1E3JA 3FWNA 3DZHA 2FSVA 3QVXA 3H5RA 2Q49A 1HE4A 1I01A 5BNIA 1SC5A 3ENNA 1ENPA 2O3UA 4ND5A 1V0JA 1GEGA 4ZRMA 4BO8A 4XIYA 2HAEA 2B0JA 4M49A 4XYMA 3DBVO 1I8TA 4J1QA 5GMOA 2VYVD 3T7CA 4FS3A 3AUUA 5JDIA 3V5NA 3S2EA 3S2IA 4BQPA 4IJVA 4WLUA 2PH5A 4IJUA 4W7HA 3UGKA 4TSKA 2G1UA 2ZTVA 4FN4A 5EMHA 3U49A 4QECA 5FI5A 5JSFA 1XEAA 4FLRA 2H1SA 2CDBA 3V8BA 4L0QA 3FSRA 4BO7A 4R1SA 4MVJG 1HYEA 1ZXLA 3G49A 3GRPA 5DN9A 5DT9A 2CF6A 3ENKA 3PXXA 2JD1A 3HZZA 3LF2A 1I3LA 4LMRA 4L9RA 1Y81A 4YB8A 4NR0A 3JQDA 1E7QA 1MG5A 2B36A 3GVHA 1O95A 2RBEA 4KQXA 1Y8RA 2O3SA 2WYVA 5G4KA 2NACA 3BMOA 2CVZA 3FNGA 4MVJH 1LRJA 4P4GA 8LDHA 3H6KA 4OAQA 5EN4A 1I24A 1Y6JA 3M2PA 2X5JO 2QRLA 1R4MA 4KMSA 5A9SB 4G81A 4L4RA 4LW8A 3VVCA 4WNIA 4ALKA 4DBZA 4NU6A 2Q1SA 1YB4A 3HG7A 4B7CA 1YL5A 4YYZA 1GR0A 4PFJA 4MP3A 3OJ0A 4QQRA 1PQPA 1JW9B 4RZIA 4P4LA 4YBZA 4ZD6A 4PZDA 3RKUA 3AJRA 2YHUA 3D4PA 2J8ZA 4RDIA 4IDAA 3ZH2A 2Y66A 4WCDA 4CMCA 1C1DA 3OEYA 4WK6A 3ZGYA 1BSVA 1E7YA 1QYCA 1ZSYA 5JS6A 1UAGA 4CLOB 4WOKA 2CNBA 1BVUA 1B15A 3F5QA 1G0NA 2P5UA 4GWKA 4XYEA 3PLNA 4MVJI 2VUSA 3LLSA 3KHUA 4I1IA 4TRNA 1AGNA 2BELA 3JQ9C 5H82A 3GN1A 4MO2A 3RWBA 1CEQA 1KIFA 3JQ6A 1X7GA 1C14A 3JQ9A 2FMUA 4Q3DA 1PZGA 2YFHA 3ONFA 3MJSA 4MKZA 2CVQA 5B4VA 1P9LA 5J23A 3WMXA 2AQHA 4XA8A 2ZK7A 4XR4A 4OL9A 4JP3A 4E3ZA 4EEXA 2IRWA 3GPIA 4WOJA 3R0IA 1BXGB 2Y0EA 4LVCA 3I52A 1M6HA 3TSCA 4BUCA 3MJ4A 2RH8A 4DPMA 5JYEA 3WOHA 3ONDA 4J16A 5G0TA 3HQ4O 2YV1A 1QV7A 3PJGA 4PG7A 3S1LA 3I83A 3I9NA 1HKUA 1YB5A 3T4XA 2C54A 5L40A 2C7GA 4AJLA 3Q1LA 3RBVA 1H2HA 1IB6A 4UULA 2HK7A 2YW9A 3LT1A 3E5MA 5JCXA 1R6DA 4CM1A 3RC9A 1ISHA 1O89A 3DHEA 1ZIDA 4AYSA 2YY7A 3DMYA 3GVXA 3SJUA 4XEHA 1UDAA 2JFGA 4RJTA 4ZICA 1VJTA 3WFIA 1NQOA 2BFPA 3GC6A 2IEDA 1V3TA 1JTVA 1CDOA 1ADGA 3H9EO 3GOHA 3GG9A 4DRYA 2O48X 1T2FA 4MVJD 4IY1A 4CV2A 1LA2A 3OJOA 3VAZA 4DMLA 3W8DA 3ADPA 5C7OO 3CZGA 2BGMA 3KXDA 1E5QA 1OBFO 4MVJM 1ZFNA 1UZMA 3RAJA 4UVHA 3WJ7A 1JKJA 2NUAA 3SBOA 4E31A 1UP4A 3X2FA 1ADFA 2NSDA 2V7PA 2WJPA 1UH5A 4CM8B 1NR1A 4CM4A 1R0KA 3GGOA 4UVDA 4R54A 5AXDA 4ZQGA 1GZ6A 3WDSA 4RORA 2GDZA 5JCJA 4GKBA 1I10A 3PFFA 1DXYA 1V8BA 3F5SA 4Z0HO 3JQAA 4EEZA 4YT8A 1BDBA 2BRUA 5CEEA 1PL6A 3G1TA 3V1YA 1EFLA 2CD9A 5KCZA 1R4NB 2I99A 1ZK4A 3ZDFA 1E1NA 1FMCA 3NGXA 5T8KA 1TT5A 4D41A 5L4NA 2Q2VA 4CQLA 5LDHA 3FBGA 4ALLA 4E5PA 1JVBA 5JW6A 4IZIA 1PS8A 1I3KA 2XF8A 3CZMA 3LT0A 3ZWAA 1YONA 1E3IA 3TNLA 3L9XA 2BKAA 1E3WA 3K9QO 4IDDA 3CEAA 2J5QA 4B4WA 2EJWA 2HMWA 3ZU3A 2X58A 4Q3NA 4NJMA 4PGFA 3F46A 1I2ZA 3FTNA 3JQGA 4AICA 3LC7O 4JXKA 4BNZA 5DF1A 2YUTA 3VPXA 3DMTA 5T64A 3C1OA 1QRRA 4IZHA 4J7XA 4HFNA 1PS0A 4RF2A 4DBVO 5C7IO 1X1EA 2H5LA 3FTPA 1OC2A 3ON5A 3WGHA 2PR2A 3IL2A 1HE5A 2GLXA 3KZVA 5BSHA 4EITA 4PVCA 4DXHA 4BMNA 4YAKA 3ROQA 3LU1A 4YJFA 4R68A 4RCVA 4I5DA 1JLLA 1UJMA 1ID1A 2GO1A 2VWGA 2P9CA 1P31A 3CUKA 3MJEA 4FCCA 2UV8A 4B8WA 3CSDA 4JLWA 1B8VA 4MJLA 2C29D 1RWBA 1P45A 4J4HA 1P1IA 4J7UA 5A1TA 2VZ9A 1UP7A 4WASA 3G1UA 3WLFA 3EZYA 3SC4A 5BQFA 2HUNA 2GD1O 2QZ9A 2XXJA 5I7EA 2R2GA 5K0ZA 3U5TA 2ZJ0A 4NZ9A 1UP6A 1Y8QB 3TQHA 4DVJA 1Y5MA 4JK3A 1N8KA 4Z6KA 3ZWCA 4XDYA 1WDLA 3JD2A 3CH6A 3ADOA 4IJWA 4XYGA 4KTVE 2VYVA 1M6WA 1IYZA 1PGOA 4FPXA 5CP8A 5IAAA 1DEHA 2IDZA 2E82A 3R3JA 5DBGA 1Q0LA 2JAPA 3UOGA 3CPSA 3VPHA 1EVYA 1J49A 4HXYA 4HFRA 2DFVA 4RV9A 4D0SA 4DIOA 3WICA 4IDCA 3LC1O 1E1KA 4CV3A 2EIHA 3A14A 2BFOA 2VZ8A 2GSDA 4FFNA 1ULSA 4CMGA 2FP4A 1P3DA 2QYTA 4K26A 1DC3A 5EESA 4CR7A 2ZQZA 1T4DA 3WNQA 3ZHXA 2FOIA 1IHYA 2D4AA 4BO1A 3BTOA 4A26A 4FC6A 1LDBA 4FW8A 4NFSA 4R5MA 4BNKA 5IG2A 1Z7BA 1YBVA 4B3IA 2GN9A 4BKOA 5IN5A 3UF0A 3IUSA 4ZQFA 4FFOA 3BHIA 5TJHA 5FEUA 2QQ5A 3GFGA 2AMFA 3FCOA 2FRDA 2O4CA 2Y0CA 4N5LA 4YQZA 4CODB 4NPCA 4EJMA 1SO8A 4IINA 2FPPA 3PWZA 5I8WA 1NM5A 2HO5A 3HHPA 1EE9A 3F1KA 3U4CA 3HSKA 3V2UA 4CMEA 3OP4A 2D5AA 5A9SA 2A35A 4TROA 4WUVA 4AG3A 1Z73A 4DWVA 4RLSA 2VUUA 3UEQA 1EZ4A 1GUYA 1T24A 1VC2A 3DHYA 1LDYA 4E6PA 2NTNA 3QA9A 1UXJA 5CAEA 3UCEA 4U6SA 1B8PA 1GQQA 3U9LA 1XA0A 1ZS2A 1CQJA 1LDNA 3E9QA 3PVZA 4Q3EA 3ZV4A 4E5MA 5IDWA 3H3FA 1HT0A 4TRJA 4BNJA 2D0IA 4R69A 2WSBA 2X9VA 1RPNA 4BNNA 1F0YA 4UREA 1DO8A 3C1AA 3I9JA 4CPDA 3GN2A 3AWDA 1PX0A 1MVYA 2I5PO 4CLHA 1JGIA 4CLOA 4OXNA 4QFDA 4Z0PA 2RCYA 2Q50A 3ABIA 5IFLA 1U2DA 1YDWA 1LNQA 2YQ4A 4IQ0A 2OOSA 1UXGA 3D1LA 3CKYA 1UXHA 2DTEA 3OJFA 2AEFA 4E12A 1LSSA 1CETA 1H0KA 4ALIA 5BSGA 4UVGA 5AXAA 4GLOA 5F3RA 3JQBA 4HFMA 3G17A 3KYCA 4IBOA 4XJTA 1Z7EA 3EZLA 3EUWA 3JQFC 2AHRA 4WNCA 4Z3DA 2PGJA 1BXGA 3QHAA 3AW9A 3AM3A 4K6CA 4Y6RA 3PHJA 1IPEA 2C20A 4GSLA 3WR5A 4KUHA 3U4DA 1FDVA 2AE1A 3JV7A 2HKIA 1NR7A 5JO9A 4ZVVA 2WYWA 1P33A 4XQEA 2GN8A 2OL4A 1GYRA 3KEQA 3QVSA 1E77A 1RM4A 1U28A 1O0SA 3FPCA 3PYMA 3B1FA 5F1KA 4R01A 2D2IA 4MVJA 1AXEA 1XIVA 3GVPA 3ZHBA 3WWZA 2MAOA 2P91A 3D7LA 4D3DA 3RUHA 1DHRA 3S2GA 4UVIA 5H83A 1HDGO 4FFRA 2ZQYA 4PG4A 1EUCA 4YJGB 2JFHA 2BLLA 1BMDA 5KKCA 3I3OA 1PL8A 2EHDA 2X5KO 3ROKA 3DZIA 4DPKA 3FHLA 4JJFA 3IKVA 1WWKA 4EW6A 5IDYA 1J6UA 1MB4A 1M66A 1TB4A 1YS4A 2PZLA 1IZ0A 2EEZA 4I5FA 3P5SA 3ZV6A 4LCJA 2B37A 4PN3A 5A5EA 4CMBA 1PZHA 2CUKA 2Q4BA 4BNHA 3NGLA 5L4LA 3TZ6A 4PIVA 3LT4A 1ZXBA 2FPIA 4NMHA 2UUPA 4M54A 2O23A 2DLDA 1ZNQO 4ILKA 4NG5A 3TF5A 3AI2A 4CM8A 3CZKA 1D3AA 5TJ9A 1LSOA 3HDYA 1CIVA 4BO0A 1EUDA 1K2WA 3E1KA 4LSWA 4J1TA 4RPKA 5GZ6A 4P38A 3PTZA 5JAMA 3GUYA 3INGA 4RLHA 4CV0A 3CZRA 1H6DA 1R4NA 4MPDA 4RO0A 3D3EA 3OEWA 5DBFA 4QUKA 4D44A 1HXHA 2VHWA 1I32A 5A05A 1I30A 1LDMA 3MWEB 3FI9A 4FJ1A 4Y6SA 1T2EA 4CV1A 2V6GA 3UCQA 1XHLA 5CEFA 2QRJA 4AJHA 2ZATA 1SPXA 1BDMA 4F3YA 2A94A 4WCFB 1WAMA 1BRMA 1VSVA 2EWMA 2ZYGA 3VH2A 2PGDA 3GG2A 3FPLA 1GTMA 5G0VA 4CLRB 1YKFA 4BO2A 3UERA 1PJ3A 5TS3A 1XU7A 5DZSA 4DQVA 4XYLA 3N58A 1DC6A 3OA0A 4HUJA 1H2BA 1GY8A 5T67A 1Q0QA 3AUTA 4S1VA 2HJRA 2WE8A 3HB5X 5LCXA 1LTHR 1UXKA 2X86A 1KC1A 3NT2A 1OOEA 1HL3A 4HV4A 5I7FA 5HWSA 4J4TA 1RM0A 3AM5A 2NWQA 1D4FA 2PK3A 2DFDA 2UUOA 3C85A 4PLCA 1HF3A 2Y99A 1U8FO 3WIEA 3PEFA 4XYBA 2QHXA 4A73A 3JTMA 1TLTA 2XAAA 1WW8A 1SBYA 3JD1A 2JHGA 4ALJA 4K28A 1SAYA 3RJ5A 1GZ3A 2PD6A 4BKUA 1M67A 3B1JA 1WDKA 2EV9A 1T1RA 4BO4A 4FB5A 5CEJA 3QWHA 4BNFA 4B4UA 4DC0A 4GSKA 3BA1A 4XKJA 2HRZA 2LDXA 1EEHA 3I9LA 4LMPA 1QYWA 5L7TA 3HUDA 3COSA 4UAGA 4YWJA 2O7SA 2HQ1A 1O9BA 1W8DA 1ZBQA 4KWHA 4M87A 2WM3A 3CXRA 2C07A 1KEPA 3TN7A 4HFJA 2VWPA 1RKXA 3PJFA 1MFZA 1YOVA 5FI3A 1SCUA 4R5HA 3HJAA 1PJLA 2PTGA 2YZ7A 1ENYA 4EJ6A 1C3VA 1SOVA 2CSUA 1FDWA 3WTCA 1H93A 2J3KA 2QYSA 3EGOA 3GAFA 3AUAA 3DR3A 4DIBA 2WMDA 4CUKA 3NEPX 2O7QA 3PPIA 1EMDA 2QW8A 1ZVMA 2VUTA 2NVBA 2SCUA 1EQ2A 3DWFA 1JKFA 4FSHA 4IGFA 3GLQA 2BGLA 4WLNA 4XD2A 5I7VA 3V2GA 2ZTUA 1QSGA 4MIYA 3WX0A 4QT0A 4QO8A 2DUWA 3GUCA 3QV1A 4XGIA 1MC5A 4HWKA 1EVIA 2V6MA 1JVSA 2EP7A 1HDRA 1YL7A 2X0RA 3ASVA 4PLZA 1ZEMA 4XDZA 2EW8A 5HA5A 3Q9UA 3GGGA 2C5AA 2JKVA 1I0ZA 4BNUA 5JY6A 5G0UA 5AQ1A 2I76A 2NADA 1H9BA 3QIVA 1TA4A 2I3GA 2RAFA 1A27A 4BGIA 2NU7A 3PJEA 1FJHA 1P1JA 5KVCA 1ML3A 1NVTA 1NBOA 3DFZA 2R6JA 3RUCA 5I8ZA 3ZHZA 4EI2A 4ZGWA 3TFOA 4NNJA 4R1NA 1DJNA 3L0DA 2X1HA 3Q2KA 1ONNA 4YDRA 3AUSA 3R1IA 3O8QB 2HSDA 4E33A 1K0UA 5L7WA 3PGJA 5DOVA 5BSEA 4GX1A 4OGWA 1YJQA 4TKMA 4QTZA 4YT4A 5HRUA 2JCVA 3QE3A 1U4SA 2PNFA 3AY7A 3HE3A 4NK4A 1OAAA 3NV9A 5HM8A 1BHSA 2FWMX 3BTSA 1DC4A 3UFXA 5THQA 2VHVA 2DBVO 4BV9A 4QEDA 1JQBA 4NBTA 5IXSA 3IP1A 3KRTA 3O26A 5A04A 1SZJG 1QG6A 1PGPA 2Q2WA 4XJSA 4XQGA 3F9IA 5H81A 2AE2A 1BVRA 1NPYA 2W90A 4AL4A 2P9EA 4UEOA 4DC1A 1AE1A 4DL9A 1PZFA 4J2OA 1WZEA 4GKVA 1BGVA 1L1FA 4GVLA 1MXFA 3KTDA 1N9GA 5K6AC 1VSUA 5CDGA 5A03A 1ZUD1 4OOFA 1DIGA 1M2WA 4HNGA 5ER9A 5K6AA 4Z9XA 1GZ4A 3VDQA 4BGVA 2J5KA 4RQTA 2PD4A 3JQ8B 2VTEA 1VKOA 2OZPA 4JCOA 2I3AA 4OYRA 2NM0A 1T25A 2EW2A 2PFGA 1ENOA 3SXPA 3U4HA 5C7LO 5G0SA 4BKRA 4C7KA 2BH9A 2J5RA 2IYPA 2Y05A 1E1MA 1CWUA 2UAGA 3UXYA 1QR6A 2F00A 1LI4A 4J7CA 2FN7A 2YDXA 1ZK0A 1KYQA 4RZHA 3NJ8A 3TZQA 3DTTA 4E32A 3Q11A 9LDBA 2Y1DA 1NX6A 4IDEA 1GCOA 1I33A 1Y5RA 1S6YA 4CQMB 4BO9A 3HN7A 3DAPA 4PVDA 3OIFA 4IDGA 2YHIA 2V6BA 3ZW9A 5A4DA 1XKQA 1J4AA 3DBHB 4Z0TA 5BR7A 4OJNA 3FF4A 4YVFA 1PR9A 5BSFA 1E7SA 4MVJF 5ITVA 2HMUA 3UW3A 2CVOA 3K5PA 1KERA 4P8RA 3UN1A 4CR6A 2WYUA 5L45A 3RFVA 2IYOA 3GY0A 4XCVA 1WP4A 4AJNA 4IXTA 4FGWA 2BGKA 2P4QA 5COBA 3LK7A 5I7SA 2C2YA 3IQDB 1NP3A 2V6FA 2DTDA 1XDWA 4PLWA 3GT0A 1WVGA 5AXBA 1GV0A 4U5QA 4ZQEA 3HN2A 4YJGA 1Z75A 4YTEA 1HDXA 4O0LA 2HRBA 5DBIA 4KDFA 4N54A 3KM0A 4OQYA 1GPJA 1PZEA 3L6DA 4FBGA 1IUKA 4PZEA 2A4KA 2QG4A 2YQ5A 3KUXA 4NJOA 4AJIA 3O9ZA 1C1XB 4FC7A 1EVZA 1L7DA 5BT9A 3QRWA 1CRWG 1YB1A 4II3A 4WLEA 1U1IA 2NTJA 5L4SA 2D8AA 5EQFA 4ND3A 1LLCA 2OMEA 3ZHYA 1A72A 3BHJA 3EHEA 4GMFA 4LCEA 2DM6A 4B8ZA 3HNPA 4W99A 3NT4A 4OMUA 3L4SO 1KS9A 3LQFA 2O3JA 2VT3A 3MJCA 3JD0A 1ZSVA 4OSPA 4E2YA 1LDEA 5KJFA 1F14A 3L9WA 1KVRA 2FR8A 1IE3A 4AJKA 3UH1A 5B4TA 3H65A 1I2BA 3QLJA 3P7MA 1BXKA 4Y67A 4ZRNA 2DBQA 4JBGA 2NU8A 1VI2A 3BTUA 3ITKA 3VH4A 4GBJA 4PG5A 1MP0A 4IQGA 3S8MA 5EQDA 1E7RA 3RBZA 4OSOA 1K6IA 3WQSB 3PHIA 3K30A 4G2NA 3AOEC 5GY7A 1W4ZA 3EK2A 4FFMA 4GX5A 1HRDA 1PIWA 2PZKA 4RF4A 3AOEA 4WCFC 2OP1A 1ZSNA 5ER6A 3UCFA 1K6JA 4Y98A 3I4CA 3DDNA 3DL2A 5F5NA 3VKUA 4ONEA 3JYOA 1HDYA 1NTOA 1D1SA 3JCZA 1J5PA 3L07A 2GGSA 5EERA 5JC8A 4DQUA 4CLRA 3PQFA 1LBEA 2VNSA 4BS9A 4RPGA 1U3TA 4JBIA 3K6JA 2EXXA 4B7UA 1LX6A 1K5HA 1DRUA 1U2GA 2B5VA 3STHA 3G79A 4S3MA 1NFFA 4RVGA 1D1TA 4BNYA 3KSUA 5BNTA 2CFCA 1X0XA 3DZBA 2FPGA 4BNMA 3H9UA 4U0JA 2FZWA 4R1TA 1FDUA 1HLDA 3FRJA 4UUPA 3UHAA 5BNFA 4A27A 3OQBA 4UUOA 3N7UA 3SLKA 3TZCA 1YH3A 1W0CA 3N74A 3EVTA 1A9ZA 1IULA 5A3VA 1U9JA 2X22A 4L4SA 2YV3A 3GPDG 4NU5A 3ZCXA 4K6FA 4FGSA 3W6UA 2Y1CA 4YXFA 1FDSA 3D4OA 3EAGA 1KC3A 3I5MA 1U7TA 1B3BA 3DBRB 5IDQA 4E2XA 1YWGO 4BQRA 3NKLA 2BMAA 1EBFA 1YO6A 4ND4A 3MWDB 1DIHA 4WEOA 2E6UX 1A4UA 2YV2A 3F3SA 1OZAA 2BHLA 1C0PA 2FSSA 1DB3A 5A9RA 1RM5A 3H2ZA 1JAXA 3ZNQA 1IPFA 1WLYA 1LLUA 2HMTA 1XYGA 2VHYA 1LC0A 4NBUA 1YDEA 4BIIA 4CUJA 1NFRA 4GLLA 1GYPA 3K73O 2OXIA 3BMQA 4MOWA 1X7HA 4L8VA 5KVQA 4CMHA 1EE2A 3FNEA 5DCUA 3VZQA 2HK8A 4Q3CA 4MVJE 2VTDA 4YJHB 1Y1PA 3WXBA 3AFNA 4BV8A 1PJBA 3JQEA 1NYTA 1PJ2A 4YPOA 3OQ6A 1ENZA 3IJRA 4D45A 2IXAA 3M2TA 3DFUA 2JL1A 5DULA 4F6CA 1LLDA 4CMAA 1WMAA 2WTBA 3ZWVA 1PQUA 2PWZA 2OP0A 1Z45A 2EKPA 2VRCD 4J3FA 1ORRA 4YAIA 3H9QA 3GEMA 1MW1A 2ZTLA 1T2DA 3Q6IA 3ZWWA 3A4VA 4CM7A 1GAEO 4QX6A 1AHHA 1U3WA 4B3JA 4EYEA 1Y7TA 4J4BA 5C3MA 5CHEA 1QMGA 3GDFA 3RROA 3I6IA 1LXCA 2VYND 3SJ7A 1ISGA 3KOUA 3W6ZA 4K9DA 1T2AA 3VH3A 2ZTMA 2I6TA 2FHSA 1I3MA 3T4EA 4R9RA 3DZJA 1J0XO 4ROSA 1MW0A 3QJ5A 2VHZA 5JPIA 4A2CA 4E2ZA 5U1PA 1DIRA 2W2KB 2BF7A 3HDHA 4BGEA 4Y8VA 2WD8A 4YT2A 2DTXA 3B70A 3RFXA 3U09A 1IOLA 4L76A 1R15A 3JD4A 3OA2A 4U8GA 1QXSA 5CFZA 3JD3A 4M8SA 5CG2A 5T5QA 4GQAA 1AXGA 1RJWA 3VPFA 3W4KA 4NDNE 2NVUB 4W9NC 1GDHA 3DBLB 3RU7A 4HP8A 1S46A 3WFJA 1JAYA 4E4YA 5JY1A 2EKLA 1HYGA 3VTFA 4W9NA 4RPHA 4D42A 2DBZA 3JQ8A 4URFA 4FQ8A 3NDJA 4I9UA 2VN8A 5EJ2A 1VL8A 4AJ4A 4YACA 4GAEA 1B3RA 1LQUA 1P1RA 3D0OA 1Y9AA 5KWEA 1NVMB 4M55A 3KSDO 1AUPA 1DSSG 2NQTA 1EBUA 1R66A 4GX0A 3PYLA 2QIOA 2GN4A 4RVUA 4JGBA 3DZFA 3PGXA 4EDFA 3ETDA 2HLPA 3FR7A 4DYDA 4QO7A 5B12A 3F1LA 5LDGA 4WECA 2H63A 4BHTA 1OFGA 1QORA 2QZZA 4FFPA 1QP8A 4CL8A 1YVEI 2A9FA 2OBYA 3VVBA 1ONOA 3AOGA 2HMVA 3KBOA 3QWIA 3GAZA 3RC7A 1W73A 5AVOA 2B83A 1NAHA 5B1YA 3WQQA 1DC5A 4YRAA 3OJEA 3CINA 4O63O 5HTOA 4FJ0A 3ZI0A 4TZKA 3A28A 4ALNA 3HFSA 1QYDA 3GEDA 1O94A 3BAZA 4RVFA 1YRLA 2XOXA 4MVJP 1PJ4A 2I65A 1H3LA 3BMCB 3INRA 3VPGA 3IP3A 3GHHA 4LN1A 4FLSA 3TL2A 1VJ0A 4CM6A 4IQ8A 3ZWPA 3PDJA 5KNLA 4EZBA 1XG5A 2Y67A 1Y8RB 4HX5A 3BMOB 4FIZA 1MA0A 3WSWA 5IN4A 3JQFA 1ZKMA 3ORFA 3OECA 1C1XA 2DPHA 2WWRA 3WGZA 1QYXA 2NU9A 2G0TA 3SX2A 3H5NA 5CDSA 1I3NA 1ZK1A 5IDXA 4CL3A 2OORA 1GPDG 2Q1TA 3WMWA 1ADBA 3PZBA 4JP2A 4WPGA 1JDJA 5C37A 3PRJA 1U5CA 4P22A 3U62A 3V1UA 4DIFA 4I08A 1GQ2A 5IZCC 1PS9A 1PJSA 4ZQHA 4JBHA 1A4IA 1BTOA 4Z9FA 4ND2A 4IIUA 2PV7A 4KOAA 2ZB4A 1BWSA 2VT2A 1KVQA 3H3JA 2WPGA 3QVTA 1VPDA 2ZB8A 1F8GA 2QRKA 1DLIA 4O6VA 3RC1A 2WDZA 1EVJA 4LRSB 4BNVA 1B8UA 4BGUA 4DYVA 3ZV5A 4IS3A 1NHWA 1ZK3A 4TQGA 2X0JA 2DT5A 1H9AA 2TMGA 3B20A 3INTA 2IEBA 3ST7A 4DLLA 1DHTA 4JQCA 3G0OA 1GL3A 3S2FA 1MGOA 3NJ4A 3D4NA 4XGNA 4MIEA 1E7WA 1ARZA 4AJOA 4NBRA 4EBFA 1CYDA 3GEGA 4HY3A 4BO6A 1Q7GA 3VZRA 2CF5A 2DAPA 3QVWA 2ZYAA 5ITWA 1R0SA 2O2SA 1B0AA 1PJTA 3WGYA 3RI3A 2R00C 3D5TA 3L4BC 1P77A 4YCAA 4KUGA 2R00A 1D8AA 2G82A 5B4UA 4EGFA 5EL0A 1JA9A 2DQ4A 3E6AA 4IMRA 3DOOA 1IHXA 2EERA 3C7CB 5A5FA 1C0LA 1HYHA 3C1TA 5JYDA 3H5AA 3BYZA 3I9KA 1V3VA 3MEQA 3L6OO 5EIOA 1W6UA 2Z1NA 5JMWA 1V3UA 2IXBA 2QX7A 2EGHA 2X0NA 1UAYA 3U4IA 4J49A 4RDHA 1KVUA 3MZ0A 1LRKA 4HADA 2NQ8A 1C0IA 1K3TA 3BZUA 1X13A 3O4RA 2J3IA 2AEMA 4PG6A 3ETEA 4AVYA 4GMGA 5L95A 3EY4A 3OSUA 3WBFA 4W6ZA 3DAFA 1DFIA 3WGQA 3CE6A 1NWCA 1LSUA 6ADHA 3K96A 3Q0EA 3ZWMA 2JHFA 2VRBA 4GVXA 3WYEA 4KUEA 3CZLA 4BO5A 3RASA 1E3LA 4PRLA 4N5MA 4L4XA 3RVDA 3H4VA 2O2YA 3B1KA 4IS2A 4B4OA 1U3VA 2GERA 4XB2A 3JYQA 3CMCO 1HTBA 3I9OA 4CM4B 4J1SA 4D7AA 1LC3A 1DDOA 5TLSA 1H5QA 1MUUA 1E6EA 2D59A 4OKNA 2H6EA 1BW9B 4QSMA 5JFOA 5CDTA 1U5AA 3GRKA 3JQAB 1V9LA 4YJHA 2BFMA 4CR8A 2X9NA 3IUPA 5ILOA 1UZNA 4CJXA 4E2WA 3PI7A 5JE8A 2G5CA 3ROMA 2VRCA 5TF4A 1TT5B 5DOZA 2O7GA 4LK3A 3OH8A 5ICSA 3IS3A 3HWRA 4JJIA 1F17A 5JO0A 1Y8QA 3W4JA 1A9YA 1GU7A 3WBBA 3JQAD 1PU2A 2VYNA 3LDHA 3FR8A 4GPD1 4PLYA 3I4FA 3FBTA 4YR9A 3LVFO 2IZZA 5CPBA 2G76A 2GYYA 3RUFA 2O3TA 1N1GA 3KLMX 3JQGB 2X6TA 3X2EA 3SC6A 1XGKA 1KVSA 3OM9A 4E21A 1YBAA 4PLVA 3WYCA 4LGVA 5ADHA 3JYLA 1VRWA 2ZB7A 3A9WA 3OF2A 1M75A 3H2SA 3RD5A 4BNTA 4J6FA 4U7WA 1T1SA 3DOCA 2Q99A 4XX0A 4R16A 1NXQA 1ZMOA 5JDCC 3IDSA 3ONEA 1PGNA 4ITUA 4RVDA 5TGDA 3VHRA 5JXWA 1T2CA 4Q3AA 1LUAA 3AK4A 4XZ3A 3ZU5A 1NFQA 1R16A 3RIHA 4YJFB 1VL0A 3ANMA 5GZ1A 1CQIA 4OXYA 2ZB3A 2GRAA 4NBWA 3U3XA 1I36A 4OH1A 3P2YA 1WMBA 7ADHA 1P0FA 1I5RA 1FF9A 2ZKLA 2BFAA 1SMKA 4HNHA 3QY9A 1JKIA 1K6XA 2PY6A 4GI2A 3P2OA 5TT1A 3I9MA 2GZ3A 2V65A 5JNLA 2Q4EA 5ENDA 3UAGA 5T57A 3F4LA 4MP6A 1E3SA 4UEJA 4XRRA 4CUZA 4XQ9A 5DCYA 3EDMA 3HDQA 1WXDA 1DAPA 4D3SA 3DC2A 4DREA 1HDOA 2NV6A 4ALMA 5DCWA 5COAA 3GR6A 4C4OA 4YAEA 4OIMA 4OM8A 5T6BA 4B3HA 2ET6A 5TRTA 1VM6A 4IDFA 3EC7A 5G4LA 3UUWA 1HEUA 2FR0A 5I9LA 1KEUA 1MLDA 3OBBA 1WNTA 2LDBA 1MW3A 2C5EA 4JROA 1KOLA 2D3TA 4M89A 2W2LD 4WJZA 4FJ2A 1NPDA 1DJQA 1MG0A 1FDTA 2AEJA 4H3VA 2PKQP 5TX7A 3AM4A 3GK3A 3LT2A 1CF2O 3LSYA 3ANNA 3QWAA 4IM7A 1X0VA 4MP8A 5JDIC 3BMNB 2Y93A 4YRBA 5AOVA 4EUFA 1DFGA 2JCYA 4BKPA 6LDHA 2AG5A 4WKGA 5HS6A 2X23A 4J9VA 5KJEA 3LLVA 4MINA 4JJGA 5CG1A
chains in the Genus database with same CATH superfamily
4A8PA 5C2JB 4MW7A 2CJPA 1UBLS 3Q5DA 3OC0A 3OE7D 3OKFA 4Q48A 4TRRA 1WDMA 4CQLB 4C7VA 1P0CA 4KIFA 4QEKA 4MVCA 3GMSA 5FPSA 1PUJA 2CD7A 1YZHA 2R6FA 3RRXA 5HMLA 1CB7A 3TLEA 3I30X 1O4WA 3ZHRA 4XFDA 2VHXA 2ZJOA 3FLBA 1HSOA 2YY6A 1WHSB 3KE9A 3MMPA 4C0QC 1AHIA 5AKIA 3IXQA 2HGZA 3QBVA 4C14A 4RAQA 1RI2A 1QH8B 3I8XA 1XVIA 4HEA1 5FFMA 4KQCA 1SD5A 4DXDA 4EUKA 5ENVA 3R3ZA 3PWKA 3ROFA 4WESB 5AKXA 4OGFA 1OXBB 3RRNA 5CFQA 2FZ4A 1HE8B 2B34A 4AECA 3TGWA 1UC9A 3A4TA 2GN1A 3MUFA 4L27A 5BOSA 4I1VA 3QNWA 3KQVA 4KVGA 3TVYA 4CM3A 3FROA 1E3EA 2F17A 1SXJD 3G2LA 3IMFA 1PGQA 1XCJA 3PZRA 1Z0FA 2JNWA 3IAS1 4Y3UA 5CXQA 3DEYX 2H1FA 2OFXA 2Z2ZA 5M04A 3WLAA 4FGUA 1QVVA 1SB8A 2BE7A 3L7OA 3QF4A 4LPSA 3RVBA 3WADA 4I4CA 1H19A 1YZUA 4I5EA 4RNDB 3UUGA 3W9SA 5FUQA 2XX3A 4LXIA 5FFFA 2XRMA 1O96A 3B1XA 3KZXA 2OZLB 4D9BA 3IPCA 4YALA 3PL1A 4W9RA 2I6FA 3ZHQA 3ZY2A 3GLFA 2B8JA 1ZUHA 1Q19A 1UT8A 1SRQA 2RB5A 4JHXA 4XH9B 3WQBA 4YUAA 2IPLA 2EF1A 2B35A 2PQ6A 3IP9A 3JSAA 3TKYA 3VYUB 3WGTA 5BXYA 1NATA 1T0JB 2OLKA 4KVZA 1D4AA 2GPWA 4MA0A 3WZMA 1FFSA 2PX0A 4QOHA 2NAFA 3R0XA 1GDDA 4QBIA 1QV6A 4FLQA 1RCFA 1HT1E 2QMQA 3LX4A 4J8PA 3K70D 3M6UA 3TMYA 1QE3A 3M6IA 1DLJA 4F6RA 3MAGA 1SK9A 3O83A 3R5HA 3RQSA 2ZBDA 4NABA 2WY2D 1II8B 2ZRLA 3ZKWB 3UMYA 3UVEA 3GNQA 1Y33E 4E5YA 4NESA 3NBZC 4II2A 4CMKA 3LH5A 3GJSA 3KYCB 4ZJUA 4YAJA 4P35A 4JI0B 4ZYVA 2IOFK 2GNPA 3LE8A 1YTLA 4OUKX 1T5HX 4IFEA 1OD6A 3HU3A 1EFVB 1SIBE 2FPOA 5HS4A 1JQLB 1X15A 1TX4B 1JHZA 1MAAA 5CLFA 2YYSA 3GZNB 5FTMA 3ENVA 3ZTWA 1UDWA 3LQYA 2I8LA 3OHSX 4Y9UA 5MDHA 2CMDA 1B6TA 2EP5A 2WUEA 3DKVA 3N8DA 1JU4A 4YASA 5T4FA 2AC7A 4RTPA 3VDNB 2IZ7A 2FMKA 3TLJA 1KMCA 1TQHA 4YRTA 2HNBA 2NO7A 4X71A 5LLTA 1KY4A 3I92A 4UBKA 2Y68A 2Q6TA 3TBHA 4CKWB 4US2R 3QX3A 3FULA 4I7EA 4XTRA 2NT3A 4E88A 1IC6A 1TE2A 3GDOA 2AYZA 4MRSA 3M6AA 4GAAA 2XYPA 1JALA 5I4BA 2O8DB 3L1JA 2ONKA 5JZBA 4KFUA 3OUZA 4OQQA 5AICA 4ZU1X 2CBGA 5CLLA 5AVZA 2HHCA 1Y7PA 3JXEA 5CNKA 5EINA 4I66A 2FW7A 4TM7A 4O4HF 3BWCA 5MGBA 1EDZA 2HV8A 1MW2A 2OGSA 1C3LA 1DEKA 2A8YA 2XD9A 2NNWB 5KI6A 2RGXA 3MOGA 4EUSA 1K5PA 4QT4A 1W2WB 2FWIA 4F8EA 4OY3A 2FG7C 1KH2A 1SUBA 3SE0A 4ENWA 1A8SA 1JI0A 4K1LA 1PRYA 4RL6A 3TZHA 1B1CA 4F9EA 5KTPA 4EHHA 4S05A 1AUOA 3GWGA 4QBHA 4DJAA 1ZMTA 5AJZA 2OVFA 4O4IA 4QU9A 1X9HA 4RK6A 3WYBA 4BP9A 3NDIA 4JI2B 1K68A 3H86A 4GF5A 4N8DA 1S2NA 3FN4A 3F97A 3IO5A 3KQQA 2JLSA 3ECCA 1WMDA 3LUKA 4HDAA 3VI4B 4BWFB 3IAXA 4EX7A 1VJRA 5CYGA 1OCEA 1OW3B 3S1AA 5BYBA 3HB7A 4OK5A 1C81A 4C7JA 1X3ZA 2A14A 5E6UA 3TJRA 1RKUA 3CHYA 3O2JA 2I66A 3IQZA 2QBYB 1PDWA 1C7ZA 3HPQA 4CKYA 2JHPA 5JHHB 4NZPA 1A7UA 3Q3CA 4WIAA 1EDBA 1NMQA 1J8VA 2QJWA 4JAVC 5DP1A 2PO7A 3K0HA 2B3DA 4OHXA 4AB1A 2QN6A 1FXWA 2Z8YM 4LXQA 2PGXA 1BW9A 4NIMA 4OI4A 3IDAA 2D7DA 4WBNA 4ENPA 5JJBA 4IDBA 5WRFA 3NORA 3AU8A 3IA2A 4M1TA 3W78A 5FBRB 2H17A 4FMDF 3R7AA 3TE6A 3R9XA 3U3OA 4HSGA 4XGQA 3HYTA 1GGNA 3HADA 3V7WA 5ALQA 3NATA 5P8WA 5IS2A 3I58A 3PXUA 2LP4Y 4INAA 1BOOA 4EEKA 4DIKA 5AUOB 2XCSB 3BGOS 2FLWA 2FNAA 1B8NA 2OO5C 4B79A 1VP9A 2C98A 2HJHA 4L5IA 4QYWA 3S27A 2VH5R 4HJXA 1GL9B 1LGYA 4JC8A 1P0IA 5ELXA 1VYTA 3BRQA 1WB9A 1KFJB 3OM0A 1OZHA 4HI0E 2NZWA 3UWMA 1ECFA 3EYWA 5JCZA 1T10A 4P4NA 1E7MA 2DY1A 1NW9B 1U1CA 2TMDA 4QNNA 3RF7A 1GZDA 1FMFA 3PENA 2JGNA 5C31A 4K9QA 5ITZB 1CP2A 2MYPA 2AOWA 3KCNA 3TSZA 5A9TA 5BRJA 2WAYA 4OYLA 3GH3A 1H2ZA 3RR2A 5T4BA 3VM6A 2UZ4A 2P9GA 4IIVA 4DSNA 3OJCA 1N7GA 3MMZA 4R3WA 1QLHA 4UCWA 3B2NA 3KUCA 2ODQA 1HV8A 1YMVA 4HATA 2AFHE 5I9IA 1BS1A 2Z6QA 5B37A 2X3UA 1NBHA 3KD3A 4X93A 4CLXA 5JJLA 1IB0A 1B6GA 3P9PA 4OOEA 1WSWA 1ULBA 2ONYA 3R8FA 1N92A 3PDCA 3ZWOA 3OQNA 2SHKA 3QEOA 1HE2A 3ETLA 1F6WA 1K8XB 1KZ9A 3KV3O 3NB0A 4RF5A 5CLHA 4BN4A 1E20A 1U8AA 5K4AA 3AVWA 5KQLA 4F45A 5A1JA 2VOEA 1U5BA 3CUTA 3R41A 4OXRA 1BCSB 4AYXA 4GC9A 5K0NA 1OX4B 4OQMA 4K6OA 4ZWNA 3VYSB 2G4CA 2JGJA 3ZY6A 4NDAA 5BSUA 4EB0A 2FSHA 1LDGA 1SK8A 2C5ZA 3DO5A 4R9VA 4TOIA 1C3OB 3BQNB 1BJKA 3GMDA 2GZ1A 3X1KA 1U3UA 4NI5A 1BH2A 1F8FA 2HT1A 2Q5JA 3I05A 3SHOA 3GU3A 1HEIA 2X7HA 1RACA 2E9SA 2HBYA 1Z74A 1CQZA 2W6JD 2C5GA 4IUBS 3MT9A 5I01A 1JHYA 2W6MA 2GPBA 1T34A 2IF0A 2H1VA 2PL3A 3SEFA 4DR2B 1TPZA 2O8FA 1NVVR 2HIMA 3EXFB 2Q8NA 1U8EA 1W4CA 5JLAA 5H80A 2FGJA 2V7WA 4YNBA 4EM6A 5F9HA 1XELA 2L42A 2BEWB 4LJ4A 4MDHA 3QMWA 5K0TA 1C9NA 3B89A 4NMLA 1Z18A 5I9MA 2VBFA 4D8UA 1U0NA 4JT8A 2BMVA 1AGYA 2OE2A 1A5ZA 2W6IA 5JNRA 2IS4A 1QHIA 5DTEA 3WLEA 4TYQA 1E2HA 4GGPA 3SFTA 3C3JA 1KFBB 3DDHA 4LI0A 1Q44A 5DM4A 4JP5A 4L4ZA 4PCLA 4BNLA 4V2IA 2PU5A 4G2TA 1WE2A 2VNHA 3L1VA 1WZCA 4F6LA 2Z0MA 5FBKA 3TM4A 3UW1A 2BI8A 1SC1A 1OU4A 1YQGA 2HLNA 2W4IA 4W1RA 3FUMA 1TVMA 4XM2A 3UJ3X 3OE7A 5ADVA 3MC1A 2Y8EA 4XPZA 3PS9A 4KXMA 5TEWA 1OLUA 1J22A 1OZ0A 2OMKA 2PX3A 4OGLA 2I6QA 4PQYA 5IRCD 3R0QA 3L4JA 1CUAA 3EQZA 3NJRA 3ANTA 4R51A 2VR1A 1NNUA 2ZCUA 3DHNA 5DHTA 1PQWA 4RF3A 4X1YB 3VKVA 2H4XA 4FR5A 3T0IA 3PQEA 2DWUA 4O2LA 1LS6A 2Q2QA 3T3NA 5BOVA 1U11A 3DO6A 4MKXA 1DWUA 5HE8A 3AVVA 3C6MA 3LBYA 4J9UE 4XWOA 5BSKA 3T7SA 2BGUA 3L0YA 4AR8A 3EC2A 3EZXA 1AKUA 1QVZA 2DSNA 3V55A 3SXUB 5C5IA 1TKAA 1U2ZA 1V41E 4A8JA 4OHCA 4BMXA 5EWJA 5HUJA 3FTWA 2O0MA 4HF7A 1CQPA 3RSLA 4AROA 3AR4A 3P9YA 2Q8QA 2A9PA 1I6KA 1SXJA 3GARA 1KK2A 4IH1A 4O4JF 5AXCA 4RKFA 3S81A 4RQUA 1KK3A 2OD2A 3L8HA 3KXIA 5TQVA 4B47A 2PUGA 1CUDA 2QUKA 3G0HA 1VCOA 1SB9A 2QTRA 2P8SA 4L73A 1H4SA 2BIFA 5JLJA 2A4MA 3OLQA 1UDRA 2XDWA 1IATA 4AWBA 1CF9A 4XFKA 5JD5A 3NASA 1OFHA 3DBHA 4S2EA 4UNNA 5A62A 3L77A 3KQYA 3AJEA 1IAVA 4UEKA 3SLGA 5LMCA 3KT8A 3CU5A 1AQJA 3NYWA 4PX2A 1UFQA 2DUNA 2QAGB 2ZRKA 3UWKA 1F1BA 2QP4A 5JC1A 1AUQA 3K20A 1MDFA 4DIUA 1E60A 2J30A 2ZRHA 3A6FA 3AIKA 3HCWA 1OFIA 4FOTA 4AQYB 1XTTA 4QJIA 1BO6A 3DMRA 4RM3A 5AVSA 5AKJA 1G98A 3JX9A 1X8KA 2BD0A 3MJVA 1KBOA 3BILA 4II7A 3IVRA 1TUBA 2GKGA 4CLRA 1OGYA 5K0FA 3ZWQA 1W44A 5KVSA 2XQFA 1T3TA 3HY3A 1DBQA 3UHOA 2KBEA 2ZULA 3GEIA 3HA2A 1WMFA 3LRXA 3OOSA 1ZVJA 5A02A 3M89A 4O4LA 2DXIA 2QMOA 3PFWO 4Q4AA 2EU8A 4TLLB 3UAZA 3MAJA 3CNQS 3CRW1 1GQYA 4JLPA 1RAGA 2HEIA 3GD7A 2ZT8A 1G59A 3W8EA 1GZ7A 1VGRA 2LTAA 2XQIA 3HHEA 4OFBA 4X62B 4EHFA 3E03A 4ZTBA 2VQ3A 5AJXA 3ILSA 3V9PA 4X64B 3DP7A 4D4LA 3IHWA 3OZWA 4JN6B 2PLAA 2C9BA 3QP9A 4H4EA 3W7AA 3QYJA 4ARSA 4IVQA 4D4HA 4TZ0A 1GQOA 4GMHA 4XWKA 3TLAA 2XUJA 3LGXA 2A5GA 3ITDA 2PFKA 1OLSB 2Z6VA 3K0CC 4IFTA 3KKZA 2RH4A 5T3UA 4BFWA 3OE1A 4BWVA 4YJDA 1PTJA 4Q6WA 4O5AA 4MWOA 1F3OA 1RABA 4PCVA 5CUQA 1JEOA 1YL6A 3M34A 5AI0A 4LE1A 4ZCSA 1BX3A 2O5VA 2ZI9A 4V3BA 3TNDA 5KQGA 4HMOA 4RE6A 4I55F 4OHUA 1UKAA 4IICA 2WUVA 2QVGA 1U02A 3PFCA 3PK0A 3Q0IA 1N7HA 2YUIA 4LYDA 2XUHA 4HDSA 5BPPA 1Z5ZA 4N7RA 5TDHA 3UO8B 2R6AA 3DD1A 4FOOA 4YYEA 3MOIA 3NRCA 4Z3KA 3MGBA 1MVNA 2ODTX 3GZ4A 4NXNB 1JJAA 1WB5A 2JFFA 3S3TA 4U2DA 5FV4A 1HT2E 4OREX 3SS9X 1J25A 2D5LA 2O8VA 2ZI6A 2BCEA 3GNLA 2UYYA 2PKQO 3NYQA 8ADHA 2ZJYA 3G13A 3A1NA 3UMRA 1U28C 4KPEC 3AIIA 1RPAA 5FNVA 1AU9A 2B4TO 3T7IA 2NO6A 2PGLA 2A92A 3F47A 1JIKA 1GG8A 2XJ4A 4Q4HA 4R5VA 4YJ3B 4B2PA 4CF3A 5BVGB 1XQ1A 2AF3C 3H9BA 2QRNA 3TO5A 3N0XA 2V58A 4CMIA 1A4RA 1DPGA 2QR3A 5E1OA 5JZMA 3K16A 3ZBUA 5JCPA 2R6DA 1FY2A 3QHPA 1NBWB 2H0QA 3NG1A 4RGBA 5JAQA 2PWAA 3O0TA 4PWYA 4TVSA 2C2GA 2LIVA 3GMTA 3PNKA 1R6AA 4JNKA 3RSFA 3WLHA 1N2SA 3H2GA 4N6GA 4P7JA 3TOZA 4AFNA 5J2TA 5C52B 4B3GA 3TXAA 1DAKA 3IOMA 2A59A 1KDOA 1P74A 2JFNA 1Z5OA 2Z8YA 2DH5A 3ZHTA 5K0LA 2C2XA 4BMYA 1ZZEA 1YS9A 5H4GA 2J3JA 1Z5NA 1ZRNA 2FPSA 3VPDA 5KREA 2FQ1A 4Q9NA 3L4BA 4I50F 3EIOA 3HVUA 4P58A 3NVKI 4XN4A 3OOEA 1JPVA 3PA8A 2HRRA 3CTPA 1GKIA 4GOOD 5H4HA 1FCJA 1MQ8B 4L5JA 3DZGA 1SHZA 1X14A 4KK4A 4REQA 4OSEA 4BNXA 1GADO 1FW6A 4Q9KA 5AESA 5IJ9B 2FSFA 3BGDA 3C8UA 3AX6A 4KFCA 2O1XA 3QXCA 2EAUA 3DO8A 2C9YA 3P71T 3S8YA 1BG6A 3CLRC 1RZVA 1SCKA 4RFSA 2I7XA 5A06A 5C53B 1G5QA 3CRNA 3F5FA 1LLFA 4MAMA 5LP6A 4L72A 4UMEA 4GPZA 1IZYA 2WIGA 1ZOPA 4CT5A 4IHJB 4OAOA 4YMSA 4AAYA 1N5DA 3DT8A 1RP3A 2Z95A 3I37X 4GX2A 5B7NA 1YJXA 4LKOA 2JHAA 4JI1B 5ICFA 1E6LA 1GD1O 4BP8A 1RXIA 3MUOA 3WJ2A 4Y2VA 3CKMA 3DBRA 4L57A 4BEJA 3PQDA 2P40A 1PFKA 2ZIFA 1NPTO 1AM4D 2CHUA 1JI3A 4L08A 5ALPA 3JZAA 2WWVD 2JLYA 1M1NB 4EP1A 1THTA 2B9VA 4Y1FA 3DR5A 2AG0A 2E49A 4HZGA 4ZDKA 1TO2E 4RCZA 1FPQA 2VK2A 1V45E 3KOMA 2C00A 4OLHA 1Y8CA 4ZI7A 5AM2A 3L6BA 4KXYA 2PWBA 4LWPA 3ZZNA 3K2BA 5J5CA 1GSAA 3HEMA 4LWQA 2ZI5A 3QYFA 3VR4D 4D4JA 3FUDA 3COJA 4BB6A 1UPTA 2JLAA 1NMYA 3MXOA 1Q0HA 1X1TA 3OU7A 2PCJA 2PD3A 4L74A 3GRUA 2ZYIA 3MIIA 1V1MB 1KO5A 5D3MB 1DX9A 2OFWA 3C3CA 1TCAA 1TMGE 3QKUA 1LQTA 2BE9A 3BGVA 4XLLA 2OYRA 3T95A 5BW8A 1N2OA 4UTOA 4H16A 2R7NA 3GLFE 4ZT4A 4ETWA 3HB4X 3GGPA 3MYRA 3RRFA 3OCXA 1SXQA 2W6JA 3JRWA 5FL3A 2Y71A 1M7GA 3GELA 1KJQA 1DUSA 2YZMA 2V96A 3M8KA 3EXG1 1KY5A 4RQBA 3W79A 5IM4A 4AY3A 3ZD6A 3RYIA 2R85A 2WKQA 4J0EA 2I2XB 5TQ0B 3PGVA 3K6KA 2DQZA 4LXHA 3T3IA 4YR7A 1HGXA 3AEQB 3PSAA 2QORA 1QHFA 3CVXA 4GZ6A 4WZZA 2XECA 5B3JA 1XD2B 3ZQJA 4MICA 2MHCA 3EWNA 3OTHA 5LU8A 3A26A 4WKOA 1G2QA 1I4WA 1N6LA 3OIVA 4UU8A 3UK1A 3FUVA 3V97A 4R98A 4UVEA 3OZEA 1DZ3A 2FW9A 3RLFA 1KBZA 2UYGA 3P4YA 4JLAA 5F2NA 3GNTA 4WERA 3H7IA 2XKKA 1JN0A 2JLXA 2FZEA 5IXYA 2GYUA 1R3UA 1U0JA 2AWOA 2H2AA 5KPDA 1Q91A 4LYGA 4LRYA 5J59A 4DLKA 2G9RA 2QMYA 2C2WA 2G6BA 1BN6A 3EPPA 3FCCA 4XJVA 2AQKA 1N6NA 3OLYA 1T9BA 4KCGA 3T9DA 5JDCA 1FMLA 2XZOA 4C03A 5LQSA 1UJ2A 1W1WA 4Y1GA 2B94A 3MSCA 1GKKA 4NC9A 4GM0A 3A4YA 3W8FA 4B48A 1FSSA 2I9KA 5KJ6A 3LQ4A 3SS7X 1ABBA 4H59A 2ZYRA 1AKNA 4IQFA 4DVGA 4PAOA 4ZT6A 5LA6B 5L3SA 1TM2A 3EVCA 1ZCAA 1GV1A 3ID6C 1P5HA 3QFSA 2W2KA 3SVLA 2YBEA 3WLPA 4Z7NB 4YI3A 1RP1A 4HN4B 1L5ZA 3BIOA 4JC5A 2ZM5A 4LXUA 3IPRA 1E5DA 1EHYA 2VTBA 3TS1A 1H1DA 1HDEA 4I3HA 4KDCA 1FJ2A 2CVPA 5D7NA 1SCNE 1JPNA 2QPOA 5LFAA 1JYEA 2ZXFA 1JFSA 5D6OA 4NE7A 1XCBA 4C7OB 2AD5A 3H1PA 5CITA 4WVFA 1IN4A 5F2KA 4DR6B 2B4QA 3MTGA 1JH8A 2WHQA 1EBBA 3K2QA 2XBUA 2VRWA 1FZQA 4LIPD 4V1CA 4JLVA 1HEYA 1SEVA 4IXWA 4B75A 5I7UA 2L2QA 1ESDA 3GLGB 4MV3A 5DSZA 3WMEA 1M8FA 1ZIPA 2VUIB 2ZJ1A 1CIPA 4XQCA 3EYAA 3M4XA 5EUQB 4EYGA 3BD9A 2BFFB 2PSJA 2R47A 2E4VA 5CK5A 4F5WA 2QVYX 1F5SA 3BJRA 4TSRA 3THSA 3VSCA 2REXB 1P2DA 3BL5A 2ZB2A 1PF7E 1QF7A 1E3JA 2BLNA 3BWXA 4OFXA 2Q5EA 5EZSA 2FSVA 3VHLB 1NV9A 1YR3A 1FZTA 1I01A 2Q6OA 4MUIA 2XCTB 1ENPA 2E89A 1V0JA 4JOBA 1KWGA 3OG9A 3HLKA 3BCUA 1CDEA 4UHEA 4PPFA 5JD6A 3UPUA 2HAEA 2K7ZA 4M49A 2FPRA 5J5VA 3RSQA 3QPDA 2WM9B 3G7SA 1Q20A 4F4JA 3OOHA 2OA0A 3DGEC 5JFGA 4TL8A 2PNJA 1OVGA 3ORRA 1M73E 5IULC 1TOAA 2X8JA 2JGIA 1XTZA 4G97A 3S2EA 3RV3A 3T5CA 1AO0A 5HCIA 1AQNA 1QQ6A 5AM0A 4HEA6 1DXHA 3NBFA 3ZD7A 4IJUA 4BQEA 1QMPA 4BU1A 4ER7A 4W7HA 2JVJA 2GWRA 4PSVA 5A71A 3W34A 4BLVA 2ECPA 2OCDA 3CX3A 4C2AA 4RTJA 4WW0A 4Q9AA 3U49A 2I80A 5FI5A 1KH3A 1XEAA 2FN4A 4FLRA 3V8BA 5EKTA 4BFCA 4L0QA 2WKSA 4ZXFA 2HA4A 4IAOA 4MVJG 4U2FA 4KAJA 2H00A 1U7OA 1HYEA 1KARA 1ZXLA 1EZ1A 1EIZA 4D9FA 5A4FS 1E1RD 5LBIA 2CF6A 3PXXA 4DDMA 4JYZA 3KXKA 2YMQA 1I3LA 3D2AA 4LMRA 4L9RA 2ACEA 4H1UA 1AS2A 3G6WA 3WE7A 1DCFA 3U2QA 2A78A 2Q28A 3OPVA 3EWSA 1HOTA 4HSEA 4M76B 4V0KA 4RK7A 3BMOA 4RFVA 5EIBD 4Z7QB 4IIYA 1BEZA 2E4XA 2F7SA 4M1OA 5L8VA 2GLUA 4D4KA 1I24A 1WCIA 3QVGA 3F67A 1ZGGA 4YIHA 1PZNA 4TKUB 1R4MA 4ERNA 4FKMA 3SYNA 2V59A 4L4RA 1FA9A 2CFRA 2FUEA 4QUOA 4WNIA 2YZ2A 1FB5A 4DBZA 2O5RA 4DV2B 1BVHA 2ODNA 2Q1SA 4IFIA 4RHYA 4YYZA 2AOXA 5CA1F 1HMPA 1GR0A 2HHLA 1N9ZA 1NOIA 1GCGA 1KP2A 1XCLA 4TYPA 1BYUA 3T1QA 4EPVA 4MUGA 4NCIA 1GT91 2YBDA 2HA6A 4FDLA 1E96A 4S24A 1PSZA 3P96A 2ID7A 1GOTA 4TGLA 2CL0X 2HIAA 5FT9A 4C3ZA 1TGYA 2V4ZA 4IDAA 1EDEA 4KQ6A 3ZH2A 3M3DA 2GBLC 3E7XA 1MABB 4LYFA 4WCDA 2WMYA 5AHXA 4X85A 2GBGA 5DT2A 1MJHA 4H1HA 3ZGYA 2PJRA 2X1LA 1S3FA 5F4BA 1T0UA 1TCVA 3WNBA 1Z29A 4D0GA 4Q02A 2HNKA 4DN6A 3B8EA 2CNBA 2D13A 1B15A 1QIMA 2P5UA 2V9ZA 3BVPA 4HB0A 4MS1A 1FLNA 1IQRA 2IEGA 1YDMA 3L5KA 4IGAA 1HNZB 1J1IA 3LLSA 2MR6A 1K92A 5DLYA 5I4KA 3HJBA 2EARA 3GJXC 3GN1A 1KQOA 3RS0A 1B1AA 1RYBA 3JQ9A 4RJKA 4OBEA 3BERA 4AY4A 3L8FA 5C1OA 2YFHA 3OIYA 1ZN8A 3ONFA 5BN1A 3PUWA 2PX5A 3LW7A 4ARIA 4EY7A 5K0JA 2J9RA 4Q05A 1TYDE 2W00A 1YF3A 1V8PA 1ADYA 1P75A 4E3ZA 2RHGB 2HT6A 1T5OA 1P4SA 4QOEA 1T6BY 2C4WA 3DE6X 4IDQA 4WOJA 3D6MA 5CM2Z 4CWAA 3HR4A 1VP3A 1OJ7A 5H3CA 3TSCA 1I9CA 3KKNA 1CUEA 1CZUA 3QK7A 3ZH9B 1LK7A 3NCTA 5JYEA 1JH9A 4FYJA 5DE3A 3WOHA 3A6HA 4B6EA 4J16A 3U4GA 4YLGA 4DQKA 5G0TA 1JR6A 1RBMA 3PJGA 5K8JB 2J07A 3S1LA 4YRZA 1MOPA 4H2DA 1HKUA 2E55A 2FG6C 2QN1A 1NW4A 4MWSA 4JYBA 3QU2A 5L40A 2K87A 1G8GA 1YDGA 2NO4A 5HQJA 2QQGA 2FX2A 1GIAA 1IB6A 2EFDB 4N8EA 4ZVKA 3R6LA 3E5MA 2AFHB 3U3KA 1AV6A 4ZYWA 2RGUA 3OUTA 5DO9A 5LPNA 1CZLA 1ISHA 3DHEA 3HL0A 1ZD9A 2AJCA 2M2IA 2WT4A 3MCWA 2PKWA 4Q9LA 1DQRA 4KKVA 1E5XA 1UDAA 1QZXA 4RDXA 2DJIA 2ZYUX 4FTWA 1DPFA 2OHFA 4XCQA 3NZEA 4L9AA 3AEKB 1OB5A 4ZZIA 5HP4A 4OX9Y 2BFPA 4QLAA 1SXJE 2WTNA 3TW4A 3N5CA 5CK4A 1ADGA 1NQXA 3GOHA 4IUCS 3TGPA 1T4CB 4E6EA 3VR4A 3ZBPA 4MVJD 4IY1A 4G24A 1KF0A 1L5SA 3OJOA 4DMLA 5BV0A 5AVRA 1MHTA 4CEIB 3KPUA 4HDNB 3UMGA 2JFQA 3KXDA 1C7QA 4RJLA 1Z63A 2D2FA 1OBFO 2LIPA 4MVJM 1PYGA 3U3ZA 4H1VA 3RNLA 4P7FA 4ZHQB 5ERXA 1JKJA 2Q3HA 4NVRA 4G0ZA 4OHVA 3WP1B 4B4DA 4E31A 4ENRA 2WZCA 4B3FX 2NSDA 5K3DA 2FWAA 1UH5A 1II9A 3CWQA 4AY6A 2KPOA 5JQGF 4CM4A 1CUYA 5CA1B 3U56A 2IH4A 1W36B 3TAUA 4AKSA 3PUUA 5AXDA 2I4IA 4MSUA 2GDZA 4RORA 3OQMA 2YWCA 4GKBA 1BIFA 3SYMA 3W05A 5HIKA 1Z5GA 1CUSA 1M1UA 1Y7LA 4EEZA 1AXRA 2QGFA 4YT8A 2BRUA 4DRXB 4X6UA 3O3NB 3LXUX 1YQWA 2F1IA 2V7EA 2FUG1 2Z98A 4P7BA 1ZK4A 3ZDFA 2WR8A 2RK4A 1FUKA 5C8YF 1FMCA 4NL4H 4AW9A 4XMXA 1CJBA 1TT5A 4KI0A 1J33A 2Z04A 4F1KA 1A50B 5AENA 1NXOA 2JGAA 1R1DA 2P1DA 2PWYA 3ZWAA 3LKDA 3L9XA 4HDRB 4LHXA 4WZAA 3F49S 1E3WA 1QS0B 1G2IA 1MJGM 3AF1A 3CEAA 1SU8A 1BMTA 3PPXA 4A91A 4F4DA 3M9XA 2R4QA 4B4WA 3H2KA 2WMOB 1YR6A 2K4MA 3C7TA 5EG5A 5B3AA 2P5SA 3KVVA 4L4UA 4PGFA 1ZJWA 4MR9B 4L7QA 2P4EA 4JL8A 3K0AB 2WZBA 3FTNA 3LC7O 2RH9B 3STWA 4BNZA 5HNFA 1Q5PA 1OI2A 2WIAA 3ANSA 2CW5A 3NFRA 2Z2XA 1YB7A 4LEIA 4NYMR 3DMTA 2HB6A 4YPVA 3M49A 4KRXA 2ISCA 1QRRA 4IZHA 2HDNB 2JAXA 3HJNA 4HXFB 4JZYA 3V1KA 2F3QA 3ZKAA 1OWMA 2UVPB 3HWX1 4FLEA 2H5LA 3FTPA 4RWZA 3DDCA 1BE1A 1OC2A 1TK2A 2F62A 3LQ1A 3OURA 1GL6A 1DKQA 3E27A 1YE5A 2GLXA 5KBYA 1X2EA 4WXRA 2ZWVA 3L04A 4ZYYA 2GWHA 4KXNA 3F7MA 3MFYA 1Q0RA 5DEIA 2G36A 4ED9A 2UYHA 3RYCB 3PR3A 3S40A 1THMA 5AVVA 1FFXA 1JXQA 3CA8A 4R68A 5JSKA 4C0SA 1MQSA 2EWVA 1UJMA 2VWGA 4FCCA 1P31A 1XO1A 2UV8A 3CW2A 4OI2A 1U7ZA 3EFBA 3UTDA 3CSDA 1W4LA 2MINB 3KT0A 4M21A 4WN3A 2CL5A 2BC9A 2IUTA 4J4HA 5C51B 3EIQA 2GHIA 2IUFA 4AXXA 1UP7A 3MHPA 3URKA 2YX1A 3EZYA 3IEPA 3FCYA 3K9BA 2PUDA 3FHTA 3GFFA 2FZKA 3D7NA 4PY2A 2HV9A 1WLSA 2GZHA 2XXJA 3AL2A 3MBKA 5FAXA 5I7EA 2A7QA 2XB8A 2ZJ0A 3IJ5A 2YIMA 4DDKA 4JK3A 5CX1A 1JDNA 5IABA 3EEFA 1N8KA 3Q5EA 4V24A 3TW8B 2EFCB 1YIOA 3UWDA 2BVNA 1WDLA 4BVBA 3CS3A 2CCJA 2CHGA 2V7TA 3AXTA 4UOEA 1K66A 2IYTA 3ADOA 4K5LA 4RADA 4FR2A 1RZUA 3CNLA 5B55A 5HRCA 4IJWA 4MA5A 3ZR4B 3H42B 3L7KA 1X9IA 2J0VA 4QOGA 1M6WA 1RQRA 1QUEA 4B84A 1PGOA 4FPXA 4R5XA 2GXAA 4P32A 5CP8A 5IAAA 5K8VA 1DEHA 1GUBA 5AKHA 5MF6A 1Y42X 3R3JA 2H9AA 4FYXA 2FPXA 2QP9X 5IWCA 3CPSA 3GGJA 3HKEA 2RJNA 1HQCA 4OMDA 2GT1A 4DDTA 1SOUA 1A1VA 1UC4B 1PJAA 3AUJB 2DFVA 3SPXA 4D0SA 1JT9A 1QH9A 4TXNA 5E7IA 4N7MA 2A5LA 3TVTA 1IY9A 4IDCA 4DIOA 2DWQA 3A14A 1ZM2A 3UH0A 4DZRA 3E9ZA 3MGAA 2YNMD 13PKA 3LUJA 1W581 1P3DA 1P7VA 4K26A 1I2MA 1YNSA 2P9YA 1KXZA 3I0NA 3L41A 3N9IA 5GM2A 3RTEA 4WD3A 5ITSA 4WX2B 1ZESA 1C29B 2FOIA 2ZI4A 1IHYA 2IY7A 4V39A 2D4AA 4P2BA 5CH8A 3U7QA 3P27A 2VZEA 3BTOA 4A26A 1Z22A 1LDBA 3ED1A 3AY0A 4FC6A 4FW8A 4WOPA 5DTMA 5IG2A 1YBVA 3Q7QA 1SC3A 2JEYA 2Z3ZA 3IBSA 3OPYB 2IKSA 4BKOA 4Z7JA 4ZK6A 4NV1A 1A97A 1VJCA 2XQVA 2A84A 4QE3A 3H4MA 5AW8A 1YT5A 1MHPA 3CLSD 2BFDA 5FEUA 1NJSA 1Z8HA 5SZHB 3NAGA 4TLAA 2AVDA 2O4CA 5E38A 1UPXA 4EJMA 2QA5A 4U7FA 1J2RA 3LY7A 3RVRA 2ZSAA 2CZQA 3U4CA 3WV5A 1FDOA 3HSKA 2JFVA 2WVAA 3NHLA 5CBPA 2F48A 3OP4A 3C2QA 3EQ6A 4DR7B 5KX5F 5ALWA 1TQ8A 1GPLA 2DPXA 4PC7A 4WUVA 1Z73A 1AS0A 2HCJB 3I9FA 4RLSA 3IBGA 2REQA 1T24A 2V03A 1MX9A 2IHZA 4EPTA 2AKEA 2NTNA 2XYQA 2PN1A 3HA5A 3QA9A 1VHDA 2QVWA 5CAEA 4U6SA 3ZJUA 2ARKA 1VRCA 4V03A 1JHVA 1LVUA 3QI7A 3U9LA 3OX4A 4RK5A 2YZNA 3PVZA 1EYZA 1LDNA 2WSSD 4Z9BA 4E5MA 3S29A 5LYJA 4ISCA 2GTPA 3WKDA 4JJEA 2D0IA 2YJTD 3KSAC 1CQXA 4R69A 3TSAA 1G291 4AZSA 4W5RA 1KR2A 4QDKA 1RPNA 4YJ3F 2H5JA 1KBQA 3I9JA 1MEJA 2CDNA 1WCYA 3SR4A 2I5PO 4DV7B 3OZSA 4QDXA 4OH7A 4QOFA 1OTHA 4F0JA 3GH1A 1KI6A 3M6XA 4QFDA 1NG9A 1QDUA 2A5YB 1ML4A 2RCYA 3ABZA 2LKCA 1U2DA 3KCQA 2ORVA 5IJXA 2YQ4A 3MUNA 3USZA 5KYUB 1Y98A 3D1LA 1QNFA 3VKWA 4DCGA 4HGNA 3ONWA 4Q15A 4TL6A 1QANA 1TFUA 5JCOA 1LSSA 2FFBA 2LWIA 1GU1A 2NSYA 4CKXA 5BSGA 3RSCA 3G88A 2GEKA 5EJEA 4E94A 2OHHA 1AQYA 4ER6A 4GLOA 4N82A 2ZJ4A 3TLGB 4DQLA 3IOEA 4OA8A 3EDCA 3G17A 3TLMA 5F23A 2NXCA 1J42A 2OV4A 4XJTA 4EENA 5FBQB 4G1BA 6REQA 2LUOA 3JQFC 1PZXA 1EM6A 1WPXA 1AZWA 1M72A 1Z34A 2G63A 4O2BA 4WNCA 2PGJA 1VOTA 2WTEA 2ZIAA 2VVTA 3GFTA 1ZN7A 4N9QA 421PA 1A0OA 4K6CA 2OORC 1IPEA 2C20A 2V0NA 2R6R1 3G82C 3W5HA 4KUHA 3Q88A 3KEFA 2AE1A 1W19A 1IK6A 2R2AA 3JV7A 3T35A 1AQUA 4ZOCA 2J45A 5EXTA 2ODPA 4PAWA 1G2PA 5LUBA 4NG4A 4DSOA 2C7RA 1EJ6A 1BS2A 1B23P 2GN8A 2OL4A 1GYRA 3QVSA 4LOLA 5MN4A 3QF4B 3TLKA 4GNRA 4N3BA 3DB1A 3FPCA 2F8MA 4HZIA 4X97A 1CY0A 1IBRA 1NE2A 1T5DX 5JWOA 4NHOA 4MVJA 5HF8A 1XIVA 3BA6A 2OKCA 2MAOA 3DG9A 3D7LA 3EEQA 4L0MA 4UNIA 3S2GA 1NXSA 1OBVA 4XUDA 3DEFA 4HQOA 2QW0X 4FFRA 3GLFB 1EUCA 3BIXA 3VV3A 2YV4A 5HVNA 5JOQA 4G1VA 1G38A 4KFRA 3SE7A 4US0R 3OLZA 2Q6LA 4E5SA 3ERCA 3FHLA 1G4UR 4GPIB 5E7JA 1FVHA 3AHEA 4JJFA 3ZGNA 5JROA 4PQGA 1QONA 2GX6A 1E8MA 2R87A 1M66A 1YS4A 1W9MA 2BHSA 2EEZA 4I5FA 4R2KA 3HY4A 2CKMA 3ZV6A 3VOTA 4F6RB 1CS4C 1OUMA 1VLZA 2B37A 3DM9B 4LCJA 3RCBA 5K99A 4QM6A 1XTPA 3MIZA 3FPJA 3NXSA 3LRTA 5EJMA 1NC3A 2OOKA 3NGLA 1KK0A 1MJ5A 4ZYXA 3TZ6A 1KZ7B 4UBLA 4HC4A 1WXGA 2IGBA 3D6VA 3NOOA 1GG2A 4KDRA 4LXTA 4PIVA 4R8VA 3TSOA 2FPIA 2GAOA 4BZXA 2B82A 4ZV7A 3ZBTA 1WOYA 1F6BA 3AP3A 2G9VA 1FFHA 2H07A 4KACA 3B7GA 3CZKA 1D3AA 1MJGA 3DVAB 1Z88A 3A3PA 2IL1A 1GAWA 1OZGA 4F21A 2XEXA 3D2CA 3QLVA 3HDYA 3N1UA 3ZHVA 2EIXA 4J1TC 3JR3A 5CM8B 3X1MA 3E1KA 3PB3A 4QJBA 3WLTA 4XIGS 3VPBA 2YN2A 2WK1A 3REQA 3INGA 4LZOA 1QFSA 4RLHA 4CV0A 1OPRA 5K6RA 4RO0A 1H6DA 1R4NA 1UK7A 3H5IA 3Q6NA 3UJPA 1KK1A 3PEYA 3UAVA 2PZEA 5DBFA 4QUKA 1RPTA 3TLCA 1HXHA 3PUKA 4NV0A 1YZVA 1NBAA 3FI9A 4FJ1A 1U81A 3QBDA 4HVLA 4JKOA 621PA 4LGCA 2PEZA 2XYVA 3TIGA 3UTCA 5KQRA 1QCCA 5PNTA 5IAOA 1J70A 4HH4A 3LTNC 2O2CA 4NZMA 4C2BA 4CNBA 1BDMA 3DXYA 4MI3A 3T8YA 1BRMA 1OFVA 4U1RA 1VSVA 3UGJA 1CY1A 1GA6A 2EWMA 1TRKA 4N7BA 3WIBA 4C89A 3ZVKA 2W8BA 1BEEA 2VHTA 1ISPA 1Y9ZA 1SUCA 4PR3A 1YKFA 1A96A 5T4EA 5TS3A 1E98A 1XU7A 3E9YA 3VTKA 2VA9A 4OHWA 4DQVA 5IH3A 3N58A 3OA0A 4HUJA 2RGNC 1Q84A 1NI4B 1QX4A 3LV8A 3WWPA 4S1VA 3NQ41 4PCAA 2BDUA 2VUHB 1LTHR 3VPAA 5KTOA 1M2NA 1LNSA 3Q85A 3THRA 4YRLA 3EFOA 2Q0QA 4FE3A 4D5EA 3W3AD 2IYRA 4O0MA 4J4TA 4ZO9A 5I7WA 3H1GA 3TIXB 2MSWA 2RHWA 3AJ8A 5E6UB 3W1EA 3EF1A 3FAZA 4UBNA 721PA 1BGWA 1P9RA 2PK3A 2UZ1A 3QE4A 1KZ6A 4PIPA 3UGQA 1T1EA 4MI6A 4DA7A 4AZ0A 3WIEA 4JXJA 3RWOA 2QHXA 2B98A 4IIFA 4LYYA 2YWJA