1R0LA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
378
Chain Sequence
QPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 123
structure length 378
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0lA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0lA01
2NVWA 4R3WA 5IJZA 1P9LA 3V2GA 1DC6A 2EF1A 3E1KA 3TQHA 1XQ6A 1SEVA 3NDJA 5TF4A 5C7OO 4P22A 4CQMD 1I33A 4B79A 4DPLA 4GAEA 3AUUA 4H7PA 4RPJA 1ZJYA 2BH9A 4GX0A 1E6UA 1ENPA 2VUUA 1I3NA 1AXEA 2FR1A 4W82A 4D44A 3O9ZA 4U0KA 4XYEA 4R1UA 4E5PA 5JAZA 2VYND 3TL2A 2YW9A 4NFSA 2DBZA 1KC1A 4LVUA 3AOEC 3ICPA 5KCZA 1BXGA 1HE3A 4YB8A 4UVDA 3NGLA 4LSMA 2I5PO 4MOWA 4Q3NA 2D3TA 5L7YA 4OSOA 2P68A 5FFFA 1S46A 4IUYA 1LLQA 3KV3O 5ICSA 3GC6A 1PZGA 2I67A 3L9WA 3JQAD 4OAQA 2C59A 3PLRA 3UICA 4KQXA 1HZJA 2Q49A 1X15A 3OJLA 1ID1A 2NQTA 4YQZA 2VZ0A 5DCUA 3TFOA 1FF9A 3C7AA 2B35A 1PR3A 5L3ZA 1LRJA 4IMPA 4BUCA 4DQVA 3BMOB 4PZCA 1FDUA 3DMTC 3LT0A 5JNLA 2PD3A 4OXKA 3RUCA 1HLPA 3VVBA 3AFMA 5JPIA 5A03A 2PD4A 3AY7A 3GF4A 3PHGA 5A4DA 1QLJA 2JFGA 1EVZA 2X9NA 4KZPA 1KOLA 4U6SA 4WGGA 1AE1A 4MP8A 4J3FA 1XU7A 4WNIA 4FIZA 4RQTA 4J16A 5TGDA 4CL3A 3KRTA 1NVMB 3W4IA 3VKVA 2EIHA 4W6ZA 3I6QA 4FLRA 2B4TO 1P1JA 2WYUA 5AYVA 3VH1A 3ZU2A 4ALJA 4XCVA 4KUGA 3FWNA 1BXZA 1KVSA 1ADFA 3NUGA 4PLWA 1FK8A 1LSUA 1WDLA 5C7LO 3ZW9A 1SBYA 1JKIA 5EESA 3UCFA 3UUWA 3EY4A 3ZWWA 3G17A 4R54A 3GVHA 4NDNE 3RFTA 3ZHBA 2X4GA 4HNHA 3RAJA 1X0XA 1P1IA 3PGJA 2EGGA 4LVCA 2DFVA 1UXIA 1MFZA 3ZWMA 3LT2A 3AUTA 1V0JA 3PWSA 2Z1NA 3C85A 3D4OA 1E7WA 2IYPA 3OSUA 4RPGA 4PCVA 4R3NA 4O5OA 4XIJA 4KOAA 3MOIA 3VPGA 3JD1A 4ROSA 3K31A 1U7HA 4NQZA 4Y67A 1KIFA 2VQ3A 2ZQZA 4YT8A 3LF1A 4XYMA 4TVBA 5TT1A 1QXSA 5G4KB 3VH2A 1LA2A 3ZWBA 4JBIA 2X0NA 1NYTA 2QZ9A 4FFMA 2CUKA 3IP3A 4S3MA 5CEEA 2NSDA 3BTOA 5KVVA 3CEAA 4B8ZA 2B83A 4DREA 1LDGA 5G0WA 3WMXA 5CFZA 5KJEA 1GQ2A 2NU6A 4WLOA 5L4SA 4Q3BA 1DFIA 2UUOA 2GLXA 1A5ZA 1QYCA 5I7SA 3JYQA 4FCCA 4CLRA 3INTA 4BO6A 4GSKA 4UVHA 2HLPA 3NEPX 3SLKA 4DC1A 4C4OA 5HA5A 1NHWA 4NBTA 2FSVA 4G65A 4NU5A 1BDMA 1UP7A 1PQWA 4BGUA 5TJ9A 3PYLA 3QRWA 1E0DA 4UREA 1UUFA 4GX5A 2DPGA 4DMLA 4J1SA 4NJMB 2AEMA 4E31A 5EJ2A 1I2CA 2Q3EA 4XA8A 4JJIA 1SOVA 5U9CA 1SAYA 3M2TA 2DM6A 1XHLA 1OOEA 1Y7TA 1YO6A 1PGQA 4II2A 1CERA 1NPDA 5IDWA 2QZZA 2PKQO 3EGOA 1MUUA 4M1QA 3KSZO 1M6WA 1KS9A 3RKUA 4E30A 2NACA 2A4KA 1YL7A 3FNEA 5L40A 5ILOA 4I08A 5G0UA 4WCFB 3H3FA 4I5DA 3OQ6A 3EUWA 3GT0A 3PWKA 4BNLA 2G76A 4P4GA 4ZQGA 1VI2A 3JCZA 3LC1O 3RCBA 4PZEA 4CUZA 1W8DA 1NR7A 1E1MA 3RU7A 4BO7A 3QVWA 4QX6A 1SNYA 1LBEA 1YBAA 3AM3A 2PH5A 3DBLA 3JQBC 5CDTA 3RC7A 1XKQA 2QX7A 2WMDA 2H5LA 5JY1A 2DTEA 2C82A 3JQGA 5AVOA 2RH8A 4RCVA 1B2LA 2X5JO 4KUHA 4MVJE 2PZMA 3UAGA 2X0IA 1E1LA 2PY6A 1CEQA 1TVEA 4FOSA 3PYMA 2OZPA 4KWHA 4E12A 1H9AA 4LN1A 3F5QA 3GG9A 2Y1FA 3ZHYA 4O63O 3CMMA 1NFRA 3DB2A 5HTOA 1T25A 3JD3A 1OAAA 2HAEA 2JJYA 4D7AA 2OFPA 1GPJA 1NAHA 1WVGA 4AJ2A 3EC7A 2A35A 2GZ2A 2Q99A 2Q4BA 2W90A 3DHNA 4UUPA 3OP4A 4NMHA 4ZRMA 5A3VA 3JQEA 4YRBA 4IM7A 4PLCA 5JYEA 2V65A 2QIOA 2X8LA 4Z9YA 3FWZA 1KY5A 3PJEA 1JW9B 2WYVA 1Y8RB 1A7KA 1N2SA 2HMVA 4YJHA 2MAPA 1LTHR 2A94A 4OGWA 3T4EA 4CLHA 3ZU4A 2Y0EA 2XAAA 3I4CA 1U2DA 3N7UA 1DLJA 2ZB3A 4R5HA 4BHTA 1LDEA 3HDYA 3VOSA 4DGSA 2VYNA 1LLDA 2NU7A 4CMBA 2O7SA 1H5QA 1H6CA 2IZZA 1T2FA 4XR9A 4YAGA 2JHGA 3A1NA 3IAHA 4JX8A 1YB5A 3NT2A 3N58A 4I9HA 3ZHXA 2HUNA 2DUUA 4CQLB 4ZQHA 2JFFA 4PLVA 4R41A 3R1IA 2RBEA 4IDBA 3WJAA 4GL4A 4DMMA 3ZV3A 1E3WA 4DLLA 1FDVA 2C2YA 4NR0A 2C7VA 3GZ4A 1V6AA 2IE0A 3M1AA 3I83A 4FFRA 1VJTA 2B4RO 1XIVA 2SCUA 3QJ5A 3ITDA 1X14A 2J3KA 2AW5A 5KWEA 3JQAB 2X5OA 2WE7A 1V3UA 1HLDA 3IKTA 3WBFA 5G2OA 4CQLA 4AVYA 1YJQA 4CMCA 4LGVA 3Q2KA 1ARZA 4IIVA 3UKOA 1E77A 4WLVA 4U5QA 3QY9A 2FZEA 2GO1A 3L4SO 5EQDA 1CQJA 1SZJG 3I9LA 2O7GA 1VJ1A 4F6LA 5GZ3A 2P5UA 4DLAA 4FR5A 1VLLA 3QW2A 4MKRA 4CR6A 4ESOA 2FPIA 4FDAA 1UP4A 4HX5A 3PDUA 3ZWYA 4B4OA 4CM1A 2O3TA 3GNQA 3NT4A 1JAXA 1B8UA 3JQAA 3ETGA 4TVOA 2OXIA 4EITA 5KNLA 1LC0A 3LYLA 3KEOA 1LI4A 3K96A 4IQGA 1UDBA 3F5SA 3ZGYA 2Y66A 1E3EA 3SXPA 2GZ1A 4GH5A 1HT0A 2CF6A 3S8MA 4EEXA 1ZBQA 3AUSA 1DEHA 4BNFA 1JA9A 4DIFA 3JQ9A 4OXNA 3JYPA 4FJ0A 4FSHA 5TC4A 5G0TA 1NQTA 3Q9UA 3CMCO 3OJEA 3G1TA 1EBFA 2RIRA 3T7EA 6ADHA 3DHYA 3F3SA 3QQPA 3ANLA 4MKZA 3ZWXA 1XGKA 4FPXA 3HN7A 1B26A 3KYCB 3W4KA 5C7IO 4Q39A 1DIRA 2XXBA 4IPTA 3FN4A 1I36A 3ROKA 4JQCA 3LLVA 1BMDA 4G5HA 3BMCA 4IQ8A 1EDOA 4OMUA 2EXXA 3D3WA 3HADA 2POQX 3DBLB 5L9AA 1GADO 2EGHA 4FQ8A 2H6EA 1JVBA 1DLIA 1P1KA 2VWPA 3KYCA 4NBWA 4ZQEA 1PS9A 3WYCA 1BSVA 3KLMX 1BTOA 4WEOA 3AUAA 2AG5A 4YAIA 2RCYA 3GZNA 3PJDA 5DOVA 2QYSA 2GSDA 1D1SA 3I5MA 3V1TC 2P2SA 5U4QA 5AXAA 1HDGO 1RM3A 4GMGA 4R9SA 3H9UA 3OBBA 1EFKA 2C29D 3OQ1A 3UOGA 4W7IA 4CJXA 2CVOA 3BTUA 5DBGA 4JROA 3VZQA 4TKLA 1I24A 4KMSA 4NK5A 4OM8A 2Q50A 3CZGA 3RUFA 3V2UA 4RLHA 1RM5A 3D4NA 4EUFA 3JQ7B 5AXDA 3GMSA 1NXQA 3IL2A 4LISA 8LDHA 3AI1A 4ZJUA 1KEUA 4ZA2A 3OM9A 3TN7A 1ZSNA 3HQ4O 4R1SA 1IY8A 3KVOA 3CKYA 1ZEMA 1DFGA 4WOKA 1LC3A 1YB4A 3H2SA 5IZ4A 4E2XA 1QG6A 3AW9A 2XXJA 1OC4A 1U8FO 1MP0A 2NVUB 4BNVA 5ICMA 4BIIA 1W0CA 5MDHA 1JKFA 1L7DA 3L07A 4CXFA 3UFXA 3MJEA 1U28A 1WZEA 4ALLA 3ZW8A 2NV6A 3ASVA 1DSSG 3EMKA 1RKXA 3JQCA 4K1LA 4FLSA 2AE1A 2EWMA 4PVCA 3EDMA 2ZYGA 1X7HA 1Q7GA 3FF4A 5DZSA 4FD3A 3RBVA 3INRA 3DOJA 4EJ6A 4XZ3A 7ADHA 1CQIA 4ITUA 4XB2A 5JSFA 3R3JA 4D45A 3HB5X 1V3VA 3WWYA 4IGFA 3TF5A 3QIVA 2HMSA 4ZRNA 3X2FA 1YKFA 2TMDA 3UCXA 4BS9A 4N5MA 2ZQYA 2JD1A 4XGNA 3FPLA 2O23A 3DBRB 4IS2A 3DAGA 4J0FA 4CLRB 1KVTA 3GH3A 1XELA 1VL8A 3ENKA 1MW2A 5JC8A 5JO0A 1HYEA 3WGHA 4J4BA 1ISIA 1YQGA 4BGEA 5B37A 4FB5A 1PR9A 1Y8QB 3BHIA 3MTGA 2BFOA 5F1KA 2HK8A 4XYBA 3ZWNA 1J0XO 3KSDO 2FMUA 4I9UA 3WGTA 5KVQA 3ZNQA 1MXFA 4XGIA 1PIWA 4CLXA 1SC5A 2W2KB 4M54A 4ZICA 3L6DA 3D3EA 4FGSA 4DYVA 1E7SA 4DBZA 3GPIA 1N8KA 3PI7A 1A27A 1XR3A 1B3BA 3DTYA 1LJ8A 3C8MA 3JQ6A 4MIOA 4BO2A 2HJRA 4J91A 3RU9A 4E32A 3HNPA 4ONEA 3ZN2A 5KJCA 3P19A 1ZJZA 2EEZA 3R6DA 3RJ5A 2D5CA 3OA2A 1FDSA 3QVOA 3E8XA 3PQFA 1Y81A 4QXMA 5F21A 3RUDA 3X2EA 1Y9AA 1DAOA 4BNZA 3ONDA 2CD9A 2JCVA 4GVXA 4QO8A 4Z0TA 1PGPA 2AA3A 3P5SA 5COQA 1ZNQO 1B3RA 2BFMA 3DR3A 3Q3CA 1T1SA 1ZIDA 2H9IA 1KVRA 3UHAA 3KUXA 4D3FA 5A9SA 3KEQA 4TWRA 1YL5A 4OXYA 1WPQA 1ENOA 5DP1A 4O6VA 3B1KA 4RF5A 1TXGA 4LW8A 5DT9A 4AJJA 1VJ0A 1FJHA 4JXKA 4Y98A 2HQ1A 4B7UA 3WS7A 1HYGA 2PFGA 4XYGA 2EKLA 1P1HA 2CVQA 3U4CA 4B4WA 3FHLA 5T6BA 1XWFA 3PIDA 2PR2A 5G4LA 2JKVA 2X23A 3DOCA 4MVJH 2Q4EA 3H8VA 3DONA 1JWAB 3GN1A 3NX4A 2O50A 2UUPA 3ZHZA 3WJ7A 3BMOA 3DXFA 3OHSX 5EL0A 3EZYA 1R37A 3RFVA 1HXHA 2Y05A 1DJNA 3CZMA 1TEHA 4JIGA 1O9BA 1YOVB 3UGKA 2I9PA 3D5QA 4BKOA 3CE6A 4NHEA 4MVJF 2P91A 2WD7B 3DFUA 3EW7A 4HNGA 2ZTMA 2B5VA 5JXWA 4DPKA 4UUNA 1ZFNA 3WGQA 4OO3A 2RHCA 1JN0A 3H2ZA 1GYPA 2VTEA 3CZLA 2NVUA 1KVQA 1YONA 4NJOA 2WD7A 1R0LA 1SOWA 4O1MA 5JBIA 3O38A 3ETDA 3C1TA 4I8XA 2IXAA 1LSJA 2QQ5A 4KTTE 2Z5LA 3DZJA 2PGDA 3C24A 4TQGA 2BFPA 3GRPA 2VCYA 2DQ4A 1Y8QA 3RASA 1QMGA 1NQAO 4IDDA 4MO2A 4Z3DA 1YXMA 1BWSA 3JD4A 4B7CA 1F8FA 1TT5B 3BXXA 1ZSVA 1GTMA 1T1RA 5TRTA 2UYYA 4BQRA 3LC7O 2ZCVA 2OHXA 2WYWA 1C1XA 3FR7A 3CZKA 3DEYX 3FNHA 3OIGA 2R6JA 4XX0A 1L7EA 4F3YA 4GPD1 4PLFA 4YTEA 2Q1SA 4Y6SA 2MAOA 4L74A 4PG5A 2JFHA 3VDQA 4CLDA 4CMKA 1X1TA 2FN7A 3BTSA 1BXGB 3H9GA 5DF1A 1MA0A 4CLOA 1F12A 2W98A 3E5MA 1GUZA 2BGKA 3GUCA 3P2YA 4J6FA 4MVJA 4ZHSA 5GMOA 1DIBA 4NPCA 3EAGA 4ALIA 4S1VA 2H1SA 4FLOA 2BFAA 5K6AA 4D42A 2O3UA 4E5NA 5IG2A 2XF8A 4FFNA 3VPHA 2Y1EA 3DBHA 4YPOA 2O48X 2W2LD 2W8ZA 2CVZA 2JAHA 1GUFA 5THKA 5T8KA 1GZ4A 4BMSA 2EP7A 4BNMA 1WZIA 1NBOA 4BO3A 2GD1O 4JBHA 3JQFC 3PIIA 1DIGA 1UXGA 4HADA 3BYZA 3B20A 1SB8A 1Y6JA 4RF3A 5IFLA 1Q0HA 1E3LA 2C07A 3OF2A 5GZ6A 2VT3A 3VH3A 4YRAA 3F6YA 3H4VA 3KZVA 2JHFA 4CV1A 2FSSA 4BNWA 1EMDA 1O95A 3E9MA 4DC0A 1JAYA 1ULSA 2GCGA 4YAJA 4CODB 1ISFA 4CM8A 4RPKA 3U9LA 3NJ8A 4PLTA 5HRUA 2FPGA 4TMFA 4R4JA 4IIUA 1I10A 4ZVVA 1A71A 5A9TA 3NV9A 2YV2A 3AI2A 4UUOA 2D8AA 4PLHA 3WGOA 4BOYA 2EKQA 4J1QA 2EKPA 4YA6A 2Q46A 1V8BA 1NAIA 4EJ0A 2HSDA 2J3HA 1DHTA 3H9JA 4CM4B 1HE5A 2B37A 1T2CA 4BO1A 4CMEC 5CG2A 3WB9A 1T26A 2ZKLA 4IMRA 4M55A 2HJSA 1HKUA 2G17A 4IJWA 5B4VA 3PYXA 5IDYA 2X58A 4FN4A 2C7GA 1M6HA 3DZHA 3GA0A 5K9ZA 3K2EA 1YL6A 3H9QA 4U6QA 1K2WA 2Q1WA 5DN9A 4K28A 2IZ1A 3W8EA 3FCOA 3RKRA 1EDZA 3ITKA 4IXTA 4TRMA 2VNAA 4TZTA 2AHRA 4RPLA 1H94A 2CDCA 5EINA 2EERA 3DFZA 3K2BA 5I9LA 3O8QB 1YVEI 3LSYA 4ND5A 5H83A 4DQUA 3NDRA 2QW8A 3TRIA 2X9VA 1EE2A 1MC4A 3FNGA 4OL9A 2NADA 3IJRA 4FFPA 1T24A 9LDTA 1P1RA 4PG7A 4RGBA 4YJFA 5I8ZA 1C1XB 3NRCA 2FPPA 3AU9A 4MKXA 3BTVA 1B8PA 1IB6A 4WCFA 2O3RA 1HDCA 2C5EA 4RZHA 1ISHA 5L4NA 3KYBA 3IS3A 2FWMX 2WD8A 3JD0A 3QWAA 4OOEA 4Z3KA 1H0KA 5JDIC 4RF2A 4CLEA 1PTJA 4FC7A 1GY8A 4YJFB 2Y67A 3U49A 1HZZA 1ZK4A 1OC2A 5FI3A 3LZ6A 5IDXA 3QVXA 3A06A 3KOUA 4W99A 5L7WA 2B69A 4WE3A 1GDHA 4DL9A 4R5MA 4BNGA 1GCUA 4A5OA 3SJUA 2PV7A 2AQIA 3HN2A 3PPIA 5TSDA 3UVEA 2J5RA 4A27A 5ITWA 3AOEA 1S6YA 4P4LA 5T8KC 3OIFA 1GUYA 1XCBA 5JAQA 1PS8A 3BAZA 1GL3A 3JYLA 5BR7A 2RAFA 4GI2A 3C7DB 4CM8B 4HFMA 2Q2QA 1NR1A 4AFNA 4RLSA 1GZ6A 1E1KA 1NHGA 5BNTA 4RVGA 3OEWA 3C3XA 1K3TA 4PIVA 1KEWA 4WLEA 2WEKA 4R1TA 3WSWA 1BG6A 4RDIA 4E13A 3EZLA 1N1GA 4UVEA 3CINA 1ADBA 3HE3A 5LC1A 1JQBA 2ZB7A 5IXSA 1XSEA 2X0RA 1UAYA 2VRCD 1MX3A 4P8RA 4QEDA 1N1EA 4RPHA 4D3DA 4B8WA 1X7DA 3RUEA 4N5LA 4A03A 2ZTVA 1UZNA 1LX6A 3CPSA 3BHMA 5IN5A 1NFQA 4Z9XA 2BGLA 4OKNA 4PN3A 4TRJA 3JQBA 3AK4A 4QFDA 2YV3A 5U1PA 1E3SA 2HRZA 3WICA 4NJMA 4ZU3A 1LLUA 4QT0A 1DBVO 1Z7BA 2EW8A 2OP0A 1NWCA 3RSHA 3U09A 3ANMA 4NBUA 1SC6A 4F46A 3WXBA 1DAPA 1ZKMA 3COSA 1U5CA 4FGWA 1A9ZA 3PHHA 4KDEA 1XYGA 3GY0A 3H7AA 2CDAA 1E7YA 2YDXA 4I5FA 1DO8A 4OQZA 2XPCA 4E6PA 1OI7A 1GV0A 1A72A 2WPGA 1QR6A 9LDBA 3H3JA 4GLOA 4JLWA 4MP6A 3CZEA 4I5GA 2AEFA 5L7TA 5MGBA 4A26A 1HEUA 2CSUA 3H5NA 3U0BA 5HWSA 3RQSA 3GN2A 4FFOA 4J2HA 3BA1A 3KBOA 4Q9NA 4YQYA 1JVSA 2X6TA 4CV3A 1IHXA 1GEEA 3S2IA 2OUIA 1C1DB 3G1UA 2GASA 3GLQA 1JGIA 3FRJA 5JFOA 3VZSA 2DBQA 3QWHA 3I6IA 4N18A 1G0NA 3VH4A 4U8GA 1VSVA 1K6IA 3WGZA 1UAGA 2IEBA 4MVJD 3OQBA 5HS4A 4C7JA 1PSDA 2PKRA 3WFIA 3IQDB 1Y5MA 4BB6A 2Z95A 1HDXA 3BMNB 5B4TA 2W4QA 4YJGB 1LNQA 4EYEA 1Y8RA 3LQFA 4XQGA 5A3JA 3Q11A 3MCVA 3ZWPA 4KWIA 4EJMA 3H5RA 2GUGA 2PD6A 1QSGA 1ISJA 2NU9A 5FEUA 5EERA 3UH1A 2NUAA 5ITVA 2BMAA 4INAA 1ISGA 2NU8A 4BNTA 3AOGA 3L4BC 3M1LA 3QV1A 2VOEA 5ES3A 1SMKA 1R12A 2GZ3A 1PZHA 4QECA 4IZIA 3PJGA 4KDFA 2BI7A 1YQDA 2HMWA 1LRKA 3ZNNA 2IDZA 3DC2A 4ZQBA 2GYYA 1ENYA 1O94A 3AY3A 3E9QA 4DA9A 4KQWA 1E5LA 1EVIA 3HSKA 4DPMA 4TRRA 4E2WA 3LT1A 2VHVA 5HS6A 4CM7A 1O5IA 2DFDA 1ZK2A 3RJ9A 3I9MA 3JQGB 3AU8A 4A2CA 1GCOA 4B4VA 4HKTA 4GSLA 4MDHA 4TRNA 5I7VA 1B14A 4PLGA 5H82A 3HDQA 4J2OA 4MINA 4YJGA 1NM5A 3BMQB 8ADHA 1DXYA 4OKIA 4R9RA 4CV2A 2BKAA 2GPTA 1ZXBA 1B8VA 1IHYA 1ML3A 4X54A 2DU8A 4F6CA 1U3TA 1T2AA 4WUVA 5JYDA 3IOYA 3SC6A 1KYQA 5DNAA 3O4RA 1PL6A 3OA0A 5KJ6A 5CPFA 2AXQA 3E82A 1EUZA 4Y8VA 3MOGA 5BSHA 3WQQA 1A7AA 2PLAA 3DBHB 3I4FA 3ZV5A 1PJCA 4G2NA 4CV0A 1I32A 1PJ2A 1IPEA 4QQRA 3U4DA 3D0OA 1Q7BA 3MJCA 1KBZA 4FS3A 4IDGA 3E48A 2I3GA 1K6JA 1DHRA 4BMVA 1ZCJA 2ET6A 4K26A 2J3JA 1U9JA 4R68A 3OJOA 1P44A 1PQUA 4TROA 2I3AA 3GG2A 1YDEA 3B70A 4IJUA 2VWGA 3W8FA 1RYDA 1GQQA 1VRWA 1W4ZA 2C0CA 4QO7A 3V2HA 1C3VA 4J90A 5CG1A 2WSBA 1K89A 1SCUA 2HRBA 3NYWA 5DCYA 5F1PA 2ZYDA 1XDWA 4L76A 1DRVA 1KETA 3TZQA 4BNIA 4CM3A 3JQFA 1XQ1A 5TS3A 4CR7A 1GV1A 1P0CA 4N5NA 4JK3A 5JLAA 4DLBA 3M2PA 4MIYA 1ZO8A 4RVSA 2E48A 4K6FA 4A7PA 2VWQA 4BO9A 1EVJA 3Q6IA 3DDNA 3TFQA 4MIEA 3RD5A 1GPDG 1Y5RA 4PRKA 4Q3DA 3RBXA 1TI7A 3DQPA 1LRLA 3ANNA 3QA9A 5CEFA 4LK3A 4JCOA 4RF4A 1VPDA 2J5QA 2YJZA 2NQ8A 4P38A 4Z0PA 1DDOA 1KEVA 4YXFA 3RROA 1PS0A 2EG9A 3ORFA 4M8SA 1I3LA 3OH8A 3GZNB 2WM3A 4DRYA 4AJIA 3KYDA 4BO8A 1NQOA 1UP6A 1MW0A 4Y6PA 1LDBA 1GFSA 2DAPA 3ONEA 4IDCA 5LDHA 4BNXA 4MVJP 3ZNPA 4Q3AA 1Z73A 3ST7A 4KUEA 2CFCA 2Y0DA 4RVFA 1N5DA 3HFSA 1PX0A 3Q9NA 4M86A 3ON5A 5IZCC 2P4HX 3PZBA 2J5KA 4ND3A 4NH4A 2R00C 1EK6A 4WCFC 1C0LA 4URFA 1Z7EA 4E4YA 3F4LA 1Z6ZA 2LDXA 2PTGA 1UDAA 3GQVA 1LDNA 4NIMA 3HDJA 3JQ8B 5EPOA 1HDRA 4LRTB 5AQ1A 1JTVA 2GN4A 3D64A 4H15A 2PA3A 3SEFA 4CM5A 3WGIA 2CF5A 3UCEA 3EYWA 4PLYA 4WLNA 4BNHA 5JS6A 4M89A 4D0SA 2YQ5A 3JV7A 1U7TA 3TOXA 3OFSA 5KKCA 1M76A 3AFNA 3GFBA 1DC3A 3K30A 2H63A 2VUTA 3CH6A 2HK9A 5CHEA 1EVYA 4CM9D 2J8ZA 1ENZA 1I8TA 4FJ1A 3L6OO 3KHUA 2Z1MA 3DAPA 3IDSA 3HWRA 4XR4A 3DZFA 1AXGA 4EUHA 2IYOA 4YT2A 1ZW1A 2DKNA 4CM9A 2GDZA 4BKPA 2PZJA 3L77A 1RYEA 4WLFA 3ABIA 3QSGA 2E82A 3MTJA 1TLTA 4XDYA 2FOIA 1HETA 3O8QA 3GDOA 1WMBA 4J7XA 1LU9A 3LDHA 1W6UA 3TZ6A 1CETA 2F1KA 1VM6A 4O59O 3UXYA 4L0QA 1ZVMA 1IZ0A 3FTPA 4BL5A 3G3EA 1R16A 5TLSA 1ZH8A 4HBGA 5KVCA 3STHA 1RM4A 3PQEA 2ZCUA 4J1TA 2ZTLA 1GQYA 1Q1NA 4IDAA 3WMWA 5B1YA 1UXKA 1IE3A 1CWUA 4AL4A 5KTKA 1UZLA 2O4UX 3JSAA 1PZFA 4JN6B 1S7CA 4N54A 4GVLA 1M67A 3GGOA 2NNLD 1DPGA 2W2KA 3OIDA 4XYLA 5IXYA 5JAMA 3BMNA 1WW8A 3ZZNA 1BGVA 2O2SA 3PJFA 1IYZA 4BMNA 2AG8A 2B5WA 3OECA 3JYOA 3L6EA 5TJHA 3WG9A 1B7GO 4JBGA 3CZRA 2NLOA 1JU9A 1EQ2A 4B3JA 1NP3A 1QV6A 2V6MA 4GMFA 3D3WB 3D1LA 2VWHA 2GN8A 2YFQA 4WCDA 1G1AA 3GR6A 4J0EA 4LMPA 3UW3A 3F4BA 4NI5A 4DQXA 3QVSA 4R16A 4I5EA 3GNSA 2HMTA 1PJTA 3GAFA 3KO8A 4DBVO 3ROQA 3FD8A 1BRMA 4GBJA 5B4UA 4J1NA 4IBOA 2UVDA 3E9NA 1PL7A 4Y6RA 4EI2A 4D0RA 1J49A 1DIHA 1H3LA 2IRWA 1QV7A 4J43A 3ENNA 3AY6A 3TJRA 5CDUA 1K5HA 3A14A 3RC1A 5C37A 3K92A 1LDYA 2NTJA 2YZ7A 5KKAA 4EEZA 3VPXA 3VZPA 1A4UA 5JO9A 3BMQA 3TOZA 2OOSA 5HBRA 1DRUA 1IUKA 4CMJA 3ASUA 4GX2A 4RQUA 4WJZA 5DP2A 3DBRA 5COAA 3Q1LA 2X86A 4BV8A 4YJDA 3AM5A 3GVCA 3NTOA 4CLOB 4CM6A 3GNTA 3KETA 3PTZA 1MB4A 3VPSA 1ADGA 1P77A 3DTTA 4C7KA 5KIAA 1H93A 1O6ZA 1IZ9A 3HB4X 5A04A 3WNVA 2GGSA 1R4NA 4RVDA 1MW3A 1O8CA 1YBVA 2IXBA 1E7QA 3GHHA 4XRGA 1LSOA 2PH3A 1P45A 3F47A 4L75A 4NFYA 3OJFA 2Y68A 5JMWA 2VZ8A 3RIHA 1E3IA 3B1FA 5IAAA 1NWHA 1HWYA 3WSVA 3LU1A 3ZU3A 2Q2VA 5BSFA 4ID9A 4WECA 5HM8A 4H16A 3WIEA 1G6KA 1N92A 3GVIA 1DJQA 1OR7A 2A9FA 4W9NC 1DOHA 4CMHA 3V8BA 2V7PA 1JLLA 2NM0A 2YFHA 1PZEA 4GWKA 4MVJM 4A73A 4BKRA 4UEKA 3PK0A 2DT5A 5A9RA 1X0VA 3TL3A 1QORA 3LF2A 1WAMA 2BELA 3GDFA 4N7RA 3RBZA 1E6WA 5A5EA 4CL8A 3HDHA 1YH3A 3KB6A 3C1AA 2QRKA 3E6AA 4I9NA 2QHXA 1PJBA 1YRLA 2JD2A 1T2EA 2NVBA 1E92A 1YJ8A 1AHIA 2O3JA 5EQFA 1H2BA 2HO5A 3NGXA 4Z0HO 1KC3A 1WDMA 4E5MA 2ZJ0A 3NTQA 3PHLA 5TIIA 1PWXA 1R4MA 3IUPA 3I9KA 4IDEA 5GY7A 2JD0A 1RJWA 4YACA 1YOVA 3ADPA 4OJNA 4WNCA 5F3RA 3U3XA 4AJHA 3CIFA 4PLPA 1R4NB 2OMEA 5A06A 1JKJA 1F8GA 5JDCA 1RM0A 5CDYA 1MGOA 2VYVD 2CZCA 4Y9DA 3F1KA 3IKVA 1QYWA 3PVZA 1JWBB 2X0JA 5DCWA 4QUKA 2FHSA 4UAGA 1EE9A 4EZBA 3VVCA 5AXBA 4D41A 5JDIA 1OBFO 5JCJA 3SJ7A 4CQMA 2RHRA 1MW1A 3VDRA 1KY4A 1YBMA 3QWFA 3WQRA 3O26A 5IN4A 4IS3A 3P2OA 4XB1A 4DUPA 3H6KA 5L53A 1T4BA 2GERA 4RZIA 4NQWA 3A28A 1YWGO 2ZB8A 3DZBA 2V6FA 1F0YA 3UEQA 2W2LA 4ZQFA 4ND2A 2Y99A 5JE8A 1DRWA 1NPYA 3UF0A 2OP1A 2QYTA 4HY3A 3ONFA 2HMUA 5JDCC 2Q1UA 4CMEA 2QRLA 2CDBA 1F17A 1I2ZA 1VSUA 3GEGA 4XQCA 1NASA 2Q45A 3BZUA 5T57A 3ICCA 4W9NA 1HRDA 2YYYA 7MDHA 1UR5A 3V1UA 4BKUA 1OMOA 2AQ8A 2UDPA 4I1IA 4IQ0A 1DC5A 3DMYA 3GGPA 1V35A 2R2GA 4L8VA 2PGLA 4BV9A 4ILKA 4BVAA 5ER6A 2ZATA 3GHYA 1ZSYA 4XWYA 3S2FA 1TB4A 3D4PA 4XD2A 4EGFA 4EBFA 2D5AA 3WYBA 2UV8A 1SB9A 4OIMA 3ZH2A 3GEDA 1UXJA 3ZCXA 3K5PA 1HF3A 2D0IA 1M75A 3SBOA 1B0AA 3W8DA 4XJSA 2DTDA 1MVYA 1HSOA 3I3OA 3K8ZA 3H5AA 1Y1PA 4EW6A 3G0OA 3NT5A 3PFFA 1K0UA 4FLQA 4O0LA 4LUPA 1QKIA 5JCXA 1VKNA 3LLSA 5I9NA 1NVTA 2DC1A 1DIAA 1Z75A 1WMAA 3DOOA 4RV9A 5T67A 3I9JA 1AHHA 3EK2A 5FF9A 1DC4A 3A4VA 3I9NA 4BO4A 2BD0A 3TZHA 1CF2O 1N7GA 4PRLA 1GEGA 1P33A 1U1IA 3DZGA 3ZI0A 4UULA 4ZN6A 5AXCA 3WLFA 4E5KA 2V6BA 3PZRA 2Y93A 4CMIB 2CMDA 2GRAA 1ZXLA 4OH1A 1OZAA 2X5KO 3DBVO 4YVFA 4WK6A 1MLDA 3Q0EA 4LCJA 2X1HA 2G1UA 4CM4A 1LDMA 4YAKA 1M66A 3JYNA 5TX7A 4KTVE 2DBVO 3BIOA 2AQKA 1U3WA 5LDGA 3WX0A 1LLCA 3NJ4A 3VTFA 3JTMA 4CUJA 3E18A 5JW6A 5A5FA 1ZEJA 4U7WA 4JJGA 2I66A 1VL0A 4B4UA 2OGUA 4CMIA 3F46A 2X9GA 4J49A 3K73O 3L0DA 4AJPA 1ULUA 1UXHA 1EZ4A 3PP8A 3RUIA 2IZ0A 3ADOA 3KSUA 2ZYAA 3GK3A 4WKGA 2DUWA 4NNJA 2YDYA 4LRSB 2I6TA 1XG5A 1D3AA 5I7EA 1U2GA 5F5LA 1TT5A 1C0PA 4K9DA 3FR8A 4GWGA 3HFGA 5L95A 2O3SA 5A9SB 4XKJA 1H2HA 3W6UA 3A9WA 1FDTA 2J6IA 3VTZA 3ZU5A 3FNFA 3PQDA 2DLDA 1BHSA 4AJLA 1YS4A 5KJFA 4BO0A 1E6EA 4W4TA 4BNNA 4YAEA 3C7CB 2PKQP 3I1JA 1DB3A 4XDZA 3D5TA 4UEJA 1ZUD1 2D4AA 3K9QO 3U62A 1N9GB 3WQSB 2YV1A 4IJVA 2O3QA 2C20A 4AICA 2QRJA 4GQAA 1H6AA 5ER9A 4FFLA 3TNLA 2AE2A 2D59A 2OO5A 4W7HA 4DTIA 3VHRA 1RPNA 2EP5A 3AJRA 4L9RA 3TPCA 4WOJA 4D43A 1G5AA 3ZWOA 2VHWA 1KEPA 2P9CA 3UN1A 2VRBA 1BW9A 3PXXA 3WFJA 2HKIA 1I3MA 4TKMA 3VAZA 3RUAA 2CY0A 2B36A 1P74A 2G82A 2V6GA 4GGPA 4OQYA 3DL2A 1MV8A 1YDWA 3GUYA 5DDIP 4R01A 3V1YA 4TZKA 2VZ9A 5CDSA 3EVNA 2TMGA 3U4HA 1E1NA 4YBZA 1EFLA 2OL4A 4FW8A 4PGFA 1H6BA 1CDOA 3WGGA 1ZK3A 2DPHA 3C1OA 1NPTO 2EHDA 1QLHA 5CP8A 1WDKA 3PDJA 3OMLA 4CQMB 1QP8A 1RWBA 1Z45A 1GYQA 2J3IA 1R6DA 2ZJ1A 3CXRA 4HFJA 4ND1A 4IY1A 4NZ9A 1DFHA 2C2XA 2P5YA 1HDZA 2OORA 2A92A 4RL6A 3H65A 1UDCA 4BNKA 4GGOA 3I9OA 5DBIA 3HUDA 3MJVA 4B3HA 2P4QA 4OSPA 4UVGA 3HJAA 1ONPA 3ZNOA 1QYVA 2ZTUA 4RO0A 1HDOA 2B4QA 5DULA 3M6IA 2GNAA 4II3A 1PGJA 3S1LA 2GF2A 1XEAA 4HXYA 4LSWA 3SLGA 4BNJA 1ZZEA 3PGXA 4U0JA 1MG5A 2FR8A 4WLUA 4DIOA 2EJWA 5EIOA 2EW2A 3L4BA 3N74A 4MVJG 5JC1A 1J5PA 3SVTA 1P0FA 2VT2A 2O7QA 1WLYA 2VTDA 4CMGA 3BHJA 3GFGA 4JNKA 5BSGA 1GU7A 1RP3A 4UVIA 5B12A 1ADCA 3PHIA 3RVDA 5I9MA 4EDFA 1I01A 3WTCA 1SEPA 1ONOA 4NU6A 1AN9A 1D8AA 1MC5A 1ZMTA 2JCYA 3PHJA 3QP9A 1FXSA 1KERA 4E0BA 1CRWG 3PFWO 2PK3A 4J7CA 4ALKA 2HCTA 4E21A 2BRUA 5GZ1A 1EUDA 5KVSA 1MXHA 4JP2A 5EN4A 4HUJA 1GZ3A 1AGNA 2NTVA 3IUSA 2BF7A 1Q2XA 2LDBA 3ETEA 3RUHA 2YHIB 1U3VA 4YCAA 1PJ4A 1Z82A 2HU2A 1IPFA 4E2ZA 3ZV6A 4J7UA 3NAQA 1U4SA 3I23A 1U4OA 3E5RA 3VZRA 1O89A 3WGYA 1NFFA 1PJSA 1D7OA 1V3TA 2Y0CA 3OEYA 5T64A 1IL0A 2D1YA 4YT5A 4OYRA 3IMFA 4WASA 3T0YA 1UH5A 4AJOA 2Y1DA 3WBBA 2Y1OA 1LUAA 2YHUA 2VHZA 3QWBA 4QSMA 2ZK7A 4BKQA 1D1TA 3PLNA 5FI5A 2HK7A 3QE3A 3RFXA 4QTZA 2R00A 1BXKA 4BO5A 4BQPA 5BSEA 3GPDG 1C1DA 3F1LA 4YJHB 1NQ5A 2YQ4A 3FPCA 4RVHA 3ZDFA 4E5YA 1YQXA 4Q3EA 4J4HA 4RJTA 2OBYA 4NBVA 3W4JA 2YUTA 2GN6A 4RDHA 3VKUA 1R0KA 3LVFO 1J4AA 2FRDA 1XA0A 2PWZA 3GEMA 3AM4A 3PEFA 1CIVA 1T4DA 2RH4A 2DTXA 4FOOA 1AUPA 5ADHA 4J9VA 1YGYA 3P7MA 3JQ9C 1NTOA 4AJNA 1ZK0A 3TZCA 1XLTA 1HL3A 2G0TA 2P9GA 3HG7A 3ZWCA 3QLJA 4CMAA 1X1EA 3IP1A 3WR5A 3FTNA 2F00A 2VHXA 4HP8A 3O03A 4NK4A 1MG0A 1BW9B 4YR9A 1E5QA 1G0OA 2VUSA 1H9BA 3G79A 3B1JA 4JP3A 1P1FA 4XQ9A 5KJ1A 4MJLA 4A0SA 4CUKA 5A05A 4PFJA 4CPDA 4E2YA 5BNIA 3KLPX 1WNTA 1PQPA 2VYVA 4L73A 5C5IA 1VKOA 1N9GA 1UJMA 1R15A 1X7GA 4XJTA 4MP3A 4H3VA 2NWQA 4LCEA 4GX1A 4P4NA 1Z74A 3DZIA 4K6CA 5FYDA 5FWNA 2JCXA 5COBA 4YYZA 5TQVA 3GOHA 3FBTA 4L4XA 1Y9EA 2UAGA 3RWBA 4IINA 4BGVA 4D46A 2E49A 1Q0QA 2C54A 3TWOA 2PGJA 1QYDA 2VRCA 4YEDA 3GDGA 3I52A 1HYHA 1KVUA 1R0SA 2ZB4A 4G81A 5ENVA 3ZWAA 1B16A 2I99A 2Q2WA 4HV4A 1C14A 1O0SA 4EUEA 3GGGA 3JD2A 4DVJA 3GVXA 4Z9FA 1PEDA 1ONNA 2PZKA 3GVPA 4UEOA 4GKBA 1A9YA 4IXWA 2XOXA 1QRRA 3DHEA 2HDHA 3OICA 3WTBA 1B15A 1BVUA 3F9IA 3RI3A 3INGA 5A1TA 3IJPA 2JL1A 5K0ZA 3VPFA 4ALNA 4M49A 1SO8A 4GKVA 4J4TA 4BNUA 4HWKA 4BB5A 4A10A 5H81A 4F45A 4PG6A 4Q3CA 4YT4A 1WP4A 4AJEA 2E37A 3JQ7A 2WDZA 4L4SA 2WE8A 5JMPA 3KTDA 1GD1O 3Q2IA 2EJVA 1FDWA 2D2IA 1N7HA 1I2BA 3S55A 3DMTA 4DYDA 2IEDA 5K6AC 3MZ0A 4WPGA 5IDQA 4NG5A 1HSZA 3T7CA 2VN8A 2BHLA 1P3DA 5BT9A 4IJKA 3FBGA 2I76A 1F14A 5IF3A 3L9XA 2ILTA 1CYDA 1EBUA 2WJPA 3ULKA 4OHUA 3R3SA 3JQ8A 1P31A 2O2YA 1GYRA 4JJFA 5LCXA 4D79A 1PJQA 1VL6A 4HFNA 1HE2A 3ZWVA 1EUCA 2G5CA 4FBGA 4M87A 5JY6A 3B6ZA 4CR8A 2X22A 3BMCB 3SC4A 1ZMOA 2VHYA 4XEHA 4FC6A 2OBNA 3NTRA 3WWZA 2B0JA 4AJ1A 3AI3A 5F5NA 1ZS2A 4MPDA 3LT4A 1JG9A 4AYSA 5L4LA 3AWDA 5A02A 5TNXA 3QHAA 1ZK1A 2Y1GA 4ALMA 4DXHA 4ZD6A 1EQUA 3KYDB 1PJLA 1GAEO 3S2EA 3IIEA 1E3WB 2YHIA 2EV9A 4YWJA 3FSRA 5J23A 1A4IA 4OOFA 1CJCA 4PLZA 3RC2A 5CPBA 3TDKA 1IOLA 1C0KA 3D7LA 5I7FA 5L51A 3U5TA 4WEQA 1BVRA 5BQFA 1PGOA 1X13A 3HHPA 2WWRA 1Q0LA 3EVTA 1EEHA 1ORRA 4NFHA 3TSCA 3GRKA 3MWDB 2AMFA 3QWIA 5EMHA 4BGIA 2DVMA 4AJKA 4PG4A 1U3UA 3WNQA 5BNFA 1T2DA 1L1FA 1PL8A 1HE4A 1LQTA 2X7HA 3CUKA 1F06A 2P9EA 1PWZA 5AOVA 3GMDA 1M2WA 2BGMA 4PG8A 4XRRA 5TT0A 5C3MA 1LEHA 4J9UE 4DIBA 3G49A 3U4IA 4NBRA 3T4XA 1PGNA 1HTBA 1PJ3A 3H9EO 2PNFA 2C5AA 3WOHA 4E33A 1I5RA 1W73A 1BDBA 2YY7A 1H6DA 4QFCA 1HDYA 2O4CA 4IDFA 2CNBA 3EHEA 2FR0A 2QG4A 3DAFA 1I30A 3W1VA 1J6UA 4ZGWA 5DBFA 1R4MB 1U5AA 2BLLA 1Q7CA 3K6JA 2GN9A 4R69A 1VE9A 6LDHA 3KM0A 3KXDA 1ISMA 4FJ2A 5F1OA 5L45A 3W6ZA 2WTBA 3ROMA 5ILGA 1GR0A 2ZIZA 3GAZA 5I8WA 1SPXA 1LQUA 1YE3A 4BNYA 1TT7A 5CAEA 3UERA 3LK7A 5KOIA 3UCQA 4PVDA 3E03A 2PZLA 4DWVA 4AJ4A 1D4FA 2VNSA 4AG3A 4YRDA 1EK5A 1PU2A 1V9LA 3RC9A 4E3ZA 2NTNA 1TA4A 4R1NA 3TZKA 3OJ0A 4R51A 5DOZA 5ENDA 3OETA 1WWKA 1OFGA 3LC2O 1MFPA 5JCJD 3CSDA 3NDIA 1U8XX 1K6XA 1E3JA 1WXDA 5JAIA 3NKLA 3FI9A 4LMRA 4XIYA 4B3IA 2BI8A 3R0IA 4XGKA 4RVUA 1YB1A 3MWEB 3DWFA 1VC2A 4D3SA 1IULA 2GR9A 3CTMA 2DBRA 4XQEA 1E7RA 2AEJA 3HZZA 2FZWA 3V5NA 3MEQA 4Z6KA 4L4RA 3WYEA 3PRJA 2Q1TA 2Y1CA 1QYXA 5THQA 2E6UX 4RORA 1I3KA 2FP4A 3VC7A 5CEJA 5G0VA 4PZDA 1UZMA 3MJ4A 3WIDA 5G4KA 4UUMA 4MVJI 1LXCA 5T5QA 3PWZA 2FY8A 3ROPA 2AQHA 3ZV4A 2IODA 4IGEA 5CDGA 4GLLA 3IC5A 3WDSA 1FMCA 1NNUA 3MJSA 1C0IA 1I0ZA 2E4AA 2JAPA 3DO5A 2VOJA 3JQDA 4YDRA 1R66A 4IZHA 5G0SA 3S2GA 4B7XA 5IZCA 4TSKA 1NX6A 4HFRA 3SX2A 4JGBA 1E7MA 3DZKA 1JDJA 3MJTA 1XU9A 1NVGA 2I65A 4ND4A 1LSSA 4KP7A 3WLEA 3QVTA
chains in the Genus database with same CATH superfamily
3ZZ0A 5C46F 1V4VA 5KYTA 2H52A 4M38A 2ZUWA 1U7DA 4MUAA 3D3NA 5DEIA 3NZEA 1JTFA 3VDNB 2EF1A 4C87A 1TMOA 5LBIA 1QCZA 2OLEA 4J3NA 1XQ6A 4H17A 1IOWA 4WY5A 5BUCA 5AVUA 2I8AA 1CDEA 4DAOA 2JAQA 1LPAB 4IRMA 4XN4A 4DV3B 1I33A 5JJIA 3RS9A 1QS0A 1OLXB 3WHPA 4ZI7B 1FSFA 1RP7A 1GZHB 1YT5A 5HZGA 2Y3IA 4RK6A 4ZOLF 5IFKA 3NHMA 2C4UA 1TJ4A 2VUUA 4HMPA 4LJAA 3HEMA 1K63A 1MENA 1AXEA 4RJ2A 2JS7A 3EHDA 4QOFA 4JT2A 3WKDA 4QBTA 1SHKA 5HKAA 3A2LA 5BQ3A 4KVAA 4XYEA 1E0AA 1EESA 3KPUA 2RGBA 3Q3IA 1TYBE 2VYND 4MVXA 2YW9A 3H6GA 2F2TA 3AOEC 5KCZA 5KNCD 3T34A 4A3SA 1BXGA 1HE3A 1SC9A 3E4CA 3NGLA 1PNRA 5L7YA 4OSOA 2P68A 1RHRA 4NXNB 3B37A 3TLMA 1USGA 3HM2A 2F64A 4XXHA 1LLQA 1KJNA 2ZT7A 1KQGA 1DT5A 4FHFA 1SVOA 4OQ4A 3JQAD 1RQ2A 2FUEA 1XCLA 3JALA 3W2FA 1NN1A 2C58A 1C7FA 1HZJA 1WBJB 3HKDA 3N76A 2HU7A 4M1SA 2CLIB 3LV8A 3PTLA 1Q77A 1XTTA 3C7AA 4JC4A 2B35A 3JWGA 5L3ZA 3OF5A 3P9XA 2OCDA 4IMPA 4BUCA 4UXHA 3BT7A 4G4GA 4XASA 2GF9A 3DMTC 3LT0A 5JNLA 2GTHA 2PD3A 4X91A 5SYMA 3U0VA 3RUCA 3V8MA 3G2PA 3NONA 4JB8A 2CXRA 4A1OA 4Z4CA 4ZALA 5A03A 5JPIA 3PHGA 4CF5A 3FYCA 5A4DA 2HV8A 3F4KA 4GM0A 1SVMA 2QWXA 3MD9A 2CJWB 5LKRA 3R9XB 3LQ2A 1KE2A 1PWYE 2O2XA 1GVNB 4U6SA 1YC5A 1KOLA 5JISA 5KOHB 1K7CA 2Q3LA 4OL0A 3SQDA 2X5NA 4GBGA 5C8DA 3E7XA 4LZLA 4CL3A 1BCSA 4B17A 3N59A 2GM4A 3IV7A 2FSUA 3W4IA 2EIHA 2V59A 4WZAB 1N8TA 2QEQA 3FGZA 2WYUA 3SQNA 1J9ZA 4DARA 1JE1A 4ZCIA 1KZ9A 5HKKD 3FWNA 1BXZA 2B8TA 1CY1A 1KVSA 4M53A 5K8JB 1ADFA 3B3JA 5EJ8A 1LSUA 1UQRA 4JLDA 1SBYA 1JKIA 1VBMA 1QKKA 2FMIA 2O05A 3ZWWA 4BCCA 1Y6RA 3UA4A 1CE8A 4HDKA 3ZHBA 3BCHA 4HNHA 4N65A 3RAJA 1APBA 1X0XA 1E79A 1G38A 2OBLA 3PGJA 4O2BB 2XUIA 3ZYZA 4HGPA 3UWOA 3L7JA 4O4HA 4RY8A 5F2EA 3LT2A 3UZUA 5AK6A 3ICQB 3BVPA 1KYTA 3PWSA 2WQ7A 3V1MA 1Z5GA 3C85A 3D4OA 4O2BF 1E7WA 4C2AA 3OSUA 2CXXA 3PGVA 4G0NA 5K6RA 4PCVA 5J4KA 2CGEA 4O5OA 3LFHA 1UEIA 4G5XA 1LW7A 1YZVA 4UATA 3WL8A 1NBEA 3EG9B 4GLBA 4XN9A 1GNTA 1GPH1 2LGJA 1FIUA 3EFHA 1SH7A 2CXHA 2JGLA 3K31A 3MBIA 4Y67A 1JYFA 1K08A 1UC9A 1KIFA 3AY0A 2NYUA 2VQ3A 2ZQZA 3HJCA 4Z9AA 5C9ZA 5G4KB 3VH2A 3A1CA 4BJ6A 2WHRA 4X2UA 1JR4A 2IOQA 3EVGA 3AG5A 1D0SA 2DPXA 2ECKA 5KVVA 1PR4A 3MQFA 1NVDA 3WMXA 2PANA 5KJEA 1M0SA 2IV2X 5EAIA 1RKBA 4B47A 2J9RA 4WLOA 5YASA 4DF3A 1NBME 5L4SA 4O4IA 2R2AA 2FPOA 2GLXA 2O2IA 1P7VA 1QYCA 2QD3A 4BQPA 1G9TA 3JYQA 3ONVA 1VKZA 4FCCA 5JS7A 4GKKB 3LHKA 4HWRA 1BVHA 2BUBA 4KDRA 3RTDA 2AJCA 2VPWA 2NYRA 3ZGNA 5ADVA 5EWJA 1K4KA 1ZPDA 2GK6A 5DI3B 4DC1A 4AKIA 4GBMA 3UUFA 2RD2A 5C18A 2YZKA 1HS6A 2I33A 3CNHA 5ARBA 2IELA 5F7XA 1UP7A 5TMPA 5TJ9A 3PYLA 1DADA 4AS3A 1W44A 4NECA 5K4HA 3JQRA 4ZO8A 4UREA 4LRWA 1COZA 4DMLA 2IF0A 2AEMA 1FXWF 2WHYA 1Q14A 1RFGE 1JG7A 3ZX5A 2W5UA 1GUAA 1YDGA 3R6GA 3R7SA 1GKYA 2J07A 4DMCA 3ZD7A 2DM6A 2X76A 1QTQA 3MBKA 5GGYA 4JJAA 5J63A 4YUXA 5IYZF 3OUUA 4YAOA 7REQB 2AOUA 2R44A 5IDWA 3BN3A 1UBTS 1ODLA 2QZZA 2XAUA 1ESZA 1ZDMA 3UY4A 1PR0A 3K94A 1W5EA 1M6WA 1R9MA 1QGOA 3K6KA 3W9BA 4E30A 1XQXA 3DH0A 5JBQA 5I5GA 1R0WA 2B2NA 1TU4A 3CR8A 4MQFB 3ROXA 5FPKA 1WCIA 2K7FA 1D5CA 3H1BA 4NOJA 5HVNA 4UU1A 2VH5R 3FLMA 3OIVA 4EKIA 3I73A 3V8VA 4LVOA 2ZR9A 3IIIA 2C2BA 4I5DA 3ZHTA 1OZ0A 5IBPA 3ANSA 4O1HA 2VF8A 3U3DA 1OXMA 3IQGX 4BNLA 2AYYA 4CW7A 4ZQGA 1VI2A 3JCZA 1JR2A 5EC8A 3UT0A 3O1HB 2BMJA 1TW2A 1NR7A 4XJVA 3RU7A 3O4GA 5FRDA 1XZNA 4QX6A 2VL7A 1NP7A 1LBEA 4QJ3A 1YBAA 2AWNA 2XADA 3AM3A 3X3HA 3L6RA 4WZBA 2ODNA 1JWLA 2ZPAA 3N28A 4G5FA 1WZNA 1KDTA 1R0BA 2QX7A 5KNBA 4WXPA 4J76A 1XRLA 2AYZA 3KV1A 3KJNA 1PYDA 2Q2NA 3IKLA 4QHSA 5IUKC 3Q5EA 1D2AA 2VNJA 2VP6A 4I1YA 2B99A 3EYAA 4MVJE 3VYRB 3PUVA 3T3HA 3UAGA 3VR3D 3UTDA 1A9XA 3PB3A 2RKOA 4KEAA 5JSYA 5C3UA 1XEWX 1W0JD 1PR6A 2PY6A 4FOSA 4KL8S 4UHFA 3RRZA 3EZ2A 2OZPA 3DL0A 5K8TA 2HY7A 1TD9A 1QDEA 4KWHA 2BH2A 1K6EA 3LCVB 5AM1A 1RYMA 3IBSA 1B0ZA 2ZANA 4DDKA 4GE0A 4PR3A 5HTOA 4B3XA 2V5AA 2OENG 3MWGA 2HAEA 2MSKA 2RGDA 2CNWD 3UAZA 2I87A 1VHWA 3U9WA 1XZJA 2OFPA 1DQNA 1NAHA 1WVGA 1XZQA 1CNFA 2VH1A 4HEHA 3VO9A 5JR3A 4EJFA 1JEAA 2Q99A 1JIQA 4UUPA 2VPTA 4F1JA 2AD1A 1GXSA 3LX4A 1M2HA 5JYEA 3COPA 2QIOA 1ECPA 3AVUA 1RFLA 3FWZA 4DBLC 3JRXA 2WG2A 3LWDA 2IWRA 1S2MA 4P7JA 4R8RA 1R0CA 3WL5A 1EWRA 3HI4A 3IAFA 3U6KA 4BX9A 2C9YA 3T4EA 1L1QA 1LTHR 2OBFA 4OGWA 4PAMA 5DWQA 4OHPA 2GPBA 3LQRA 3ZU4A 2XAAA 3VHXA 4MLZA 1QFSA 1Q15A 1M3SA 4DM3A 3W6PA 4OU5A 2O2HA 2SHKA 4MW7A 4DGSA 4EUSA 4TVSA 2BPOA 2NU7A 3ONWA 5FAKA 4W7SA 1S2DA 3EPRA 2BEJA 1T2FA 2MINA 4YAGA 5KTOA 3IAHA 2QTHA 4WVLA 3IQXA 4CIXA 3X1YA 3VC1A 4M76B 2C5SA 3OOSA 3N58A 2WJIA 4I9HA 4NG4A 1GTRA 4LDAA 3W8RA 4BQQA 4QQ8A 1U7XA 2JFFA 2QG9A 3TE6A 3E27A 4A16A 2HGZA 4MV1A 3WJAA 4F3RA 4B44A 2L17A 2HU8A 4ZO7A 1QUEA 4Z4QA 5DGCA 3TRDA 4DLLA 2I34A 3U19A 3OZGA 4NR0A 1QGAA 2C7VA 3GZ4A 5ARDA 1R6XA 2IE0A 4F4HA 2J7PA 3DJFA 3ABSB 3BCSA 3I83A 4LYJA 5MFPA 1KJWA 4YCMA 1VJTA 2HSGA 3C1UA 1T0PA 3QJ5A 1I6LA 1HY3A 1VLHA 1X14A 2XD9A 3ITDA 3CJRA 3KSMA 4HVTA 5KSOA 2V7XA 4QM7A 4PONA 5B64A 5FOXA 1UMBA 3SCZA 3HGTA 2ZUTA 1BA2A 1HLDA 2ORED 2PS3A 2HC9A 1DO0A 1U90A 2ISSD 3U16A 2VP0A 3MMZA 1SCNE 4U5QA 3R7NA 3ZGLA 2DWCA 2FZEA 4JIMA 8ATCA 1ZA2A 1GRCA 4WDQA 5GZ3A 2P5UA 1X42A 4DLAA 4FR5A 2RGRA 2IOFK 2J0QA 1TVKA 2PWAA 4MKRA 4DCTA 3MILA 1ABFA 1NY5A 2UKDA 5LA6F 1NGSA 3IDQA 4FDAA 3V7NA 3TZLA 4H7KA 1C4XA 2H1IA 3QXHA 1M0WA 3D1JA 3N8NA 2BY4A 3OEHD 4P9NA 4PFQA 1INLA 5B1HA 4LHEA 3UK7A 5B58C 1JAXA 4UMVA 4A8PA 1JLMA 4XI9A 3U80A 2OV1A 3THWA 1KU6A 2OXIA 5KNLA 1TM5E 2JAWA 1LI4A 3FJOA 4K9OA 1AC5A 4CN8A 5J2UF 1GQOA 3WRVA 5EVCA 3SE7A 2BL4A 4JQOA 4XAQA 4GH5A 5AJWA 1QJCA 5EHNA 3W5HA 2FN4A 3GLRA 3UT6A 1KP9A 3LBIA 3UAWA 3AUSA 2VDLB 4HK4A 3RHFA 4QUDA 1JA9A 1WF6A 3AINA 4OXNA 1LI7A 3HL4A 4LY9A 3GRYA 4X5OA 2AVDA 4X61A 4FSHA 5AKLA 2VXOA 4JBYA 3ZWKA 5G0TA 1R8XA 3KQOA 4O8ZA 3ETJA 3CMCO 5FJJA 4KQMA 2W6PA 1XRJA 2QL5A 2RIRA 2PIAA 4LXGA 1Z38A 1Q84A 3EZ9A 3GYBA 5K3SA 3FZYA 3WGJA 1PSWA 3DHYA 4EW3A 3FE2A 3Q40A 3VBEA 4OBBA 1JZTA 4KYIB 1C0EA 3GLHB 2C84A 3NUQA 1UDRA 3WZLA 3ROKA 1AF4A 1GG2A 2JATA 5AI4A 2Y4OA 1BMDA 3VR4D 3UHOA 5DLLA 2QX8A 2O1XA 4IQ8A 4DSNA 3EMBA 1YZHA 2OHFA 4FGKA 5KUTA 2WHQA 4U2DA 5MGNA 1TEZA 2EGHA 4GZMA 4RACA 1MGPA 1P1KA 1S8AA 1SHLA 2BFFA 2LPMA 2FTKE 3FU6A 3H8JA 3KYCA 4FFWA 4NMMA 1PS9A 3WYCA 1E9CA 3MTIA 3HUTA 4D3ZA 4IWXA 4WEOA 2GPNA 4PYLA 1NKSA 4HQKA 4EK9A 1PDVA 2RCYA 4CETA 5I9SA 4UU8A 3NEJA 1PR1A 4PC3A 1D1SA 2EOAA 3FPGA 3V1TC 5E4TA 1NL3A 1E0KA 3CEPB 5D87A 5U4QA 2PSHA 4GMGA 4PQFA 4P54A 3DZCA 3RPEA 1SIOA 1I9CA 5AW1A 1EFKA 2IZ5A 1JBQA 2CVOA 3H75A 3P71T 3S6JA 3UMYA 1NUSA 3LHDA 4MJXA 3SBEA 4KMSA 1P4HA 4NK5A 2Q50A 4CRWB 5CT4A 2HJVA 2AB0A 2GN0A 1O97D 3D4NA 1VPLA 4EUFA 1QO9A 4Z4FA 2WJAA 3TJZA 1B2RA 1JDUA 1YDMA 1T36A 2WKSA 3K09C 1G18A 4PU0A 1U7PA 1UMCB 3AI1A 3VSEA 3GEHA 2WUEA 1E2JA 1ZSNA 2N47A 4R1SA 1PVOA 4Q5IA 3CKYA 1ZUWA 1DFGA 4QDUA 1ZICA 1E5VA 1SWWA 2GZHA 5IZ4A 2CYCA 4E2XA 4W1QA 5CFNA 4OI1A 3AW9A 2XXJA 2J3LA 5E3HA 1OC4A 2VF7A 3PCXA 1KO8A 2VRWA 3QLVA 4Y6OA 3EGXA 3TLXA 1JDTA 3B12A 5MDHA 2VPZA 4D9EA 1JKFA 4LC9A 1W2HA 1L7DA 2J4DA 4CXFA 3KWJA 4KXVA 4OI0A 1ACMA 2GN2A 2DR2A 1XMPA 4ALLA 1GGFA 3E81A 4WKCA 2VC2B 2Z57A 2ZSUA 2IUYA 3EMKA 3B7GA 4KWCA 1OAKA 5F3DA 4PVCA 2QTBA 3OFVA 5FBQB 3IRVA 4GO1A 4CKWA 3O4IA 2OV2A 1UQUA 2YHAA 2V0CA 1X7HA 3S7ZA 2OV6A 4I14A 621PA 5DZSA 1YFLA 4O08A 5LQUA 1O5OA 2YWCA 1HTWA 1U3DA 3DP9A 1CY4A 3AJDA 2IYWA 1OLUA 5DBEX 1FFEA 2VSOA 4ITUA 1L5MA 3R3JA 3HB5X 3LQ1A 5FUQA 4EVSA 4W5WA 5I45A 2P3SA 2RHTA 1NU8A 1NIPA 2HMSA 4Y2JA 4Z53A 1A82A 1YKFA 3NBYC 2A3NA 3H87A 1VJRA 3ACCA 3A6FA 3LHIA 1VZ2A 5FWAA 4DVGA 3CX3A 2QYHA 4IS2A 1UXOA 5FIUA 5I9IA 5KREA 1I2DA 4OQEA 4HO1X 3NR2A 5IKPA 4KWTA 1MW2A 1GNSA 4E5DA 4EHAA 3THYA 1L8OA 4MQLA 1XE3A 1E63A 3U37A 4BGEA 5DLYA 1Y8QB 5A4MS 2HK8A 1Z2EA 1RXCA 4XYBA 3KSDO 1WW2A 2FMUA 4M8LA 2A5YB 1XEXB 5KVQA 2JDID 3EXHA 1MH9A 4XGIA 1DAFA 2IX9A 1PIWA 3KAKA 4Y1EA 1SC5A 4GPAA 1L5OA 1XAGA 4LYDA 4CLXA 4ZICA 3T38A 1BU5A 1L9KA 2E0IA 4DYVA 1CF4A 1E7SA 4DBZA 3GPIA 1N8KA 4U2FA 1NBWB 2GK4A 2Q6KA 1LJ8A 4S2UA 4G0ZA 1G7CA 4TM7A 2HJRA 3HNRA 4J91A 4XUCA 2HHAA 1ZHOA 5AKJA 4RNCA 4OPMA 1JPNA 3CU5A 4MW9A 2AUNA 2XB9A 5HKKA 4MWZA 3T9AA 3FRIA 2J4CA 3OCYA 1M2JA 1ISPA 4MW4A 4PPQA 4Z51A 5AHKA 3N05A 2FPGB 3LZDA 1M0TA 4ZT5A 4D74A 1Z62A 2VKQA 1OXVA 3MWEA 4MWEA 4ZODA 4O4JF 1QGYA 3FVWA 3VKFA 2JCVA 4QO8A 4Z0TA 5AUPB 3P20A 1PGPA 1U63A 4FHGA 2O7RA 4ENTA 1H4QA 3P5SA 5IBRA 1R74A 1ZITA 1G3MA 1QCYA 4D81A 2JLCA 3SMVA 2CJPA 3DR3A 4QU5A 1MMFB 2H9IA 1MQSA 3UHAA 2ZRMA 1MRSA 4O5AA 1YUBA 3N2YA 3T54A 1X1SA 5DP1A 4JZKA 1X7WA 3KC2A 3B1KA 4O6VA 4KVGA 3SOZA 4CT0A 3VR6A 4RF5A 2C7RA 4AJJA 1RC8A 2XQIA 4NBSA 4BFYA 3WS7A 1AVTA 1DVRA 1WZUA 4B4WA 3MJDA 5T6BA 4N7JA 4YFYA 2SNIE 1P62B 5AKZA 1XLWA 3HLYA 4AKEA 1T0BA 4N8EA 3DONA 3AR3A 1EFTA 1PNQA 3LUAA 3NX4A 4TTIA 2CNNA 3PCTA 2JI6A 3WJ7A 4XWWA 3OTGA 3OHSX 5DM4A 2VHEA 3NYRA 1XAIA 2M2IA 4JQYA 4JR1A 5FKJA 3UXEA 3TBHA 1XDDA 1HXHA 5K0NA 1ZN8A 4L2IB 2DT8A 3K1AA 1N3BA 1U81A 1DJNA 1P1BA 3CZMA 3GP8A 1UIMA 3S5JA 1YQUA 1YOVB 3EFOA 1W59A 3D5QA 2XTMA 2A9OA 3ZDQA 1TF5A 2IVFA 3Q6NA 3PSAA 1EFUA 4L6CA 1JAIA 2Y9PB 1OH5A 3GJ8A 2ZSJA 4K3VA 2UZIR 4JOBA 4DADA 4DPKA 3ZJTA 1JR3A 4JLVA 2IS2A 3WGQA 4HDRB 5FNVF 3ZH9B 1JN0A 3N39C 2JFNA 4LNUB 4LZNA 5DYIA 2PAAA 1KVQA 4NJOA 4JI3B 1R0LA 2EWWA 1SOWA 1WXXA 2R70A 2HQSA 1W0KA 2GCOB 5JBIA 2H92A 2IXFA 3HKCB 4QODA 1NYRA 4KODA 3EEFA 4EECA 2IBMA 4I8XA 4IVRA 2QQ5A 3LCUA 2A30A 2C0QA 2Z5LA 1VSTA 3EVBA 4PYIA 3DZJA 1ODJA 4Q02A 5J4VA 1T9KA 3NG1A 9ABPA 3AVTA 1PBNA 2PMCA 5JCOA 3K4HA 3PNVA 1FU8A 3QIAA 4PQGA 1G2QA 3JQPA 3GRPA 1R3UA 1ZM9A 4Y6LA 4AZVA 4C1BA 5ALUA 4EJSB 3MNFA 4S24A 4KXUA 4FK8A 4V0OA 5I7OA 5FBWB 1ZJ6A 3T4UA 3KKMA 1LB1B 2MIIA 1TT5B 3BXXA 4YGYA 1WRBA 2WNHA 1DPFA 3SQOA 4E4RA 2QTWB 5HBGA 1J23A 3IXQA 3T7AA 4Q12A 3T5DA 4BQRA 3AVYA 3LC7O 2WYWA 4CTMA 3SYRA 2CB0A 3SYMA 3FR7A 4C4TA 3EGXB 1YHZA 1FVFA 3G5UA 4HTFA 1KDRA 3DEYX 4UMFA 3SX0A 4XX0A 2EW1A 1T9GR 4H7HA 2LZ0A 4HSEA 1X8KA 3ANXA 3FF1A 1FSZA 3LO8A 4WWHA 3SIWA 3ABRB 3BRWD 2XMBA 3T94A 4Y6SA 2WIFA 3CLSC 4CMKA 4K6MA 1DBRA 2QJFA 3IPXA 4R8SA 4DDWA 1V1RA 1W85A 1P2UA 3NWBA 1GTJ1 1A5BB 2G8NA 4XFDA 1SCIA 2W98A 3E5MA 3GJ4A 2FP4B 4L4ZA 3FYUB 4I4TA 4D8WA 1V5WA 3UJBA 2I1LA 3C14C 1OTYA 3GUCA 2OHGA 4J6FA 4MVJA 3T4PA 4ZVPA 5EJ4A 4UQLA 3N2GA 3P27A 2F62A 2YASA 3DW1X 3EAGA 4NPCA 4TUYA 4A82A 3MUFA 4FLOA 4KE8A 3G0CA 4FYVA 3RS0A 2OHOA 4OK3A 3IAUA 5TPWB 4E5NA 2X5XA 2ZVPX 4XE5A 3DBHA 4NOMA 4ZV7A 1XL1A 2PGOA 4URXR 4G3XA 3JSXA 1JF8A 5THKA 2JPDA 2SECE 1Y8CA 5T8KA 1RXYA 4RZ3A 4A91A 4QG3A 2EP7A 4ARVA 4BNMA 3V7FA 2ZRAA 2VDKB 4OGLA 3X43A 1LV8A 2EJCA 1H1DA 1XZEA 4B34A 5AJXA 4P5EA 1GGEA 3BJRA 1S3FA 4RF3A 3L0YA 1NVWQ 1Q0HA 2FFHA 3ILVA 3PQ7A 4KRXA 4OVKA 3UJCA 1M0EA 3BJMA 1A2OA 2ERCA 3G9QA 4LCBA 3SHTA 4BY9E 4I50B 2Z3ZA 5KBYA 3V80A 2PUSA 2BZ0A 2Q5LA 4KFUA 5IH3A 5CCDA 1ULSA 1XMOB 1ISFA 4JU8A 1UCFA 3CRRA 4RPKA 3U9LA 3O73A 3NJ8A 1DWUA 1Q95A 3OAAD 5LL6P 3U3KA 4R4JA 1ZY2A 5HUQA 1A71A 2YINC 5TR9A 4G36A 4MWGA 1JG2A 4F1WA 1L5HA 3AF6A 4XCQA 4PLHA 1GSOA 3QFRA 4J1QA 4CIWA 1ORWA 1QE0A 5GV8A 5LNK6 2P6UA 4GOND 5HE9A 5K0GA 1FMFA 1KYVA 3ZZMA 2A14A 3LHSA 3CW8X 3TVYA 2HIHA 3H9JA 2X41A 2JJ1D 1HE5A 5HQTA 3HSYA 1YU9A 4BO1A 5BV0A 3P9PA 3RTAA 2VP3A 1P2SA 5JEEA 4M55A 5CT6A 4DSTA 3AJAA 3SF8B 3F96A 2NNWB 2OHIA 5KHLB 4PQEA 2XYVA 3ABOB 5IDYA 2ZJ7A 4R5XA 1K86A 3V7UA 1QZZA 3UKDA 2XRYA 3VO8A 5K9ZA 2HSWA 3K2EA 5FFMA 1YL6A 2NUAB 1R8SA 4JT9A 4FXOA 1EE1A 4U6QA 1EAYA 4G5OA 4DLVA 2Q1WA 3W5AA 3JWHA 2YIMA 1VJ5A 4JUCA 4C7XA 3WMRA 3BSYA 2X77A 5LQDA 3K20A 3FCOA 3RKRA 4EY8A 2JGMA 1SOUA 1IFXA 4NKRA 1T3HA 4RPLA 4KBGA 4WINA 5MF6A 1SUBA 1JMVA 2OR3A 5I7AA 3FKSA 2F1HA 2B2XA 4XOUA 3IQHX 4ND5A 5H83A 2CKMA 3JYHA 1KH1A 1ZAKA 3NPAA 5CYFA 4DQUA 4GP9A 3Q6MA 4TXLA 2QW8A 2ZSBA 2XT6A 2X9VA 3FAZA 3TNYA 1MC4A 2NADA 4WN3A 4FFPA 4FYIA 9LDTA 4I46A 4PG7A 4PF1A 4TWBA 2BEVA 3ZBQA 5EWJB 2CT8A 4BV2A 1NYLA 1BEUB 3LCMA 4A8JB 3AB3A 3IKMB 4CU5A 3D8NA 2JGEA 3BTVA 4WCFA 1GP2A 1IG0A 5AO9A 1KH3A 3FKQA 3DE5X 3G2MA 4U5XA 4YPFA 3SIRA 2WV7A 2Q5JA 1QUFA 3IS3A 3JD0A 2WD8A 1IY2A 3IGFA 4OOEA 3QWAA 2OB2A 3A26A 2NQ2C 3N75A 5IVHA 2BTEA 3KR9A 2Q3FA 3PXDA 4RF2A 1E60A 2I4MA 3GCDA 4FC7A 4YFVA 2XGJA 4YJFB 1T9ZA 5HEKA 3L8GA 4G9BA 4ARZB 4L6IA 5FI3A 2GKGA 5IDXA 3QVXA 4UHJA 2JFZA 1QH0A 3FDZA 4W99A 1PLJA 4DA4A 5ICCA 2ZT8A 4DL9A 3KR2A 2V3CC 5B1IA 4BNGA 4R0NA 1JQ3A 4EQ6B 1OI4A 4UBIA 1UKVY 2VAWA 4EHJA 1FFGA 1VLVA 4M0KA 4PTYA 1L4GA 5JCPA 4RD3A 3OIFA 1JLSA 2QZJA 2MOKA 4U2EA 5JAQA 1PS8A 1SUWA 1AO0A 2PAFA 2H06A 4OA5A 3BAZA 3KL4A 2R1VA 2Z1DA 2J9XB 1BZYA 1IEXA 2PMBA 5DLEA 2QTRA 1SELA 1SUEA 5CVJA 1ECCA 4CM8B 4E08A 1F9EA 2BJWA 4OLAA 1X7ZA 4U9IS 2Q8QA 3DDCA 1X1AA 1VE1A 3E8SA 1Q3HA 3PL5A 1E2LA 4O2AF 2Y0PA 3OKPA 3W2EA 2JA1A 1E1KA 2EDAA 3D8HA 3LZCA 1MJHA 4QUOA 1OBHA 2AN5A 1NHGA 4WJKB 1OX5A 1Z29A 4WESB 4IAOA 3OT1B 4G0UA 1GFWA 2WEKA 4NZZA 2NOAA 3ZGOA 1J8MF 5DXFA 1BG6A 4CKBB 4IWNA 4B82A 2OO5C 1N1GA 1OBVA 1XI2A 3TTYA 1QG0A 3CINA 3HE3A 3IVMA 5LC1A 1FFHA 5JANA 1L3IA 2VDMB 2P40A 2IU0A 4DBLE 4P8RA 2CVFA 3W5DA 4QEDA 1I13A 4ZCPA 2FKAA 1GA6A 4MULA 3HJFA 4GR5A 4M21A 3CZ4A 5BV1A 3RUEA 3O74A 1ADJA 3BA6A 4N5LA 4HX2A 4NE9A 3SDSA 4B2YA 5B7NA 1R9JA 7REQA 2OGSA 2OV8A 5HHTA 3NTLA 5EUCA 2Y77A 5IN5A 1CUUA 2BGLA 2X2EA 1J1UA 8MHTA 1MOZA 5F7ZA 3M3HA 1W581 2QY6A 3CVXA 3AK4A 4MVYA 2LXNA 3PXCX 4Q4IA 4ZOLA 1OV4A 5JFGA 5JXGA 4TL7A 1Z8NA 2RHWA 3K0FB 4G1CA 2ZUFA 4BE7B 3AXSA 3CN9A 1LLUA 3OZBA 1Z7BA 1PEYA 2EW8A 2IPMA 2OP0A 1NWCA 3P2EA 3RSHA 5KI6A 3U09A 2EEPA 5FR1A 1UANA 1GAWA 1XTUA 2JI7A 3F5MA 4P4UA 2OCYC 5F7JA 1JIIA 1DAPA 1M2NA 4WERA 4FGWA 4RZ2A 1Z6XA 3SM9A 4QBGB 2BGRA 3T7DA 4LQDA 2ADMA 4ZTUB 1QM5A 3QELA 4L2IA 2YDXA 5FWQA 3G5LA 5BN3B 1HORA 1NZFA 2E2WA 3B34A 5CLQA 3TSWA 3KE9A 2BCGY 3AX6A 1GTG1 2GJ9A 1DTWA 1NDHA 2O2ZA 3CZEA 3AERA 4MP6A 4AWBA 1CUZA 4BRWA 5TQ0A 4Z4EA 4GPTA 5HDBB 4F85A 4NCNA 4RK1A 2RGGA 3AP3A 4J2HA 1KI6B 2B4KA 3KBOA 2L18A 4IW3B 2AKYA 3FUJA 3ZTTA 5JRJA 2AOUB 2CB9A 3NWEA 2OCBA 1J97A 2QTTA 4UM9D 5CDFA 3WLLA 2XH8A 5HIKA 3QPCA 3BCRA 2WZCA 4MRMA 3S2IA 4DT1B 1VZ3A 3AKYA 2R5WA 3HYTA 3MK31 3QWHA 2V7BA 4DMFA 1G3QA 5EZSA 3SQXA 2J3EA 1FS5A 3I09A 5G3YA 3KHKA 2Z2IA 4U8GA 1I6MA 1HQDA 2UZ1A 1UAGA 4GR9A 1O6CA 2C4NA 2XI4A 3OQBA 4NZYA 4C7JA 1ZCFA 3O9VA 1U4NA 1CUCA 5JPCA 1AUVA 1EUYA 2RHLA 4BB6A 3F2VA 4E2FA 5FD8A 4HXFB 4XQGA 2REBA 2MSNA 3WYFA 1ZJWA 3ZWPA 2DHEA 4YIHA 4J29A 4EB6B 2BKVA 3LDUA 5LJLA 3VU0A 4DTCA 2FX2A 5EERA 5FEUA 4XIFA 3UH1A 1EX7A 2NUAA 3BQMB 4INAA 4MQ6A 4ZZ2A 4X1IA 1ISGA 2ZXGA 4BNTA 3AOGA 3TW8A 4P3OA 2O8DB 1CUGA 3Q87B 5ES3A 1SMKA 1TVCA 1I4DD 1RAIA 1YI0A 3ZIAA 4JA2A 2GZ3A 5HYVA 2RI6A 4QECA 4MR7A 3B2NA 5AQEA 2NO5A 2GZAA 3BE8A 2BI7A 4WV3A 4RMNA 1YQDA 2HMWA 4QRDA 4AZ3B 5EP2A 5LBTA 1O94A 5CX1A 4YGXB 1XNQB 1IAVA 4KQWA 2IYAA 3H8WA 5HF8A 1JGTA 1EVIA 1TYEB 2QIPA 4ZAGA 2VHVA 3OIYA 2HB6A 4CXMA 3NYQA 3RJ9A 5I7RA 3AR2A 4IOJA 4QLAA 3A37A 3EVEA 3ES9A 1F6BA 5KTPA 1Z4LA 4UBLA 1GCOA 3P2IA 4DC9A 5KEIA 5I7VA 2P9FA 4PLGA 5H82A 2H2AA 1BEEA 3HDQA 3WP1B 1M5TA 3MM4A 3ZQ6A 1F7UA 4AMUA 5IUJC 1QTNA 2JLXA 4M0MA 4ZZIA 4ZZ0A 5J1SB 4R3UC 4N01A 3AJ9A 2ZIAA 2N1BA 3T3OA 4EPVA 4X1KA 2WILA 1B8VA 1JP7A 3PSHA 4QGSA 1W4BA 3QX7A 2XQGA 4GYKA 3PRKE 3NNSA 2NTEA 1T6YA 4JX9A 1U7WA 3SC6A 1TE2A 1KYQA 3NKFA 2V6IA 1FRNA 1N7IA 2ECQA 1Z13A 3Q3GE 5FUVA 3VDXA 1EUZA 3K5WA 3MOGA 3NM5A 3IUJA 5LQJA 3IA7A 4KMMA 3ZIUA 3DBHB 5BWNA 4G2NA 5DXAA 3R4CA 1QF6A 3EG9A 3T5CA 6YASA 4CF7A 2PX8A 2XNHA 1QZ3A 4QQRA 3D0OA 1NV9A 1AZTA 1DG3A 3BXZA 1MO4A 4N0DA 3S28A 2WAYA 3AC0A 3ZE8A 5GIOE 4AW9A 1L5KA 5EQJB 3NKVA 1K6JA 1PJ8A 4BMVA 2XJ4A 4II7A 4R68A 3OJOA 1CUFA 1P44A 1VMDA 2VJ8A 5HTKA 3FUIA 1JALA 3A58B 4PXAA 2QV7A 3ERCA 5JIBA 2QENA 2WFLA 1Z7WA 3RSFA 3VPDA 1WBDA 3B70A 4D97A 1TQ6A 2W48A 2XB6A 5KWJA 3L0SA 3E3LA 2XMQA 1IRXA 3CXBA 1RYDA 1GQQA 1VRWA 3B1VA 3JT1A 2C2GA 1UPXA 5CG1A 5ICGA 3FVTA 1RXEA 2L2QA 4F3NA 4CWAA 2HRBA 5DCYA 4F6RB 4F4IA 2ZYSA 4JVOA 2LCQA 1QO0A 2GPAA 1GZDA 1XDWA 2G63A 2KW5A 3SHWA 3CO0S 5CNMA 1T1EA 1CRQA 2QRPA 2QZSA 1N25A 1E2MA 3DVLA 2Y1WA 3PFGA 5TS3A 1IB0A 4F2GA 1HQYE 1XA4A 2IIBA 3AEYA 3EZNA 4RH3A 3UMBA 4RZQA 3MWFA 3M2PA 1RZVA 1ZO8A 1N9ZA 1CRZA 4MIYA 1G2IA 1RPTA 4K6FA 4RVSA 4EL5A 5BNZA 1QFYA 2Z08A 4L3VA 1EVJA 2FKNA 4HAWA 1DXOA 4N40A 4PYOA 4PZYA 3O2QB 2G0AA 3TFQA 1L8LA 3DMFA 1Y5RA 4K2HA 3ZKWA 5I3CA 3DLIA 2OMKA 4Q3DA 1TI7A 3DQPA 1LRLA 3ANNA 4RD1A 3RBXA 1EFDN 4AQDA 2C03A 1K4MA 5ALYA 1ZGGA 5BN3A 3FOWA 5CEFA 4ZZ1A 1CUVA 4RF4A 3Q8XB 5K99A 4H60A 2J5QA 4DNQA 1U31A 1GITA 1CUIA 1EGVB 1VDZA 3RROA 3L06A 3NH9A 3OH8A 4LBVA 1KJQA 2WM3A 3X1DA 2VPQA 4QDZA 5CBPB 3LQ4A 1LDBA 2MR6A 1LPOA 5B53A 1G8JA 1QQTA 4IDCA 4BNXA 4CHGA 3Q3EA 4FMPA 1Z73A 3KFLA 4KBFA 3DE6X 3CSUA 2Y0DA 1XZ8A 3SS7X 4RVFA 1V7PC 1OSNA 2QVBA 3GJZA 2C2MA 3HFSA 3ON5A 5DWVA 2BZ1A 3VPBA 3W7VA 4KN9S 4KQHA 4XSVA 2AXPA 3T15A 4BU1A 3U7FB 1U2TA 2DKFA 1NVVR 3M81A 4WCFC 4YASA 4XPIB 1T2VA 3LO5A 3GDWA 2NXWA 1Z7EA 2ATIA 3L49A 2VLAA 4DUGD 4Q7QA 1JYSA 4YRFA 2EJBA 1NURA 3DZ8A 5AQ1A 2ASEA 1MHTA 2CBGA 5FX2A 5DNCA 2W0SA 4LJKA 4NU8X 3VMFA 2GN4A 1ULZA 2Q4OA 1B6TA 2H31A 2CLMB 2E1RA 3HRIA 1SXHA 4JMPA 1R00A 4R7ZA 3SEFA 3WRYA 1BGWA 2WV9A 4LY6A 5JBNA 5ALLA 4PLYA 2O8DA 5JS6A 1AZLA 1X2BA 3QEJA 1I1NA 4M89A 3ZDRA 4DA8A 1GNVA 1YOBA 5AI9A 2P6NA 3PVSA 4GZ6A 3TOXA 1JEYB 1X8LA 4UAUA 3CRVA 1YF3A 1Y6GA 2KB0A 3GFBA 2AR7A 1XTJA 1ZN7A 5DTRA 2VUTA 2YR0A 4P58A 4Y2SA 4A5OA 2HK9A 3F8TA 1MA3A 4XSHA 4FHEA 3CJQA 4BQIA 2VA8A 2ONJA 3RVKA 2O07A 3EZ6A 2H2HA 3M5WA 3IDSA 3HWRA 4ZPXA 2Q7DA 4K1XA 2VXBA 3ME5A 3OQOA 4B3DA 3RU3A 4YT2A 3R0QA 1Y63A 3M4ZA 2A6PA 3L77A 3OEED 3LW7A 3MTJA 3O95A 1TLTA 3U9TA 2FOIA 3EQ7A 4BJ5A 1HETA 1C7IA 1RRPA 2CLKB 4LHXA 3O8QA 4TT3A 2PJZA 3OPVA 4H3KB 3O1IC 2QM3A 3OVMA 3R5SA 3LDHA 3LUHA 1GIAA 3IUYA 3UJ8A 3UXYA 2GD6A 4B3GA 4L0QA 4NDAA 4LF6B 1YI1A 4HAIA 5JOQA 3IT3A 1R16A 1L4YA 2NXEA 3CF4G 2P30A 2CJWA 2BN4A 3QPDA 3R9XA 4LX8A 3PQEA 4M4SA 4DV5B 9MHTA 1Q1NA 4IDAA 1XVAA 2ZS9A 3GJ0A 1M2FA 3T1VA 5P8WA 4AL4A 2QQFA 3AR8A 5KTKA 1AKMA 5K3AA 1PZFA 1X86B 2CXOA 3U7EB 4EBBA 3FTSA 3HGQA 4JYPA 4R31A 1UJNA 1R6UA 1T91A 3AETB 4A2PA 4RPIA 1HRKA 1PFUA 1SXJD 1FX1A 3EIXA 3UNXA 2OEPA 1UKCA 1USVA 1XTQA 2R7AA 2ZIEA 1L4KA 1M8FA 3GFOA 1X8JA 2AG8A 2PBLA 3A4TA 3CO5A 4QJ5A 4M7RA 4UD6A 4AZWA 2GEKA 5A4FS 3CRMA 3UT5A 4CHTA 1KOGA 3TKLA 1E0JA 1HDIA 4IUBS 3V4FA 5IAGA 1EQ2A 1UKYA 4H1HA 4LOJA 1QV6A 3QI7A 4GMFA 3FFAA 4AF7A 3D3WB 1C9JA 5TQ2B 4BXOA 3ICEA 4J0EA 5HKOA 3ORYA 1P2BA 4NVRA 2BFEB 3FGPA 3QU7A 2Q4DA 2PE5A 4P33A 5I9BA 2HMTA 1C3LA 4GRAA 1QFJA 4G23A 2WMOB 3CTPA 4REQB 3GLUA 4DBVO 1E1RD 1NVBA 2FRXA 1M74A 3QXCA 2B5OA 3DT8A 2QORA 4LJYA 1BRMA 4GBJA 2WKWA 3OFNA 1ORIA 1MEJA 2QN2A 3DWGA 3JW8A 4JP1A 3W7AA 4B33A 2X1VA 2YVKA 4AR9A 4Y6RA 1K27A 1TCBA 3WLMA 5CVEA 3SMQA 1EVEA 2HXSA 3WB1A 1YRBA 4MR7B 1KAQA 2IRWA 2YYSA 4LA4A 3BDAA 3UHPA 4ND8B 3H2GA 3AY6A 3ICWA 5BW6B 3SZ3A 2WWYA 2AOTA 2XOKA 3GT7A 1DARA 3RC1A 1Q0TA 1LDYA 2NTJA 3MOSA 3K8QA 5IM5A 3VPXA 5IP5A 4EENA 2Y1LA 4HXGA 1QO0D 4KVZA 4OGGA 5L40A 4FDLA 5CYPA 2OOSA 1FBTA 3M9LA 1SVIA 2AEEA 4MTLA 4EARA 2IX3A 3FU3A 1AQLA 1YB6A 3ASUA 5DTQA 3WB0A 1ZRNA 3VKWA 3IV6A 5B1EA 4TQ9A 1XP8A 5DP2A 2JLBA 3DBRA 3NHWA 4N3CA 3NAZA 4K6HA 4AC9A 1YQEA 1P72A 1KRXA 5IT0A 3AIKA 1IUNA