1R0LA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
378
Chain Sequence
QPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 123
structure length 378
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0lA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0lA01
2W98A 5L95A 2B69A 4HFNA 5A3JA 3EVTA 2IYOA 3DMTA 1H2HA 3GK3A 2CDAA 4PZCA 2OBYA 1AHHA 4YJFA 2QW8A 1PQUA 3JQ9A 1GAEO 1A4UA 2DM6A 3K6JA 3V2GA 1HE4A 1WMBA 2ZCUA 2PWZA 3ADOA 1B26A 5ES3A 1DDOA 3G1TA 3QVWA 5A3VA 2FY8A 2GN8A 1MFZA 3DBRB 3I52A 4FSHA 4D3FA 4D42A 2NACA 1I3NA 3JCZA 1HT0A 3PZBA 1VJTA 4ND1A 4E2YA 1IHXA 1WWKA 4B4VA 3PK0A 1I24A 3VH2A 4OOEA 1DC6A 1VRWA 3H9GA 3INTA 3WB9A 2IODA 1E7QA 2D5AA 1BXGB 5B4TA 2CUKA 4OHUA 4YT8A 3UCEA 3OEWA 1GUFA 2H5LA 5FEUA 1I3KA 3E5MA 3WWYA 1A9ZA 4YQYA 2PA3A 2GZ2A 2UUOA 2WMDA 1OI7A 2Z95A 3OJ0A 3PDUA 3IQDB 1VE9A 2VT3A 2VWQA 2D8AA 1YQDA 1F0YA 1O89A 4LRSB 3H2SA 1MP0A 3WWZA 1QSGA 1GZ4A 3QRWA 3AOGA 5AVOA 1RYEA 2FZWA 5EQDA 4QX6A 4E2XA 4R69A 3L07A 1N9GA 1RM5A 3WJAA 4CMJA 4BGEA 1LDBA 1D3AA 2I6TA 4BHTA 1JWAB 4LVCA 5IXYA 4BL5A 1NYTA 3RFVA 4UULA 1ENOA 1HZZA 3OQ1A 4YRBA 1BGVA 3WOHA 4WECA 3ROKA 5CDGA 3CZMA 4IXWA 3QQPA 1ZFNA 1JKIA 3BAZA 1RWBA 1V0JA 2Q46A 5ENDA 3RD5A 3SC6A 2VHZA 4I5DA 4TRJA 3ZNQA 4A73A 1YDWA 3ICCA 1LBEA 2BFAA 2CF6A 1HDRA 5LDGA 1Z7EA 2NADA 1G0NA 4WLFA 4FFLA 2JD0A 5DT9A 2J6IA 2ZYGA 1XQ6A 3W8EA 1H6AA 4XCVA 1A9YA 2VUTA 5KVVA 3MOGA 3C7DB 4NJMA 4Z9XA 1PIWA 1YBVA 2EEZA 1EVZA 3DO5A 4FLOA 2GD1O 5JE8A 5IDQA 4XRGA 2BRUA 1PWZA 3RUCA 1Z75A 5JMPA 2LDBA 1H93A 1NM5A 4HFJA 4FFMA 4GWKA 4DIFA 3VH1A 3FR7A 3ZWOA 1WDLA 3B1FA 3E9QA 3DTYA 2WYWA 3B6ZA 3F1LA 4KQWA 1U2DA 2O3QA 3W4JA 3W4IA 2P9EA 4OSOA 3DB2A 3NV9A 2JCVA 1I0ZA 4E0BA 2IRWA 1PJTA 3QE3A 3BMQA 4AJHA 5A02A 3GEDA 4E30A 2PKRA 4J0FA 4ZVVA 1EQ2A 3A28A 2PD6A 5CEFA 2VHYA 3EHEA 4FCCA 1I33A 5L53A 3GA0A 1EQUA 4HNGA 4HNHA 4M87A 3WIDA 3GUYA 3PVZA 1Z82A 1PQPA 3WGQA 5BNFA 1EFLA 1R0SA 1UXHA 5JYEA 1K3TA 2EG9A 4WGGA 5KJCA 3H5RA 4UVDA 1DC3A 3RUAA 3ZWCA 2AW5A 4BMVA 1M66A 1YJQA 5CPFA 4DWVA 2EHDA 3INGA 4CM1A 2X9GA 3NDRA 1K0UA 2VZ8A 4OXKA 4UUMA 2W2KA 3RUIA 1FDUA 5KKCA 4BNMA 2VHVA 2B0JA 4ZHSA 4MIEA 4WPGA 3WYEA 1VKOA 1LUAA 2C82A 3D3EA 1RJWA 1E3LA 4R1TA 1U28A 1LLCA 1E3WA 1S7CA 2J3IA 3L9WA 4GH5A 4ZRNA 2I3AA 3BA1A 3P19A 1QV6A 4AVYA 4CM8A 5DULA 3COSA 3WG9A 5KNLA 5G4LA 3WSVA 1N92A 2HSDA 4P4GA 1DFHA 3OFSA 3U3XA 4AJPA 3WLEA 2VHXA 1KVQA 2VUUA 4O6VA 3A06A 4CM6A 1K6XA 4WUVA 3A14A 3VZRA 5A5EA 3TRIA 2E82A 1ZJYA 1CDOA 4BQRA 2C20A 2O4CA 4BO8A 5CPBA 3U0BA 4U6QA 2NUAA 1Z74A 3KSUA 2X8LA 2ZTLA 1PJ3A 4DIBA 5EQFA 4IDDA 4HXYA 3EY4A 4GKVA 4ZJUA 4KUGA 1PL8A 1PTJA 3AW9A 3SX2A 4PG8A 3LT4A 2NU9A 5KJ1A 2Q50A 1T2FA 1TT5B 3D7LA 4WCFB 2D2IA 2E48A 5JYDA 2Q3EA 3ZWYA 2OFPA 1B3RA 4PN3A 3FBGA 4G81A 3TL2A 4GX1A 4B4WA 3BTVA 2E49A 3I9OA 3KVOA 1RM3A 4A10A 1CERA 4NI5A 1B2LA 3RFXA 3KO8A 4BO6A 4XIYA 1QORA 4I5EA 1GFSA 4Q3DA 3AFNA 3PYMA 1YXMA 2H6EA 5CEJA 5L9AA 5TJHA 4NFSA 1Y5RA 1N7GA 2DUUA 3KYCA 4NBVA 4HKTA 2Q1SA 3DEYX 1SEPA 4P38A 3L0DA 4KQXA 3WX0A 2HAEA 1XEAA 4MKXA 4Z0HO 4FGWA 3RAJA 4AL4A 1CF2O 1R15A 4ZQBA 1KS9A 4AJ1A 4H16A 4FC7A 3K31A 5LCXA 4LGVA 5GMOA 4B79A 5AXCA 3ZCXA 1ZJZA 3HDYA 4L74A 2Q1UA 2I3GA 2YW9A 1PZHA 3FNHA 4XDZA 1O8CA 3A1NA 1E3JA 1OR7A 3AM5A 3RQSA 1CETA 3L4BC 5T8KA 3M2TA 2Q45A 4IJUA 5COAA 5FYDA 3LC1O 4CM8B 1YH3A 3ASUA 3IIEA 4BNLA 2UDPA 3I1JA 3AY3A 2OO5A 4PVCA 4F6CA 2O7GA 1O6ZA 2FP4A 4BNYA 2BFMA 1T1RA 1W73A 2J3JA 5KVSA 5JW6A 1H9BA 3E5RA 3UN1A 3VTZA 5L3ZA 1ZXBA 2X22A 4E31A 4BB5A 2VYVD 4NU5A 5JCJD 1ZBQA 3QWAA 5HTOA 4BNXA 5G2OA 5L4SA 3GDOA 1GPDG 4FFNA 1ZH8A 3GHYA 3MJVA 2DFDA 4TMFA 3TQHA 1EK6A 3DHNA 3I23A 4W6ZA 1FK8A 1YO6A 3R6DA 3H3FA 2HDHA 3C1OA 3GT0A 3JYQA 4RLSA 1O94A 3GRPA 1C1XB 4LMRA 4KOAA 1H3LA 3ICPA 2A92A 1K6JA 4KZPA 2PR2A 2Z1NA 4RQTA 1ENZA 4J4HA 1DIBA 4KWHA 1LSSA 2C5EA 3IMFA 5EINA 1LC0A 4Q39A 1EVIA 4BGUA 3D3WA 1JAXA 3FWNA 4NZ9A 4ZA2A 3NDJA 1QG6A 5JY6A 2I65A 1EVYA 2FPIA 2QYTA 2O50A 3DZJA 4K28A 5F5LA 2CNBA 1U4OA 2VNAA 1ZXLA 3JQAD 1PJQA 4J2OA 1DIRA 4J9VA 4I9HA 4CM4B 3OM9A 1XKQA 4UREA 1U3UA 4HP8A 4YQZA 5T67A 1UP7A 4KDEA 3IP3A 1X0XA 5KTKA 4NH4A 1C3VA 1LQUA 4NHEA 4GVLA 5EPOA 1H94A 4DLAA 3NAQA 2BMAA 3MJSA 2B37A 2YHIA 2JJYA 2X6TA 4OXNA 4DIOA 4IJWA 1LLUA 3RUEA 4J7UA 1XG5A 1KETA 1DLJA 1UUFA 4M86A 4L73A 5AXBA 2TMDA 1LLDA 2YV3A 1VC2A 1ZEJA 5JAQA 3UCXA 1SEVA 5JMWA 1GQ2A 2J5RA 5FI5A 2JFHA 2C2XA 2JHFA 4AICA 2J3HA 5FI3A 2RHRA 3NTOA 3NJ8A 4CR7A 2C2YA 1U4SA 4CMHA 1V3TA 1V3UA 3JQEA 3PGXA 1N5DA 5K0ZA 2Y67A 3T4XA 2EJWA 1AXEA 3E48A 1CJCA 3F3SA 2QQ5A 1WDKA 4YRDA 1Y8QA 3AM3A 1LEHA 3AJRA 1GR0A 1NP3A 4A27A 1GUZA 4Q3CA 1IHYA 3DL2A 4XYBA 3A9WA 3U4DA 3I3OA 4YAKA 1N1GA 4J7XA 1MC5A 2OHXA 4OGWA 2HRBA 4DRYA 5GZ1A 1K89A 2BLLA 5K6AA 3EZYA 1VL8A 1PZFA 2P5YA 4FJ0A 4JJIA 3LYLA 3LT1A 4AJEA 4PLFA 3UERA 2PTGA 5I7VA 3UKOA 1PGJA 2DBQA 5L4LA 1EUZA 2OXIA 2X0RA 2GLXA 5LDHA 3DZBA 2FR1A 2WE8A 4TROA 4B7UA 4MJLA 5K9ZA 2NNLD 5F1PA 5C3MA 4ILKA 3P5SA 2YJZA 2G0TA 3WDSA 4YAEA 4NIMA 4A7PA 3MEQA 4X54A 3TF5A 4LN1A 2VRBA 3EK2A 3ZH2A 2OL4A 1JVSA 3B1JA 2H1SA 4RVSA 4A26A 3DZHA 4YR9A 1HLPA 2GO1A 4OJNA 3E1KA 5AXDA 2J3KA 2VRCA 3QWHA 1M6HA 1MGOA 2ZYAA 4AJOA 4CLOA 3B70A 1WXDA 3LF1A 1M75A 4ZU3A 1NX6A 4Z9FA 3SLKA 5HS4A 4JJFA 4MP8A 5EIOA 5KJ6A 5KOIA 4RGBA 2ZTVA 4KMSA 5G4KA 4AFNA 2AMFA 4E5PA 1XU9A 1UDAA 1ISMA 2JCYA 4TVOA 2PK3A 3W4KA 4BO7A 3GH3A 4U8GA 1OBFO 2V6FA 4L75A 3AI3A 4BVAA 2GZ1A 3DOCA 2D3TA 2GR9A 5BT9A 4WASA 2YV2A 4DQVA 8ADHA 4XYEA 2EV9A 4UVHA 3RBXA 3UGKA 4YAGA 1UXIA 3PDJA 1CYDA 4QFCA 1DLIA 3I4FA 5ITWA 3HFGA 2VZ0A 1DIHA 2DU8A 4J90A 3V2UA 4TRRA 5JC1A 1QYXA 4RPHA 3FBTA 4II3A 3RVDA 2D1YA 4R9SA 4HBGA 1LA2A 3RUFA 1C1DB 1MLDA 4RVUA 1I5RA 1VJ0A 3ANMA 3B1KA 4I5GA 4QQRA 1DO8A 5THQA 4YRAA 3MJTA 3RASA 4BS9A 3HQ4O 4JBHA 1U2GA 4CXFA 3GNSA 3AM4A 1SC5A 1ZKMA 2CVOA 4IQ8A 3GQVA 1EK5A 1P1KA 4HUJA 1FDSA 5JDCA 1CIVA 2AEJA 3LZ6A 1ENYA 4W7IA 3U5TA 1R16A 2HRZA 3MJ4A 4XEHA 4A0SA 2NU6A 1ADGA 4CLEA 2X5JO 4DXHA 5A05A 5CDYA 3ITDA 3QA9A 3DZFA 1NAIA 1EUCA 2DBZA 2DFVA 2UVDA 1GPJA 3TPCA 3AU8A 4W7HA 2YUTA 4BNJA 1LLQA 4ROSA 3IUSA 1Y8QB 5FFFA 1ISJA 1V6AA 7MDHA 4DUPA 1YE3A 4OOFA 4ZQGA 5C7OO 2BELA 1U5CA 4C7JA 2B4RO 3TZKA 4IM7A 3C8MA 2A4KA 1DFIA 2GNAA 4RO0A 2QRJA 3VDQA 3IUPA 1P1FA 4QFDA 4GL4A 1QYDA 1ZK0A 6ADHA 2DTXA 5JLAA 5MDHA 1JKFA 1IY8A 3LLSA 1HLDA 4G2NA 1DRUA 3RROA 1QP8A 4NQWA 4B3HA 3GEMA 2EWMA 4KP7A 3D5TA 3VZPA 3KYCB 5HS6A 3TDKA 3HN2A 1M67A 3O03A 5A9SB 3KSDO 1GQQA 3JQFA 3RBVA 2H63A 3JQ9C 3NDIA 4BKQA 1HDOA 5A06A 3I9KA 5TNXA 3HZZA 5DCWA 5A5FA 2PKQO 4B3IA 3LLVA 3JQAB 1Z73A 4WLOA 1XIVA 3GFBA 4OKNA 3JQDA 3KLMX 1KIFA 1SNYA 5JFOA 4NFHA 2W4QA 4YAJA 1R0KA 1U8XX 5A9RA 3I4CA 3Q9UA 2EF1A 3Q2IA 3D3WB 3D0OA 3ENKA 3GPIA 3OQ6A 1TI7A 4FN4A 4Q3EA 2AE2A 4Y8VA 3GN1A 2B4QA 4K1LA 2VCYA 2QHXA 1Y6JA 3U09A 1ZK4A 1NFFA 1JG9A 1MXHA 5A1TA 2V65A 1T24A 1VSVA 4JJGA 4Q3BA 3EAGA 2XF8A 1VLLA 1KC1A 3ORFA 5IDYA 1F8GA 2Q4EA 2B83A 2WJPA 3WGYA 8LDHA 5TRTA 2I5PO 3RIHA 3I9JA 2DBRA 3FSRA 4RVGA 4AJJA 4DC0A 4URFA 3GFGA 3TFOA 2DVMA 4D46A 3OICA 4LUPA 1KEPA 3HN7A 2WYUA 1R37A 3HUDA 4YEDA 1UXGA 3LVFO 2EP5A 3M2PA 3GVPA 2X0IA 2ZB8A 1ZSVA 1TVEA 2PLAA 2PZJA 1T1SA 1GEGA 3UCQA 2Z5LA 3LDHA 4MO2A 4XGKA 3TNLA 3NGXA 2XOXA 2Y1EA 1LDMA 3P2OA 5I9MA 2Y66A 2CY0A 4TVBA 2O4UX 2AEFA 3M1AA 2BGMA 4IDBA 3NEPX 1U7HA 4R51A 1ZK1A 3DBLA 1B16A 3NJ4A 4CUZA 5I9LA 3K96A 4NBTA 4J16A 1PJBA 2RHCA 3LQFA 4HWKA 4J7CA 3S2FA 1GEEA 1LTHR 3EMKA 1P1IA 3KEOA 2E4AA 3Q1LA 4EDFA 5JSFA 3V2HA 1I2BA 1C1DA 1GADO 4YJFB 4D0RA 1T2DA 1MG5A 1NQOA 3ZU3A 2GERA 4PLWA 3SLGA 2Y0EA 1G1AA 3E8XA 4QSMA 3ZNNA 1NFRA 4L0QA 2IZ1A 1Q0HA 1PJ2A 3P2YA 5GZ3A 3OHSX 4DTIA 2HJRA 3KSZO 4MP6A 5F1OA 3UHAA 4DA9A 4BNZA 4MVJP 4B7XA 2G5CA 3WXBA 1UJMA 1ISHA 2I67A 3OECA 4GVXA 4H7PA 1WMAA 2ILTA 3OMLA 5IDXA 2XPCA 3O9ZA 4A2CA 1BVUA 2FWMX 2UAGA 4RPKA 3CE6A 3SEFA 3JD0A 2YHIB 3QIVA 4J91A 4FB5A 3DHYA 3JQ8A 1V9LA 2Y99A 2I9PA 3VPHA 2WM3A 5ICSA 1PL7A 1GTMA 2O3RA 1B3BA 1PJSA 4NK5A 3BTSA 2O3SA 4B8WA 1HRDA 5CDTA 3FPCA 3CMMA 3IC5A 1T2CA 4R9RA 5IJZA 1BW9A 3LC2O 4CQLB 3CH6A 2EGGA 4B3JA 3VH4A 5J23A 2Y93A 4DREA 4QECA 1IB6A 2NVWA 4GSKA 3GUCA 5TC4A 4RL6A 3KETA 1K5HA 1HSOA 3U4CA 1DRWA 3ZU4A 2HMWA 1L7DA 4E4YA 3KOUA 3DR3A 1GCUA 4YJGB 3RJ5A 5KIAA 4RVDA 1NASA 1O0SA 2IE0A 1FMCA 5JC8A 1D7OA 4WCFC 5CAEA 3RUHA 1T4BA 4Z0TA 1HE5A 2EJVA 4OKIA 2G17A 5CP8A 4BO3A 3AY6A 3CMCO 4BQPA 2GN6A 1ZW1A 3CZRA 3GDGA 2VWHA 1I2ZA 4PIVA 4EUHA 4NG5A 4DC1A 2YV1A 3QY9A 3GEGA 3CZKA 2Q49A 1V8BA 1CWUA 4FLQA 4GI2A 3PHHA 4JP2A 3T7CA 4RF2A 4XD2A 3D4PA 2HK7A 4Z0PA 1ZO8A 5DP2A 3D64A 4EZBA 3DOJA 1VL0A 1JN0A 3T4EA 1CEQA 5U4QA 3AI2A 3ZN2A 3VZQA 2YFQA 4GMFA 3JQBC 2YDYA 2C07A 5KVCA 1NWCA 2NQ8A 1M2WA 2Q1TA 4XQ9A 1GUYA 1LSUA 3Q3CA 4MKZA 3HADA 1WP4A 4IQGA 3K73O 4E33A 4IMPA 4FLRA 3PLRA 4CV3A 1MX3A 1QMGA 1RPNA 1E5QA 1MVYA 3MTGA 4R68A 4XA8A 2X5OA 3QV1A 3DQPA 1VPDA 3D4OA 3TFQA 4ALLA 3DMTC 1PS8A 4PLYA 3KRTA 3DAGA 4FOSA 3I6QA 4N5MA 2C5AA 4XYLA 4CL8A 2EKQA 1ZCJA 3QVXA 3KBOA 1WVGA 4GX0A 4DPMA 4D0SA 1KEVA 1P77A 1VSUA 4GGPA 4GX2A 3V1YA 1UAGA 4CV1A 1DB3A 2NVUB 3QWFA 1ZMTA 3QVSA 5AOVA 4E2ZA 4NNJA 1N7HA 3VAZA 3IAHA 4MVJH 3JSAA 1JKJA 3ON5A 1ZSNA 3F5SA 3PYXA 3O4RA 3ZWXA 3C1AA 4NJMB 2FSSA 1SBYA 3SXPA 2A94A 4JK3A 1LRKA 4DPKA 5A4DA 3AU9A 3PHGA 4PG6A 3ZNOA 1DHTA 3WGGA 1N1EA 1PJCA 3N74A 3OH8A 1L1FA 3FHLA 4EEXA 3PHJA 3H7AA 3IJPA 3WGZA 1JGIA 1MXFA 2PFGA 1YQXA 5JO9A 4C4OA 1I3MA 3WSWA 1A71A 4RDIA 1SMKA 1XSEA 2ZTUA 1NFQA 1B15A 2AG5A 1GV1A 4N7RA 1NHWA 3VOSA 3WTCA 5IN5A 4Z3KA 2Q4BA 4M54A 4ZQFA 2IXAA 3D1LA 3HB5X 3VHRA 1I36A 2OMEA 4JP3A 4OH1A 2DUWA 2ZB7A 4ID9A 4J4BA 4NBRA 2FSVA 4E13A 2P2SA 3OIGA 4XYMA 4MVJA 1X7DA 3PIIA 4J9UE 4Z6KA 1R4MB 1IPFA 2R6JA 5G0TA 1LRJA 2ZYDA 5DCUA 1UZNA 3GHHA 4BNGA 1FXSA 2CD9A 2D5CA 1HDXA 3GZNB 3DXFA 3F6YA 1U3VA 1Y9EA 3EUWA 3NX4A 4WLEA 1XGKA 1UP4A 1KVRA 1YL7A 3LC7O 5THKA 4EW6A 4PCVA 3I9MA 2P9GA 4BNVA 1M6WA 2P68A 3RU9A 3KEQA 4IMRA 2ZJ0A 5A03A 3PJFA 2GCGA 3MCVA 3GR6A 2CSUA 1E1KA 4H3VA 4YA6A 3GVXA 3JQGB 5EN4A 4PGFA 3CZEA 4IDCA 1XHLA 1HXHA 4F6LA 3ZW8A 1EBFA 1Q2XA 3KYBA 4CLRB 1UDBA 5B1YA 5BNTA 1I10A 1HYGA 2GZ3A 2R00C 3UFXA 5FWNA 3Q6IA 4EJMA 3M6IA 4NU6A 1LX6A 1P0CA 3IJRA 1HDGO 3ENNA 3BHIA 4FIZA 4GGOA 5JPIA 2G1UA 4YT5A 1NR1A 5L40A 4LCEA 3CZLA 4FD3A 4I08A 1PX0A 1P0FA 4E5NA 3C7AA 1QYVA 3ZV5A 2Y0DA 3VVBA 4ALMA 4IINA 4TKLA 3LU1A 4QTZA 1VL6A 1NHGA 3VPGA 2QZZA 4ALKA 3JYLA 4NBWA 3RKRA 2FHSA 4OMUA 1JAYA 1ORRA 5IDWA 1U3TA 3ZHBA 2UV8A 2BKAA 4QUKA 3R3SA 1OAAA 3ROMA 3ZW9A 1R4NA 1KERA 3NT5A 5CDSA 1E7MA 1SZJG 2PZKA 1HDCA 3GDFA 4QO7A 1H0KA 3OSUA 1IPEA 4CLXA 4XQGA 5ENVA 3C24A 1O95A 3GN2A 1ZUD1 4BNTA 1FDTA 3GLQA 1E3SA 3PP8A 1VI2A 5A9TA 2X23A 4KUEA 1EVJA 4NBUA 1Q7BA 4PG4A 1PGNA 2VQ3A 2D4AA 2BI8A 3DZGA 5I7SA 3L6DA 4XR9A 4R5MA 3QWIA 5EMHA 1Q7CA 1R4NB 3PWSA 3L9XA 2YQ5A 1DOHA 4GQAA 1EUDA 4I5FA 4JROA 3WMWA 3X2EA 4CMIB 3VPXA 3TSCA 3F9IA 1SOWA 4DLLA 1MFPA 4E5YA 3TJRA 3GG2A 4NDNE 1UXKA 1X1EA 4BNFA 2BGKA 5DBFA 4IZIA 3KV3O 3CSDA 4CLOB 4H15A 5JBIA 1E7WA 1YQGA 1RM0A 4UVIA 3IP1A 2C54A 4F3YA 2QG4A 4OSPA 1E6WA 2JL1A 9LDTA 1F14A 4E5MA 3OETA 3H9EO 4PRLA 5I8WA 3IL2A 3ANLA 4RPGA 4J1TA 3DFZA 3HJAA 3UXYA 2NM0A 2Q1WA 3KB6A 3TOZA 5EL0A 2GSDA 3AUTA 1T25A 3H9UA 2TMGA 3HB4X 3I5MA 4DYVA 5DN9A 5G0UA 3UW3A 3W6ZA 3OEYA 1NQAO 2WD7B 1A7KA 4P4NA 5AQ1A 4ALJA 4UUNA 2GASA 2A9FA 1Z6ZA 3PI7A 3ZDFA 1DHRA 5L7WA 3TZ6A 3SVTA 2DKNA 3GPDG 2JKVA 1GV0A 1JQBA 4MIYA 4J43A 2PH3A 4BO0A 3DC2A 1YBMA 3D5QA 1GL3A 1ZSYA 1UH5A 4CR8A 5I7FA 4N5LA 5BSFA 3GZNA 2P91A 2I99A 2RIRA 4R1NA 4ALIA 3RI3A 1QR6A 5U1PA 4NK4A 3E82A 5TF4A 3S8MA 2WD7A 4NR0A 4RPLA 4WE3A 3PFFA 1E92A 4BO2A 1I32A 1IULA 4FFRA 2Y05A 1G0OA 4J4TA 4R4JA 1F12A 4JBGA 5DF1A 2VWPA 5TIIA 1I30A 2ET6A 1W6UA 3ZWVA 2GDZA 4B4OA 4W4TA 3S2IA 3FWZA 3GNQA 1FDVA 4BO1A 1KVUA 5F5NA 2C7VA 4FJ2A 4A03A 3FN4A 5IFLA 2J8ZA 1Y8RA 2ZKLA 1F8FA 2BH9A 4DPLA 1X13A 3NYWA 4L76A 1UZMA 3UEQA 1TA4A 3FI9A 5TT0A 2NU8A 1TB4A 4U7WA 1BRMA 1G6KA 3HG7A 2O48X 1E1MA 4Y6RA 4CL3A 1Z7BA 1D8AA 4RDHA 2Y1CA 2AQHA 3SJUA 1CQJA 2QYSA 3N58A 4D7AA 1BXZA 3FD8A 2Q2WA 3ZWAA 1X0VA 1GYRA 4DBVO 4RF5A 4LMPA 5GZ6A 4WEOA 5L45A 2V6BA 4PG7A 2NTVA 2EW2A 2OP0A 3QW2A 4GKBA 2Q99A 4UUOA 4PLGA 1NPTO 4Y9DA 4XGNA 4EI2A 2AA3A 5T5QA 5T8KC 4ALNA 1B0AA 4MPDA 2BD0A 2IZZA 3SBOA 1YKFA 1AE1A 5ER9A 4E3ZA 5KJFA 3LF2A 1UP6A 2NVUA 4D3DA 9LDBA 1FF9A 3M1LA 3PHIA 4JGBA 5G0VA 1NR7A 1A4IA 4M8SA 1D1TA 4OYRA 3WGIA 4FS3A 2NU7A 4FOOA 5TJ9A 4HV4A 2GN4A 3INRA 1EE2A 4J1QA 4B4UA 5TT1A 3BMCB 2OZPA 4IDAA 5CDUA 3V5NA 3G17A 3TZQA 1XYGA 3L6EA 1EBUA 4J0EA 4CLRA 1BXKA 1QYCA 1HE2A 3C1TA 1U9JA 3DZIA 5KCZA 4AJKA 1Q7GA 3ULKA 1NAHA 4CQMD 1YB4A 4WEQA 2P9CA 3ASVA 2FR8A 4TRMA 2V6GA 4MP3A 2NTNA 2DT5A 3HE3A 4EUEA 1PEDA 3NKLA 4LSWA 3RC7A 1AGNA 2B5VA 2W2KB 3F4BA 2OORA 3BYZA 3DFUA 5B12A 3DBVO 1QLJA 1JDJA 1WZIA 2GGSA 2HU2A 1MW0A 1GQYA 2UYYA 3BTUA 4O1MA 1XWFA 3PGJA 1T4DA 3QWBA 1ZZEA 3WQQA 1AXGA 4YT4A 3R0IA 1YOVA 2C59A 3WYBA 1X14A 3F1KA 5HM8A 2BGLA 4BMSA 2J5KA 4MOWA 4KTVE 1KBZA 1ADCA 2PV7A 3GGOA 1HDYA 1ONOA 3ETGA 4GLOA 3OA0A 1S46A 2GN9A 4J6FA 3ONFA 2O23A 3JD4A 4ND4A 2WDZA 3IKTA 1PR3A 5EESA 2AQIA 4TQGA 1HYEA 3CKYA 3DBHA 1LDGA 6LDHA 5JXWA 4YT2A 1SB9A 2WE7A 4IZHA 1WAMA 4ND2A 4Z3DA 1C0LA 2HK9A 3PQEA 4CMCA 3KTDA 4WJZA 1LQTA 3RC1A 5TQVA 1ENPA 1HL3A 5JCXA 2AQ8A 1U5AA 1V3VA 1BW9B 1ZMOA 4UEJA 3ONEA 2VT2A 4PRKA 4L4SA 1JVBA 1LDNA 3KXDA 3KYDA 2FN7A 1OFGA 2X0JA 1SCUA 1GZ3A 2EXXA 1X1TA 1EDZA 4II2A 1PZEA 4NQZA 4E12A 3EYWA 3PJEA 5BR7A 1EZ4A 1Q0QA 1QKIA 1YJ8A 1XELA 4J2HA 2DQ4A 4DQXA 4GLLA 3B20A 3HNPA 4MVJI 5F21A 4N54A 4K6FA 3JQBA 5DDIP 4WLUA 2JAPA 1GY8A 5DCYA 5IXSA 5HRUA 1KC3A 1EMDA 2VYND 4WLNA 4IBOA 1ML3A 3VVCA 4CPDA 3AY7A 4CMAA 4BGVA 4Y67A 1O5IA 4U5QA 3WFIA 4IIVA 1KYQA 3DZKA 3K5PA 4M1QA 3AOEA 3S1LA 3NTQA 4UVEA 3WS7A 4Y6PA 1S6YA 2EP7A 4BO5A 3GAZA 3ZWBA 5JNLA 4BO4A 1C0KA 1YOVB 4YWJA 4TZKA 2OBNA 1YL5A 3WYCA 4F46A 1BVRA 1KY5A 4RF3A 1XA0A 1NVMB 3MZ0A 3ZHZA 4JNKA 4K26A 4HFMA 3QJ5A 1DC5A 2ZJ1A 1NVTA 1KOLA 3ZWNA 3CXRA 3G49A 1E1NA 4IJVA 4MINA 2X9VA 2PH5A 2PKQP 1NNUA 2QRKA 3LSYA 4I1IA 1E3WB 4HFRA 1V35A 3ZU2A 3QP9A 3CEAA 5L51A 1B8UA 3GGPA 2HMSA 4O59O 4LISA 3MJCA 4HX5A 4E2WA 4S3MA 3ADPA 2VYVA 3OJOA 5JCJA 1K6IA 4AJNA 1TEHA 2ZATA 2RBEA 3O8QA 4G5HA 4R1SA 1XDWA 3JYPA 3W6UA 5B4VA 2WTBA 3VKUA 2WYVA 3JYNA 2EERA 3ZI0A 3HDJA 5FF9A 5DOVA 3ZWPA 3RBZA 2G82A 5T6BA 3ZWWA 4MKRA 2NQTA 3E9NA 4N18A 4UAGA 1BTOA 2Y0CA 4CMBA 4FBGA 5I8ZA 1DC4A 1B8PA 2EW8A 1ADFA 4XB1A 1IYZA 4AJ2A 2NWQA 2P5UA 2X4GA 2I66A 4W9NA 1R0LA 5G0WA 1YGYA 1X7GA 5BSGA 1WDMA 3OIDA 5CFZA 1WLYA 3BTOA 3GRKA 3OP4A 2X58A 1HETA 3OJLA 5DNAA 2POQX 3JQAA 2F00A 3AWDA 4LK3A 3GG9A 4JBIA 4G65A 1TLTA 2CF5A 1CQIA 2NTJA 2JD1A 4CQLA 4CMGA 1VM6A 1D1SA 1HF3A 1KVTA 2IYPA 5G4KB 3ZHXA 3TZCA 4U0KA 1E5LA 5AXAA 1NBOA 4DMMA 1TT7A 4GPD1 4CMKA 3AOEC 3GGGA 2DAPA 3PWKA 2JCXA 5IZCA 2WSBA 3R1IA 4ZRMA 4CMEC 1I3LA 4F45A 2X0NA 1UZLA 2CZCA 4GMGA 2VOJA 4CLHA 1LC3A 1U1IA 1MW2A 1ARZA 3HFSA 1DXYA 3BHJA 4WK6A 2ZB4A 3GF4A 4D45A 4XB2A 1R66A 1PJ4A 2OOSA 4CM7A 2BF7A 4M89A 5H83A 2XAAA 5IF3A 2CFCA 2V7PA 3UICA 1C1XA 1KY4A 2X5KO 2MAOA 1HSZA 5KJEA 1XU7A 4PLCA 4YJHB 4PLTA 4RF4A 5B37A 3WNVA 4IDFA 4BNUA 2CDCA 5DBIA 3RSHA 3OJEA 2HKIA 5F3RA 1DIGA 5JAMA 1BSVA 3RKUA 4L4XA 1U3WA 4YYZA 2G76A 4CM9D 2FPPA 1SPXA 2C0CA 2PD3A 4RORA 3O38A 3U9LA 4YVFA 3MTJA 3DBLB 1LRLA 2IXBA 2PZMA 2WWRA 5TS3A 4FFPA 1P31A 3PLNA 4TWRA 2HMUA 3PIDA 5KWEA 4WKGA 4QT0A 3LT0A 4FDAA 4O63O 3TWOA 5JDIA 2F1KA 3H5NA 2Y1OA 1BXGA 4XQCA 5L7YA 4EITA 1D4FA 2X1HA 4R41A 5TX7A 3TL3A 2VNSA 1PS0A 3S2GA 4BOYA 3H3JA 2GPTA 5ILOA 7ADHA 1AHIA 3BMCA 4DBZA 2GYYA 4RVHA 1LSOA 4BNWA 3DWFA 3VPFA 1GYPA 4D43A 3QVTA 3AK4A 1MB4A 1R4MA 2QIOA 3W1VA 3JQFC 4AJ4A 2AG8A 3K2BA 4GSLA 4IDGA 2R2GA 3DAPA 2JFFA 1CRWG 4YPOA 4R16A 2X9NA 1YB5A 4LVUA 1P1JA 2WD8A 1JW9B 3NGLA 4QO8A 5CHEA 2ZTMA 2W2LA 4ZGWA 4Y98A 4OIMA 2B5WA 2O3TA 4ZICA 3PXXA 1P1HA 2JD2A 3PQFA 3EC7A 1MV8A 3WR5A 1PGOA 3WGOA 3BIOA 2O7QA 4CMIA 1BMDA 2J5QA 5EJ2A 3WBBA 2OP1A 4RZHA 4PVDA 4W82A 5BNIA 1HEUA 4XJSA 5A9SA 4RPJA 1YWGO 5COBA 2PZLA 1XR3A 1YONA 1Q0LA 1F17A 1XQ1A 1IZ9A 1OOEA 3E03A 4Q3NA 1P74A 2QX7A 5C7LO 4OQYA 1DSSG 3T0YA 4CM9A 4PG5A 3GZ4A 3GOHA 2PY6A 3CPSA 4YXFA 3HHPA 4O5OA 5KVQA 4BKUA 4IJKA 5B4UA 5IN4A 4FFOA 1Y8RB 2H9IA 3FRJA 4PFJA 5CEEA 1BWSA 3WIEA 4YTEA 2QRLA 3ITKA 4EEZA 1Y5MA 1ZNQO 1IUKA 5A04A 3UCFA 4XYGA 1Y9AA 3K30A 3DONA 4IXTA 2VN8A 1IOLA 2A35A 3BZUA 1Y1PA 5F1KA 4JX8A 3MJEA 4P8RA 3JV7A 3QHAA 1ULSA 4MVJF 4BO9A 1UAYA 4DVJA 3KUXA 1R6DA 4BNKA 4R1UA 2B36A 1O9BA 3CIFA 4L4RA 4UEOA 4E5KA 4L9RA 4WNIA 4BKOA 4CODB 4EGFA 4BIIA 3E18A 3LT2A 2W2LD 4D79A 2Y1DA 3C3XA 1F06A 5BSHA 1GZ6A 4C7KA 1P3DA 2VTEA 1QYWA 2ZQYA 4NMHA 4FGSA 2HO5A 3WJ7A 2O3JA 1NQTA 4XX0A 4FQ8A 3GY0A 3ETDA 1JU9A 1YRLA 4QXMA 2VTDA 3SC4A 3T7EA 2DPGA 3RUDA 1KVSA 2AXQA 4KDFA 4XKJA 4YJDA 2HMVA 3DHEA 2VYNA 1PQWA 2DBVO 1GCOA 3ETEA 1RYDA 3QSGA 5BSEA 4B8ZA 3ABIA 1DJNA 4IUYA 1H5QA 4CQMA 1T2AA 2IEDA 3JTMA 4FLSA 4QEDA 1MG0A 3L77A 4YACA 5T64A 3DOOA 3W8FA 4U0JA 3EDMA 3S55A 2JHGA 4R3NA 5HWSA 1PSDA 4XR4A 3TN7A 2BFPA 4BNHA 2YHUA 1IE3A 4YCAA 4EBFA 4R54A 1BHSA 4LCJA 4ND3A 4YJHA 3VTFA 4MVJE 3WLFA 5ADHA 3JD3A 4D3SA 1LDYA 1LNQA 2OGUA 2NLOA 4BMNA 3FNGA 1MC4A 1U8FO 3IDSA 2RH4A 1J5PA 4HY3A 2Z1MA 1N8KA 1ONNA 3RFTA 1HE3A 3KHUA 4DGSA 1P45A 1ONPA 3VC7A 1SAYA 1J49A 4CV0A 3H9QA 3E9MA 4MVJM 5BQFA 3UOGA 1PWXA 1I2CA 2PGLA 1EDOA 4MVJD 4ITUA 1TXGA 4DL9A 4KUHA 4CUJA 4CM4A 4IDEA 1LJ8A 3IS3A 3DDNA 2ZB3A 1AUPA 4TKMA 1JA9A 4ND5A 2ZQZA 1BG6A 2O2SA 3BXXA 2BFOA 3Q9NA 1QXSA 4P22A 2W90A 3AUSA 1WW8A 5I9NA 1UR5A 1PL6A 4UEKA 3GNTA 1ZIDA 3BMOA 2W8ZA 4BKRA 4Q3AA 4OL9A 1HTBA 5C37A 2LDXA 1H6BA 2X7HA 3GVIA 5EERA 3NT2A 2YDXA 5IZCC 1OMOA 2X86A 3FNFA 3H4VA 2O3UA 1LI4A 3JQCA 5COQA 3VH3A 4M49A 1RKXA 3RC9A 1H9AA 4D41A 1E6EA 4Y6SA 1FDWA 5IG2A 4BV8A 3DAFA 1ISGA 3AFMA 2UUPA 1N9GB 3OA2A 2JFGA 1B7GO 2FRDA 3OBBA 1DJQA 4GAEA 1IL0A 2AEMA 1KEUA 1NXQA 2BHLA 3O8QB 1U7TA 1N2SA 2DTDA 2NV6A 3OJFA 3JYOA 4TSKA 3V1TC 4PLPA 1E0DA 1JTVA 1E77A 4GWGA 3LK7A 2EGHA 1P1RA 4RV9A 4OM8A 5HA5A 3FR8A 4I9UA 1OC2A 2HLPA 2YYYA 3ZU5A 4M55A 1DAOA 5C5IA 4LSMA 1ID1A 3PRJA 1NWHA 3BMNB 2RAFA 4XDYA 1E6UA 5H81A 1I01A 3H8VA 4IQ0A 4AYSA 3FPLA 1NQ5A 2R00A 4B7CA 3FTNA 2YY7A 3EW7A 1EE9A 3MWEB 4IY1A 2FPGA 1H2BA 5IZ4A 3ST7A 1ULUA 2OUIA 3RJ9A 1QLHA 2YFHA 3ONDA 3Q11A 3JD2A 1ZVMA 3JQ6A 1A7AA 1XLTA 2B4TO 4EUFA 4HADA 4RQUA 4K6CA 3RWBA 3WICA 1HYHA 5ITVA 2AE1A 1ISIA 1DPGA 1M76A 1UDCA 2D0IA 1MUUA 5JDCC 2HK8A 3U49A 3H9JA 3PFWO 3P7MA 3HDHA 5L4NA 5DZSA 3WQSB 3FF4A 5TLSA 5GY7A 3Q0EA 4DLBA 3KYDB 4RZIA 2Q2QA 2HJSA 5G0SA 2I76A 1QV7A 1WPQA 3F5QA 3S2EA 2P4QA 4PLHA 3WGTA 3AUAA 3JQ8B 3ZWMA 5HBRA 3D4NA 2NVBA 4I9NA 4ZQEA 3GVHA 4TRNA 1PR9A 3PZRA 3H6KA 1P33A 4MDHA 3IOYA 3WFJA 3EGOA 1H6DA 3OQBA 1K2WA 2MAPA 3K9QO 3N7UA 3U62A 3WQRA 1W8DA 4MIOA 1X15A 5C7IO 4WOJA 1Q1NA 3K92A 2E37A 3HWRA 3WTBA 3U4HA 4L8VA 1W0CA 4CM5A 3WGHA 2V6MA 3H65A 4KTTE 4J3FA 3WNQA 2JAHA 3L6OO 3GMSA 1WZEA 4UVGA 1B14A 1ZS2A 3F47A 3I83A 1P44A 5CG1A 1E7SA 4GBJA 1SO8A 4W99A 3WMXA 1C14A 4JCOA 4IGEA 4CQMB 4LRTB 5JDIC 3K8ZA 3L4BA 4PLZA 5TSDA 3PYLA 2C7GA 5H82A 4ZQHA 3JD1A 1Z45A 1YS4A 3AUUA 5CG2A 1VJ1A 1OZAA 2ZK7A 4GX5A 4E21A 4PZEA 1NPYA 4A5OA 3Q2KA 5JY1A 2ZIZA 3UAGA 3I9LA 4FW8A 5ER6A 5T57A 3SJ7A 3L4SO 1DEHA 4FR5A 1PGPA 4BB6A 4XQEA 4OQZA 3ANNA 1DFGA 1EFKA 1PZGA 2VWGA 1LSJA 2IZ0A 2VHWA 3TZHA 3BHMA 1SB8A 1YB1A 3FNEA 1T2EA 1WNTA 3PTZA 3C85A 4ZN6A 2D59A 5DP1A 2FOIA 1PU2A 4BNIA 2HUNA 1Y81A 1GU7A 1RP3A 3G0OA 1L7EA 4XJTA 1YVEI 3CINA 2QZ9A 2VOEA 4YAIA 1MA0A 3ROQA 1GYQA 3PJGA 4YDRA 4ESOA 3E6AA 4LW8A 1P9LA 3UVEA 3CZGA 2CVQA 4MVJG 4JLWA 3BMQB 3KLPX 2HMTA 3FCOA 5MGBA 5K6AC 2YZ7A 3U4IA 4TZTA 1LDEA 4RVFA 2HQ1A 2B35A 1H6CA 1X7HA 5TGDA 5L7TA 2Y1GA 1NVGA 2FZEA 3A4VA 4Z9YA 3NUGA 4P4LA 1PGQA 4INAA 1DRVA 5JAZA 3RC2A 1XCBA 2AQKA 3GVCA 3TOXA 3BMOB 2WEKA 3MWDB 4WOKA 3JQ7B 1NTOA 2VRCD 1Y7TA 3F46A 2DC1A 3CUKA 1SOVA 2IDZA 3G1UA 2AHRA 3O26A 2CVZA 4E32A 3EZLA 3EVNA 1HZJA 4OAQA 3WBFA 2EIHA 4J1SA 4CJXA 3X2FA 2IEBA 2NSDA 3H5AA 3I6IA 2XXJA 4WNCA 2Y1FA 1TT5A 4WCFA 3I9NA 4IGFA 3G79A 4RCVA 1IZ0A 3GAFA 3HSKA 3PPIA 3PJDA 4R5HA 5AYVA 2PGJA 3JQ7A 2O7SA 2EKLA 1ZK2A 2XXBA 3NT4A 4U6SA 2PD4A 3DBHB 3KZVA 5DBGA 4PLVA 4YB8A 1E1LA 5U9CA 2FR0A 3H2ZA 3STHA 4IS3A 4DYDA 3UH1A 1B8VA 5JS6A 2SCUA 2BI7A 3R3JA 5DOZA 3ROPA 4ZD6A 3V1UA 1J0XO 4NPCA 4JN6B 2P4HX 1ZK3A 4FC6A 3K2EA 5KKAA 5ICMA 1LU9A 2HCTA 1MW3A 1E7RA 4KWIA 4AJLA 2Q2VA 4XWYA 4XZ3A 4R01A 3NTRA 3PWZA 1JWBB 2GUGA 3QLJA 1R12A 4CMEA 1QRRA 2GRAA 3F4LA 4DQUA 3W8DA 2PNFA 3DTTA 3NRCA 5JO0A 4S1VA 4YBZA 3V8BA 4XRRA 1J6UA 1E3IA 1HKUA 5ILGA 1PS9A 1DIAA 4WCDA 3BMNA 3ZNPA 4CR6A 4EJ0A 4PZDA 3JQGA 1BDBA 2CMDA 3PEFA 3VDRA 2FMUA 5IAAA 1RM4A 1DAPA 2PGDA 3DMYA 4J49A 4Q9NA 1ZEMA 1A27A 1HDZA 3DBRA 3GC6A 2C29D 3ZV4A 3ZGYA 2GF2A 4IIUA 1ISFA 4ONEA 3VKVA 1SC6A 2YQ4A 1VKNA 1GD1O 1C0IA 4W9NC 5LC1A 1BDMA 1A72A 4CUKA 4J1NA 3GMDA 2VZ9A 4UUPA 4D44A 4E6PA 4OXYA 3G3EA 4EJ6A 2RCYA 1A5ZA 1YDEA 4YJGA 4IPTA 2E6UX 4N5NA 2DLDA 3PQDA 1HWYA 2DPHA 2O2YA 4AJIA 3ZV3A 4EYEA 4CV2A 2RH8A 3OIFA 4O0LA 3UUWA 1G5AA 1YL6A 4JIGA 3UF0A 3MOIA 4BGIA 4K9DA 3ZHYA 3C7CB 3KM0A 1AN9A 4RLHA 3FTPA 5JAIA 1W4ZA 1I8TA 4NFYA 1T26A 4IS2A 4BNNA 1PJLA 4BKPA 4BV9A 4XIJA 1OC4A 2WPGA 4WLVA 4DMLA 2Y68A 1C0PA 1E3EA 3HDQA 3RU7A 1YBAA 1FJHA 4FPXA 1EEHA 1NPDA 2DTEA 1KEWA 4CM3A 5I7EA 1UXJA 2EKPA 2ZCVA 3QVOA 4XGIA 1JLLA 3PHLA 1J4AA 1GDHA 4JXKA 4R3WA 2VUSA 3AI1A 3IKVA 4OO3A 4JQCA 4RJTA 1DBVO 1LXCA 4CLDA 1MW1A 1ADBA 1E7YA 2CDBA 4FJ1A 3RCBA 4AG3A 3ZV6A 3OF2A 3VZSA 4BUCA 4NJOA 4I8XA 3ZZNA 3VPSA 3CTMA
chains in the Genus database with same CATH superfamily
3BIXA 1LX7A 2W98A 3NQ41 3O8OB 5L95A 3LE8A 1BX0A 4H2DA 5A3JA 3T6KA 2J4DA 3PQ2A 3LDGA 4QJBA 3EVTA 3SDZA 1M5TA 4HOYA 5CURA 4O4JB 4Y1FA 4EW3A 2E1RA 1H2HA 2CDAA 4AKSA 1MU0A 2JFOA 3IBGA 5LZ8A 1LI5A 2GD6A 3WDKA 5LQUA 3I01M 4LX0A 1X7XB 5C3UA 1OF1A 1P4RA 3V80A 3WLPA 1Z4OA 2NPIA 3OLWA 4PQRA 2W70A 1HE4A 2I34A 1XQXA 2PWZA 2ZCUA 2ZE8A 5TV2A 2LGJA 3H1PA 3UA4A 1DDOA 4GLBA 4FN5A 4TXLA 1OB5A 1Y8AA 2H7XA 2QENA 4KV9A 3S7TA 1D5CA 4YUAA 5TPZA 3KT0A 3JCZA 1BDJA 3PZBA 4E2YA 5JJBA 5JSZA 1KPHA 4M1MA 4HLCA 3DT9A 3PK0A 1I24A 1VRWA 3INTA 2ZSFA 3H9GA 4HTFA 3RVQA 2CVFA 4O2RA 5DVZA 3FDIA 4OHUA 2VA8A 1OI3A 4I4TB 4YT8A 2H5LA 5FEUA 4JUBA 1CX9B 5AW2A 1I3KA 3E5MA 1FQOA 1OUMA 1ZOSA 2V7GA 4YUVA 4YRCA 1WCV1 4C0BA 5JMOA 3B2QA 4G0XA 4LNUA 4RKRA 1ZMBA 3IULA 1V8DA 4IF4A 3UIEA 1YZVA 1YULA 3DLIA 3B9PA 4MW4A 3K70D 1OBCA 1GTSA 3MN1A 1BCSA 1NSFA 2PR7A 3ZJYA 5LD2B 4Z4FA 3CHPA 2NXJA 4Z54A 3IPXA 5BVHB 1F0YA 4Q6WA 3RS9A 1O89A 5GJBA 5A7FA 1MORA 1E64A 1L5QA 1G6HA 1EFUA 3GJZA 1QSGA 1GZ4A 5CHYA 3AOGA 3U31A 3VUFA 3S0JA 1UBLS 1X2BA 1X7XA 2FZWA 3ZDBA 5DW0A 4BZQA 4D9NA 4QX6A 4XO3A 3CXUA 5K5EA 1R6TA 1GOTA 1GL9B 3PRYA 1NP7A 1X74A 4C5BA 3LAWA 3NANA 3HCFA 4LGYA 1P2UA 3WJAA 4BGEA 1LDBA 2I6TA 3COPA 5BO5A 3ETJA 3BD9A 1D2GA 2K2WA 2X8AA 3TTTA 5IXYA 1KRXA 2WILA 3IALA 3ETHA 4KIWA 4ZAGA 1WV0A 2EIXA 1NG9A 3WBJA 1EJBA 2R2AA 4G56A 4WECA 2WR8A 4AUKA 3PD7A 2F1HA 3LQYA 3CUTA 4A82A 4F85A 3ER6A 2QUZA 2JLQA 1X1AA 1G5IA 1ZGJA 1ZFNA 1EP3B 2QRNA 2COEA 2QF7A 4GC5A 5ENDA 5HNFA 4TRJA 3TO5A 3K6KA 5HUQA 5JNVA 4OEHA 2CF6A 3NM4A 1GG5A 1ZU4A 3EVDA 3SF8A 3ABSB 3LVRE 1OWPA 1RJEA 4ZCPA 3OIUA 3QM1A 4B74A 3HVIA 1CR6A 4QOFA 3DFIA 5EHNA 2JD0A 4LQCA 2J6IA 4Q5IA 2WFZA 2OQVA 3SIRA 5CRIA 1J0DA 1E96A 5A5DA 1I80A 3MOGA 3H5OA 3PKIA 4G0OA 4NJMA 3DO5A 1U9IC 2BSXA 5FJJA 4AKHA 4Q1CA 1PWZA 1Z75A 2OMKA 2ZRAA 4WZAE 4IX1A 1UOPA 1T5LA 1QQ7A 2HQBA 1N5RA 1KH2A 4GWKA 2QUHA 1W5AA 5FOVA 3OPMA 2ZPAA 1TNDA 1AMOA 3E9QA 1BJTA 2GKGA 2FWNA 2G25A 2RGNC 4NEHB 3SU8A 1UWLA 1ULBA 2HF7A 1US8B 2O3QA 4EZIA 5IHPA 3D6UA 1T3HA 2OAEA 2P9EA 3NV9A 3LOUA 2NUPB 1FNBA 4BJ6A 1XZDA 2CVPA 4AC9A 1RWXA 2G9NA 3I05A 2VPIA 8MHTA 1V26A 4AJHA 2WJVA 1GAWA 2QR3A 3RYFB 2PKRA 3VU9A 4CF4A 121PA 4JASB 2FPKA 3LBAA 4HDSA 2VP5A 2VHYA 4LY0A 1WVMA 2GCOA 1V7QA 4MYTA 4M87A 3VFDA 2XCUA 1SBTA 1Z0JA 2NUTB 4LOKA 3STWA 3KQVA 1X8JA 4KKVA 4PU0A 1CR0A 1Z82A 4EABA 3L6UA 3TVDA 2H17A 4ER3A 1EFLA 1R0SA 2JC3A 4WGGA 3DG9A 3H5RA 3EBIA 1J23A 1JHDA 1NDUA 3OPYB 5E1MA 2AW5A 3K05A 1I13A 5CPFA 1JI3A 3ESYA 3RABA 4CM1A 5JD3A 1YFJA 5LB4A 4HRXA 3GJSA 2QMUA 2CYCA 2GM9A 4WA8A 4PYRA 1AGRA 1SIWA 3IBYA 4HQFA 4YJ2F 1KI9A 2W2TA 4G5FA 4PN7A 3I8XA 2IH2A 1WE2A 3JASA 5KKCA 2YASA 4XWKA 3H2JA 1UPBA 4H18A 3PQ8A 4MIEA 1LUAA 1ZUNB 4R6WA 5C8ZA 2PHZA 1CS4C 1ZGCA 1W5TA 4RYLA 5EE5B 1RJWA 4DJ5X 5LOVF 1QTQA 1DBPA 1N5MA 1LLCA 4F5ZA 1KHHA 2VUIB 1X86B 2N47A 3D4IA 3H5TA 3L9WA 5C4GB 4EA8A 5AUPB 2I3AA 2HR1A 1QV6A 3IEMA 2BM1A 4UXJA 1B8NA 1AK9A 3COSA 3GYGA 5EPEA 1N2JA 4I6GA 5KNLA 2YXNA 1N92A 2GEDA 3GUVA 1HLGA 1NZDA 3DE3X 1JDSA 2HRDA 4W63A 4K6MA 5GJWC 4M0UA 5ESRA 1SHZA 2P6UA 4M1ZA 1OFUX 2VHXA 2EJTA 5F52A 4WDRA 5KOHA 1K6XA 4MKGA 5ALXA 4WUVA 3QKUA 3P0FA 3AETB 3CHYA 4I2NA 4EGSA 1X77A 5JQGA 4JT2A 3TRIA 1ZJYA 1CDOA 1UMCB 3FPJA 1N9KA 2WZDA 1B0PA 2O4CA 4CXMA 3E3AA 1OGJA 4HSGA 1FSFA 2F43A 3KQOA 4QM6A 3N7AA 1Z74A 3GV0A 2LRHA 1MIHA 3EEYA 4DIBA 1CEYA 3FOZA 4JYZA 4C6TB 3IB3A 3WYDA 2FNAA 4HXYA 3L02A 1QCCA 5EIAA 3A05A 1PL8A 2GS9A 2C2ZA 3SX2A 1J5EB 1H1LB 5CM2Z 2JANA 4Z7OB 3QENA 4DV5B 2O8BA 1N6OA 1LKZA 2YC4C 1MGPA 3FPBA 4Y1RA 4ENUA 1RI5A 2D2IA 2E48A 4F3KA 1XTUA 5KQPA 2G1KA 3OJXA 3NLLA 1RS0A 3OFNA 4P58A 4C4ZA 1X38A 1IEXA 4YWHA 1QDUA 1E2FA 4GX1A 1TYCA 3HA5A 1ULHA 3KVVA 2H5EA 4X92A 4F2PA 1CRQA 3I9OA 4F5DA 5C1BA 3KVOA 2FMTA 4A6DA 2X7JA 4CI0B 4NI5A 1E79D 4LY9A 4LSGA 1B76A 3BFKA 3KZXA 3O4FA 1LLFA 1RMTA 4IV8A 1G64A 5SY6A 3VSBA 4LUCA 3WZ2A 4BO6A 5AVRA 3CRNA 2J08A 4X8MA 5FAXA 2QVBA 4AMVA 1GFSA 4EECA 1RCUA 2MWMA 3TSAA 4FFSA 4KPUA 4TV9A 1VE6A 3RHZA 3QELB 2OQRA 2AJCA 4TVSA 2VSNA 2LUOA 1HRKA 1QRTA 1N7GA 2DUUA 1S2OA 3KYCA 1GG8A 1VBNA 2Q1SA 3OY7A 1EB8A 1WEKA 4FZRA 4OHXA 4PZ9A 4P38A 5FO1A 2RHMA 3WX0A 3FZQA 4MKXA 5CH5A 1LTQA 2RK4A 4IUCS 3V3TA 1CF2O 4ABYA 2VPXA 1RYBA 1KS9A 4ZI5A 1VMAA 5GMOA 1VRCA 1L3CA 4BC1A 3FDFA 4IFBA 5AXCA 4HSEA 3RJZA 1ZJZA 4RK5A 2JIZD 2NZYA 5C7YA 5JHGB 2CNNA 3OEHA 1KF0A 2I3GA 4MUKA 3RWMB 2YW9A 1PZHA 4YV2A 4ZTBA 5LYJF 4H4DA 3ZUPA 3QVMA 3A1NA 2ZQ5A 1DQPA 3TRHA 4U2BA 3AM5A 1VCNA 2M2IA 3HXKA 3B2PA 1THMA 2PUHA 3JVVA 1K5GA 4WESA 3ZCRA 1L1RA 2GK4A 5T8KA 2Q45A 1GPUA 4JNDA 4OQQA 2ATVA 3V4FA 5A0VA 1YH3A 3ASUA 4EF6A 4XPIB 3I2FA 1QO0A 5HTKA 4M2LA 1M0SA 3RLFA 1Z0FA 3AY3A 1XD8A 4MWEA 3PXAA 1M3SA 4NMXB 4BNYA 5AO9A 1OFHA 1Q3HA 1V39A 2FA9A 3WLKX 3RLIA 5M34A 2MU1A 3AYZB 3HB0A 3N2IA 3VV3A 4Z4HA 1H9BA 5EYPA 3QE2A 3RT9A 1RWMA 5HGXA 2Y4OA 3O92A 3OC6A 2EFEB 2X22A 4E31A 4BB5A 4XFJA 3TW4A 1EK1A 4ADSG 4CG1A 1Z9BA 4BNXA 2DG2A 3EIOA 1JFFA 3H75A 2DE0X 3DTNA 2A9KA 2NSLA 3BB3A 3EQ2A 2ILVA 1NG1A 1W0JA 4HAZA 3NHBA 4Y2UA 4I3FA 1PWEA 2QN1A 1QQ6A 3I04M 4TMFA 2H4XA 2GN0A 3HFRA 4XH9B 1LF0A 4RX1A 2GM3A 3DHNA 1FYXA 2NPFA 4QICA 3RSCA 2E4VA 3T5BA 1WQ4A 1YO6A 3EUEA 2NUTA 1XTRA 5MN5A 2PX0A 5H3LA 3H3FA 4MSUA 1CS0A 2HDOA 2UYOA 4ZOEA 2HDHA 3GT0A 4RLSA 1BZYA 3SJAA 3GRPA 1NUPA 1C1XB 5CJPA 3IEPA 1M2EA 5F4BA 4FR0A 1EVKA 4KZPA 1RBMA 2TS1A 4B35A 1VPWA 3W7AA 2ZJ6A 1ENZA 3FYSA 4URYR 4KWHA 4A8HA 2VBFA 1I1QB 5LKRA 1XTKA 1VSBA 3UKJA 4P93A 3LI2A 2XMZA 4KXWA 4DMUB 2EYQA 2C9MA 3GJ8A 3NBFA 4OYYA 4WZAB 5FPYA 4ETIA 1J21A 1A7UA 2FFJA 4M1SA 3SK0A 3WMRA 5ALVA 2V97A 3QF7A 1P3JA 2O2CA 3NDJA 2PFSA 4DR7B 3GZJA 3Q72A 3SC2B 2IV2X 1C9KA 3GEBA 1U7PA 3TBFA 3AB7A 3B7RL 1E9DA 1X42A 2L17A 2VNAA 3HZRA 4R7LA 3L5OA 3JQAD 2G72A 2WBLC 1PNQA 1TAHA 2XA1A 4O4IA 2MSLA 3HRHA 2APJA 1VIMA 2F1JA 4BQIA 5A1JA 3H1TA 3H8WA 1BNCA 4HP8A 4BLPA 5G3YA 2ZAOA 5AM4A 5T67A 1DAKA 1TADA 4KDEA 1OWOA 3RS0A 5HPYB 2QTCA 2F62A 4CVNA 2XMQA 4NHEA 4GVLA 3TKAA 4CZ2A 2KLHA 1TLFA 3AUKA 4U6NA 3T8YA 2QTLA 2SKDA 3S27A 3NAQA 2HHAA 4NJEA 2BMAA 1H65A 1XNHA 3NXSA 1U7XA 3OFJA 2YHIA 2QRUA 4X24A 4V1CA 1FFAA 4K40A 2Z1DA 3QYAA 1SBCA 4IJWA 5L3SB 1XXHA 5HOEA 2P7IA 4PHGA 4J7UA 1XG5A 5T41A 3WNDA 4EW1A 1RW4A 3I1FA 4PRZA 5EV7A 1UMBB 4N3CA 2V7EA 2YV3A 2HT1A 1FDIA 1ZEJA 3UCXA 1QZZA 5JMWA 1JMVA 4QBFA 1SXJB 5E7QA 1A7JA 3CXBA 2COKA 3IUQA 1UQTA 1G21E 2C2YA 1U4SA 2E2WA 1V3UA 3JQEA 3EPKA 1L4EA 2O7RA 3BBPA 3QXCA 3ZLBA 1TRKA 4PICA 4OBBA 1H1DA 1AXEA 1TZKA 4XJVA 4A6EA 4C88A 1WDKA 4JA0A 4JUIA 1O8BA 4ZT3A 1N0UA 1EEXB 5EVCA 3VYTB 3AJRA 3AVOA 4J29A 4V24A 2JFVA 3VMFA 4D0LB 2R4TA 4MYSA 1G1MA 1ZZGA 1IHYA 4JXJA 5BSTA 3TQRA 1XDGA 1MJHA 2QMZA 3A9WA 2IOFA 2XZDA 3HACA 5ALOA 5K8CA 1DWUA 4WN9B 2RGDA 2GEUA 4EQZA 1CY8A 5TY0A 3ZX4A 4GOOD 4BCCA 4DRYA 5GZ1A 1HX7A 1KO5A 3V1MA 4KOEC 2QLMA 3LUKA 5CM9C 3MAGA 3W9SA 5K6AA 3U6BA 3AEQA 1QNLA 3B3AA 1DUIA 3QKIA 4XLZA 3FWPA 3BILA 4PF1A 2CNKA 5LQRA 1Q1QA 4DVGA 1ZC3A 2XH8A 5EXEA 4PLFA 1U65A 3UKOA 2FX2A 1GU1A 1PGJA 2HT6A 4BU1A 2DBQA 4Q9DA 1FYWA 1U8AA 2X14A 1EUZA 2RJNA 5L4LA 4US0R 3ZZ1A 5LDHA 3A9TA 4L78A 3D8NA 2WE8A 4TROA 3DVAB 5IJ0A 4JJZA 3CHQA 5K9ZA 1Q84A 5KHLB 4IRUB 4D8UA 5ESWA 2GVDC 2J33A 4KB5A 3GUHA 4YAEA 4Z7NB 3CUYA 1C7QA 4FMDB 3FYUC 3MEQA 1FXUA 4G07A 4NIMA 2PBRA 4A7PA 4X54A 2XPYA 4LN1A 2VRBA 3HO1A 1NBHA 3EBPA 1Y5LA 4CKEB 4FX5A 3B1JA 5CB4A 1Y3DE 3UJAA 1KHTA 4ZCIA 2VAWA 4F1KA 3O7WA 1EFRA 1T3GA 2TSYB 4I4NA 3CR8A 4YR9A 2Z04A 5JV5A 3U7GA 4B3TB 1JSZA 3BGSA 3Q3GE 4U9IS 5DLYA 3ZE0B 1B42A 3C3BA 4X0EA 4QDZA 2ZYAA 4CLOA 3B70A 3ORYA 2W4MA 3W34A 1YAHA 5KYYA 4DHWA 2H1HA 1JPNA 4N7BA 3SLKA 4QUDA 4UDNA 4FWBA 2RIPA 5HE9A 5KOIA 4RGBA 3ESAA 5G4KA 3DPIA 4ZHQB 2DECA 2AXPA 2AMFA 3VJKA 1XU9A 1ISMA 3C3MA 3R3ZA 1P7VA 1OBFO 2GUWA 3SN6A 4CKBA 3D8SA 2XMBA 1JIIA 2VQEB 1TKBA 3DOCA 3WWPA 4F2DA 4QGSA 2D3TA 1KMNA 5E4JA 4K5QA 1DVRA 4AUMA 2GR9A 3N6RA 3AEKA 5AJHA 2VPWA 3C5CA 1AK1A 5BT9A 4B6EA 1CQJB 1GTRA 1CIJA 2IUUA 1G8HA 1YVUA 4XYEA 2GA8A 2OZVA 1JG3A 2WKRA 4YAGA 3RYCA 1UXIA 3PDJA 4OK6A 3WISA 4QFCA 5TPZD 1UKBA 4JC0A 3I4FA 2FE4A 1M74A 1Q3KA 4LYAA 4DA8A 1ZVKA 3MS4A 3E35A 3AIKA 4YRFA 4QHTA 3U7IA 3PICA 4FT4A 3ETLA 5C4IA 3CKMA 3PNOA 3GRFA 1QYXA 4RPHA 4C0KA 2B2XA 4DM3A 1SG0A 4II3A 3CBQA 2J48A 3RVDA 4AKGA 1NVUQ 4D9FA 1XTSA 1YB2A 4LJ6A 2EEPA 5CXQA 5J2UA 2OK7A 2HHHB 1WBJB 3RUFA 1L9XA 1ZR2A 4C0XA 3OJWA 3IBSA 1Z35A 1E3DA 1MOZA 1HNNA 1FRFS 5IH3A 2MYNA 2O07A 4GXTA 4I50B 4W1QA 5AK3A 5IDVA 3SYRA 3P9CA 2ATCA 4MQFA 4GS5A 1SELA 5LJLA 3HUEA 1XJ5A 3LH5A 5CDFA 3SFZA 4JBHA 3AM4A 3N5KA 4H7DA 1KJJA 4YPFA 1N36B 4KN9S 4EHNA 1FYEA 2H07A 2ZYHA 3OEED 3VSDA 1L9KA 2MSWA 1EK5A 1SVWA 1BYUA 1W34A 2BZ1A 3OCXA 5BURA 4X45A 2AEJA 4B34A 2GCIA 5JPCA 1R16A 1OVGA 4FDLA 4XEHA 2XI4A 4A0SA 2NU6A 3F2IA 3E7DA 4NOLA 3AF1A 5T3UA 5A05A 5CDYA 4TLEA 2ID8A 3ITDA 1RRFA 2WWGA 2YWRA 4DY6A 2V45A 2ZJBA 4C1NA 1GITA 2PLNA 4DZRA 4PBTA 3TMYA 3NDPA 3SEAA 2AF4C 4KAAA 1HT3A 3HCCA 1GPJA 1OY1A 1U4NA 1BHQ1 1GM5A 4L3WA 4FGJA 4IXNA 4W7HA 4QIHA 5F9FA 4ARZA 4IDQA 1LLQA 3EFOA 2PRJA 4ROSA 4XSGA 2BTEA 3EGXB 1Y8QB 4YNBA 4MQEB 2VH5R 1STOA 1V25A 1V6AA 2KI5A 3HJBA 3IV9A 3TW6A 5JWOA 1UZUA 1Z17A 3G5LA 1YE3A 2WOJA 1JJFA 2JH3A 1AMUA 3K9FC 1IUOA 2BELA 3EPHA 2YQZA 5JSYA 5JQGF 1ZIXA 1ESCA 1W44A 3C8MA 4DCVA 4E1VA 3IP5A 3H9CA 4LF8B 4G85A 2JHAA 2ONZA 4WK4B 3T7IA 1XTZA 2D1TA 2HN9A 3FOBA 3IUPA 1N6LA 1OYOA 3KFLA 4QFDA 3K0FB 5ESXA 3VDQA 5LBIA 1OXSC 4GL4A 5K20A 5MDHA 2ZYVX 5JLAA 2K7FA 1JKFA 1IH8A 5KSYA 1O9GA 2F1RA 4NECA 3GH1A 3RROA 1DRUA 1K3UB 4A4DA 2GK6A 4Y2XA 1YNOA 1ODJA 2XE7A 3TRFA 4DMFA 4ZARA 1S1MA 2IDKA 3AHFA 4AS2A 2LV8A 4OQLA 5B7QA 5FBHA 1XMVA 4Y9TA 4B6QA 4P3XA 1TTPB 3RQIA 4MR9A 5AM2A 2DLCX 1L5ZA 5FLKA 5HMLA 2QJTA 3K53A 4A36A 1Y1KE 4QUOA 2RI6A 1CR2A 2CHQA 4PHCA 4Q00A 3HSYA 4YMWA 4B3CA 4N3NA 3T61A 3U7FB 1CJVC 3ZTTA 3I9KA 2HSZA 5B2EA 5DCWA 2WJZB 1S2GA 2ZAYA 1J0CA 3EXFA 5ANRB 3VXKA 1Y33E 2QM8A 2VP4A 4JDUA 1JECA 3TS1A 3WVNA 1KIFA 2ZI4A 1TCCA 4DCNA 2Y76A 1FQJA 3CHOA 1R0KA 2NUAB 5KOJB 3ZGVA 4HNAB 3DO6A 1BIFA 1JHXA 2CJFA 3ENKA 1RNLA 3GPIA 1CQXA 2AE2A 2FPRA 3OQ6A 2WUGA 3QA3E 4Y8VA 4K1LA 5ENZA 4LRWA 5TF0A 1USUA 4BE9A 1WMSA 1Y6JA 1W36C 2QAIA 1Q7TA 1JG9A 1MXHA 1ZJ4A 1DJPA 4FIDA 1KI3A 2RJIA 4RY0A 1VSVA 3GT4A 4HS4A 4JJGA 5DTRA 1HC7A 2DX7A 3ORFA 4FEYA 2G4LA 3DS8A 3HYTA 1ELOA 3MFQA 2O6LA 4IL5A 5TRTA 4EBFA 5CLJA 4RD3A 3I9JA 3JZIA 4RVGA 1Z34A 2NSJA 3GJTA 4URFA 4AJJA 4D92A 1TL7C 2ZBUA 4XCQA 1NDQA 3A9RA 2B20A 4QWWA 2GZHA 2FZGA 4E6EA 2Q5FA 1EB9A 2XRYA 2EP5A 1TKAA 2J41A 5F7XA 4B6GA 2DPYA 1AQNA 1XVIA 1ZSVA 3H6HA 5CNMA 2ATIA 2D13A 2GEVA 5AI0A 1T1SA 1GEGA 3GLHE 3PX2A 4GD3Q 4MO2A 4TSFA 2XOXA 2BMVA 2GETA 4J0JA 3P2OA 3TCNA 4M1KA 4TVBA 3KYJB 2WSSA 4EH1A 1HDIA 1QF7A 2C2BA 4HZUB 1Y5IA 3NEPX 1D2RA 3UUEA 2Z2ZA 4R51A 2A2ZA 1VYVA 2MJLA 3NJ4A 3CO0S 1J24A 1KPGA 1PG2A 2QSUA 3ID6C 3K96A 3JARB 3R09A 4J16A 4NPHA 3L41A 3LQFA 3IT0A 3P8ZA 4J7CA 3ZY2A 2DUJA 1DKQA 1GEEA 1LTHR 3MGGA 3EMKA 1P1IA 2AJ8A 5G53C 5KNCD 2WHYA 3V2HA 1NBEA 2G4VA 1C1DA 4R8SA 2FSHA 1MHPA 4ZXFA 2Q5JA 5DNEA 2FDRA 2P6NA 1X9GA 1GA4A 2XUOA 3SLGA 3CLSD 1RE1A 3Q43A 2Y0EA 5EI5A 3E8XA 3HY4A 1DAMA 4KW7A 4PSUA 4QSMA 5K1ZA 2RKWA 3L4EA 3HO8A 3HN6A 3CVYA 2VJNA 2HF2A 2YTZA 2M6KA 1HMYA 2MINA 1SQGA 3RVKA 4DTIA 1OBHA 3UHAA 2RONA 4IAOA 1HOXA 3BIJA 4NE7A 1PP4A 1J2YA 3MMPA 4FMDF 5CLLA 1JJ7A 3UK1A 1KOFA 3IIJA 3WXBA 5L3VA 4H7PA 4NMWA 1TPYA 1WMAA 3OMLA 1CJUC 2XPCA 3OZCA 4E46A 4TLBA 2FWMX 3LQKA 1WCXA 4D9CA 3JD0A 3FJOA 3BJIC 421PA 1GCAA 1UC4B 1JP7A 2DHCA 2PLRA 2Y99A 3DHYA 3FW1A 3H42B 3N05A 4BWVA 5DNVA 3ZY3A 2WM3A 5ICSA 3B12A 1PL7A 5MFZA 1GTMA 4JFRA 1PJSA 2WT4A 4G4GA 3MTEA 1ZVJA 4DSAA 1RLOA 5HNHA 1YKSA 3EBOA 1Z6QA 1S3FA 4NV0A 5CDTA 2JRLA 2VP2A 4LXXA 1JXOA 3EG5A 3OKFA 4FGKA 2XCRB 1G3IA 1JSCA 1VLMA 4RH3A 4CQLB 4B3JA 3CS3A 4NNPA 2Y93A 2EFCB 3DKIA 3LJKA 4DIEA 1NW4A 4AF7A 1JKJB 5JXIA 3GUCA 4WZAA 2FN3A 3EFHA 3ESRA 3QX8A 3WMFA 4RL6A 1M2VA 3CH4B 3KETA 2CE2X 5EJEA 3U4CA 3UGJA 2DFKB 5SYNA 4YCNA 4LRQA 2NMVA 1G20A 2O5VA 2ZR8A 2HMWA 2VNIA 2AJTA 3RJ5A 1HTTA 4BQNA 4CF5A 4H6XA 4PTLA 1FMCA 3TVTA 1JSLA 3EMVA 3M3PA 2JJ1D 2QL6A 5AJVB 3LP8A 1RAGA 3KAJA 3O73A 1JALA 2YHBA 4I9GA 3RUHA 4RK7A 4OKIA 2G17A 4BO3A 5H3CA 3ZX5A 4TTRA 3LA8A 1H2EA 1ZW1A 4JGIA 3CN7A 4EUHA 5IVDA 4Q4CA 4U7GA 3M4YA 2XBLA 1T9KA 3HKBB 2RGNA 3GEGA 4I1UA 1V8BA 1CWUA 2ODNA 3EH1A 1MC1A 4JP2A 4LTDA 3T7CA 2BDUA 3D4PA 1KE1A 3TIXB 4JITA 1IEWA 1N0IA 3H3XA 2WKWA 4PC1A 3HGMA 2PXHA 5DP2A 2GF0A 4LBVA 3DOJA 1RBQA 4YMIA 3M83A 5ALZA 3VX4A 1JN0A 3IQWA 4ZAXA 4QE3A 1DRJA 4LY3A 1CEQA 1FB5A 1MEJA 1DO0A 2GLUA 3HB9A 5CLFA 1O3YA 3Q5EA 2CL0X 5FPPA 4HXEB 5KNBH 1M6VA 3AVPA 1ORDA 3G5UA 4P80A 4Q24A 1JBEA 3MT0A 1KAQA 3BFVA 1L8LA 2YBEA 1E4OA 2Q1TA 4Q7KA 5DYFA 3Q3CA 3FCXA 3HADA 4OQXA 3K73O 2AI3A 4ASUD 4RXTA 3W5VA 2X0KA 3ZDZB 4FMPA 1OAKA 3ZDDA 1MX3A 2CK3A 2WJ3A 1WD7A 4J3BA 1E5QA 1TAQA 2RGCA 2VJKA 3TQQA 4E14A 5IS2A 2X5OA 3QV1A 1Z0ZA 4HWPA 1VPDA 1I7DA 2ATXA 4JJ8A 4Q34A 4ALLA 1C7JA 1AHNA 3KRTA 5F35A 3SC6A 3LTNC 2IH5A 3JS5A 3O82A 4HMOA 3FPKA 4N5MA 2RGEA 3LFTA 4URVR 1BA2A 2C5AA 4AM8A 2HMYB 3MT8A 3HCWA 5CMLA 5FWYB 4CL8A 4YRRA 2PMKA 4RBNA 2JARA 5DGIA 3A6JA 4ETMA 1E59A 3QVXA 4PO8A 1NVEA 5M04A 3VOBA 4D0SA 4FOLA 1P77A 1FFDA 2FUNB 3QLTA 3DVLA 5FOWA 2NO5A 4CTKA 3V1YA 1UAGA 4QM7A 1EH5A 2ZYUX 1M8GA 1NY6A 2DFNA 4L4YA 3RT1A 2JLWA 3EARA 2YJ6A 2FFBA 2KBEA 4FHCA 4QDUA 1QX3A 2QMOA 2IYFA 4ZAFA 4U02A 2QTVA 2ZI7A 2HA0A 1F2TB 2JVIA 1JKJA 1Z0KA 4KQJA 3F5SA 3CM0A 4C89A 1CDZA 2HEIA 3N0WA 3UFBA 5JAOA 3T15A 4BPBA 3SMQA 2ZRBA 3C1AA 2Z2JA 1M2OA 1ORWA 4JK3A 4JI3B 4OQEA 3AU9A 4OHWA 4PG6A 5JS8A 4WNYA 2AJBA 4PZPA 5KYUB 4IIJB 3JPYA 4IHQA 1FUYB 3TSZA 2QUKA 1T5BA 3KQHA 4FVTA 4WBSA 3ZNOA 1EA5A 1PJCA 2QRVA 3OH8A 1FXWF 1E1YA 2UVPA 1PZXA 3RYIA 4DLTA 3ROZA 5CK5A 3TTYA 2R5WA 2H1VA 1OFVA 3IJPA 2G7MC 4Z6KA 2H4JA 3E27A 4KG7A 1YQXA 4L50A 4OM7A 3OMWA 4RDIA 5CR9A 5FBKA 3TSWA 3UJ8A 1B15A 5EJMA 2AG5A 3L4JA 4N7RA 5TMEA 3DNFA 4PYKA 1V37A 4X6YA 1OBVA 4JVMA 1VDZA 5IN5A 1QYRA 2WJ4A 4Q18A 1XZGA 2BCJQ 2R62A 3HB5X 2E4WA 2M1XA 3K0AB 2OCIA 5IM4A 1XDZA 3CA8A 1VGVA 3EISA 3K9HA 3AP2A 3L3BA 4E13A 2CLIB 2P2SA 1ZH2A 3OIGA 4MVJA 4XYMA 2O2XA 3EBGA 3DYVA 2R6JA 2VCHA 4PEVA 3SXUA 2C5FA 5LQDA 3FH5A 4KR6A 3A3NA 3QLVC 2ZYDA 5DCUA 3GHHA 3PGMA 3USES 1A8HA 1CUCA 1FXSA 4UNIA 1Z3CA 4BUJA 3K9WA 5IT5A 3I58A 4JQZA 5KPJA 1E5DA 1ID8A 5JAUA 2B1QA 3GELA 4CG2A 4CTJA 1Y37A 1XA4A 4FHEA 1YL7A 2VNJA 2RJOA 3EB9A 4PCVA 2I6QA 5E8JA 5EHQA 2JIOA 3I9MA 4WCVA 1KJ8A 2I6UA 2WPDD 2MR6A 4FFDA 1RQGA 2G5PA 1CV2A 1KGDA 4G9BA 2CXSA 2QTHA 3MINB 4ZOLF 3A4LA 3SKVA 4CU5A 4I1OA 3UWKA 1PFKA 3A6HA 3MCVA 4O4HF 1Z6PA 2BZGA 2CSUA 2G9QA 3GR6A 4H3VA 3JQGB 3WMEA 4PGFA 4ZICA 1NI4A 4MRMB 3BZBA 4IDCA 2QPTA 1CY6A 2N1BA 3LX5A 2ZZNA 1GAJA 3L7JA 4BVJA 3B5JA 3LPAA 1Q2XA 4J0GA 3M6VA 5AHRA 3WYNA 5B1YA 5IF9A 1I10A 1KO8A 4CEIA 5IMSA 3R75A 4FFWA 3JT1A 1NVVR 4EJMA 1T15A 4RS3A 1P0CA 2VSQA 4F3CA 4X20A 4JI2B 4MQUA 3FDXA 8OHMA 3BUSA 4OHKA 1GARA 1KKUA 1NR1A 2ZIXB 3RTCA 5L40A 2JAWA 1BQ3A 3C7AA 3LK6A 4K3UA 3VU9B 3A04A 1MA3A 2Y0DA 1NKTA 4IINA 2HMAA 4I55B 1MO3A 3LU1A 4QTZA 2JRCA 2AH5A 1KJWA 4RD1A 5DM4A 2E9SA 2GLTA 1L8OA 4NBWA 3M6WA 5IDWA 3TLAA 1FFEA 1V5EA 2BKAA 4QUKA 4BX2A 4YQFA 5BVGB 5CFRA 3T3DA 5JJKA 3ROMA 1MVOA 1YR6A 5F2NA 1GGKA 1KERA 2QZJA 3NT5A 1QVAA 4P7BA 3LT5A 4R5TA 1D03A 5DBEX 1H0KA 3OSUA 5KWSA 3FRHA 5KTTA 1NBAA 3GOQA 1ZUD1 3PP8A 3GLQA 1E3SA 3T5CA 3TK1A 2X8JA 4GMHA 5BR1A 3M70A 2V7TA 2IXEA 3I42A 2CLMB 1PGNA 2GN1A 4JXZA 1ZPDA 2WG2A 2ZIAA 4UJ3A 3FOWA 1CC1S 1P6XA 2FZ4A 4FHZA 4FEGA 3BE4A 5H02A 2HQSA 4RA9B 1MB9A 5LP1A 3O74A 3P0IA 1ZRMA 4ZX5A 1ZHHA 4K9SA 1JE1A 4DIDA 5I4CA 1R4NB 1CUEA 1TECE 5DHPA 1DOHA 2W8BB 3HDGA 4G97A 4GQAA 3OE1A 3QKWA 2A5DA 4Z2YA 3WMWA 1ZCZA 1GKYA 2OZLB 3VPXA 2BUAA 4BEJA 4CMIB 1JTEA 4HDQB 5EE0A 1A5AB 4DLLA 4E5YA 1A9PA 2KQUA 1WMFA 4AS1A 3CC8A 1VIAA 4MUJA 1IU9A 4IZIA 2Q3LA 3ACBA 5CBPB 4QUAA 3ZVNA 3ZIAA 3KBBA 4H15A 1E7WA 5CA0A 3ICWA 2OC4A 3D6FA 2OD9A 2ZXEA 3DFKA 2QG4A 3RNOA 1G3QA 1BAPA 1HBJA 4OSPA 4F3YA 1E6WA 4RDCA 4WW0A 1W59A 2BP7B 2EHJA 4HNTA 2GXAA 1E1QA 2F3TA 1QG2A 1NLUA 2ECFA 3H9EO 3KDPA 2IT1A 2ZR0A 1FYVA 4U2GA 3ANLA 1FLAA 4J1TA 3UXYA 2XMCA 1ZA2A 3VISA 4CDMA 4HNVA 3TOZA 2GSDA 2RD2A 1GRVA 3OZSA 5CX1A 1VQ1A 1BGXT 1JLSA 2O5RA 4DYVA 4XN7A 5DN9A 3U3JA 4ZOQI 5CA1F 3UHOA 3OEYA 2QTZA 2Q5EA 2Z9BA 1A7KA 2ZSAA 3IVCA 4UD6A 1C3EA 1JE0A 3PI7A 3IR7A 3ZDFA 1DHRA 1SOAA 4Q05A 1UJ6A 2WU0A 3SVTA 5C5EA 4GUAA 3GPDG 1VECA 2W0SA 3G2LA 2PH3A 4J43A 1YZTA 2B7LA 2Y77A 1SCQA 3AJ9A 3KQSA 1XROA 3L0PA 3NBAA 3L6BA 5AOAA 3FHOA 5J4VA 1PNRA 2JK1A 3D0RA 3KT8A 1G2QA 4N5LA 2GJ9A 4XGRA 4BDTA 4MJXA 2P91A 2VJOA 4R1NA 5DNYB 3NOVA 1RAFA 4Y1GA 1ICIA 5J43A 3CX6A 5FWQA 3ILYA 2IJGX 2XGOA 1JXAA 3FFBA 3K1ZA 3OZBA 5EMJA 1WXXA 1ULTA 2WSMA 5A3SA 2ERCA 1IULA 1IIBA 3ACCA 1YR2A 3NP7A 2IYLD 3GJ4A 1DOZA 4R4JA 4RIFA 5LSAA 4DMRA 5EJ8A 1DJMA 1M8JA 3IAUA 4B1FA 1W30A 4KQMA 2ET6A 4UBJA 2IIVA 1Z25A 3LZCA 3ZWVA 4CKWA 1OX6A 4S1NA 2WF8A 4W4TA 3C8UA 4JYAB 4REOA 4ZI2A 2VPQA 3QXHA 1FX0B 1KP9A 1G21A 1MPTA 2OORC 4IGIA 5LA6F 5REQA 5TGZA 5HQ3A 3LX8A 2HIHA 5K0JA 2JAXA 1ZD9A 1I2MA 1LNZA 4MW1A 1L4HA 4XQ0A 2J8ZA 4DV3B 3QEOA 1QH1A 2ZKLA 1SPBS 3T1VA 4N8DA 1JLRA 1UWKA 4LMAA 5FTJA 4ZYLA 4N0EA 4J07A 5EZYB 1BRMA 2R72A 3W90A 4RTRA 3A9CA 2O48X 1E1MA 4QVKA 1KWKA 3ZHVA 4CL3A 1VFPA 3FH7A 1Z7BA 2ZRMA 3RYCB 1D8AA 5L6MB 3E0QA 3AIOA 4EG1A 1JQDA 4RDHA 5AKXA 1P0PA 1CQJA 3T7KA 3N58A 3FPAA 2ZM5A 4A6XA 1M72A 1ZLXA 1SUPA 4DV6B 5CVTA 1XEWX 4LDNA 3UG7A 1Z2PX 5FDFA 3OFVA 3NASA 4X9XA 1Y1LA 4B84A 1VPTA 1NUUA 1YA8A 4O3FA 3T0FA 4LMPA 1V2GA 2JGFA 1CUIA 2ZDQA 4X1OA 3VSCA 3SJCA 4PG7A 3WRYA 4B32A 4E1BA 3O47A 3QW2A 4FQ5A 4GKBA 4F56A 4Y9DA 2P3QA 2NYRA 3GRRA 2PS3A 3SHWA 2LBPA 5AT1A 1RHMA 2AA3A 3V55A 5T8KC 1QMPA 4YP1A 3FHEA 2BD0A 1BGWA 4MPDA 4E3ZA 1JDTA 5EIFA 4EJFA 3G5AA 3OJCA 4KYVA 5DRTA 3A9UA 3B34A 1L1QA 5DBHX 2NVUA 2V6IA 3ESCA 4JGBA 5ARBA 3V9PA 4DA6A 1MX5A 4F06A 4OYRA 4GAAA 2CD7A 4NAUA 3U3KA 2R8YA 5LQCA 3U13A 4QAQA 4B4UA 4QOGA 3BMCB 1JJBA 1NJGA 1P9NA 3P0HA 1F38A 4IDAA 3UOWA 4CFSA 4MKTA 2CKDA 3CX3A 5CDUA 4CIWA 2JLBA 3TZQA 1SFRA 1EBUA 2HQOA 3C6ZA 3L6EA 1OE0A 4J0EA 3PXEA 1XWWA 3FF1A 4O4JF 2JGRA 1HE2A 3C1TA 3DXYA 3GRUA 3KDAA 1O97C 3MWGA 3B1XA 3DM5A 2CXQA 3V42A 3G8DA 4U7PB 5DLDA 3P0RA 1O97D 1P8JA 2C3UA 3AR5A 3Q88A 5FOQA 4WT7A 1Z3IX 2P9CA 4DJEC 3VR4A 1TTHA 1T4CA 3ASVA 3EGDB 3LCCA 1SXJD 2PX6A 2NG1A 2VPZA 4F4HA 2MDTA 4TRMA 1CD5A 2I4TA 2WA1A 1G2OA 4ENQA 3HEMA 5C32A 1AO0A 1I3OA 1MENA 3B89A 2XVZA 2EDAA 2XNCA 1YAJA 2QPOA 4LNUB 3NKLA 4PZUA 1MB0A 5B1HA 1TTQB 2B5VA 3FMOB 3WK8A 3F4BA 3AVWA 3BYZA 3DFUA 4MWBA 1XRPA 3E5NA 5LOVA 3T3NA 3OOHA 4DDHA 5J2TB 2QWXA 2GGSA 1CG6A 1EK2A 3FZYA 2DWCA 3S1SA 2QN8A 5ED0A 4US2R 2C7OA 2H2IA 2SBTA 5AJZA 3COWA 1E0SA 1G8SA 3D2AA 1GXSA 1ZZEA 2CLEB 3P2IA 3PFBA 5EXSA 3R2JA 1DKPA 3R0IA 4YT4A 2C59A 5FXMA 2OGTA 1X14A 5HM8A 5AVVA 3HBFA 3L40A 1ADCA 4KTVE 3LV8A 4LJ8A 4ZREA 1PNTA 1UKZA 1S46A 4H6PA 1XTIA 2O23A 1E2LA 4GQIA 4NULA 4D4MA 4ND4A 4Q66C 2PN1A 4PZ0A 1W4AA 1DTWA 1XVTA 4TMZA 2WV9A 4TQGA 3PITA 1JEQA 4ISBA 5F33A 3DBHA 4MCHA 2P0EA 2UZIR 3GLGA 4YT2A 3E4CA 4E2FA 2WE7A 1CSEE 1WAMA 4KH1A 2W83A 3KKEA 4EYKA 4WACA