1SG7A

Nmr solution structure of the putative cation transport regulator chab
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
PYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Cation transport regulator chaB
publication title The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06150 ChaB ChaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.70 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sg7A00
1SG7A
chains in the Genus database with same CATH superfamily
1MW1A 2WZGA 4XMVA 4ZQFA 5EV7A 3VVLA 3ANMA 3B2XA 2PL5A 4Y6SA 4R5XA 4XNAA 3FTZA 2Y1DA 4Y67A 5HNFA 4K5PA 4MKTA 4XN2A 3B2PA 4ZQTA 3CHRA 2R72A 3JT1A 2O7GA 4XN4A 3FULA 1ONOA 2B61A 4ZW5A 3B7SA 2PUSA 4MS6A 3Q43A 3UERA 4XMWA 5JNLA 4R5TA 3B7TA 4AR9A 3FU5A 1SQMA 3CHPA 1H3LA 3CZEA 5DULA 4AYSA 4XNBA 4XNDA 1R0LA 2HPOA 2MAPA 1S46A 1OR7A 3JSZA 2R59A 3ANNA 3T8VA 2JCVA 2GTQA 5JAZA 1Q0QA 3CZKA 1ONPA 1Q0HA 4FLQA 4ZW7A 4ZX3A 4LUPA 3QJXA 1K5HA 4A03A 3R0IA 1R0KA 3FTSA 3UCQA 1G5AA 3CHSA 5DYFA 4XMTA 4J3BA 2VJ8A 2XPYA 3AU8A 4ZX5A 3FTWA 3FUJA 3FH5A 4RVBA 4AR8A 4ZQEA 4R5VA 3EBGA 4GAEA 5JBIA 3ZHXA 4CXFA 3AU9A 1MW0A 2JCYA 5DLLA 3ANLA 4ZN6A 2Y1GA 4AICA 4JNDA 4ZW3A 3EBHA 4XO5A 4NQWA 3FH8A 4QHPA 1X3WA 4L2LA 3HW2A 5BPPA 1T1RA 4QUOA 3B34A 4FLRA 3ZI0A 5HNHA 4FCAA 2XPZA 3ZHYA 2JCXA 4QIRA 2R70A 2WZFA 2C82A 4K5OA 3FTXA 4DPRA 5JO0A 1JG9A 3PUUA 2WPGA 3CIAA 2ZXGA 5HLTA 1MW2A 3CZLA 2QVWA 1T1SA 4K5NA 3CZGA 4PW4A 5JC1A 4R7LA 2A7OA 3RASA 3FU0A 3B3BA 3WQRA 3WQSB 4RCVA 4XMXA 3EBIA 4XN8A 2FFLA 5FWQA 3FU6A 2JD0A 3FHEA 3FUIA 4QMEA 3WQQA 2XQ0A 3FUKA 4AR1A 1GW6A 2Y1FA 2Y1CA 2VLAA 2Y1EA 4XO4A 1HS6A 2JD1A 4QPEA 4Y6RA 4K5MA 5JMPA 1SC5A 2JD2A 3FU3A 3VVMA 3ZHZA 3RC3A 3FUDA 4Q4IA 3FTYA 3KEDA 4FLOA 4GAAA 3CHOA 3RC8A 1ONNA 4PU2A 4ZW8A 4XMUA 4ZQGA 1X3ZA 3FH7A 4ZX6A 1H19A 4OOEA 4FLSA 4PVBA 3FUFA 4OOFA 4ZQHA 3FTUA 1Q0LA 2MAOA 4XN7A 2DQ6A 3FTVA 4RSYA 1RP3A 3CHQA 4XN5A 3U9WA 1ZS2A 2DQMA 3B37A 3B7UX 4K5LA 1MW3A 3A14A 3CXBA 1JGIA 3FUEA 3A06A 2JV7A 3Q44A 2HPTA 4ZX4A 3IIEA 1MVYA 4XO3A 3AUAA 3UEQA 2EGHA 4Y6PA 5JMWA 3FUNA 4Q4EA 4XN9A 2RJIA 1SG7A 2PGGA 3T0YA 3B7RL 3FUHA 4KP7A 1JVSA 3FUMA 4X2UA 5AENA 2C5ZA 4XN1A 4XMZA 2QJ1A 4ZW6A 4BKXA 4ARFA
chains in the Genus database with same CATH topology
1MW1A 2WZGA 4XMVA 4ZQFA 5EV7A 3VVLA 3ANMA 3B2XA 2PL5A 4Y6SA 4R5XA 4XNAA 3FTZA 2Y1DA 4Y67A 5HNFA 4K5PA 4MKTA 4XN2A 3B2PA 4ZQTA 3CHRA 2R72A 3JT1A 2O7GA 4XN4A 3FULA 1ONOA 2B61A 4ZW5A 3B7SA 2PUSA 4MS6A 3Q43A 3UERA 4XMWA 5JNLA 4R5TA 3B7TA 4AR9A 3FU5A 1SQMA 3CHPA 1H3LA 3CZEA 5DULA 4AYSA 4XNBA 4XNDA 1R0LA 2HPOA 2MAPA 1S46A 1OR7A 3JSZA 2R59A 3ANNA 3T8VA 2JCVA 2GTQA 5JAZA 1Q0QA 3CZKA 1ONPA 1Q0HA 4FLQA 4ZW7A 4ZX3A 4LUPA 3QJXA 1K5HA 4A03A 3R0IA 1R0KA 3FTSA 3UCQA 1G5AA 3CHSA 5DYFA 4XMTA 4J3BA 2VJ8A 2XPYA 3AU8A 4ZX5A 3FTWA 3FUJA 3FH5A 4RVBA 4AR8A 4ZQEA 4R5VA 3EBGA 4GAEA 5JBIA 3ZHXA 4CXFA 3AU9A 1MW0A 2JCYA 5DLLA 3ANLA 4ZN6A 2Y1GA 4AICA 4JNDA 4ZW3A 3EBHA 4XO5A 4NQWA 3FH8A 4QHPA 1X3WA 4L2LA 5BPPA 1T1RA 4QUOA 3B34A 4FLRA 3ZI0A 5HNHA 4FCAA 2XPZA 3ZHYA 2JCXA 4QIRA 2R70A 2WZFA 2C82A 4K5OA 3FTXA 4DPRA 5JO0A 1JG9A 3PUUA 2WPGA 3CIAA 2ZXGA 5HLTA 1MW2A 3CZLA 2QVWA 1T1SA 4K5NA 3CZGA 4PW4A 5JC1A 4R7LA 2A7OA 3RASA 3FU0A 3B3BA 3WQRA 3WQSB 4RCVA 4XMXA 3EBIA 4XN8A 2FFLA 5FWQA 3FU6A 2JD0A 3FHEA 3FUIA 4QMEA 3WQQA 2XQ0A 3FUKA 4AR1A 1GW6A 2Y1FA 2Y1CA 2VLAA 2Y1EA 4XO4A 1HS6A 2JD1A 4QPEA 4Y6RA 4K5MA 5JMPA 1SC5A 2JD2A 3FU3A 3VVMA 3ZHZA 3RC3A 3FUDA 4Q4IA 3FTYA 3KEDA 4FLOA 4GAAA 3CHOA 3RC8A 1ONNA 4PU2A 4ZW8A 4XMUA 4ZQGA 1X3ZA 3FH7A 4ZX6A 1H19A 4OOEA 4FLSA 4PVBA 3FUFA 4OOFA 4ZQHA 3FTUA 1Q0LA 2MAOA 4XN7A 2DQ6A 3FTVA 4RSYA 1RP3A 3CHQA 4XN5A 3U9WA 1ZS2A 2DQMA 3B37A 3B7UX 4K5LA 1MW3A 3A14A 3FUEA 1JGIA 3Q44A 3A06A 2JV7A 2HPTA 4ZX4A 3IIEA 1MVYA 4XO3A 3AUAA 3UEQA 2EGHA 4Y6PA 5JMWA 3FUNA 4Q4EA 4XN9A 2RJIA 1SG7A 2PGGA 3T0YA 3B7RL 3FUHA 4KP7A 1JVSA 3FUMA 4X2UA 5AENA 2C5ZA 4XN1A 4XMZA 2QJ1A 4ZW6A 4BKXA 4ARFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG7 A; 
#chains in the Genus database with same CATH topology
 1MW1 A;  2WZG A;  4XMV A;  4ZQF A;  5EV7 A;  3VVL A;  3ANM A;  3B2X A;  2PL5 A;  4Y6S A;  4R5X A;  4XNA A;  3FTZ A;  2Y1D A;  4Y67 A;  5HNF A;  4K5P A;  4MKT A;  4XN2 A;  3B2P A;  4ZQT A;  3CHR A;  2R72 A;  3JT1 A;  2O7G A;  4XN4 A;  3FUL A;  1ONO A;  2B61 A;  4ZW5 A;  3B7S A;  2PUS A;  4MS6 A;  3Q43 A;  3UER A;  4XMW A;  5JNL A;  4R5T A;  3B7T A;  4AR9 A;  3FU5 A;  1SQM A;  3CHP A;  1H3L A;  3CZE A;  5DUL A;  4AYS A;  4XNB A;  4XND A;  1R0L A;  2HPO A;  2MAP A;  1S46 A;  1OR7 A;  3JSZ A;  2R59 A;  3ANN A;  3T8V A;  2JCV A;  2GTQ A;  5JAZ A;  1Q0Q A;  3CZK A;  1ONP A;  1Q0H A;  4FLQ A;  4ZW7 A;  4ZX3 A;  4LUP A;  3QJX A;  1K5H A;  4A03 A;  3R0I A;  1R0K A;  3FTS A;  3UCQ A;  1G5A A;  3CHS A;  5DYF A;  4XMT A;  4J3B A;  2VJ8 A;  2XPY A;  3AU8 A;  4ZX5 A;  3FTW A;  3FUJ A;  3FH5 A;  4RVB A;  4AR8 A;  4ZQE A;  4R5V A;  3EBG A;  4GAE A;  5JBI A;  3ZHX A;  4CXF A;  3AU9 A;  1MW0 A;  2JCY A;  5DLL A;  3ANL A;  4ZN6 A;  2Y1G A;  4AIC A;  4JND A;  4ZW3 A;  3EBH A;  4XO5 A;  4NQW A;  3FH8 A;  4QHP A;  1X3W A;  4L2L A;  3HW2 A;  5BPP A;  1T1R A;  4QUO A;  3B34 A;  4FLR A;  3ZI0 A;  5HNH A;  4FCA A;  2XPZ A;  3ZHY A;  2JCX A;  4QIR A;  2R70 A;  2WZF A;  2C82 A;  4K5O A;  3FTX A;  4DPR A;  5JO0 A;  1JG9 A;  3PUU A;  2WPG A;  3CIA A;  2ZXG A;  5HLT A;  1MW2 A;  3CZL A;  2QVW A;  1T1S A;  4K5N A;  3CZG A;  4PW4 A;  5JC1 A;  4R7L A;  2A7O A;  3RAS A;  3FU0 A;  3B3B A;  3WQR A;  3WQS B;  4RCV A;  4XMX A;  3EBI A;  4XN8 A;  2FFL A;  5FWQ A;  3FU6 A;  2JD0 A;  3FHE A;  3FUI A;  4QME A;  3WQQ A;  2XQ0 A;  3FUK A;  4AR1 A;  1GW6 A;  2Y1F A;  2Y1C A;  2VLA A;  2Y1E A;  4XO4 A;  1HS6 A;  2JD1 A;  4QPE A;  4Y6R A;  4K5M A;  5JMP A;  1SC5 A;  2JD2 A;  3FU3 A;  3VVM A;  3ZHZ A;  3RC3 A;  3FUD A;  4Q4I A;  3FTY A;  3KED A;  4FLO A;  4GAA A;  3CHO A;  3RC8 A;  1ONN A;  4PU2 A;  4ZW8 A;  4XMU A;  4ZQG A;  1X3Z A;  3FH7 A;  4ZX6 A;  1H19 A;  4OOE A;  4FLS A;  4PVB A;  3FUF A;  4OOF A;  4ZQH A;  3FTU A;  1Q0L A;  2MAO A;  4XN7 A;  2DQ6 A;  3FTV A;  4RSY A;  1RP3 A;  3CHQ A;  4XN5 A;  3U9W A;  1ZS2 A;  2DQM A;  3B37 A;  3B7U X;  4K5L A;  1MW3 A;  3A14 A;  3CXB A;  1JGI A;  3FUE A;  3A06 A;  2JV7 A;  3Q44 A;  2HPT A;  4ZX4 A;  3IIE A;  1MVY A;  4XO3 A;  3AUA A;  3UEQ A;  2EGH A;  4Y6P A;  5JMW A;  3FUN A;  4Q4E A;  4XN9 A;  2RJI A;  1SG7 A;  2PGG A;  3T0Y A;  3B7R L;  3FUH A;  4KP7 A;  1JVS A;  3FUM A;  4X2U A;  5AEN A;  2C5Z A;  4XN1 A;  4XMZ A;  2QJ1 A;  4ZW6 A;  4BKX A;  4ARF A; 
#chains in the Genus database with same CATH homology
 1MW1 A;  2WZG A;  4XMV A;  4ZQF A;  5EV7 A;  3VVL A;  3ANM A;  3B2X A;  2PL5 A;  4Y6S A;  4R5X A;  4XNA A;  3FTZ A;  2Y1D A;  4Y67 A;  5HNF A;  4K5P A;  4MKT A;  4XN2 A;  3B2P A;  4ZQT A;  3CHR A;  2R72 A;  3JT1 A;  2O7G A;  4XN4 A;  3FUL A;  1ONO A;  2B61 A;  4ZW5 A;  3B7S A;  2PUS A;  4MS6 A;  3Q43 A;  3UER A;  4XMW A;  5JNL A;  4R5T A;  3B7T A;  4AR9 A;  3FU5 A;  1SQM A;  3CHP A;  1H3L A;  3CZE A;  5DUL A;  4AYS A;  4XNB A;  4XND A;  1R0L A;  2HPO A;  2MAP A;  1S46 A;  1OR7 A;  3JSZ A;  2R59 A;  3ANN A;  3T8V A;  2JCV A;  2GTQ A;  5JAZ A;  1Q0Q A;  3CZK A;  1ONP A;  1Q0H A;  4FLQ A;  4ZW7 A;  4ZX3 A;  4LUP A;  3QJX A;  1K5H A;  4A03 A;  3R0I A;  1R0K A;  3FTS A;  3UCQ A;  1G5A A;  3CHS A;  5DYF A;  4XMT A;  4J3B A;  2VJ8 A;  2XPY A;  3AU8 A;  4ZX5 A;  3FTW A;  3FUJ A;  3FH5 A;  4RVB A;  4AR8 A;  4ZQE A;  4R5V A;  3EBG A;  4GAE A;  5JBI A;  3ZHX A;  4CXF A;  3AU9 A;  1MW0 A;  2JCY A;  5DLL A;  3ANL A;  4ZN6 A;  2Y1G A;  4AIC A;  4JND A;  4ZW3 A;  3EBH A;  4XO5 A;  4NQW A;  3FH8 A;  4QHP A;  1X3W A;  4L2L A;  5BPP A;  1T1R A;  4QUO A;  3B34 A;  4FLR A;  3ZI0 A;  5HNH A;  4FCA A;  2XPZ A;  3ZHY A;  2JCX A;  4QIR A;  2R70 A;  2WZF A;  2C82 A;  4K5O A;  3FTX A;  4DPR A;  5JO0 A;  1JG9 A;  3PUU A;  2WPG A;  3CIA A;  2ZXG A;  5HLT A;  1MW2 A;  3CZL A;  2QVW A;  1T1S A;  4K5N A;  3CZG A;  4PW4 A;  5JC1 A;  4R7L A;  2A7O A;  3RAS A;  3FU0 A;  3B3B A;  3WQR A;  3WQS B;  4RCV A;  4XMX A;  3EBI A;  4XN8 A;  2FFL A;  5FWQ A;  3FU6 A;  2JD0 A;  3FHE A;  3FUI A;  4QME A;  3WQQ A;  2XQ0 A;  3FUK A;  4AR1 A;  1GW6 A;  2Y1F A;  2Y1C A;  2VLA A;  2Y1E A;  4XO4 A;  1HS6 A;  2JD1 A;  4QPE A;  4Y6R A;  4K5M A;  5JMP A;  1SC5 A;  2JD2 A;  3FU3 A;  3VVM A;  3ZHZ A;  3RC3 A;  3FUD A;  4Q4I A;  3FTY A;  3KED A;  4FLO A;  4GAA A;  3CHO A;  3RC8 A;  1ONN A;  4PU2 A;  4ZW8 A;  4XMU A;  4ZQG A;  1X3Z A;  3FH7 A;  4ZX6 A;  1H19 A;  4OOE A;  4FLS A;  4PVB A;  3FUF A;  4OOF A;  4ZQH A;  3FTU A;  1Q0L A;  2MAO A;  4XN7 A;  2DQ6 A;  3FTV A;  4RSY A;  1RP3 A;  3CHQ A;  4XN5 A;  3U9W A;  1ZS2 A;  2DQM A;  3B37 A;  3B7U X;  4K5L A;  1MW3 A;  3A14 A;  3FUE A;  1JGI A;  3Q44 A;  3A06 A;  2JV7 A;  2HPT A;  4ZX4 A;  3IIE A;  1MVY A;  4XO3 A;  3AUA A;  3UEQ A;  2EGH A;  4Y6P A;  5JMW A;  3FUN A;  4Q4E A;  4XN9 A;  2RJI A;  1SG7 A;  2PGG A;  3T0Y A;  3B7R L;  3FUH A;  4KP7 A;  1JVS A;  3FUM A;  4X2U A;  5AEN A;  2C5Z A;  4XN1 A;  4XMZ A;  2QJ1 A;  4ZW6 A;  4BKX A;  4ARF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...