1SG7A

Nmr solution structure of the putative cation transport regulator chab
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
PYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative Cation transport regulator chaB
publication title The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06150 ChaB ChaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.70 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sg7A00
1SG7A
chains in the Genus database with same CATH superfamily
2O7GA 3ZHZA 5JNLA 1MW0A 2FFLA 4ZQTA 4XMVA 4RCVA 4MS6A 4ARFA 3FUIA 3FUJA 4Y67A 2R70A 4RVBA 4PW4A 1G5AA 5AENA 4XN1A 3ZHYA 1T1SA 4FLOA 4Y6RA 2XQ0A 4ZW3A 3B7SA 5HLTA 3CHSA 3B7RL 4KP7A 3B7UX 3FTZA 4XMXA 5FWQA 4R7LA 3FTXA 1Q0LA 1SC5A 2R72A 4QUOA 5JMPA 3FUNA 3U9WA 5JBIA 2JV7A 1HS6A 4XN4A 5DYFA 1T1RA 5JMWA 3FU5A 3IIEA 4QHPA 4CXFA 4LUPA 3EBGA 3CHRA 2R59A 3CHQA 1MW3A 2WZFA 3QJXA 3JT1A 4AR9A 3CZGA 3R0IA 4XO3A 2Y1DA 4R5XA 2DQ6A 4DPRA 4XN5A 3FH7A 3FTUA 2QVWA 3FTYA 4K5MA 4XN9A 4FLRA 4OOEA 4ZQGA 3RC3A 4GAEA 5DLLA 3UEQA 1R0LA 4XMUA 4ZN6A 3ANMA 4ZQEA 4ZX5A 4JNDA 3FUHA 4QIRA 3B2XA 3T0YA 4L2LA 3VVMA 1H19A 2GTQA 3FULA 3ANLA 4XMZA 1ONPA 4XNDA 2RJIA 3FUEA 4ZQFA 3CXBA 3FUKA 5EV7A 1JVSA 4RSYA 4AR1A 4K5OA 4XNAA 1JG9A 2HPOA 4X2UA 3CHPA 2Y1FA 4ZW8A 3B37A 2XPZA 4MKTA 2QJ1A 4A03A 4AYSA 2ZXGA 3CIAA 3CZEA 3Q43A 3UCQA 2B61A 4XMTA 2JD1A 1X3ZA 3FUMA 2Y1EA 1X3WA 1S46A 3Q44A 4XO4A 3RC8A 2JCXA 1JGIA 4ZQHA 1ZS2A 4XN8A 3WQRA 3RASA 1SG7A 4ZX4A 3FTVA 2VJ8A 1H3LA 3CHOA 3AU8A 3FU3A 3FHEA 3B34A 4R5TA 4XO5A 4ZX3A 3B3BA 3JSZA 4XN7A 4ZW5A 3KEDA 3ZI0A 1K5HA 3FU6A 2Y1GA 4J3BA 2XPYA 2JD2A 3UERA 4FCAA 4ZX6A 2Y1CA 4Q4EA 2HPTA 3AUAA 3VVLA 1RP3A 2PUSA 4K5PA 2JCVA 4FLQA 1GW6A 4ZW6A 3FUDA 4Y6PA 3FUFA 1MVYA 2PGGA 3FH5A 4XN2A 1R0KA 4NQWA 3ZHXA 3AU9A 1MW2A 4PVBA 1Q0HA 3WQQA 5JC1A 5DULA 4AR8A 2A7OA 4GAAA 2MAPA 3A14A 3ANNA 4PU2A 3HW2A 4XMWA 3CZKA 1Q0QA 3EBHA 4XNBA 5HNFA 2VLAA 5JO0A 3PUUA 2DQMA 3FTSA 3A06A 2C82A 2PL5A 1ONOA 2JD0A 4ZW7A 2C5ZA 2EGHA 3T8VA 2WPGA 5JAZA 4R5VA 4K5LA 3FTWA 4QMEA 1ONNA 2MAOA 3B7TA 3FH8A 4AICA 3WQSB 3EBIA 3FU0A 2WZGA 1OR7A 4QPEA 4FLSA 4Y6SA 4OOFA 5BPPA 1SQMA 1MW1A 4K5NA 3CZLA 4BKXA 5HNHA 3B2PA 4Q4IA 2JCYA
chains in the Genus database with same CATH topology
2O7GA 3ZHZA 5JNLA 1MW0A 2FFLA 4ZQTA 4XMVA 4RCVA 4MS6A 4ARFA 3FUIA 3FUJA 4Y67A 2R70A 4RVBA 4PW4A 1G5AA 5AENA 4XN1A 3ZHYA 1T1SA 4FLOA 4Y6RA 2XQ0A 4ZW3A 3B7SA 5HLTA 3CHSA 3B7RL 4KP7A 3B7UX 3FTZA 4XMXA 5FWQA 4R7LA 3FTXA 1Q0LA 1SC5A 2R72A 4QUOA 5JMPA 3FUNA 3U9WA 5JBIA 2JV7A 1HS6A 4XN4A 5DYFA 1T1RA 5JMWA 3FU5A 3IIEA 4QHPA 4CXFA 4LUPA 3EBGA 3CHRA 2R59A 3CHQA 1MW3A 2WZFA 3QJXA 3JT1A 4AR9A 3CZGA 3R0IA 4XO3A 2Y1DA 4R5XA 2DQ6A 4DPRA 4XN5A 3FH7A 3FTUA 2QVWA 3FTYA 4K5MA 4XN9A 4FLRA 4OOEA 4ZQGA 3RC3A 4GAEA 5DLLA 3UEQA 1R0LA 4XMUA 4ZN6A 3ANMA 4ZQEA 4ZX5A 4JNDA 3FUHA 4QIRA 3B2XA 3T0YA 4L2LA 3VVMA 1H19A 2GTQA 3FULA 3ANLA 4XMZA 1ONPA 4XNDA 2RJIA 3FUEA 4ZQFA 3FUKA 5EV7A 1JVSA 4RSYA 4AR1A 4K5OA 4XNAA 1JG9A 2HPOA 4X2UA 3CHPA 2Y1FA 4ZW8A 3B37A 2XPZA 4MKTA 2QJ1A 4A03A 4AYSA 2ZXGA 3CIAA 3CZEA 3Q43A 3UCQA 2B61A 4XMTA 2JD1A 1X3ZA 3FUMA 2Y1EA 1X3WA 1S46A 3Q44A 4XO4A 3RC8A 2JCXA 1JGIA 4ZQHA 1ZS2A 4XN8A 3WQRA 3RASA 1SG7A 4ZX4A 3FTVA 2VJ8A 1H3LA 3CHOA 3AU8A 3FU3A 3FHEA 3B34A 4R5TA 4XO5A 4ZX3A 3B3BA 3JSZA 4XN7A 4ZW5A 3KEDA 3ZI0A 1K5HA 3FU6A 2Y1GA 4J3BA 2XPYA 2JD2A 3UERA 4FCAA 4ZX6A 2Y1CA 4Q4EA 2HPTA 3AUAA 3VVLA 1RP3A 2PUSA 4K5PA 2JCVA 4FLQA 1GW6A 4ZW6A 3FUDA 4Y6PA 3FUFA 1MVYA 2PGGA 3FH5A 4XN2A 1R0KA 4NQWA 3ZHXA 3AU9A 1MW2A 4PVBA 1Q0HA 3WQQA 5JC1A 5DULA 4AR8A 2A7OA 4GAAA 2MAPA 3A14A 3ANNA 4PU2A 4XMWA 4XNBA 3CZKA 1Q0QA 3EBHA 5HNFA 2VLAA 5JO0A 3PUUA 2DQMA 3FTSA 3A06A 2C82A 2PL5A 1ONOA 2JD0A 4ZW7A 2C5ZA 2EGHA 3T8VA 2WPGA 5JAZA 4R5VA 4K5LA 3FTWA 4QMEA 1ONNA 2MAOA 3B7TA 3FH8A 4AICA 3WQSB 3EBIA 3FU0A 2WZGA 1OR7A 4QPEA 4FLSA 4Y6SA 4OOFA 5BPPA 1SQMA 1MW1A 4K5NA 3CZLA 4BKXA 5HNHA 3B2PA 4Q4IA 2JCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG7 A; 
#chains in the Genus database with same CATH topology
 2O7G A;  3ZHZ A;  5JNL A;  1MW0 A;  2FFL A;  4ZQT A;  4XMV A;  4RCV A;  4MS6 A;  4ARF A;  3FUI A;  3FUJ A;  4Y67 A;  2R70 A;  4RVB A;  4PW4 A;  1G5A A;  5AEN A;  4XN1 A;  3ZHY A;  1T1S A;  4FLO A;  4Y6R A;  2XQ0 A;  4ZW3 A;  3B7S A;  5HLT A;  3CHS A;  3B7R L;  4KP7 A;  3B7U X;  3FTZ A;  4XMX A;  5FWQ A;  4R7L A;  3FTX A;  1Q0L A;  1SC5 A;  2R72 A;  4QUO A;  5JMP A;  3FUN A;  3U9W A;  5JBI A;  2JV7 A;  1HS6 A;  4XN4 A;  5DYF A;  1T1R A;  5JMW A;  3FU5 A;  3IIE A;  4QHP A;  4CXF A;  4LUP A;  3EBG A;  3CHR A;  2R59 A;  3CHQ A;  1MW3 A;  2WZF A;  3QJX A;  3JT1 A;  4AR9 A;  3CZG A;  3R0I A;  4XO3 A;  2Y1D A;  4R5X A;  2DQ6 A;  4DPR A;  4XN5 A;  3FH7 A;  3FTU A;  2QVW A;  3FTY A;  4K5M A;  4XN9 A;  4FLR A;  4OOE A;  4ZQG A;  3RC3 A;  4GAE A;  5DLL A;  3UEQ A;  1R0L A;  4XMU A;  4ZN6 A;  3ANM A;  4ZQE A;  4ZX5 A;  4JND A;  3FUH A;  4QIR A;  3B2X A;  3T0Y A;  4L2L A;  3VVM A;  1H19 A;  2GTQ A;  3FUL A;  3ANL A;  4XMZ A;  1ONP A;  4XND A;  2RJI A;  3FUE A;  4ZQF A;  3CXB A;  3FUK A;  5EV7 A;  1JVS A;  4RSY A;  4AR1 A;  4K5O A;  4XNA A;  1JG9 A;  2HPO A;  4X2U A;  3CHP A;  2Y1F A;  4ZW8 A;  3B37 A;  2XPZ A;  4MKT A;  2QJ1 A;  4A03 A;  4AYS A;  2ZXG A;  3CIA A;  3CZE A;  3Q43 A;  3UCQ A;  2B61 A;  4XMT A;  2JD1 A;  1X3Z A;  3FUM A;  2Y1E A;  1X3W A;  1S46 A;  3Q44 A;  4XO4 A;  3RC8 A;  2JCX A;  1JGI A;  4ZQH A;  1ZS2 A;  4XN8 A;  3WQR A;  3RAS A;  1SG7 A;  4ZX4 A;  3FTV A;  2VJ8 A;  1H3L A;  3CHO A;  3AU8 A;  3FU3 A;  3FHE A;  3B34 A;  4R5T A;  4XO5 A;  4ZX3 A;  3B3B A;  3JSZ A;  4XN7 A;  4ZW5 A;  3KED A;  3ZI0 A;  1K5H A;  3FU6 A;  2Y1G A;  4J3B A;  2XPY A;  2JD2 A;  3UER A;  4FCA A;  4ZX6 A;  2Y1C A;  4Q4E A;  2HPT A;  3AUA A;  3VVL A;  1RP3 A;  2PUS A;  4K5P A;  2JCV A;  4FLQ A;  1GW6 A;  4ZW6 A;  3FUD A;  4Y6P A;  3FUF A;  1MVY A;  2PGG A;  3FH5 A;  4XN2 A;  1R0K A;  4NQW A;  3ZHX A;  3AU9 A;  1MW2 A;  4PVB A;  1Q0H A;  3WQQ A;  5JC1 A;  5DUL A;  4AR8 A;  2A7O A;  4GAA A;  2MAP A;  3A14 A;  3ANN A;  4PU2 A;  3HW2 A;  4XMW A;  3CZK A;  1Q0Q A;  3EBH A;  4XNB A;  5HNF A;  2VLA A;  5JO0 A;  3PUU A;  2DQM A;  3FTS A;  3A06 A;  2C82 A;  2PL5 A;  1ONO A;  2JD0 A;  4ZW7 A;  2C5Z A;  2EGH A;  3T8V A;  2WPG A;  5JAZ A;  4R5V A;  4K5L A;  3FTW A;  4QME A;  1ONN A;  2MAO A;  3B7T A;  3FH8 A;  4AIC A;  3WQS B;  3EBI A;  3FU0 A;  2WZG A;  1OR7 A;  4QPE A;  4FLS A;  4Y6S A;  4OOF A;  5BPP A;  1SQM A;  1MW1 A;  4K5N A;  3CZL A;  4BKX A;  5HNH A;  3B2P A;  4Q4I A;  2JCY A; 
#chains in the Genus database with same CATH homology
 2O7G A;  3ZHZ A;  5JNL A;  1MW0 A;  2FFL A;  4ZQT A;  4XMV A;  4RCV A;  4MS6 A;  4ARF A;  3FUI A;  3FUJ A;  4Y67 A;  2R70 A;  4RVB A;  4PW4 A;  1G5A A;  5AEN A;  4XN1 A;  3ZHY A;  1T1S A;  4FLO A;  4Y6R A;  2XQ0 A;  4ZW3 A;  3B7S A;  5HLT A;  3CHS A;  3B7R L;  4KP7 A;  3B7U X;  3FTZ A;  4XMX A;  5FWQ A;  4R7L A;  3FTX A;  1Q0L A;  1SC5 A;  2R72 A;  4QUO A;  5JMP A;  3FUN A;  3U9W A;  5JBI A;  2JV7 A;  1HS6 A;  4XN4 A;  5DYF A;  1T1R A;  5JMW A;  3FU5 A;  3IIE A;  4QHP A;  4CXF A;  4LUP A;  3EBG A;  3CHR A;  2R59 A;  3CHQ A;  1MW3 A;  2WZF A;  3QJX A;  3JT1 A;  4AR9 A;  3CZG A;  3R0I A;  4XO3 A;  2Y1D A;  4R5X A;  2DQ6 A;  4DPR A;  4XN5 A;  3FH7 A;  3FTU A;  2QVW A;  3FTY A;  4K5M A;  4XN9 A;  4FLR A;  4OOE A;  4ZQG A;  3RC3 A;  4GAE A;  5DLL A;  3UEQ A;  1R0L A;  4XMU A;  4ZN6 A;  3ANM A;  4ZQE A;  4ZX5 A;  4JND A;  3FUH A;  4QIR A;  3B2X A;  3T0Y A;  4L2L A;  3VVM A;  1H19 A;  2GTQ A;  3FUL A;  3ANL A;  4XMZ A;  1ONP A;  4XND A;  2RJI A;  3FUE A;  4ZQF A;  3FUK A;  5EV7 A;  1JVS A;  4RSY A;  4AR1 A;  4K5O A;  4XNA A;  1JG9 A;  2HPO A;  4X2U A;  3CHP A;  2Y1F A;  4ZW8 A;  3B37 A;  2XPZ A;  4MKT A;  2QJ1 A;  4A03 A;  4AYS A;  2ZXG A;  3CIA A;  3CZE A;  3Q43 A;  3UCQ A;  2B61 A;  4XMT A;  2JD1 A;  1X3Z A;  3FUM A;  2Y1E A;  1X3W A;  1S46 A;  3Q44 A;  4XO4 A;  3RC8 A;  2JCX A;  1JGI A;  4ZQH A;  1ZS2 A;  4XN8 A;  3WQR A;  3RAS A;  1SG7 A;  4ZX4 A;  3FTV A;  2VJ8 A;  1H3L A;  3CHO A;  3AU8 A;  3FU3 A;  3FHE A;  3B34 A;  4R5T A;  4XO5 A;  4ZX3 A;  3B3B A;  3JSZ A;  4XN7 A;  4ZW5 A;  3KED A;  3ZI0 A;  1K5H A;  3FU6 A;  2Y1G A;  4J3B A;  2XPY A;  2JD2 A;  3UER A;  4FCA A;  4ZX6 A;  2Y1C A;  4Q4E A;  2HPT A;  3AUA A;  3VVL A;  1RP3 A;  2PUS A;  4K5P A;  2JCV A;  4FLQ A;  1GW6 A;  4ZW6 A;  3FUD A;  4Y6P A;  3FUF A;  1MVY A;  2PGG A;  3FH5 A;  4XN2 A;  1R0K A;  4NQW A;  3ZHX A;  3AU9 A;  1MW2 A;  4PVB A;  1Q0H A;  3WQQ A;  5JC1 A;  5DUL A;  4AR8 A;  2A7O A;  4GAA A;  2MAP A;  3A14 A;  3ANN A;  4PU2 A;  4XMW A;  4XNB A;  3CZK A;  1Q0Q A;  3EBH A;  5HNF A;  2VLA A;  5JO0 A;  3PUU A;  2DQM A;  3FTS A;  3A06 A;  2C82 A;  2PL5 A;  1ONO A;  2JD0 A;  4ZW7 A;  2C5Z A;  2EGH A;  3T8V A;  2WPG A;  5JAZ A;  4R5V A;  4K5L A;  3FTW A;  4QME A;  1ONN A;  2MAO A;  3B7T A;  3FH8 A;  4AIC A;  3WQS B;  3EBI A;  3FU0 A;  2WZG A;  1OR7 A;  4QPE A;  4FLS A;  4Y6S A;  4OOF A;  5BPP A;  1SQM A;  1MW1 A;  4K5N A;  3CZL A;  4BKX A;  5HNH A;  3B2P A;  4Q4I A;  2JCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...