1SG7A

Nmr solution structure of the putative cation transport regulator chab
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
PYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Cation transport regulator chaB
publication title The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 20
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06150 ChaB ChaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.70 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1sg7A00
1SG7A
chains in the Genus database with same CATH superfamily
3CIAA 4DPRA 4XN9A 5JBIA 3Q43A 5JMWA 2ZXGA 3JT1A 3B34A 4XN5A 3WQQA 2JV7A 3FTVA 4KP7A 4BKXA 5JNLA 4QHPA 4ZX4A 2HPOA 3FULA 4XN4A 2EGHA 4Y6PA 4Y67A 4XMXA 2R72A 3CHPA 2HPTA 4OOFA 4ZQEA 4ZQGA 4ARFA 3FTXA 3CHQA 3KEDA 5DLLA 2QJ1A 2B61A 4XO5A 2MAPA 4QPEA 1SC5A 2O7GA 4ZW7A 2DQ6A 2RJIA 2JCYA 1X3WA 4GAAA 3CHSA 3CZGA 4XN1A 2Y1GA 3ANLA 5JMPA 4XMUA 4ZX6A 3B7RL 4FLQA 4FCAA 3FUEA 4OOEA 4XO3A 1MW2A 3FU0A 3UCQA 1ONPA 4MS6A 1Q0QA 3FTUA 2XPYA 3FUNA 3RC3A 1RP3A 4FLSA 1SG7A 4XNAA 4AR9A 3RASA 2Y1EA 3ZHYA 1T1SA 4RVBA 2QVWA 5HLTA 2A7OA 4FLOA 4JNDA 3B7UX 4K5NA 1ONNA 3UERA 5DYFA 3B2PA 5BPPA 3FU5A 4FLRA 2C5ZA 2JD0A 3FHEA 3A14A 3IIEA 3ANNA 4PU2A 4ZX5A 4Y6SA 2DQMA 1MW3A 5EV7A 4CXFA 2WZGA 3A06A 3RC8A 1JG9A 1ONOA 3ANMA 4XNBA 3CHOA 2R59A 2Y1FA 3FH7A 3FTWA 4ZW8A 5DULA 3WQSB 3CZEA 3AUAA 3CZLA 4Q4EA 2WZFA 3PUUA 3FUIA 4QUOA 4AR1A 2FFLA 4RCVA 2R70A 2Y1CA 4R5XA 4XN2A 4ZW3A 4LUPA 1R0KA 1G5AA 1MVYA 2JCXA 2PUSA 1HS6A 3FU6A 4PW4A 2JD1A 4XMZA 3U9WA 3B3BA 4ZN6A 3AU9A 3FUDA 4XN7A 4XMTA 3R0IA 3Q44A 1MW1A 3FUHA 3HW2A 4K5OA 2Y1DA 4Y6RA 4PVBA 3EBGA 1H19A 1JGIA 1MW0A 2GTQA 3B7SA 3B37A 1K5HA 1T1RA 3WQRA 5HNHA 4XMWA 4NQWA 3CXBA 2XQ0A 3CZKA 1ZS2A 3FH8A 4X2UA 1JVSA 2PGGA 1GW6A 1S46A 4XMVA 4R5VA 3FU3A 2C82A 3QJXA 3EBHA 4QIRA 2JD2A 3T8VA 3FUJA 4ZW5A 3B7TA 5JC1A 3FTYA 4K5PA 4L2LA 2MAOA 1R0LA 2VJ8A 4Q4IA 3CHRA 3VVLA 4K5MA 2XPZA 3ZHZA 4AYSA 5AENA 4R5TA 1X3ZA 3FUKA 3EBIA 4XN8A 4A03A 1Q0LA 5HNFA 4RSYA 1H3LA 3ZHXA 4XNDA 4XO4A 2JCVA 5JAZA 3AU8A 4AR8A 3T0YA 3ZI0A 1Q0HA 3FTSA 5JO0A 1OR7A 4QMEA 3JSZA 4ZQTA 3UEQA 4ZQFA 3FTZA 3FUMA 4GAEA 5FWQA 2PL5A 4ZW6A 3FUFA 1SQMA 4AICA 3B2XA 4MKTA 4ZQHA 3VVMA 4ZX3A 4R7LA 4J3BA 2WPGA 4K5LA 3FH5A 2VLAA
chains in the Genus database with same CATH topology
3CIAA 4DPRA 4XN9A 5JBIA 3Q43A 5JMWA 2ZXGA 3JT1A 3B34A 4XN5A 3WQQA 2JV7A 3FTVA 4KP7A 4BKXA 5JNLA 4QHPA 4ZX4A 2HPOA 3FULA 4XN4A 2EGHA 4Y6PA 4Y67A 4XMXA 2R72A 3CHPA 2HPTA 4OOFA 4ZQEA 4ZQGA 4ARFA 3FTXA 3CHQA 3KEDA 5DLLA 2QJ1A 2B61A 4XO5A 2MAPA 4QPEA 1SC5A 2O7GA 4ZW7A 2DQ6A 2RJIA 2JCYA 1X3WA 4GAAA 3CHSA 3CZGA 4XN1A 2Y1GA 3ANLA 5JMPA 4XMUA 4ZX6A 3B7RL 4FLQA 4FCAA 3FUEA 4OOEA 4XO3A 1MW2A 3FU0A 3UCQA 1ONPA 4MS6A 1Q0QA 3FTUA 2XPYA 3FUNA 3RC3A 1RP3A 4FLSA 1SG7A 4XNAA 4AR9A 3RASA 2Y1EA 3ZHYA 1T1SA 4RVBA 2QVWA 5HLTA 2A7OA 4FLOA 4JNDA 3B7UX 4K5NA 1ONNA 3UERA 5DYFA 3B2PA 5BPPA 3FU5A 4FLRA 2C5ZA 2JD0A 3FHEA 3A14A 3IIEA 3ANNA 4PU2A 4ZX5A 4Y6SA 2DQMA 1MW3A 5EV7A 4CXFA 2WZGA 3A06A 3RC8A 1JG9A 1ONOA 3ANMA 4XNBA 3CHOA 2R59A 2Y1FA 3FH7A 3FTWA 4ZW8A 5DULA 3WQSB 3CZEA 3AUAA 3CZLA 4Q4EA 2WZFA 3PUUA 3FUIA 4QUOA 4AR1A 2FFLA 4RCVA 2R70A 2Y1CA 4R5XA 4XN2A 4ZW3A 4LUPA 1R0KA 1G5AA 1MVYA 2JCXA 2PUSA 1HS6A 3FU6A 4PW4A 2JD1A 4XMZA 3U9WA 3B3BA 4ZN6A 3AU9A 3FUDA 4XN7A 4XMTA 3R0IA 3Q44A 1MW1A 3FUHA 4K5OA 4Y6RA 2Y1DA 4PVBA 3EBGA 1H19A 1JGIA 1MW0A 2GTQA 3B7SA 3B37A 1K5HA 1T1RA 3WQRA 5HNHA 4XMWA 4NQWA 2XQ0A 3CZKA 1ZS2A 3FH8A 4X2UA 1JVSA 2PGGA 1GW6A 1S46A 4XMVA 4R5VA 3FU3A 2C82A 3QJXA 3EBHA 4QIRA 2JD2A 3T8VA 3FUJA 4ZW5A 3B7TA 5JC1A 3FTYA 4K5PA 4L2LA 2MAOA 1R0LA 2VJ8A 4Q4IA 3CHRA 3VVLA 4K5MA 2XPZA 3ZHZA 4AYSA 5AENA 4R5TA 1X3ZA 3FUKA 3EBIA 4XN8A 4A03A 1Q0LA 5HNFA 4RSYA 1H3LA 3ZHXA 4XNDA 4XO4A 2JCVA 5JAZA 3AU8A 4AR8A 3T0YA 3ZI0A 1Q0HA 3FTSA 5JO0A 1OR7A 4QMEA 3JSZA 4ZQTA 3UEQA 4ZQFA 3FTZA 3FUMA 4GAEA 5FWQA 2PL5A 4ZW6A 3FUFA 1SQMA 4AICA 3B2XA 4MKTA 4ZQHA 3VVMA 4ZX3A 4R7LA 4J3BA 2WPGA 4K5LA 3FH5A 2VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG7 A; 
#chains in the Genus database with same CATH topology
 3CIA A;  4DPR A;  4XN9 A;  5JBI A;  3Q43 A;  5JMW A;  2ZXG A;  3JT1 A;  3B34 A;  4XN5 A;  3WQQ A;  2JV7 A;  3FTV A;  4KP7 A;  4BKX A;  5JNL A;  4QHP A;  4ZX4 A;  2HPO A;  3FUL A;  4XN4 A;  2EGH A;  4Y6P A;  4Y67 A;  4XMX A;  2R72 A;  3CHP A;  2HPT A;  4OOF A;  4ZQE A;  4ZQG A;  4ARF A;  3FTX A;  3CHQ A;  3KED A;  5DLL A;  2QJ1 A;  2B61 A;  4XO5 A;  2MAP A;  4QPE A;  1SC5 A;  2O7G A;  4ZW7 A;  2DQ6 A;  2RJI A;  2JCY A;  1X3W A;  4GAA A;  3CHS A;  3CZG A;  4XN1 A;  2Y1G A;  3ANL A;  5JMP A;  4XMU A;  4ZX6 A;  3B7R L;  4FLQ A;  4FCA A;  3FUE A;  4OOE A;  4XO3 A;  1MW2 A;  3FU0 A;  3UCQ A;  1ONP A;  4MS6 A;  1Q0Q A;  3FTU A;  2XPY A;  3FUN A;  3RC3 A;  1RP3 A;  4FLS A;  1SG7 A;  4XNA A;  4AR9 A;  3RAS A;  2Y1E A;  3ZHY A;  1T1S A;  4RVB A;  2QVW A;  5HLT A;  2A7O A;  4FLO A;  4JND A;  3B7U X;  4K5N A;  1ONN A;  3UER A;  5DYF A;  3B2P A;  5BPP A;  3FU5 A;  4FLR A;  2C5Z A;  2JD0 A;  3FHE A;  3A14 A;  3IIE A;  3ANN A;  4PU2 A;  4ZX5 A;  4Y6S A;  2DQM A;  1MW3 A;  5EV7 A;  4CXF A;  2WZG A;  3A06 A;  3RC8 A;  1JG9 A;  1ONO A;  3ANM A;  4XNB A;  3CHO A;  2R59 A;  2Y1F A;  3FH7 A;  3FTW A;  4ZW8 A;  5DUL A;  3WQS B;  3CZE A;  3AUA A;  3CZL A;  4Q4E A;  2WZF A;  3PUU A;  3FUI A;  4QUO A;  4AR1 A;  2FFL A;  4RCV A;  2R70 A;  2Y1C A;  4R5X A;  4XN2 A;  4ZW3 A;  4LUP A;  1R0K A;  1G5A A;  1MVY A;  2JCX A;  2PUS A;  1HS6 A;  3FU6 A;  4PW4 A;  2JD1 A;  4XMZ A;  3U9W A;  3B3B A;  4ZN6 A;  3AU9 A;  3FUD A;  4XN7 A;  4XMT A;  3R0I A;  3Q44 A;  1MW1 A;  3FUH A;  3HW2 A;  4K5O A;  2Y1D A;  4Y6R A;  4PVB A;  3EBG A;  1H19 A;  1JGI A;  1MW0 A;  2GTQ A;  3B7S A;  3B37 A;  1K5H A;  1T1R A;  3WQR A;  5HNH A;  4XMW A;  4NQW A;  3CXB A;  2XQ0 A;  3CZK A;  1ZS2 A;  3FH8 A;  4X2U A;  1JVS A;  2PGG A;  1GW6 A;  1S46 A;  4XMV A;  4R5V A;  3FU3 A;  2C82 A;  3QJX A;  3EBH A;  4QIR A;  2JD2 A;  3T8V A;  3FUJ A;  4ZW5 A;  3B7T A;  5JC1 A;  3FTY A;  4K5P A;  4L2L A;  2MAO A;  1R0L A;  2VJ8 A;  4Q4I A;  3CHR A;  3VVL A;  4K5M A;  2XPZ A;  3ZHZ A;  4AYS A;  5AEN A;  4R5T A;  1X3Z A;  3FUK A;  3EBI A;  4XN8 A;  4A03 A;  1Q0L A;  5HNF A;  4RSY A;  1H3L A;  3ZHX A;  4XND A;  4XO4 A;  2JCV A;  5JAZ A;  3AU8 A;  4AR8 A;  3T0Y A;  3ZI0 A;  1Q0H A;  3FTS A;  5JO0 A;  1OR7 A;  4QME A;  3JSZ A;  4ZQT A;  3UEQ A;  4ZQF A;  3FTZ A;  3FUM A;  4GAE A;  5FWQ A;  2PL5 A;  4ZW6 A;  3FUF A;  1SQM A;  4AIC A;  3B2X A;  4MKT A;  4ZQH A;  3VVM A;  4ZX3 A;  4R7L A;  4J3B A;  2WPG A;  4K5L A;  3FH5 A;  2VLA A; 
#chains in the Genus database with same CATH homology
 3CIA A;  4DPR A;  4XN9 A;  5JBI A;  3Q43 A;  5JMW A;  2ZXG A;  3JT1 A;  3B34 A;  4XN5 A;  3WQQ A;  2JV7 A;  3FTV A;  4KP7 A;  4BKX A;  5JNL A;  4QHP A;  4ZX4 A;  2HPO A;  3FUL A;  4XN4 A;  2EGH A;  4Y6P A;  4Y67 A;  4XMX A;  2R72 A;  3CHP A;  2HPT A;  4OOF A;  4ZQE A;  4ZQG A;  4ARF A;  3FTX A;  3CHQ A;  3KED A;  5DLL A;  2QJ1 A;  2B61 A;  4XO5 A;  2MAP A;  4QPE A;  1SC5 A;  2O7G A;  4ZW7 A;  2DQ6 A;  2RJI A;  2JCY A;  1X3W A;  4GAA A;  3CHS A;  3CZG A;  4XN1 A;  2Y1G A;  3ANL A;  5JMP A;  4XMU A;  4ZX6 A;  3B7R L;  4FLQ A;  4FCA A;  3FUE A;  4OOE A;  4XO3 A;  1MW2 A;  3FU0 A;  3UCQ A;  1ONP A;  4MS6 A;  1Q0Q A;  3FTU A;  2XPY A;  3FUN A;  3RC3 A;  1RP3 A;  4FLS A;  1SG7 A;  4XNA A;  4AR9 A;  3RAS A;  2Y1E A;  3ZHY A;  1T1S A;  4RVB A;  2QVW A;  5HLT A;  2A7O A;  4FLO A;  4JND A;  3B7U X;  4K5N A;  1ONN A;  3UER A;  5DYF A;  3B2P A;  5BPP A;  3FU5 A;  4FLR A;  2C5Z A;  2JD0 A;  3FHE A;  3A14 A;  3IIE A;  3ANN A;  4PU2 A;  4ZX5 A;  4Y6S A;  2DQM A;  1MW3 A;  5EV7 A;  4CXF A;  2WZG A;  3A06 A;  3RC8 A;  1JG9 A;  1ONO A;  3ANM A;  4XNB A;  3CHO A;  2R59 A;  2Y1F A;  3FH7 A;  3FTW A;  4ZW8 A;  5DUL A;  3WQS B;  3CZE A;  3AUA A;  3CZL A;  4Q4E A;  2WZF A;  3PUU A;  3FUI A;  4QUO A;  4AR1 A;  2FFL A;  4RCV A;  2R70 A;  2Y1C A;  4R5X A;  4XN2 A;  4ZW3 A;  4LUP A;  1R0K A;  1G5A A;  1MVY A;  2JCX A;  2PUS A;  1HS6 A;  3FU6 A;  4PW4 A;  2JD1 A;  4XMZ A;  3U9W A;  3B3B A;  4ZN6 A;  3AU9 A;  3FUD A;  4XN7 A;  4XMT A;  3R0I A;  3Q44 A;  1MW1 A;  3FUH A;  4K5O A;  4Y6R A;  2Y1D A;  4PVB A;  3EBG A;  1H19 A;  1JGI A;  1MW0 A;  2GTQ A;  3B7S A;  3B37 A;  1K5H A;  1T1R A;  3WQR A;  5HNH A;  4XMW A;  4NQW A;  2XQ0 A;  3CZK A;  1ZS2 A;  3FH8 A;  4X2U A;  1JVS A;  2PGG A;  1GW6 A;  1S46 A;  4XMV A;  4R5V A;  3FU3 A;  2C82 A;  3QJX A;  3EBH A;  4QIR A;  2JD2 A;  3T8V A;  3FUJ A;  4ZW5 A;  3B7T A;  5JC1 A;  3FTY A;  4K5P A;  4L2L A;  2MAO A;  1R0L A;  2VJ8 A;  4Q4I A;  3CHR A;  3VVL A;  4K5M A;  2XPZ A;  3ZHZ A;  4AYS A;  5AEN A;  4R5T A;  1X3Z A;  3FUK A;  3EBI A;  4XN8 A;  4A03 A;  1Q0L A;  5HNF A;  4RSY A;  1H3L A;  3ZHX A;  4XND A;  4XO4 A;  2JCV A;  5JAZ A;  3AU8 A;  4AR8 A;  3T0Y A;  3ZI0 A;  1Q0H A;  3FTS A;  5JO0 A;  1OR7 A;  4QME A;  3JSZ A;  4ZQT A;  3UEQ A;  4ZQF A;  3FTZ A;  3FUM A;  4GAE A;  5FWQ A;  2PL5 A;  4ZW6 A;  3FUF A;  1SQM A;  4AIC A;  3B2X A;  4MKT A;  4ZQH A;  3VVM A;  4ZX3 A;  4R7L A;  4J3B A;  2WPG A;  4K5L A;  3FH5 A;  2VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...