5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
2VLAA 5HNFA 5HNHA 5HLTA
chains in the Genus database with same CATH superfamily
2OTJI 5J1UA 2ECCA 4FASD 3OYFA 5LGNA 2E34A 4A3JJ 4UY8I 3OMYA 3PO3J 1IXRC 3MAJA 3F23A 1CQTA 3OL4A 2BHZA 2XRNA 3K2AA 2IGMA 1S9HA 3M4OJ 2DAOA 1IO2A 1GUUA 2UUZA 2GIVA 3AL0B 3E6DA 1P92A 2CSOA 1T6SA 2WAFA 1NG6A 2VKVA 2Z99A 1XX5A 4ZN6A 3WG9A 3GTLJ 4MGRA 3ZOBA 2A6TA 4A0XA 4YRVA 3G3ZA 1ZGJA 2LP0A 4M3EA 1YW8A 3MD2A 4HAMA 4Q4IA 2ZXWH 2ZMEB 3SQNA 4O6JA 3H3UA 5KCMA 1P4AA 2EZHA 3CJQB 3ZHYA 4LFUA 2VASA 4NDLA 3HOSA 2ZXIA 1SMTA 4M3FA 4E7IA 1T8IA 3F8BA 2E5NA 3SEZA 3VFZA 1UZCA 3HSRA 3S1MJ 5J40A 1XS9A 3ELKA 4RB1A 4BEHA 4PDKA 4BQOA 4FLRA 1MNDA 1ULYA 4LG3A 1SEUA 3KX2A 4KMUX 4WXDA 4XM3A 4ZYGA 4H0EA 1D8KA 1XGNA 4IJAA 2XSDC 1U6GA 2R0QC 3WHBA 1XTAA 3NRVA 3PNTA 3PIOF 2HPIA 2JCYA 2QQ9A 5M5YJ 4NC8A 2QBYA 2HI3A 1MKMA 4F3QA 1QZZA 2EINH 4QWQA 3HUGA 2HKXA 2XROA 5A2QK 4PGHA 1V54H 2LYCA 5BPPA 3IC7A 3CD6I 3S1QJ 4AM3A 5E8GA 2JVHA 5DULA 3WG7H 2EV0A 1V4RA 3I56I 4R79A 4HRIA 1FTTA 2PX9A 1FIAA 3FUNA 5BPDA 1TT0A 2BE5F 3EUAA 4XLEA 4UNOA 1FOWA 3VB2A 4OMZA 4L5IA 5JO0A 3RKXA 4XNDA 1XCVA 4BS9A 2STTA 1O3SA 2EFOA 1SG7A 4PCQA 2L7FP 2D5VA 5FFXA 3B6AA 1T56A 2LBFB 1ZKGA 1ZRDA 4I0AA 2M8EA 2WBMA 1VZ0A 2PMZA 1KU9A 1UCRA 4FE4A 3SZPA 3J81Z 2R93J 1Z91A 4HA8A 5HNFA 3QYEA 3FF5A 2VE8A 2QA4I 2A5WA 1ENHA 2XGDA 2HOSA 2DJIA 4KMFA 3BZ6A 2OZUA 3TP0A 1RC9A 1LDKB 5M5XJ 2WTEA 4R1HA 1X3WA 4AU7A 2DT6A 3CCYA 5JHFA 4ENKA 3B7SA 2RKHA 5EEAA 4AIDA 2DA5A 3FTWA 3FXKA 4KICA 4XONA 2KZVA 1OR7C 2Y0SA 4Y4RA 2RNJA 5FKMA 3T8RA 3PNVA 4PGGA 3GTJJ 2H27A 3M1EA 2F4IA 4MTDA 4MIMA 3D5RC 4G8XA 5J3LA 2X6XA 1T0FA 3RCOA 3FU3A 3RASA 3S15J 3CMAI 3E5UA 3JRAA 1WI3A 4XRMA 1M1EB 2VIXA 2K3PA 2HTJA 4Q48A 1ETWA 4KN4X 1XDUA 4CCOA 1H88C 2NOGA 1QA6A 1FTZA 1F4KA 2QZ8A 1J09A 2ELJA 5EYRA 4Y6SA 1IRGA 2VBZA 3ZMUA 1SVLA 5KHDA 2CU7A 3IRRA 3ANMA 1RNLA 2KHMA 3H3ZA 4A3LJ 3OYNA 5F04A 4L18B 1IN8A 2CQKA 2EK5A 1MNEA 1O3RA 2DK8A 3LSIA 5HS9A 3GLLA 1YJ9I 3BTCA 4WWCA 2BW3B 4KT5C 5JLXA 3MKYB 1X4OA 2P8TA 2VONA 1I27A 2EIKH 3LQQA 1IF1A 4V19K 2FA5A 3DKXA 4DNCA 4BY1J 4OOEA 1VI0A 1KQ8A 2OQGA 4HNVA 5GTHC 2VQLA 1F9NA 4XN9A 4O5VA 5JMWA 2CO5A 2MH2A 1Z0XA 2X6YA 3FXRA 3CLQA 1A6IA 3LSJA 3O8HA 4OINF 1W1WE 3V4GA 1MW0A 2Z33A 2QLZA 1Y1WJ 2DN0A 3OYDA 2P4WA 5GPAA 1TWFJ 1UAAA 4DPRA 3S3OA 3DU6A 2JVGA 4RCVA 3BG6A 1HA8A 3HW2A 1ZHFA 5EG0A 1YJWI 3NWSA 1WJDA 3B7UX 4PJJA 3S2WA 1HBXG 1PDNC 2EFQA 3WTTC 2KZGA 2LSOA 3VYRB 4M3BA 3DPUA 2YPRA 1P7IA 3BG5A 3PL8A 1IN4A 4PJMA 4RSYA 2V26A 4S04A 1ZG3A 2EJRA 5EEHA 4XMWA 2E5ZA 2KP6A 1G3YA 3E5QA 1XCBA 4XNBA 4XLFA 1R36A 1KA8A 3LFKA 1B8IB 1RESA 3CJTB 1FOKA 2E19A 5K5OA 4KITB 3GX4X 4DZPA 1D5YA 3MZHA 2XPWA 3EUHA 1ZG1A 3ZRGA 3OSGA 1K61A 4XIDA 5CPRB 3UCQA 3MKZA 1Z7UA 2HEOA 5IYDJ 2R7WA 3Q9VA 5HODA 2LTPA 4LITA 1MMAA 3F8FA 3RC3A 3EYIA 2CRGA 1K7AA 4HF2A 1S3JA 1OISA 3ABKH 3OR2C 2DA6A 2E7WA 1Z67A 5CKTA 1XN7A 1VQLI 2E2JJ 1PP8F 2DDAA 4M74A 2R7FA 3ECOA 3KLOA 1K78A 1XPXA 4AIHA 1C0WA 1HC8A 1QZEA 1ETOA 1Z7LA 3BG3A 4BNCA 4RA2A 5HDKA 3WQQA 3M8FA 1MMNA 2BVLA 3QP5A 5GAEJ 1APLC 2O61A 1SVOA 3TDUC 1UB9A 2BW3A 1ZAOA 1GDTA 3TOAA 3ZMDA 3HM5A 3OIQA 1JKRC 1G3SA 3QPSA 3CJNA 4K5OA 5IPAA 1H89C 3OS1A 1RRJA 3ANLA 4F93B 4IX7A 4ENNA 2Z9OA 3JAMZ 3F9KA 3LSMA 1U2WA 2HZTA 2GAUA 1MJBA 3TW7A 3FTXA 1I39A 2EV6A 4AICA 4U0YA 2IA2A 4CZCA 5DTDA 2DI3A 1GXPA 1T33A 3CCSI 1ZLKA 3GVAA 2OQRA 4M9ZA 2IJLA 2QSFX 1ORKA 2TCTA 3IAS2 2HOAA 2HNHA 3B73A 1V5GA 4LG0A 1A35A 2R92J 5L3GA 5IP6A 1I6HJ 3P9KA 1WHUA 3HOZJ 3H0DA 4I6ZA 1DU6A 5KAFC 3A03A 3C2GA 5LHGA 1BC7C 2G7HA 4ZDPA 3FULA 2NS7A 1K4TA 3IP4B 2YUSA 4UUSA 4GAEA 3WE2A 2OCEA 2VB6A 2EZLA 3FWEA 4QLCU 3HOWJ 4NC6A 1E17A 1SANA 3K70C 4XMYA 2DOEA 2DQRA 1U5TB 3VDXA 3IKTA 3DPTA 3ZQHA 2L02A 4XLHA 4AWXB 1QNTA 4ENMA 4XN3A 2ZNZA 3FU6A 4AUXA 4AVPA 5JMPA 2MLKA 3FX3A 2M7BA 5E1ZB 5AIQA 2XB0X 2XPUA 1I5ZA 1T0FC 1D5VA 1JJ6C 1P7JA 4A3FJ 1J2XA 2WWYA 3W6VA 2JD2A 1BA5A 2UV1A 4G12A 3N4MA 4ZTJA 3I59A 1K5HA 2JUCA 3ZCOA 3CHPA 4LLNA 2H6CA 4RGXA 2HR3A 3K10A 5FFZA 4X1EA 1ZYRF 2LH9A 2PN6A 2V1DA 2ISYA 4XOPA 3FBNB 3IL2A 2G0EA 3J81K 2M45A 3JTHA 3PFIA 5AIPA 5K7FA 1G59A 3VYUB 1FEXA 2HTSA 4XN0A 3A0BC 4ANJA 2LK2A 4P5OA 5FKOA 5TGTA 4MTEA 1POGA 2X48A 4MFDA 1IN6A 2A7OA 2V6EA 2MFZA 4ITVA 4IHXA 3OV8A 2ESNA 3OOPA 5FRNA 3FH5A 4QUOA 1QHHD 2ID3A 3F22A 1FBSA 2XGXA 3EBIA 4NQWB 4XRFA 3G6EI 2UXNA 3AG4H 2MABA 3L2VA 1TQMA 4JX6A 3T0YA 1HF0A 4K5NA 3LA7A 3BR6A 3DEEA 4BYYA 1X1AA 4MLOA 1BIBA 3BTLA 3E6BA 3RDIA 2XAJA 4U7BA 1T2KA 1WJEA 1AOYA 1VQNI 2DT7B 1BIAA 2DBBA 3JRGA 3BROA 3CUOA 1YITI 4C3IJ 1TP4A 2IS6A 5E3LA 3RQIA 2FQ4A 3FISA 3GWZA 4DBRA 5GP9A 4RGRA 2G9WA 2QGUA 4FHTA 1SFOJ 3E1SA 4X2UA 3CHRA 4AYBA 2QVWA 5EJCA 1DP3A 4AC0A 4YFKF 2JD1A 2LC2A 3EUHC 4EV0A 4RS8A 4EMSA 3GTGJ 3FTVA 4ZX5A 1SD7A 1ODDA 3BPXA 5E79C 1TWGJ 5ICEA 3HYIA 3CP2A 1TWCJ 2KISA 2VQGA 4ZX6A 1OJLA 3GMEA 1YIJI 3QYBA 2L9RA 3U21A 2HYJA 3FXOA 1X3ZB 4ON0A 5HLHA 2L9NA 3PQKA 2CMPA 2NAZA 3BZCA 3BR3A 2DMUA 2ELKA 1HQCA 2WAQA 4IRHA 3D1NI 4JOMA 1LE8B 3RPQA 3EBGA 1OYWA 5DLLA 3CTAA 2RREA 4F7ZA 1O7LA 2AO9A 3FKJA 4LK1F 2VJIA 4CXFA 4C2TA 3MQ0A 1IXSB 1ETKA 1Q1VA 2VN2A 4Q4EA 2R7UA 5ED4A 3GW2A 1ZGWA 1I3QJ 1EJ9A 3BR1A 1X4PA 4IVNA 1WRJA 2CW7A 2EB7A 3T8VA 4LOCA 2EFWA 4D7NA 4RGSA 3RSNA 4NQWA 1MNMC 3DWLE 4XNFA 4B44A 4M6YA 4I0BA 1MBFA 4AD9A 3WTXC 2XC7A 2HOTA 2IGKA 1W7PB 3T5XA 1ZN2A 1OCCH 1B1BA 2NVYJ 2CV1A 1W0TA 4NHJA 3UEQA 2FBIA 3BR5A 2F48A 4FT8A 3PUBA 1FYKA 2Z1DA 2FRHA 3ZQQA 3TO7A 2ZNYA 1MMSA 2M5WA 2P6TA 4IHTA 5FGMA 2GZWA 3K4MA 4A6DA 1F5TA 1ZREA 4EGYA 1OMIA 4YIIA 3R61A 1KGSA 1R0KA 3M7GA 2E1CA 2JSCA 3A01B 4KIGA 2K9LA 4HEA2 1VQKI 2UWMA 2O9LA 2V9KA 4K5MA 1R1VA 4BGDA 4ESBA 3S17J 2F5CA 2K5CA 3FUIA 3HIFA 3ZQIA 5IYCJ 3JCUC 1H9GA 4C9YA 2Y48A 3JAMK 1U9NA 3DFGA 1P4XA 1RETA 4J19A 1IUFA 3ECHA 1S5LC 2E1MC 1PP7U 4MEXF 3FXUA 2O7OA 1STZA 3RQ4A 4RB2C 1BR2A 2R5YB 2L01A 1SFUA 1MGTA 2JPBA 2JRMA 3P5JA 1JUSA 1FYMA 2YX4A 3LSHA 2CQ7A 2COBA 5AENA 2X9DA 1RP3A 1GV2A 3PSFA 1B72A 2KMUA 1WJAA 4CHUA 5J8CA 4GYIA 4HLXA 2L54A 3U9GA 4XRSA 3S1RJ 4CUGA 4RGUA 3GTPJ 3BCAA 3BR2A 1A6QA 1E3PA 4HF0A 4CICA 1BR4A 3DLLF 1R00A 3L2RA 4HYEA 1YFHA 3DV8A 3E6CC 1W5CC 2VODA 3CCRI 4FX0A 1I3AA 5B5EC 3R6SA 3QOPA 4OU0A 2JV7A 3B02A 3C2BA 4G7OF 1S46A 2NVUB 3ZQFA 2DA4A 2DO7A 3S3MA 3HHHA 2E71A 4EM2A 2HKOA 3AAFA 4G7HF 2JA7J 5FRMA 1L0OC 2KT0A 3I58A 5JR3A 2Y1EA 3IH2A 3CCEI 1Q0LA 2Z3YA 2CW8A 4EM1A 4YIFA 1FBQA 1FP1D 1P6RA 2K9MA 4RAGA 3H35A 5CQGA 1HKTA 2A5YB 4F92B 4XN5A 2KLOA 2HZDA 3A01A 3ZQGA 3J7AY 6PAXA 1JTXA 4BEHB 4L9JA 3CF2A 2X1CA 1WSUA 1ONNA 2L7ZA 5BS6A 3E0JB 4XBFA 3QP6A 3UKGA 4QSHA 4N9IA 2NNNA 3FZVA 1KONA 4D0PA 1BW6A 2QBYB 3G1OA 3FTUA 1QQIA 3OYGA 5HOOA 1YQAA 3HUGB 1REPC 1Y8RB 2M8GX 1HSJA 2RDPA 2W82A 3QPTA 3FUFA 2F4OB 1UHMA 2Q0OA 5LD2C 1ETXA 4JK1X 3FUJA 3KP7A 5FKNA 2Y9YA 1R58A 2VQHA 4DYQA 2D1VA 1OCTC 1F36A 5H20A 3LAPA 1TC3C 2KPMA 1DGWY 5DS9A 1RUNA 3TGNA 2NRAC 3UNGC 2Y1FA 2FMYA 3BJ6A 4BJ6C 3HG9A 1FLIA 5FLXK 2HOEA 3B3BA 2Y75A 4RAZA 3VPRA 2QWWA 3TBIA 1NK3P 3KFWX 1J75A 3H36A 2X6OA 4GAAA 4PFOA 2E36A 1D8JA 5IP9J 2V1NA 3KYDB 4IHYA 1UHWA 2WY8Q 2ZSIB 5IOYA 4IPAA 1ZGAA 5JVTA 1LKXA 2L9VA 1O3TA 2OCCH 1CGPA 3JT1A 2TRTA 3FMQA 3GLXA 5D5UB 4PW4A 4UUTA 2DMNA 1LJ9A 5LEKA 2VE9A 3SDGA 1IRFA 1TBXA 2FE3A 4CA0A 1ETVA 3LSTA 3V42A 4FISA 3VSKA 5EGOA 5DM6F 2B63J 4PVBA 2WV0A 1XSDA 4C3JJ 3RZOJ 2R7OA 1QBJA 1X3WB 4ZW5A 3LQRA 1N75A 1XD7A 4D5FA 1MDMB 2IT0A 1Y56A 3OL3A 3P9IA 5DUIA 1VQOI 4EVIA 1ZR4A 1USTA 1YX3A 2ZSHB 1IRXA 4ARFA 3TOBA 1OLTA 4S05A 4BQAA 3AU8A 1ZTRA 3J7YJ 3GO5A 4KN7X 5EDNA 1IJWC 4B43A 1Y1VJ 5FJ8J 3M07A 3MMYB 4BKXA 1RI7A 3E7LA 2R7ZJ 4KISA 1MH4A 2J5PA 3COAC 3BC8A 2XV4S 5ICFA 3HRUA 1D1AA 4XLPF 2NNYA 1EKEA 3B34A 2XAQA 3GEZA 3U1DA 1SAXA 2EIJH 4ZW7A 5KAIC 2XGEA 1GXQA 3H1CA 5D8LB 1HW2A 3VYTB 4XSXF 2XPYA 3HPGA 4HZFA 5LBQA 4RBOA 1TZLA 4XN1A 1SC7A 3B2XA 4L5JA 2WPGA 2HYFA 5H6RA 4OIQF 5M5WJ 2L4AA 5ICGA 3L09A 3HC7A 3CZLA 3FUEA 3EETA 2DA1A 2MD0A 2R72A 3A1YA 5F64A 2Q8KA 2B7EA 3FXMA 3QODA 3CC7I 3ASNH 1D0XA 1WI9A 4AIKA 2QJ1A 2XPZA 3OYHA 4CYDA 2WZFA 1B6AA 4R8HA 1QGPA 4M72A 1JE8A 3OYLA 2FNPA 2O5RA 1D3YA 2GTQA 2OAZA 3KP3A 3FUDA 2YR2A 2Y69H 4FX4A 4O3MA 1YLFA 2EQRA 4EQQA 4M71A 3OS0A 3SEQA 5EG0B 3QJXA 4B3AA 4I7HA 5F1RA 3Q0VA 1IGNA 5D5WB 3AG2H 1BR1A 4X0GA 2VBXA 3V8JA 5TJJA 3DBRB 2JT1A 3R60A 2GIZA 4FE7A 3HZJA 3TEDA 3E97A 1R71A 1H19A 1PUFA 1HW1A 1A36A 1MDMA 2VJJA 4R5XA 3F0CA 4LJZF 1J5YA 3ABMH 3S8PA 1MW3A 2LR8A 4II3A 2BZTA 4BH9A 2FJ1A 4GGGA 1FY7A 1TL8A 3DCFA 1T39A 2CJJA 1U78A 4ZW3A 2XKOA 1Z6TA 3DKWA 2CQXA 3HGYA 3MKLA 1BC8C 2A6HF 3K4BA 4HOBA 1HKSA 4XKWA 2QVOA 4Y17A 2DCEA 4Z2YA 3WTZA 3V7CA 3N05A 4I99C 2HPTA 2GA1A 3ZN1A 4C2MJ 1K78B 2GXAA 5EZGA 4EJTA 2FFLA 2OPTA 3EQLF 3LSGA 2VOPA 4EEFG 3BQYA 3BG9A 1W0UA 3HOTA 4PJLA 2XASA 3D5LA 2STWA 3CO6C 4RM3A 2HVSA 3W2VA 3NQOA 3CZGA 4N9HA 4A03A 1DDNA 3LL7A 1FOXA 2KJBA 4MS6A 4BE2A 4AYSA 3KP5A 1OYYA 1QVUA 4IF4A 4OWRB 2HVRA 4QTRA 3GZNB 1WGXA 2XDVA 3L2UA 4A3DJ 2FUG2 1AKHA 1AU7A 2PGGA 3J7ZI 1XB4A 3BDDA 3FUMA 5DDGA 3EUKL 2DYSH 2IEKA 4CO8A 4BXUA 2CV0A 3EDPA 4GDFA 4MKTA 4LG0B 1WVRA 1HKQA 1MBEA 2UXXA 4A0YA 2HQNA 5L3FA 2Y9ZA 1QU3A 2KRFA 3FDYA 1QVTA 2CV2A 3DBHB 2DTRA 3U9WA 3ZMTA 2JJ7A 2DK5A 1X2MA 4ZYAA 3RI4A 2DJNA 3QWLA 1BBYA 1RKWA 4NNJA 1BI2A 2V1UA 4Y6PA 3ABTA 4IZZA 1HCRA 1FSHA 4A69C 5LHIA 4ZJZA 4UUSB 1YG2A 2Y31A 2JD0A 4FCAA 3SZTA 2FBHA 3FMRA 3A02A 1X1PA 5JLWA 4JQFA 2LKPA 1VQPI 3GUDA 4A3MJ 3CZ6A 4CZZA 4QMEA 1MVYA 1P4WA 2MAOA 1JUMA 3NWTA 3RTRA 3Q9SA 1QZYA 1TW3A 3FXJA 3JW4A 4XKBA 2R70A 3C3WA 2BHYA 2QF7A 1SD6A 4PK4A 4UXNA 3I59B 3DLAA 5J4YA 2E1MB 3CCLI 2FF4A 2V7FA 5DV5A 2DFHA 5B3SH 3FHEA 5DYFA 4AVZA 3OYEA 1X3UA 5LGUA 2WZGA 2XPVA 1I1SA 4N0BA 5FB2A 5LEJA 1IZ1A 5C4XJ 2LY9A 1YX5A 5LGTA 3VVMA 2X4HA 5FD6A 2CQQA 2Y2ZA 3CCUI 1JUPA 1O57A 2W85A 5D4SA 1V5EA 2M1BA 2RVCA 4LD5A 5CVRA 5D6FA 1JKQC 2IVMA 4U0WA 2K7LA 5HLGA 2C6YA 1FJLA 3WQSB 1J7KA 2JWTA 2F6CA 3ANNA 4JYKA 4M3DA 2K3FA 2EIMH 4D7MA 2HGCA 4NUBA 2HYGD 1MW2A 2P7CB 3OSFA 3O3KA 4DOZA 2CWEA 2DLLA 1MBKA 1JT0A 1S8NA 2QYOA 1YW9A 3OOUA 2OD5A 4OOFA 3Q0UA 3I71A 4OIOF 3SFIA 4IXAA 3K1MA 5AONA 1WCMJ 2L3DA 3K4JA 1H8AC 1FZPB 3J7AO 2COMA 1U0JA 3OYBA 1JHFA 4IRIA 2F5DA 1Z3XA 2IA1A 3QYFA 4HG2A 4LIVA 3L1PA 4ZZLA 2DPUA 4I02A 2PMZN 1JTYA 1TWHJ 3S32A 2JA6J 4A3GJ 4E7ZA 5E1WA 5F0FA 1BW5A 2K02A 4HX7A 1BI1A 1Y6IA 3FU5A 1N25A 1D0YA 2XIGA 4RMNA 2AHQA 2H94A 5FROA 3R0AA 3HSFA 1ZARA 3A14A 5C44J 1N78A 3CUQA 4I01A 1LEBA 4DJAA 1YI2I 4CCNA 3IKVA 2ME0A 4MFEA 1Z1DA 2R7RA 3R0JA 4Q5SF 2EILH 4MEYF 3LSKA 3NEUA 4E7JA 4ZQTA 2O8KA 1S29A 2ESHA 5F6FA 3ZHXA 3IHUA 5HLTA 3M8EA 3DEWA 2QCOA 1FP2A 1OCZH 2W4SA 2A68F 2KRCA 4NB5A 2CQNA 3FK7A 3OS2A 1Y39A 4XQFA 2Y0SN 4IL6C 2AQEA 1R5HA 3HRMA 5LFAA 4KIBA 1G2HA 3TMOA 3CLOA 2EWNA 1HXDA 5K5RA 4XLNF 5CJ9A 2A07F 1VQ8I 3RJPA 2DMQA 1QPMA 1ZH5A 3SYTA 4R7LA 4BJ5C 4CYCB 4XN4A 1BOBA 4M6VA 3PQJA 3CCMI 3CO7C 5D6EA 4BE1A 5L3BA 5ILSA 9ANTA 1Q0QA 3J80Z 2LD5A 4Y67A 5DCMA 1XGOA 1FBUA 3PNYA 4QPOA 5D8KB 5FLMJ 4IHSA 1YE9A 1F1ZA 2OUMA 3LAJA 3JRBA 1Y0NA 2LF8A 3RYRA 1XDSA 3KE2A 4LMYA 1IDZA 2G7UA 2Y0MA 3CIAA 2BGCA 1W36D 2QUFA 2IXSA 1XMXA 1YO5C 4R5TA 2KIMA 2J5OA 2UZKA 1LEAA 1MMGA 3BJOA 3FBIB 3QU6A 1S6LA 5IY5H 2P6SA 3KIOA 3GCMA 1USSA 3D5SC 4WXHA 4ZX4A 2VPLA 3SZGA 1E3HA 5FLXZ 1YTYA 2EFPA 4DQ2A 4PU2A 1JXSA 3FTZA 4OAYA 5IP7J 5HNHA 4EM0B 3HKZN 2EGHA 5ERIA 2X1EA 3WU2C 4HNUA 1TNTA 3G1LA 3MVPA 4UB8C 1MW7A 1VQ9I 3IAM2 1JJ8C 3GYHX 2E1NA 3LMMA 4IQJA 3WTVC 2JN6A 1I1GA 1LDJA 2CS3A 1KU3A 4F91B 4E7LA 3CMYA 2H6BA 4E7KA 4PSWA 2QQBA 1ONOA 2WA0A 1DQUA 4HX4A 5DUKA 1I6XA 2XSJC 3ZI0A 1AHDP 2JUGA 3H5AA 4Y33A 3M1CA 4WK8F 1IN7A 1PUEE 2CG4A 1ZRCA 5TISC 1UJ8A 5LLQA 4P96A 2BOLA 2H1LA 1V55H 4G6DA 1T98A 2YU3A 3RIRA 1MSEC 4X6AJ 1B9MA 3H92A 2EA4A 3L9FA 2IPQX 2L4MA 3JRHA 1B72B 3QU3A 3TP3A 2HU9A 2W48A 2K9SA 4PUSA 4BAYA 2P7VB 4LIUA 4CYCA 4XOTA 3RZDJ 2IW5A 3T8TA 5DEQA 1QO0D 2M9HA 2QKLB 1A04A 2CFOA 4G6QA 4J01A 4DBQA 3CCQI 4A3EJ 1DU0A 4ZDLA 4HDVA 2L2OA 3CF5F 2DMTA 3F3XA 5JVGF 1HLVA 2VKHA 4A3KJ 1J59A 3BJAA 1VQ5I 2LKXA 4ZDOA 4B3XA 1SVMA 2HQRA 3FM5A 1XGMA 2KKOA 3IRQA 2NVQJ 2RAEA 3U1KA 1T08B 2YX7A 2M7AA 3BLYA 3EBHA 4PSXA 2A69F 1BI0A 2WADA 4M73A 4HDUA 3ABLH 2LF7A 2HPMA 1WJFA 4L2LA 3CESA 2GQQA 3VWBA 2QKMB 2R5ZA 4KDPA 1A5JA 3JRFA 2VC0A 2QM3A 3OYIA 4ZTFA 1X58A 2DDBA 2MW8A 4D5CA 2ECBA 2AXLA 1JGSA 3CUQC 2FOWA 4A5NA 3JTGA 1KU2A 3F6VA 3HL2A 5E3NA 5J1RA 4BACA 2WC2A 1HS6A 1WZ2A 1LVKA 3HOYJ 4BQQA 3L2CA 3EYYA 4N4NB 2H8WA 1J9IA 5JFRA 3DQVC 3MKWB 4BUPA 2X51A 3JRDA 1R23A 1SQMA 2W7NA 1EH8A 2E1OA 2IGOA 5DCFA 5CQEA 4Y15A 3ZMSA 5F1JA 2BY2A 4MNUA 2VJ8A 4BE0A 2WY7Q 2VLAA 2ZFUA 2BY0A 4XLAA 3S93A 1G3WA 3TQNA 1JGIA 2R7TA 3B7TA 3HSEA 3DTEA 3JREA 2CW0F 2HWVA 4XMVA 2W25A 2E2IJ 1NTCA 4JBAA 2R7SA 5J1YA 4L9TA 4W1UA 1OPCA 1VTNC 1RZ4A 1F43A 4XN8A 3W2AA 4HW0A 1E2XA 3LNQA 1KYWA 4L9VA 1ON1A 3SFZA 2QEXI 5JC1A 1R49A 1O7FA 3FXQA 1MBJA 3I3LA 3K7AJ 4YELA 1MZBA 4G7ZF 2OTLI 3LA3A 3JRIA 2GXBA 5E17F 3G4SI 3F21A 1JT6A 2OA4A 1ZELA 2DFFA 5F0HA 4KP7A 1BL0A 1QHGA 1D1CA 2I5UA 3LSPA 3CCJI 4YFXF 1WPKA 5EGOB 2M2EA 2Q2EA 1W4MA 4EJOA 2KRHA 2OBPA 1TQPA 3FIWA 3ERMA 2WAEA 3DF8A 3VODA 3GF2A 3L00A 3BY6A 4G9YA 3V7RA 1R22A 4XNAA 4GCVA 3HTSB 1TQIA 1ZG5A 4C30A 4ESJA 4FLSA 2AQFA 4FQGA 4NBQA 5FWQA 1Y8QB 5F0CA 2XKPA 5M3FJ 3DPLC 1W5TA 1NH3A 5BQTA 3ZPLA 4Y52J 1H9TA 2VXZA 4ZQFA 1TWAJ 2K86A 3CQZJ 2W57A 3J80K 4P9UA 4OMYA 2I8DA 2E7XA 4MO7A 3I0TA 4MQ9F 3AG1H 3FU0A 4WX9A 4A0ZA 1FMVA 2OZ6A 3SXYA 2PUSA 4AYBN 2ZJRF 2M0MA 2O03A 3M8JA 3GZ6A 1V3FA 3WU0A 4XMXA 4L0ZB 5JHUA 2FOKA 2KIUA 2MG4A 2VBWA 1R1TA 4GRIA 5E18F 3W3CA 3GFIA 1RR7A 4K2EA 3MZ8A 1YRNA 1DGRM 2Z16A 3C1DA 1LFBA 4BDYA 4ENJA 1B9NA 4MQVA 2VJ5A 3HB9A 3ZGKA 4EGZA 3TKYA 3KP4A 2X1DA 3AUAA 3BTJA 1U8RA 2DQMA 4EJVA 3I53A 1CF7A 3HOVJ 1EF4A 4CCJA 4ESFA 1BJZA 3H9JA 1ONPA 2LY2A 2LFBA 2H09A 2F5VA 3CC2I 2L7MP 5B66C 5LHHA 3KLNA 2KIQA 2VPRA 2Y30A 3F8NA 4RLFA 4U0VA 3OYMA 5EF6A 3ZN0A 4KYWA 5JI6A 3K1PA 2EH3A 3V8KA 1JGGA 3DTKA 3FTYA 2MLGA 4E7HA 3DP7A 2I10A 4GFBA 1SC5A 2ZB9A 1VQ6I 1MBGA 1WH5A 2RGVA 2EV5A 4D1QA 3B7RL 4XICA 2YS9A 1MJAA 4YEJA 1PVEA 4XMTA 1OQYA 3VSLA 4ZC3A 3TL4X 1YS6A 5D5XB 1PUFB 3CMMA 3S2HJ 2OC6A 1LNWA 2M0CA 1B59A 1EH6A 3NARA 4M9SA 1WJCA 5CLSA 5CVUA 2M34A 5D5VB 2NOJB 2ZXGA 1MMDA 4OIRF 2L9SA 4ABZA 3HOXJ 1UELB 3REOA 1N77A 3AFHA 3E6MA 1JHHA 4ZQGA 3K9TA 3JSPA 4CSWA 3N97A 4ZH4F 3CZEA 2EZIA 2X6WA 1ZK8A 3CDLA 3H9QA 2ZJ2A 4R5VA 2XGCA 3KP6A 2DQ6A 2JZYA 5LRRA 2RC4A 2IS2A 1RPWA 2BXZA 3ASOH 5FO5A 3DBLB 1Y0UA 2DMPA 4ZYDA 2V9PA 3FUHA 3B2PA 5BOXA 1BI3A 1Z6RA 3QQAA 2C82A 2V9VA 4BJTA 4UV9A 3AKZA 2C5ZA 4XORA 4LB6B 1RUOA 5K5QA 1FMWA 1XMAA 1VF9A 3BCBA 4DZJA 1O3QA 3H0GJ 3P7NA 2QQAA 3Q5FA 4XKVA 2R7XA 3OYAA 2O0YA 3QPLA 4W97A 1T1SA 1GVJA 1R5GA 5B1BH 1HW5A 2Y1CA 2M4GA 3K6GA 4DGWB 1AKHB 1A31A 1D1BA 1FPQA 1X19A 1NK2P 1OCOH 2D45A 1Z21A 3FTSA 2ZC2A 2O8XA 5LRSA 2IRFG 2XF5A 5J47A 1LFUP 1JVSA 3WTYC 3LOCA 1LDDA 2Y1GA 2PG4A 4ZQEA 3S16J 4LUPA 3KYLA 4B1RA 3ISPA 2RNGA 2BV6A 4QIWN 2MH9A 1WKMA 4XO5A 2M3AA 2XAGA 2RN7A 3NAUA 1FIPA 2L0KA 3TO9A 3KPHA 1R6RA 3A0HC 1ZS2A 1GVDA 1LPQA 2YU9J 2BY1A 3O6BB 2XAUA 1ZR2A 2LVSA 4Q47A 3GTKJ 4DYRA 3LFUA 4EJUA 1SFKA 1MH3A 2RQPA 1VQMI 4I76A 3WGGA 4EATA 1LQ1A 4WF2A 2JPCA 4A3CJ 5BMZA 3LA2A 2KJCA 1IDYA 5ILVA 2Y1DA 1U9OA 4BY7J 3OYJA 2CUJA 1LB2A 3G73A 3ZMZA 3ZP5A 3IWFA 2EFNA 1VQ7I 2HDWA 4II2A 3CDHA 1YOVB 3EPZA 2XAHA 5KNLA 1R4MB 2LNBA 3T1BA 2JCVA 1U3EM 1YYVA 3RKYA 4Z6YA 5BNGA 2R4GA 3X2QH 3FKIJ 2W00A 2A3SA 2IGNA 2ZBKA 3I5UA 1ZQ3P 3BT9A 2DA3A 5JNLA 1BN5A 1K6OA 5K7HA 3DXJF 2HS5A 1MJ9A 4GXOA 4D9JA 3HOUJ 1R0LA 2ZMEA 3JSOA 4E70A 1LFPA 2XVCA 3PSIA 3H5NA 2LG4A 5E8IA 1HSTA 2JTVA 4Y6RA 2XF6A 3FM3A 4AR9A 2Z5UA 4G6TB 4XSZF 5CVVA 3BZKA 3QRFF 3Q0WA 1LUJB 4F52A 2HQ5A 1W36C 4A5MA 1X1BA 2A05A 2MBFA 5GADJ 3FH8A 4F55A 3CJRB 1OFCX 2MA3A 3K2ZA 1T38A 4QHPA 4BXXJ 1IXCA 4DW6A 4HBLA 3W6JB 3BR0A 3F8CA 4RM2A 2HQAA 1DUXC 4IO9F 1ACIA 1UFMA 4HNTA 4G94A 2D2WA 4UUVA 1W5SA 3M3YJ 4M6XA 4Y13A 1DPRA 4B8XA 4UVAA 4V2FA 1X2NA 2ISZA 3ZXSA 1GW6A 5H2FC 3QAHA 5ILUA 4JX4A 2ADUA 3BWGA 1YW7A 5E20A 3I4NJ 2F4MB 4E7SA 2CUFA 2WB1N 2BY3A 3CMEI 2V79A 3HXLA 1ZLJA 4M9XA 2VJ4A 4RLQA 2AXTC 2YSRA 1XSXA 4E4HA 4FTHA 3WHCA 1MIJA 3SDBA 1I50J 2P5KA 3C2HA 3S14J 5C4JJ 1XG1A 2FU4A 3QOEA 3Q44A 1EV7A 1XGSA 4UB6C 3CHOA 4TV7A 1K4SA 2ICWG 1RKTA 3CDIA 2LKSA 2LBFA 4YIRX 4BBSJ 1IRZA 4HSTA 4E6KG 2XF7A 2P81A 3CUQB 4IRGA 5HS7A 4RVBA 1V5FA 1VFCA 3HKZA 2HDCA 4FLQA 4BU2A 4BHPA 1ZRFA 5ICCA 2GA2A 4LLLA 2NXNB 4LK0F 2LY1A 4IEJA 2GM4A 1YS7A 2MSYA 3OIPA 3I4MJ 2A61A 3GBGA 2PMHA 1YJNI 2HXOA 2D1HA 2FBKA 3RPUD 3MZYA 5GPCA 2XAFA 3G71I 3PUUA 2PEXA 3FH7A 4KIFA 2ELHA 2R7DA 4KNYA 3S3NA 1KQ9A 3HBLA 4XK4A 5BPIA 4OIPF 2ZFWA 4BHBA 2W24A 2VOOA 3ZR8X 1IW7F 2E35A 2WV1A 4RAYA 2HDDA 2RJIA 1X1CA 1IAWA 1SMYF 3IH4A 1AA7A 1ETYA 2L5QA 4IKFA 4BQNA 2W1OA 2XUBA 5J8FA 2ZKZA 4IOAF 4XN2A 4B48A 5DCMB 1Z05A 2JMWA 2KQRA 2VQCA 4KT6A 3BG7A 4A2UA 2MC3A 4BL0B 4JNDA 2DQLA 2VL8A 3K4KA 4PJ0C 4WXCA 5GAHJ 3ERED 1GT0C 1EH7A 2X0LA 1RIOH 2CYYA 2IP2A 5B1AH 4K5PA 4XO4A 1IN5A 2K4JA 2IS1A 1SAUA 2KL4A 2JA2A 2EBIA 4C3HJ 2EA2A 4CCKA 5DD4A 3HJEA 1BOAA 3I55I 3C7JA 4AR8A 4A3IJ 1NHAA 3PFYA 3SHFA 2LDUA 2PBIA 4YFNF 4DIQA 4K5LA 3HEFA 1GV5A 3KEYA 3KZIC 2W84A 5GAGJ 2K4BA 1GHCA 3ZHZA 3BQZA 4HPQA 3H9GA 1MBHA 3LSRA 3HDDA 3O2PE 1WFXA 1DPUA 3WE3A 3OIOA 1JKPC 3GFLA 5J6XA 5CVJA 2A6EF 3RKQA 4L0YB 2DXIA 2GXGA 4DYCA 4QPQA 2DA2A 5F27A 1RR8C 2DOAA 3FHNA 2K9QA 2CFXA 1Q1HA 4FLOA 2JA5J 3AL0C 2M4KA 2RV8A 2JK3A 4P55A 2DODA 3UR3C 3FUKA 3E5XA 2B61A 2F2EA 2MAPA 2K40A 4XN7A 2VXDA 1OCPA 2M30A 4L9NA 3F6OA 4UVCA 2DU9A 4J3BA 5IT9Z 4HQEA 3ZQ7A 3A06A 1K6YA 1KYZA 2E60A 3HPHA 1B8IA 2FQ3A 1SD4A 4U7DA 4XMUA 2ZMEC 3B6CA 2B0LA 1B4AA 1W7PD 2DT5A 3HTUA 1E3OC 4BHCA 3WTWC 3GTOJ 3BPVA 2QQ8A 3W6KB 3A4CA 4LGWA 3TW6A 2MYSA 5CYVA 1UMQA 4KUMA 2K27A 3W2WA 4YG2F 3ROUA 3G2BA 3A2KA 2PQ8A 3WQRA 5HLIA 4CH7A 4B4CA 3GTMJ 3I4PA 1ITYA 1MW1A 2EZKA 4RB0A 3FXLA 1T1RA 1BJAA 1PYVA 3PM1A 3BTIA 3AG3H 2ZCWA 2P0WA 3GZ5A 2VC1A 1D0ZA 1FX7A 3P9CA 1FNNA 4RAFA 3GFMA 1AWCA 5JAZA 4I09A 1JG9A 3I64A 2M87A 2O3FA 1HDPA 3K4CA 3FMSA 4HQMA 2PJRB 2XQ0A 2BYVE 1ERDA 2EPFA 1S7AA 3KEOA 4PJNA 2RQQA 1Z3YA 4HF1A 2R59A 1R7JA 3V7SA 5FKKA 2MGQA 5J4VA 4HV5A 3IIEA 3MN2A 1UHSA 1S7OA 4I2OA 2KIFA 1FYLA 1JI8A 1SD5A 2HVQA 2R5ZB 4ASNA 3BP8A 3PUFA 4IHWA 3B37A 3KEDA 3PJRA 3LWFA 2QSHX 2F5EA 4OAZA 4CDGA 3ZQLA 2PJPA 4XMZA 4XR6A 1OKRA 3WODF 1P2FA 1R5ID 4FETA 2CUZA 4KFCA 4C2UA 1IV6A 3HRSA 1G5AA 2DTZA 2HPOA 5EEGA 2GWRA 5IYBJ 2TDXA 2CGPA 2PI0A 1NG7A 3Q43A 2FEZA 3ONQA 2FD5A 3K4LA 4V2GA 1HOMA 3ABUA 3O8GA 1T95A 4BXFA 1QRYA 1QPIA 3L2QA 3ESWB 5EZHA 5FKLA 3V8LA 1G8XA 3HGGA 2VKEA 2L7KA 4OOIA 4CCMA 2R7VA 4A3BJ 4ZYHA 3K69A 4HLYA 2PLYA 4Y7NJ 4XKCA 5L3CA 2DPDA 4B47A 1J0RA 1U8BA 3RC8A 5EV7A 1WH7A 3PIPF 2CH0A 1BM9A 2VI6A 1U5TA 2KDOA 2OU2A 5FD5A 3WTSC 3MFKA 4XRSG 1Z77A 3HRTA 2ACJA 3DKYA 1XSVA 4MHGA 5KK1A 3K0LA 2ME6A 2VT2A 1K83J 1H3LA 1S72I 5CVIA 4LLGF 2IBDA 3L2WA 3OYKA 1L3LA 4GO1A 1FC3A 1TW2A 3VOEA 5K1YA 3K4NA 4RB3C 1P9QC 3CHSA 3KZYA 4KJZA 4A6EA 2NYXA 3FHZA 2GOMA 2NS8A 4HV6A 5E3OA 2BVMA 2ZJQF 3KZZA 3TDZC 3CC4I 2Q2EB 1YHQI 2P5VA 2PJRA 4M3GA 3KEQA 2V1XA 1H0MA 2VUMJ 1ONVA 5D4RA 2DYRH 3I9V2 2IA0A 2ZO4A 3GFJA 2ID6A 3IV5A 2JCXA 1TTYA 2OJED 4BDZA 2P5LC 2DA7A 4UVBA 5IOZA 5HDGA 3RKWA 3CP8A 3RPUA 4ZX3A 3CZKA 5L3EA 1MSFC 4AR1A 3H3VK 2H8RA 3SJMA 3KCCA 4NC7A 2V4JC 2R7QA 5A2QZ 4Y3OA 5DYMA 5E3MA 5M3MJ 4XO3A 1S7EA 1R1UA 2LREA 2XRLA 1KU7A 5F08A 1IUYA 4P9FA 5K7ZA 5HS8A 1VQ4I 2JSPA 3QPHA 5KVRA 3JSZA 2PFBA 3DTIA 1JKOC 2E2HJ 1ON2A 3WTUC 1OYIA 5C3EJ 3JR9A 1E0EA 3E3VA 3OY9A 5TRDA 2B9SA 3U2RA 4HSRA 1XMKA 5H6QA 5GTIC 4IHVA 3I54A 4EJWA 2QENA 2DFIA 2BBYA 1DP7P 1TT5B 1YRNB 3HHGA 2JA8J 1G6NA 3GXOA 3R4KA 4A93J 2NS0A 5DD8A 4U87A 3F8MA 2HFHA 2X85A 2IS4A 3ML6A 2H1KA 2BXYA 4P1WA 3S1NJ 1CF7B 3K70D 3FK6A 2JQ7A 2PL5A 3RYPA 3AU9A 1EA3A 4PFPA 3Q3SA 1KZHA 1R4NB 1X3ZA 4RDUA 3H5RA 2ZXJA 3D0SA 1IG7A 5HDNA 3IWZA 5HVQC 2CUEA 4UV8A 1GLNA 3VVLA 3M9AA 4A12A 2HXIA 1G4DA 1LE8A 2LMDA 4U88A 4CGZA 2FX0A 4IOCF 1MD0A 1WJ5A 1R9TJ 5FLVA 1VNDA 3C18A 1G3TA 1Z9CA 3DU5A 3OWTA 4B09A 2DW4A 3ZQCA 3VYSB 2LRDA 4FCYA 4J00A 1K79A 2K9NA 2GLOA 2K85A 4HX8A 4BBRJ 2O6GE 5IT9K 2GBYA 3OR1C 5IT3A 4UHTA 3CXBA 1HDDC 1LVAA 3MEXA 4ZQHA 2KDZA 1UG0A 3KP2A 5DM7F 2FXAA 2VKDA 1X1DA 2R3SA 2QSGX 1O4XA 4I98B 2LLKA 3OYCA 2FNAA 2F5FA 2NVXJ 1W7PA 2ZJPF 5JBIA 1WWXA 2NVTJ 4ETSA 4S0HB 2BEOA 2XHKA 1WJBA 3BOQA 1KQ0A 5E1XA 4JP0A 4XLCA 4ZYEA 2JRTA 2N8GA 1PJRA 2MD5A 1TNSA 1WQ2A 1OR7A 2VBYA 2XB5A 3MWMA 2Q1ZB 1IC8A 1U5TC 4PZJA 4JX5A 4KA4A 1FT9A 2DOFA 2Z2SB 3MCZA 3UERA 2GOXB 3L7WA 4IQ4A 4ZZDA 4N4OB 3WU1B 2V6CA 4GYGA 4ZW8A 3S2DJ 2DFEA 3PO2J 3G1MA 2OV7A 3K1NA 1XC5A 3CCVI 4AIJA 2LOOA 4ZW6A 3KETA 2AS5F 1IV8A 2PMUA 2FSWA 4QPEA 1UG2A 1FOYA 3R0IA 3GTQJ 2WAQN 4CCLA 3WGHA 3CHQA 4Q4ZF 3VEPA 1SFXA 1TLHB 2IAIA 1SFEA 3DEUA 1OCRH 2ZXHA 2R5YA 2VT3A 2O7GA 1YIOA 3IH3A 4LB5A 4L5EA 1Q0HA 3F72A 3JRCA 2ETHA 4XL9A 2FMLA 2KFDA 3ZMVA 4QIRA 3TO6A 2OF7A 4WCGA 3KYCB 3ULQB 1ETQA 1FWZA 2WB1A 2MC4A 3IUOA 1FSEA 4H4KC 5L3DA 3WGIA
chains in the Genus database with same CATH topology
2W4SA 2KRCA 3K4MA 4RM2A 2HQAA 4FASD 3OS2A 3OYFA 4XQFA 3OMYA 2AQEA 5LFAA 1R0KA 4HNTA 3OL4A 3TMOA 2IGMA 1S9HA 2K9LA 4HEA2 2UWMA 4R7LA 2UUZA 2V9KA 3SYTA 4K5MA 3AL0B 1GW6A 3ZXSA 4BJ5C 4XN4A 1BOBA 4BGDA 2WAFA 1NG6A 4BE1A 4ZN6A 2K5CA 4E7SA 3FUIA 1Q0QA 2A6TA 3HXLA 4C9YA 4YRVA 2VJ4A 4RLQA 4Y67A 3PNYA 4E4HA 4QPOA 3MD2A 3SDBA 4Q4IA 1YE9A 2OUMA 3C2HA 5KCMA 3QOEA 2E1MC 3Q44A 3CJQB 3ZHYA 3CHOA 3RQ4A 1BR2A 2VASA 3HOSA 3CIAA 2LBFA 2ZXIA 4HSTA 1W36D 4E6KG 2XF7A 4E7IA 4RVBA 1V5FA 2E5NA 2IXSA 3HKZA 3SEZA 4FLQA 4BU2A 3LSHA 4R5TA 5AENA 4BEHA 1RP3A 4FLRA 1MMGA 3PSFA 2LY1A 3FBIB 1MNDA 2KMUA 4BQOA 1WJAA 4LG3A 3KX2A 3OIPA 3GBGA 4XM3A 3D5SC 4CUGA 4ZX4A 3RPUD 2VPLA 3BCAA 3PNTA 3SZGA 3PUUA 2HPIA 2JCYA 3FH7A 4NC8A 3S3NA 1BR4A 4PU2A 4F3QA 3L2RA 4OAYA 3FTZA 5HNHA 3ZR8X 2EGHA 2X1EA 2RJIA 1X1CA 4HNUA 2LYCA 5BPPA 1MW7A 1AA7A 4IKFA 2L5QA 2JV7A 3IAM2 4BQNA 4IQJA 3LMMA 2JVHA 2W1OA 5DULA 4HRIA 4R79A 1S46A 2CS3A 4F91B 4XN2A 3FUNA 4B48A 4E7LA 1TT0A 3EUAA 4XLEA 2KQRA 2VQCA 3S3MA 4KT6A 3BG7A 4E7KA 4PSWA 4BL0B 4JNDA 1ONOA 2WA0A 5JO0A 2VL8A 1DQUA 3K4KA 4XNDA 5FRMA 4BS9A 2XSJC 3ZI0A 2JUGA 3H5AA 1SG7A 4Y33A 3M1CA 2Y1EA 1Q0LA 4K5PA 4XO4A 2IS1A 2CW8A 1SAUA 2KL4A 2LBFB 5CQGA 2JA2A 2K9MA 3H35A 2WBMA 1VZ0A 2PMZA 2BOLA 4CCKA 4F92B 4XN5A 2KLOA 2HZDA 4AR8A 3J7AY 3PFYA 4BEHB 5HNFA 4K5LA 4DIQA 3KEYA 2HU9A 2X1CA 3CF2A 4PUSA 1ONNA 3QYEA 4LIUA 4XOTA 3ZHZA 4HPQA 3E0JB 3H9GA 2QKLB 2A5WA 2DJIA 2CFOA 1WFXA 1KONA 1LDKB 1X3WA 4AU7A 2DT6A 4J01A 3FTUA 4DBQA 5JHFA 5HOOA 3OYGA 3B7SA 3HUGB 3FUFA 3FTWA 2W82A 4ZDLA 2L2OA 5LD2C 2DXIA 3FUJA 4XONA 4QPQA 2KZVA 1OR7C 2DOAA 2VQHA 2Y0SA 3FHNA 2VKHA 4Y4RA 4ZDOA 4FLOA 2KPMA 1DGWY 3PNVA 4B3XA 2F4IA 3D5RC 3AL0C 2M4KA 2X6XA 3UNGC 3RCOA 2Y1FA 3FU3A 3RASA 3UR3C 3FUKA 2M7AA 2B61A 4BJ6C 3BLYA 3HG9A 2VIXA 2MAPA 2K3PA 4XN7A 2VXDA 3EBHA 3B3BA 4PSXA 4CCOA 3TBIA 2WADA 4J3BA 1J09A 2HPMA 2ELJA 4GAAA 1WJFA 4PFOA 4L2LA 3CESA 3A06A 4Y6SA 1K6YA 3VWBA 2QKMB 2E60A 3HPHA 2V1NA 4XMUA 5KHDA 3ANMA 2WY8Q 2ZSIB 2KHMA 1LKXA 3OYNA 3OYIA 1MNEA 4ZTFA 3LSIA 3JT1A 4PW4A 3MKYB 2BW3B 3A4CA 1X4OA 2MYSA 4CA0A 3HL2A 4BACA 1HS6A 3V42A 3VSKA 1LVKA 3DKXA 4PVBA 3W2WA 4OOEA 2R7OA 4BQQA 3G2BA 3A2KA 4ZW5A 3WQRA 1N75A 2VQLA 4N4NB 4CH7A 4XN9A 1MW1A 5JMWA 1T1RA 2X6YA 3DQVC 3MKWB 4BUPA 2X51A 1PYVA 1SQMA 1Y56A 3OL3A 1MW0A 2W7NA 2P0WA 1YX3A 2ZSHB 1IRXA 4ARFA 3OYDA 1OLTA 2IGOA 1D0ZA 5CQEA 1UAAA 3AU8A 3S3OA 3DU6A 2JVGA 4RCVA 4DPRA 4B43A 5JAZA 3BG6A 1JG9A 1HA8A 3MMYB 4BKXA 3K4CA 2VJ8A 2PJRB 2XQ0A 4KISA 3NWSA 4BE0A 1WJDA 1ERDA 2WY7Q 3BC8A 4PJJA 2VLAA 3B7UX 4PJNA 2ZFUA 2RQQA 1Z3YA 4XLAA 3S93A 2R59A 3B7TA 1D1AA 3VYRB 2R7TA 1JGIA 3DPUA 3DTEA 3B34A 3PL8A 4RSYA 4PJMA 4XMVA 4ZW7A 2V26A 3IIEA 2R7SA 4XMWA 2E5ZA 2KP6A 4XNBA 1JI8A 4XLFA 3VYTB 2HVQA 3B37A 3W2AA 2XPYA 3HPGA 3KEDA 4XN8A 5JC1A 3PJRA 4KITB 1TZLA 4XN1A 3I3LA 4YELA 4OAZA 3B2XA 4XMZA 2WPGA 4XR6A 3ZRGA 4FETA 2CUZA 1ZELA 4C2UA 1G5AA 2HPOA 3CZLA 3HC7A 3FUEA 4KP7A 1QHGA 5CPRB 1D1CA 2MD0A 3MKZA 2R72A 3A1YA 3UCQA 2R7WA 1NG7A 3Q43A 3QODA 4LITA 3ONQA 1D0XA 1MMAA 3K4LA 2QJ1A 2XPZA 2KRHA 1T95A 4BXFA 3OYHA 2WZFA 3RC3A 2WAEA 3L2QA 3OR2C 1G8XA 3OYLA 5CKTA 2O5RA 2GTQA 2L7KA 4XNAA 4CCMA 2R7VA 3FUDA 4XKCA 4C30A 4B47A 3OS0A 3SEQA 3RC8A 5EV7A 4FLSA 2AQFA 2CH0A 5FWQA 2KDOA 3QJXA 1Z7LA 3DPLC 3DKYA 2VXZA 4ZQFA 3WQQA 1MMNA 2BVLA 1BR1A 4X0GA 2BW3A 1H3LA 2I8DA 3FU0A 3OIQA 3L2WA 3OYKA 4K5OA 3OS1A 1FMVA 3ANLA 2PUSA 4F93B 4IX7A 2M0MA 3M8JA 3F9KA 1H19A 3K4NA 3LSMA 1P9QC 3CHSA 4KJZA 3FTXA 4XMXA 4AICA 2VJJA 4R5XA 4CZCA 4GRIA 2GOMA 3W3CA 3S8PA 1MW3A 4II3A 3IAS2 2HNHA 4ZW3A 1V5GA 2BVMA 1DGRM 2Q2EB 2Z16A 4BDYA 2PJRA 2VJ5A 3ZGKA 3H0DA 3C2GA 3K4BA 2X1DA 4XKWA 4ZDPA 3AUAA 3FULA 2DCEA 3I9V2 2DQMA 3N05A 2HPTA 2JCXA 3IP4B 4CCJA 4BDZA 3H9JA 1ONPA 2LY2A 4GAEA 2F5VA 2VB6A 3CP8A 2FFLA 4ZX3A 3CZKA 3K70C 3LSGA 4AR1A 4XMYA 4RLFA 3VDXA 4NC7A 3OYMA 4PJLA 3HOTA 3D5LA 3DPTA 4XLHA 2V4JC 2R7QA 4RM3A 2HVSA 3W2VA 4XN3A 3CZGA 4Y3OA 4A03A 3FTYA 3DTKA 3LL7A 3FU6A 5JMPA 4E7HA 4XO3A 2M7BA 2LREA 1SC5A 4MS6A 4BE2A 4AYSA 1T0FC 4D1QA 4OWRB 3B7RL 2HVRA 4YEJA 4XMTA 2JD2A 3VSLA 4ZC3A 2XDVA 3L2UA 2JSPA 3TL4X 2FUG2 2UV1A 4ZTJA 3JSZA 3DTIA 1K5HA 2PGGA 3CMMA 3ZCOA 3CHPA 1E0EA 3K10A 2OC6A 3FUMA 3OY9A 2LH9A 3EUKL 4HSRA 4XOPA 2CV0A 3FBNB 1WJCA 2NOJB 4MKTA 2ZXGA 1MMDA 1G59A 1QU3A 2L9SA 1N77A 1UELB 3VYUB 3FDYA 2CV2A 3AFHA 4XN0A 3U9WA 4ANJA 4P5OA 4ZQGA 5TGTA 4CSWA 4R5VA 3CZEA 2X6WA 3H9QA 4ZYAA 4U87A 2DQ6A 4NNJA 2X85A 2IS4A 2A7OA 2V6EA 2MFZA 4ITVA 2IS2A 4P1WA 4Y6PA 5FRNA 3K70D 4IZZA 3FH5A 4QUOA 2PL5A 1QHHD 3FUHA 4ZJZA 3AU9A 3B2PA 1EA3A 4PFPA 2JD0A 4FCAA 3EBIA 4NQWB 1X3ZA 2C82A 3H5RA 4BJTA 3AKZA 2MABA 2C5ZA 5HVQC 3L2VA 4XORA 1GLNA 4JQFA 3T0YA 3VVLA 1FMWA 3CZ6A 4QMEA 1MVYA 4K5NA 2MAOA 3BCBA 3DEEA 1WJ5A 3NWTA 3RTRA 1X1AA 4MLOA 2R7XA 4XKVA 3OYAA 3DU5A 3OWTA 1T1SA 4XKBA 4U7BA 2R70A 1WJEA 3VYSB 2LRDA 2DT7B 2Y1CA 4J00A 2M4GA 3K6GA 4DGWB 4PK4A 3DLAA 1D1BA 2IS6A 1X19A 3OR1C 2E1MB 1Z21A 3FTSA 4DBRA 2V7FA 3FHEA 5DYFA 2XF5A 3E1SA 4AVZA 3OYEA 4AYBA 2QVWA 3CHRA 1JVSA 2WZGA 1UG0A 4X2UA 4ZQHA 2Y1GA 2VKDA 4ZQEA 1X1DA 1YX5A 1DP3A 3VVMA 4LUPA 2JD1A 3KYLA 2LC2A 2RNGA 3EUHC 1V5EA 4XO5A 2M3AA 3OYCA 3FTVA 4ZX5A 5JBIA 3CP2A 3WQSB 2VQGA 4ZX6A 1R6RA 1ZS2A 1WJBA 2F6CA 3ANNA 3QYBA 3U21A 2XAUA 4XLCA 2L9NA 3LFUA 4NUBA 1SFKA 2CMPA 1PJRA 1MW2A 4EATA 2WAQA 4JOMA 4DOZA 2Y1DA 1OR7A 3OYJA 2CUJA 3EBGA 5DLLA 2Q1ZB 2RREA 3FKJA 3OOUA 4CXFA 2VJIA 4C2TA 2HDWA 4II2A 4OOFA 4Q4EA 2Z2SB 2R7UA 3UERA 3EPZA 2GOXB 4IQ4A 5KNLA 4ZW8A 4N4OB 3K4JA 2JCVA 1U0JA 2OV7A 1X4PA 3OYBA 2R4GA 2LOOA 4ZW6A 2W00A 2IGNA 2CW7A 1Z3XA 4QPEA 3QYFA 4HG2A 4LIVA 3R0IA 3T8VA 5JNLA 4CCLA 3S32A 3CHQA 4D9JA 4E7ZA 1R0LA 3RSNA 1LFPA 3PSIA 1Y6IA 3FU5A 3H5NA 4NQWA 3DWLE 2ZXHA 1D0YA 4RMNA 4XNFA 5FROA 2LG4A 4B44A 2O7GA 3A14A 4Y6RA 2XF6A 1N78A 1Q0HA 2XC7A 4G6TB 4AR9A 2IGKA 4XL9A 4DJAA 4QIRA 4CCNA 4F52A 2CV1A 2R7RA 1W36C 3UEQA 4ZQTA 1X1BA 3LSKA 4E7JA 3FH8A 4F55A 3PUBA 3CJRB 2Z1DA 3ZQQA 4QHPA 4H4KC 2WB1A 2MC4A 3IUOA 5HLTA 3ZHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNF A;  5HNH A;  5HLT A; 
#chains in the Genus database with same CATH topology
 2OTJ I;  5J1U A;  2ECC A;  4FAS D;  3OYF A;  5LGN A;  2E34 A;  4A3J J;  4UY8 I;  3OMY A;  3PO3 J;  1IXR C;  3MAJ A;  3F23 A;  1CQT A;  3OL4 A;  2BHZ A;  2XRN A;  3K2A A;  2IGM A;  1S9H A;  3M4O J;  2DAO A;  1IO2 A;  1GUU A;  2UUZ A;  2GIV A;  3AL0 B;  3E6D A;  1P92 A;  2CSO A;  1T6S A;  2WAF A;  1NG6 A;  2VKV A;  2Z99 A;  1XX5 A;  4ZN6 A;  3WG9 A;  3GTL J;  4MGR A;  3ZOB A;  2A6T A;  4A0X A;  4YRV A;  3G3Z A;  1ZGJ A;  2LP0 A;  4M3E A;  1YW8 A;  3MD2 A;  4HAM A;  4Q4I A;  2ZXW H;  2ZME B;  3SQN A;  4O6J A;  3H3U A;  5KCM A;  1P4A A;  2EZH A;  3CJQ B;  3ZHY A;  4LFU A;  2VAS A;  4NDL A;  3HOS A;  2ZXI A;  1SMT A;  4M3F A;  4E7I A;  1T8I A;  3F8B A;  2E5N A;  3SEZ A;  3VFZ A;  1UZC A;  3HSR A;  3S1M J;  5J40 A;  1XS9 A;  3ELK A;  4RB1 A;  4BEH A;  4PDK A;  4BQO A;  4FLR A;  1MND A;  1ULY A;  4LG3 A;  1SEU A;  3KX2 A;  4KMU X;  4WXD A;  4XM3 A;  4ZYG A;  4H0E A;  1D8K A;  1XGN A;  4IJA A;  2XSD C;  1U6G A;  2R0Q C;  3WHB A;  1XTA A;  3NRV A;  3PNT A;  3PIO F;  2HPI A;  2JCY A;  2QQ9 A;  5M5Y J;  4NC8 A;  2QBY A;  2HI3 A;  1MKM A;  4F3Q A;  1QZZ A;  2EIN H;  4QWQ A;  3HUG A;  2HKX A;  2XRO A;  5A2Q K;  4PGH A;  1V54 H;  2LYC A;  5BPP A;  3IC7 A;  3CD6 I;  3S1Q J;  4AM3 A;  5E8G A;  2JVH A;  5DUL A;  3WG7 H;  2EV0 A;  1V4R A;  3I56 I;  4R79 A;  4HRI A;  1FTT A;  2PX9 A;  1FIA A;  3FUN A;  5BPD A;  1TT0 A;  2BE5 F;  3EUA A;  4XLE A;  4UNO A;  1FOW A;  3VB2 A;  4OMZ A;  4L5I A;  5JO0 A;  3RKX A;  4XND A;  1XCV A;  4BS9 A;  2STT A;  1O3S A;  2EFO A;  1SG7 A;  4PCQ A;  2L7F P;  2D5V A;  5FFX A;  3B6A A;  1T56 A;  2LBF B;  1ZKG A;  1ZRD A;  4I0A A;  2M8E A;  2WBM A;  1VZ0 A;  2PMZ A;  1KU9 A;  1UCR A;  4FE4 A;  3SZP A;  3J81 Z;  2R93 J;  1Z91 A;  4HA8 A;  5HNF A;  3QYE A;  3FF5 A;  2VE8 A;  2QA4 I;  2A5W A;  1ENH A;  2XGD A;  2HOS A;  2DJI A;  4KMF A;  3BZ6 A;  2OZU A;  3TP0 A;  1RC9 A;  1LDK B;  5M5X J;  2WTE A;  4R1H A;  1X3W A;  4AU7 A;  2DT6 A;  3CCY A;  5JHF A;  4ENK A;  3B7S A;  2RKH A;  5EEA A;  4AID A;  2DA5 A;  3FTW A;  3FXK A;  4KIC A;  4XON A;  2KZV A;  1OR7 C;  2Y0S A;  4Y4R A;  2RNJ A;  5FKM A;  3T8R A;  3PNV A;  4PGG A;  3GTJ J;  2H27 A;  3M1E A;  2F4I A;  4MTD A;  4MIM A;  3D5R C;  4G8X A;  5J3L A;  2X6X A;  1T0F A;  3RCO A;  3FU3 A;  3RAS A;  3S15 J;  3CMA I;  3E5U A;  3JRA A;  1WI3 A;  4XRM A;  1M1E B;  2VIX A;  2K3P A;  2HTJ A;  4Q48 A;  1ETW A;  4KN4 X;  1XDU A;  4CCO A;  1H88 C;  2NOG A;  1QA6 A;  1FTZ A;  1F4K A;  2QZ8 A;  1J09 A;  2ELJ A;  5EYR A;  4Y6S A;  1IRG A;  2VBZ A;  3ZMU A;  1SVL A;  5KHD A;  2CU7 A;  3IRR A;  3ANM A;  1RNL A;  2KHM A;  3H3Z A;  4A3L J;  3OYN A;  5F04 A;  4L18 B;  1IN8 A;  2CQK A;  2EK5 A;  1MNE A;  1O3R A;  2DK8 A;  3LSI A;  5HS9 A;  3GLL A;  1YJ9 I;  3BTC A;  4WWC A;  2BW3 B;  4KT5 C;  5JLX A;  3MKY B;  1X4O A;  2P8T A;  2VON A;  1I27 A;  2EIK H;  3LQQ A;  1IF1 A;  4V19 K;  2FA5 A;  3DKX A;  4DNC A;  4BY1 J;  4OOE A;  1VI0 A;  1KQ8 A;  2OQG A;  4HNV A;  5GTH C;  2VQL A;  1F9N A;  4XN9 A;  4O5V A;  5JMW A;  2CO5 A;  2MH2 A;  1Z0X A;  2X6Y A;  3FXR A;  3CLQ A;  1A6I A;  3LSJ A;  3O8H A;  4OIN F;  1W1W E;  3V4G A;  1MW0 A;  2Z33 A;  2QLZ A;  1Y1W J;  2DN0 A;  3OYD A;  2P4W A;  5GPA A;  1TWF J;  1UAA A;  4DPR A;  3S3O A;  3DU6 A;  2JVG A;  4RCV A;  3BG6 A;  1HA8 A;  3HW2 A;  1ZHF A;  5EG0 A;  1YJW I;  3NWS A;  1WJD A;  3B7U X;  4PJJ A;  3S2W A;  1HBX G;  1PDN C;  2EFQ A;  3WTT C;  2KZG A;  2LSO A;  3VYR B;  4M3B A;  3DPU A;  2YPR A;  1P7I A;  3BG5 A;  3PL8 A;  1IN4 A;  4PJM A;  4RSY A;  2V26 A;  4S04 A;  1ZG3 A;  2EJR A;  5EEH A;  4XMW A;  2E5Z A;  2KP6 A;  1G3Y A;  3E5Q A;  1XCB A;  4XNB A;  4XLF A;  1R36 A;  1KA8 A;  3LFK A;  1B8I B;  1RES A;  3CJT B;  1FOK A;  2E19 A;  5K5O A;  4KIT B;  3GX4 X;  4DZP A;  1D5Y A;  3MZH A;  2XPW A;  3EUH A;  1ZG1 A;  3ZRG A;  3OSG A;  1K61 A;  4XID A;  5CPR B;  3UCQ A;  3MKZ A;  1Z7U A;  2HEO A;  5IYD J;  2R7W A;  3Q9V A;  5HOD A;  2LTP A;  4LIT A;  1MMA A;  3F8F A;  3RC3 A;  3EYI A;  2CRG A;  1K7A A;  4HF2 A;  1S3J A;  1OIS A;  3ABK H;  3OR2 C;  2DA6 A;  2E7W A;  1Z67 A;  5CKT A;  1XN7 A;  1VQL I;  2E2J J;  1PP8 F;  2DDA A;  4M74 A;  2R7F A;  3ECO A;  3KLO A;  1K78 A;  1XPX A;  4AIH A;  1C0W A;  1HC8 A;  1QZE A;  1ETO A;  1Z7L A;  3BG3 A;  4BNC A;  4RA2 A;  5HDK A;  3WQQ A;  3M8F A;  1MMN A;  2BVL A;  3QP5 A;  5GAE J;  1APL C;  2O61 A;  1SVO A;  3TDU C;  1UB9 A;  2BW3 A;  1ZAO A;  1GDT A;  3TOA A;  3ZMD A;  3HM5 A;  3OIQ A;  1JKR C;  1G3S A;  3QPS A;  3CJN A;  4K5O A;  5IPA A;  1H89 C;  3OS1 A;  1RRJ A;  3ANL A;  4F93 B;  4IX7 A;  4ENN A;  2Z9O A;  3JAM Z;  3F9K A;  3LSM A;  1U2W A;  2HZT A;  2GAU A;  1MJB A;  3TW7 A;  3FTX A;  1I39 A;  2EV6 A;  4AIC A;  4U0Y A;  2IA2 A;  4CZC A;  5DTD A;  2DI3 A;  1GXP A;  1T33 A;  3CCS I;  1ZLK A;  3GVA A;  2OQR A;  4M9Z A;  2IJL A;  2QSF X;  1ORK A;  2TCT A;  3IAS 2;  2HOA A;  2HNH A;  3B73 A;  1V5G A;  4LG0 A;  1A35 A;  2R92 J;  5L3G A;  5IP6 A;  1I6H J;  3P9K A;  1WHU A;  3HOZ J;  3H0D A;  4I6Z A;  1DU6 A;  5KAF C;  3A03 A;  3C2G A;  5LHG A;  1BC7 C;  2G7H A;  4ZDP A;  3FUL A;  2NS7 A;  1K4T A;  3IP4 B;  2YUS A;  4UUS A;  4GAE A;  3WE2 A;  2OCE A;  2VB6 A;  2EZL A;  3FWE A;  4QLC U;  3HOW J;  4NC6 A;  1E17 A;  1SAN A;  3K70 C;  4XMY A;  2DOE A;  2DQR A;  1U5T B;  3VDX A;  3IKT A;  3DPT A;  3ZQH A;  2L02 A;  4XLH A;  4AWX B;  1QNT A;  4ENM A;  4XN3 A;  2ZNZ A;  3FU6 A;  4AUX A;  4AVP A;  5JMP A;  2MLK A;  3FX3 A;  2M7B A;  5E1Z B;  5AIQ A;  2XB0 X;  2XPU A;  1I5Z A;  1T0F C;  1D5V A;  1JJ6 C;  1P7J A;  4A3F J;  1J2X A;  2WWY A;  3W6V A;  2JD2 A;  1BA5 A;  2UV1 A;  4G12 A;  3N4M A;  4ZTJ A;  3I59 A;  1K5H A;  2JUC A;  3ZCO A;  3CHP A;  4LLN A;  2H6C A;  4RGX A;  2HR3 A;  3K10 A;  5FFZ A;  4X1E A;  1ZYR F;  2LH9 A;  2PN6 A;  2V1D A;  2ISY A;  4XOP A;  3FBN B;  3IL2 A;  2G0E A;  3J81 K;  2M45 A;  3JTH A;  3PFI A;  5AIP A;  5K7F A;  1G59 A;  3VYU B;  1FEX A;  2HTS A;  4XN0 A;  3A0B C;  4ANJ A;  2LK2 A;  4P5O A;  5FKO A;  5TGT A;  4MTE A;  1POG A;  2X48 A;  4MFD A;  1IN6 A;  2A7O A;  2V6E A;  2MFZ A;  4ITV A;  4IHX A;  3OV8 A;  2ESN A;  3OOP A;  5FRN A;  3FH5 A;  4QUO A;  1QHH D;  2ID3 A;  3F22 A;  1FBS A;  2XGX A;  3EBI A;  4NQW B;  4XRF A;  3G6E I;  2UXN A;  3AG4 H;  2MAB A;  3L2V A;  1TQM A;  4JX6 A;  3T0Y A;  1HF0 A;  4K5N A;  3LA7 A;  3BR6 A;  3DEE A;  4BYY A;  1X1A A;  4MLO A;  1BIB A;  3BTL A;  3E6B A;  3RDI A;  2XAJ A;  4U7B A;  1T2K A;  1WJE A;  1AOY A;  1VQN I;  2DT7 B;  1BIA A;  2DBB A;  3JRG A;  3BRO A;  3CUO A;  1YIT I;  4C3I J;  1TP4 A;  2IS6 A;  5E3L A;  3RQI A;  2FQ4 A;  3FIS A;  3GWZ A;  4DBR A;  5GP9 A;  4RGR A;  2G9W A;  2QGU A;  4FHT A;  1SFO J;  3E1S A;  4X2U A;  3CHR A;  4AYB A;  2QVW A;  5EJC A;  1DP3 A;  4AC0 A;  4YFK F;  2JD1 A;  2LC2 A;  3EUH C;  4EV0 A;  4RS8 A;  4EMS A;  3GTG J;  3FTV A;  4ZX5 A;  1SD7 A;  1ODD A;  3BPX A;  5E79 C;  1TWG J;  5ICE A;  3HYI A;  3CP2 A;  1TWC J;  2KIS A;  2VQG A;  4ZX6 A;  1OJL A;  3GME A;  1YIJ I;  3QYB A;  2L9R A;  3U21 A;  2HYJ A;  3FXO A;  1X3Z B;  4ON0 A;  5HLH A;  2L9N A;  3PQK A;  2CMP A;  2NAZ A;  3BZC A;  3BR3 A;  2DMU A;  2ELK A;  1HQC A;  2WAQ A;  4IRH A;  3D1N I;  4JOM A;  1LE8 B;  3RPQ A;  3EBG A;  1OYW A;  5DLL A;  3CTA A;  2RRE A;  4F7Z A;  1O7L A;  2AO9 A;  3FKJ A;  4LK1 F;  2VJI A;  4CXF A;  4C2T A;  3MQ0 A;  1IXS B;  1ETK A;  1Q1V A;  2VN2 A;  4Q4E A;  2R7U A;  5ED4 A;  3GW2 A;  1ZGW A;  1I3Q J;  1EJ9 A;  3BR1 A;  1X4P A;  4IVN A;  1WRJ A;  2CW7 A;  2EB7 A;  3T8V A;  4LOC A;  2EFW A;  4D7N A;  4RGS A;  3RSN A;  4NQW A;  1MNM C;  3DWL E;  4XNF A;  4B44 A;  4M6Y A;  4I0B A;  1MBF A;  4AD9 A;  3WTX C;  2XC7 A;  2HOT A;  2IGK A;  1W7P B;  3T5X A;  1ZN2 A;  1OCC H;  1B1B A;  2NVY J;  2CV1 A;  1W0T A;  4NHJ A;  3UEQ A;  2FBI A;  3BR5 A;  2F48 A;  4FT8 A;  3PUB A;  1FYK A;  2Z1D A;  2FRH A;  3ZQQ A;  3TO7 A;  2ZNY A;  1MMS A;  2M5W A;  2P6T A;  4IHT A;  5FGM A;  2GZW A;  3K4M A;  4A6D A;  1F5T A;  1ZRE A;  4EGY A;  1OMI A;  4YII A;  3R61 A;  1KGS A;  1R0K A;  3M7G A;  2E1C A;  2JSC A;  3A01 B;  4KIG A;  2K9L A;  4HEA 2;  1VQK I;  2UWM A;  2O9L A;  2V9K A;  4K5M A;  1R1V A;  4BGD A;  4ESB A;  3S17 J;  2F5C A;  2K5C A;  3FUI A;  3HIF A;  3ZQI A;  5IYC J;  3JCU C;  1H9G A;  4C9Y A;  2Y48 A;  3JAM K;  1U9N A;  3DFG A;  1P4X A;  1RET A;  4J19 A;  1IUF A;  3ECH A;  1S5L C;  2E1M C;  1PP7 U;  4MEX F;  3FXU A;  2O7O A;  1STZ A;  3RQ4 A;  4RB2 C;  1BR2 A;  2R5Y B;  2L01 A;  1SFU A;  1MGT A;  2JPB A;  2JRM A;  3P5J A;  1JUS A;  1FYM A;  2YX4 A;  3LSH A;  2CQ7 A;  2COB A;  5AEN A;  2X9D A;  1RP3 A;  1GV2 A;  3PSF A;  1B72 A;  2KMU A;  1WJA A;  4CHU A;  5J8C A;  4GYI A;  4HLX A;  2L54 A;  3U9G A;  4XRS A;  3S1R J;  4CUG A;  4RGU A;  3GTP J;  3BCA A;  3BR2 A;  1A6Q A;  1E3P A;  4HF0 A;  4CIC A;  1BR4 A;  3DLL F;  1R00 A;  3L2R A;  4HYE A;  1YFH A;  3DV8 A;  3E6C C;  1W5C C;  2VOD A;  3CCR I;  4FX0 A;  1I3A A;  5B5E C;  3R6S A;  3QOP A;  4OU0 A;  2JV7 A;  3B02 A;  3C2B A;  4G7O F;  1S46 A;  2NVU B;  3ZQF A;  2DA4 A;  2DO7 A;  3S3M A;  3HHH A;  2E71 A;  4EM2 A;  2HKO A;  3AAF A;  4G7H F;  2JA7 J;  5FRM A;  1L0O C;  2KT0 A;  3I58 A;  5JR3 A;  2Y1E A;  3IH2 A;  3CCE I;  1Q0L A;  2Z3Y A;  2CW8 A;  4EM1 A;  4YIF A;  1FBQ A;  1FP1 D;  1P6R A;  2K9M A;  4RAG A;  3H35 A;  5CQG A;  1HKT A;  2A5Y B;  4F92 B;  4XN5 A;  2KLO A;  2HZD A;  3A01 A;  3ZQG A;  3J7A Y;  6PAX A;  1JTX A;  4BEH B;  4L9J A;  3CF2 A;  2X1C A;  1WSU A;  1ONN A;  2L7Z A;  5BS6 A;  3E0J B;  4XBF A;  3QP6 A;  3UKG A;  4QSH A;  4N9I A;  2NNN A;  3FZV A;  1KON A;  4D0P A;  1BW6 A;  2QBY B;  3G1O A;  3FTU A;  1QQI A;  3OYG A;  5HOO A;  1YQA A;  3HUG B;  1REP C;  1Y8R B;  2M8G X;  1HSJ A;  2RDP A;  2W82 A;  3QPT A;  3FUF A;  2F4O B;  1UHM A;  2Q0O A;  5LD2 C;  1ETX A;  4JK1 X;  3FUJ A;  3KP7 A;  5FKN A;  2Y9Y A;  1R58 A;  2VQH A;  4DYQ A;  2D1V A;  1OCT C;  1F36 A;  5H20 A;  3LAP A;  1TC3 C;  2KPM A;  1DGW Y;  5DS9 A;  1RUN A;  3TGN A;  2NRA C;  3UNG C;  2Y1F A;  2FMY A;  3BJ6 A;  4BJ6 C;  3HG9 A;  1FLI A;  5FLX K;  2HOE A;  3B3B A;  2Y75 A;  4RAZ A;  3VPR A;  2QWW A;  3TBI A;  1NK3 P;  3KFW X;  1J75 A;  3H36 A;  2X6O A;  4GAA A;  4PFO A;  2E36 A;  1D8J A;  5IP9 J;  2V1N A;  3KYD B;  4IHY A;  1UHW A;  2WY8 Q;  2ZSI B;  5IOY A;  4IPA A;  1ZGA A;  5JVT A;  1LKX A;  2L9V A;  1O3T A;  2OCC H;  1CGP A;  3JT1 A;  2TRT A;  3FMQ A;  3GLX A;  5D5U B;  4PW4 A;  4UUT A;  2DMN A;  1LJ9 A;  5LEK A;  2VE9 A;  3SDG A;  1IRF A;  1TBX A;  2FE3 A;  4CA0 A;  1ETV A;  3LST A;  3V42 A;  4FIS A;  3VSK A;  5EGO A;  5DM6 F;  2B63 J;  4PVB A;  2WV0 A;  1XSD A;  4C3J J;  3RZO J;  2R7O A;  1QBJ A;  1X3W B;  4ZW5 A;  3LQR A;  1N75 A;  1XD7 A;  4D5F A;  1MDM B;  2IT0 A;  1Y56 A;  3OL3 A;  3P9I A;  5DUI A;  1VQO I;  4EVI A;  1ZR4 A;  1UST A;  1YX3 A;  2ZSH B;  1IRX A;  4ARF A;  3TOB A;  1OLT A;  4S05 A;  4BQA A;  3AU8 A;  1ZTR A;  3J7Y J;  3GO5 A;  4KN7 X;  5EDN A;  1IJW C;  4B43 A;  1Y1V J;  5FJ8 J;  3M07 A;  3MMY B;  4BKX A;  1RI7 A;  3E7L A;  2R7Z J;  4KIS A;  1MH4 A;  2J5P A;  3COA C;  3BC8 A;  2XV4 S;  5ICF A;  3HRU A;  1D1A A;  4XLP F;  2NNY A;  1EKE A;  3B34 A;  2XAQ A;  3GEZ A;  3U1D A;  1SAX A;  2EIJ H;  4ZW7 A;  5KAI C;  2XGE A;  1GXQ A;  3H1C A;  5D8L B;  1HW2 A;  3VYT B;  4XSX F;  2XPY A;  3HPG A;  4HZF A;  5LBQ A;  4RBO A;  1TZL A;  4XN1 A;  1SC7 A;  3B2X A;  4L5J A;  2WPG A;  2HYF A;  5H6R A;  4OIQ F;  5M5W J;  2L4A A;  5ICG A;  3L09 A;  3HC7 A;  3CZL A;  3FUE A;  3EET A;  2DA1 A;  2MD0 A;  2R72 A;  3A1Y A;  5F64 A;  2Q8K A;  2B7E A;  3FXM A;  3QOD A;  3CC7 I;  3ASN H;  1D0X A;  1WI9 A;  4AIK A;  2QJ1 A;  2XPZ A;  3OYH A;  4CYD A;  2WZF A;  1B6A A;  4R8H A;  1QGP A;  4M72 A;  1JE8 A;  3OYL A;  2FNP A;  2O5R A;  1D3Y A;  2GTQ A;  2OAZ A;  3KP3 A;  3FUD A;  2YR2 A;  2Y69 H;  4FX4 A;  4O3M A;  1YLF A;  2EQR A;  4EQQ A;  4M71 A;  3OS0 A;  3SEQ A;  5EG0 B;  3QJX A;  4B3A A;  4I7H A;  5F1R A;  3Q0V A;  1IGN A;  5D5W B;  3AG2 H;  1BR1 A;  4X0G A;  2VBX A;  3V8J A;  5TJJ A;  3DBR B;  2JT1 A;  3R60 A;  2GIZ A;  4FE7 A;  3HZJ A;  3TED A;  3E97 A;  1R71 A;  1H19 A;  1PUF A;  1HW1 A;  1A36 A;  1MDM A;  2VJJ A;  4R5X A;  3F0C A;  4LJZ F;  1J5Y A;  3ABM H;  3S8P A;  1MW3 A;  2LR8 A;  4II3 A;  2BZT A;  4BH9 A;  2FJ1 A;  4GGG A;  1FY7 A;  1TL8 A;  3DCF A;  1T39 A;  2CJJ A;  1U78 A;  4ZW3 A;  2XKO A;  1Z6T A;  3DKW A;  2CQX A;  3HGY A;  3MKL A;  1BC8 C;  2A6H F;  3K4B A;  4HOB A;  1HKS A;  4XKW A;  2QVO A;  4Y17 A;  2DCE A;  4Z2Y A;  3WTZ A;  3V7C A;  3N05 A;  4I99 C;  2HPT A;  2GA1 A;  3ZN1 A;  4C2M J;  1K78 B;  2GXA A;  5EZG A;  4EJT A;  2FFL A;  2OPT A;  3EQL F;  3LSG A;  2VOP A;  4EEF G;  3BQY A;  3BG9 A;  1W0U A;  3HOT A;  4PJL A;  2XAS A;  3D5L A;  2STW A;  3CO6 C;  4RM3 A;  2HVS A;  3W2V A;  3NQO A;  3CZG A;  4N9H A;  4A03 A;  1DDN A;  3LL7 A;  1FOX A;  2KJB A;  4MS6 A;  4BE2 A;  4AYS A;  3KP5 A;  1OYY A;  1QVU A;  4IF4 A;  4OWR B;  2HVR A;  4QTR A;  3GZN B;  1WGX A;  2XDV A;  3L2U A;  4A3D J;  2FUG 2;  1AKH A;  1AU7 A;  2PGG A;  3J7Z I;  1XB4 A;  3BDD A;  3FUM A;  5DDG A;  3EUK L;  2DYS H;  2IEK A;  4CO8 A;  4BXU A;  2CV0 A;  3EDP A;  4GDF A;  4MKT A;  4LG0 B;  1WVR A;  1HKQ A;  1MBE A;  2UXX A;  4A0Y A;  2HQN A;  5L3F A;  2Y9Z A;  1QU3 A;  2KRF A;  3FDY A;  1QVT A;  2CV2 A;  3DBH B;  2DTR A;  3U9W A;  3ZMT A;  2JJ7 A;  2DK5 A;  1X2M A;  4ZYA A;  3RI4 A;  2DJN A;  3QWL A;  1BBY A;  1RKW A;  4NNJ A;  1BI2 A;  2V1U A;  4Y6P A;  3ABT A;  4IZZ A;  1HCR A;  1FSH A;  4A69 C;  5LHI A;  4ZJZ A;  4UUS B;  1YG2 A;  2Y31 A;  2JD0 A;  4FCA A;  3SZT A;  2FBH A;  3FMR A;  3A02 A;  1X1P A;  5JLW A;  4JQF A;  2LKP A;  1VQP I;  3GUD A;  4A3M J;  3CZ6 A;  4CZZ A;  4QME A;  1MVY A;  1P4W A;  2MAO A;  1JUM A;  3NWT A;  3RTR A;  3Q9S A;  1QZY A;  1TW3 A;  3FXJ A;  3JW4 A;  4XKB A;  2R70 A;  3C3W A;  2BHY A;  2QF7 A;  1SD6 A;  4PK4 A;  4UXN A;  3I59 B;  3DLA A;  5J4Y A;  2E1M B;  3CCL I;  2FF4 A;  2V7F A;  5DV5 A;  2DFH A;  5B3S H;  3FHE A;  5DYF A;  4AVZ A;  3OYE A;  1X3U A;  5LGU A;  2WZG A;  2XPV A;  1I1S A;  4N0B A;  5FB2 A;  5LEJ A;  1IZ1 A;  5C4X J;  2LY9 A;  1YX5 A;  5LGT A;  3VVM A;  2X4H A;  5FD6 A;  2CQQ A;  2Y2Z A;  3CCU I;  1JUP A;  1O57 A;  2W85 A;  5D4S A;  1V5E A;  2M1B A;  2RVC A;  4LD5 A;  5CVR A;  5D6F A;  1JKQ C;  2IVM A;  4U0W A;  2K7L A;  5HLG A;  2C6Y A;  1FJL A;  3WQS B;  1J7K A;  2JWT A;  2F6C A;  3ANN A;  4JYK A;  4M3D A;  2K3F A;  2EIM H;  4D7M A;  2HGC A;  4NUB A;  2HYG D;  1MW2 A;  2P7C B;  3OSF A;  3O3K A;  4DOZ A;  2CWE A;  2DLL A;  1MBK A;  1JT0 A;  1S8N A;  2QYO A;  1YW9 A;  3OOU A;  2OD5 A;  4OOF A;  3Q0U A;  3I71 A;  4OIO F;  3SFI A;  4IXA A;  3K1M A;  5AON A;  1WCM J;  2L3D A;  3K4J A;  1H8A C;  1FZP B;  3J7A O;  2COM A;  1U0J A;  3OYB A;  1JHF A;  4IRI A;  2F5D A;  1Z3X A;  2IA1 A;  3QYF A;  4HG2 A;  4LIV A;  3L1P A;  4ZZL A;  2DPU A;  4I02 A;  2PMZ N;  1JTY A;  1TWH J;  3S32 A;  2JA6 J;  4A3G J;  4E7Z A;  5E1W A;  5F0F A;  1BW5 A;  2K02 A;  4HX7 A;  1BI1 A;  1Y6I A;  3FU5 A;  1N25 A;  1D0Y A;  2XIG A;  4RMN A;  2AHQ A;  2H94 A;  5FRO A;  3R0A A;  3HSF A;  1ZAR A;  3A14 A;  5C44 J;  1N78 A;  3CUQ A;  4I01 A;  1LEB A;  4DJA A;  1YI2 I;  4CCN A;  3IKV A;  2ME0 A;  4MFE A;  1Z1D A;  2R7R A;  3R0J A;  4Q5S F;  2EIL H;  4MEY F;  3LSK A;  3NEU A;  4E7J A;  4ZQT A;  2O8K A;  1S29 A;  2ESH A;  5F6F A;  3ZHX A;  3IHU A;  5HLT A;  3M8E A;  3DEW A;  2QCO A;  1FP2 A;  1OCZ H;  2W4S A;  2A68 F;  2KRC A;  4NB5 A;  2CQN A;  3FK7 A;  3OS2 A;  1Y39 A;  4XQF A;  2Y0S N;  4IL6 C;  2AQE A;  1R5H A;  3HRM A;  5LFA A;  4KIB A;  1G2H A;  3TMO A;  3CLO A;  2EWN A;  1HXD A;  5K5R A;  4XLN F;  5CJ9 A;  2A07 F;  1VQ8 I;  3RJP A;  2DMQ A;  1QPM A;  1ZH5 A;  3SYT A;  4R7L A;  4BJ5 C;  4CYC B;  4XN4 A;  1BOB A;  4M6V A;  3PQJ A;  3CCM I;  3CO7 C;  5D6E A;  4BE1 A;  5L3B A;  5ILS A;  9ANT A;  1Q0Q A;  3J80 Z;  2LD5 A;  4Y67 A;  5DCM A;  1XGO A;  1FBU A;  3PNY A;  4QPO A;  5D8K B;  5FLM J;  4IHS A;  1YE9 A;  1F1Z A;  2OUM A;  3LAJ A;  3JRB A;  1Y0N A;  2LF8 A;  3RYR A;  1XDS A;  3KE2 A;  4LMY A;  1IDZ A;  2G7U A;  2Y0M A;  3CIA A;  2BGC A;  1W36 D;  2QUF A;  2IXS A;  1XMX A;  1YO5 C;  4R5T A;  2KIM A;  2J5O A;  2UZK A;  1LEA A;  1MMG A;  3BJO A;  3FBI B;  3QU6 A;  1S6L A;  5IY5 H;  2P6S A;  3KIO A;  3GCM A;  1USS A;  3D5S C;  4WXH A;  4ZX4 A;  2VPL A;  3SZG A;  1E3H A;  5FLX Z;  1YTY A;  2EFP A;  4DQ2 A;  4PU2 A;  1JXS A;  3FTZ A;  4OAY A;  5IP7 J;  5HNH A;  4EM0 B;  3HKZ N;  2EGH A;  5ERI A;  2X1E A;  3WU2 C;  4HNU A;  1TNT A;  3G1L A;  3MVP A;  4UB8 C;  1MW7 A;  1VQ9 I;  3IAM 2;  1JJ8 C;  3GYH X;  2E1N A;  3LMM A;  4IQJ A;  3WTV C;  2JN6 A;  1I1G A;  1LDJ A;  2CS3 A;  1KU3 A;  4F91 B;  4E7L A;  3CMY A;  2H6B A;  4E7K A;  4PSW A;  2QQB A;  1ONO A;  2WA0 A;  1DQU A;  4HX4 A;  5DUK A;  1I6X A;  2XSJ C;  3ZI0 A;  1AHD P;  2JUG A;  3H5A A;  4Y33 A;  3M1C A;  4WK8 F;  1IN7 A;  1PUE E;  2CG4 A;  1ZRC A;  5TIS C;  1UJ8 A;  5LLQ A;  4P96 A;  2BOL A;  2H1L A;  1V55 H;  4G6D A;  1T98 A;  2YU3 A;  3RIR A;  1MSE C;  4X6A J;  1B9M A;  3H92 A;  2EA4 A;  3L9F A;  2IPQ X;  2L4M A;  3JRH A;  1B72 B;  3QU3 A;  3TP3 A;  2HU9 A;  2W48 A;  2K9S A;  4PUS A;  4BAY A;  2P7V B;  4LIU A;  4CYC A;  4XOT A;  3RZD J;  2IW5 A;  3T8T A;  5DEQ A;  1QO0 D;  2M9H A;  2QKL B;  1A04 A;  2CFO A;  4G6Q A;  4J01 A;  4DBQ A;  3CCQ I;  4A3E J;  1DU0 A;  4ZDL A;  4HDV A;  2L2O A;  3CF5 F;  2DMT A;  3F3X A;  5JVG F;  1HLV A;  2VKH A;  4A3K J;  1J59 A;  3BJA A;  1VQ5 I;  2LKX A;  4ZDO A;  4B3X A;  1SVM A;  2HQR A;  3FM5 A;  1XGM A;  2KKO A;  3IRQ A;  2NVQ J;  2RAE A;  3U1K A;  1T08 B;  2YX7 A;  2M7A A;  3BLY A;  3EBH A;  4PSX A;  2A69 F;  1BI0 A;  2WAD A;  4M73 A;  4HDU A;  3ABL H;  2LF7 A;  2HPM A;  1WJF A;  4L2L A;  3CES A;  2GQQ A;  3VWB A;  2QKM B;  2R5Z A;  4KDP A;  1A5J A;  3JRF A;  2VC0 A;  2QM3 A;  3OYI A;  4ZTF A;  1X58 A;  2DDB A;  2MW8 A;  4D5C A;  2ECB A;  2AXL A;  1JGS A;  3CUQ C;  2FOW A;  4A5N A;  3JTG A;  1KU2 A;  3F6V A;  3HL2 A;  5E3N A;  5J1R A;  4BAC A;  2WC2 A;  1HS6 A;  1WZ2 A;  1LVK A;  3HOY J;  4BQQ A;  3L2C A;  3EYY A;  4N4N B;  2H8W A;  1J9I A;  5JFR A;  3DQV C;  3MKW B;  4BUP A;  2X51 A;  3JRD A;  1R23 A;  1SQM A;  2W7N A;  1EH8 A;  2E1O A;  2IGO A;  5DCF A;  5CQE A;  4Y15 A;  3ZMS A;  5F1J A;  2BY2 A;  4MNU A;  2VJ8 A;  4BE0 A;  2WY7 Q;  2VLA A;  2ZFU A;  2BY0 A;  4XLA A;  3S93 A;  1G3W A;  3TQN A;  1JGI A;  2R7T A;  3B7T A;  3HSE A;  3DTE A;  3JRE A;  2CW0 F;  2HWV A;  4XMV A;  2W25 A;  2E2I J;  1NTC A;  4JBA A;  2R7S A;  5J1Y A;  4L9T A;  4W1U A;  1OPC A;  1VTN C;  1RZ4 A;  1F43 A;  4XN8 A;  3W2A A;  4HW0 A;  1E2X A;  3LNQ A;  1KYW A;  4L9V A;  1ON1 A;  3SFZ A;  2QEX I;  5JC1 A;  1R49 A;  1O7F A;  3FXQ A;  1MBJ A;  3I3L A;  3K7A J;  4YEL A;  1MZB A;  4G7Z F;  2OTL I;  3LA3 A;  3JRI A;  2GXB A;  5E17 F;  3G4S I;  3F21 A;  1JT6 A;  2OA4 A;  1ZEL A;  2DFF A;  5F0H A;  4KP7 A;  1BL0 A;  1QHG A;  1D1C A;  2I5U A;  3LSP A;  3CCJ I;  4YFX F;  1WPK A;  5EGO B;  2M2E A;  2Q2E A;  1W4M A;  4EJO A;  2KRH A;  2OBP A;  1TQP A;  3FIW A;  3ERM A;  2WAE A;  3DF8 A;  3VOD A;  3GF2 A;  3L00 A;  3BY6 A;  4G9Y A;  3V7R A;  1R22 A;  4XNA A;  4GCV A;  3HTS B;  1TQI A;  1ZG5 A;  4C30 A;  4ESJ A;  4FLS A;  2AQF A;  4FQG A;  4NBQ A;  5FWQ A;  1Y8Q B;  5F0C A;  2XKP A;  5M3F J;  3DPL C;  1W5T A;  1NH3 A;  5BQT A;  3ZPL A;  4Y52 J;  1H9T A;  2VXZ A;  4ZQF A;  1TWA J;  2K86 A;  3CQZ J;  2W57 A;  3J80 K;  4P9U A;  4OMY A;  2I8D A;  2E7X A;  4MO7 A;  3I0T A;  4MQ9 F;  3AG1 H;  3FU0 A;  4WX9 A;  4A0Z A;  1FMV A;  2OZ6 A;  3SXY A;  2PUS A;  4AYB N;  2ZJR F;  2M0M A;  2O03 A;  3M8J A;  3GZ6 A;  1V3F A;  3WU0 A;  4XMX A;  4L0Z B;  5JHU A;  2FOK A;  2KIU A;  2MG4 A;  2VBW A;  1R1T A;  4GRI A;  5E18 F;  3W3C A;  3GFI A;  1RR7 A;  4K2E A;  3MZ8 A;  1YRN A;  1DGR M;  2Z16 A;  3C1D A;  1LFB A;  4BDY A;  4ENJ A;  1B9N A;  4MQV A;  2VJ5 A;  3HB9 A;  3ZGK A;  4EGZ A;  3TKY A;  3KP4 A;  2X1D A;  3AUA A;  3BTJ A;  1U8R A;  2DQM A;  4EJV A;  3I53 A;  1CF7 A;  3HOV J;  1EF4 A;  4CCJ A;  4ESF A;  1BJZ A;  3H9J A;  1ONP A;  2LY2 A;  2LFB A;  2H09 A;  2F5V A;  3CC2 I;  2L7M P;  5B66 C;  5LHH A;  3KLN A;  2KIQ A;  2VPR A;  2Y30 A;  3F8N A;  4RLF A;  4U0V A;  3OYM A;  5EF6 A;  3ZN0 A;  4KYW A;  5JI6 A;  3K1P A;  2EH3 A;  3V8K A;  1JGG A;  3DTK A;  3FTY A;  2MLG A;  4E7H A;  3DP7 A;  2I10 A;  4GFB A;  1SC5 A;  2ZB9 A;  1VQ6 I;  1MBG A;  1WH5 A;  2RGV A;  2EV5 A;  4D1Q A;  3B7R L;  4XIC A;  2YS9 A;  1MJA A;  4YEJ A;  1PVE A;  4XMT A;  1OQY A;  3VSL A;  4ZC3 A;  3TL4 X;  1YS6 A;  5D5X B;  1PUF B;  3CMM A;  3S2H J;  2OC6 A;  1LNW A;  2M0C A;  1B59 A;  1EH6 A;  3NAR A;  4M9S A;  1WJC A;  5CLS A;  5CVU A;  2M34 A;  5D5V B;  2NOJ B;  2ZXG A;  1MMD A;  4OIR F;  2L9S A;  4ABZ A;  3HOX J;  1UEL B;  3REO A;  1N77 A;  3AFH A;  3E6M A;  1JHH A;  4ZQG A;  3K9T A;  3JSP A;  4CSW A;  3N97 A;  4ZH4 F;  3CZE A;  2EZI A;  2X6W A;  1ZK8 A;  3CDL A;  3H9Q A;  2ZJ2 A;  4R5V A;  2XGC A;  3KP6 A;  2DQ6 A;  2JZY A;  5LRR A;  2RC4 A;  2IS2 A;  1RPW A;  2BXZ A;  3ASO H;  5FO5 A;  3DBL B;  1Y0U A;  2DMP A;  4ZYD A;  2V9P A;  3FUH A;  3B2P A;  5BOX A;  1BI3 A;  1Z6R A;  3QQA A;  2C82 A;  2V9V A;  4BJT A;  4UV9 A;  3AKZ A;  2C5Z A;  4XOR A;  4LB6 B;  1RUO A;  5K5Q A;  1FMW A;  1XMA A;  1VF9 A;  3BCB A;  4DZJ A;  1O3Q A;  3H0G J;  3P7N A;  2QQA A;  3Q5F A;  4XKV A;  2R7X A;  3OYA A;  2O0Y A;  3QPL A;  4W97 A;  1T1S A;  1GVJ A;  1R5G A;  5B1B H;  1HW5 A;  2Y1C A;  2M4G A;  3K6G A;  4DGW B;  1AKH B;  1A31 A;  1D1B A;  1FPQ A;  1X19 A;  1NK2 P;  1OCO H;  2D45 A;  1Z21 A;  3FTS A;  2ZC2 A;  2O8X A;  5LRS A;  2IRF G;  2XF5 A;  5J47 A;  1LFU P;  1JVS A;  3WTY C;  3LOC A;  1LDD A;  2Y1G A;  2PG4 A;  4ZQE A;  3S16 J;  4LUP A;  3KYL A;  4B1R A;  3ISP A;  2RNG A;  2BV6 A;  4QIW N;  2MH9 A;  1WKM A;  4XO5 A;  2M3A A;  2XAG A;  2RN7 A;  3NAU A;  1FIP A;  2L0K A;  3TO9 A;  3KPH A;  1R6R A;  3A0H C;  1ZS2 A;  1GVD A;  1LPQ A;  2YU9 J;  2BY1 A;  3O6B B;  2XAU A;  1ZR2 A;  2LVS A;  4Q47 A;  3GTK J;  4DYR A;  3LFU A;  4EJU A;  1SFK A;  1MH3 A;  2RQP A;  1VQM I;  4I76 A;  3WGG A;  4EAT A;  1LQ1 A;  4WF2 A;  2JPC A;  4A3C J;  5BMZ A;  3LA2 A;  2KJC A;  1IDY A;  5ILV A;  2Y1D A;  1U9O A;  4BY7 J;  3OYJ A;  2CUJ A;  1LB2 A;  3G73 A;  3ZMZ A;  3ZP5 A;  3IWF A;  2EFN A;  1VQ7 I;  2HDW A;  4II2 A;  3CDH A;  1YOV B;  3EPZ A;  2XAH A;  5KNL A;  1R4M B;  2LNB A;  3T1B A;  2JCV A;  1U3E M;  1YYV A;  3RKY A;  4Z6Y A;  5BNG A;  2R4G A;  3X2Q H;  3FKI J;  2W00 A;  2A3S A;  2IGN A;  2ZBK A;  3I5U A;  1ZQ3 P;  3BT9 A;  2DA3 A;  5JNL A;  1BN5 A;  1K6O A;  5K7H A;  3DXJ F;  2HS5 A;  1MJ9 A;  4GXO A;  4D9J A;  3HOU J;  1R0L A;  2ZME A;  3JSO A;  4E70 A;  1LFP A;  2XVC A;  3PSI A;  3H5N A;  2LG4 A;  5E8I A;  1HST A;  2JTV A;  4Y6R A;  2XF6 A;  3FM3 A;  4AR9 A;  2Z5U A;  4G6T B;  4XSZ F;  5CVV A;  3BZK A;  3QRF F;  3Q0W A;  1LUJ B;  4F52 A;  2HQ5 A;  1W36 C;  4A5M A;  1X1B A;  2A05 A;  2MBF A;  5GAD J;  3FH8 A;  4F55 A;  3CJR B;  1OFC X;  2MA3 A;  3K2Z A;  1T38 A;  4QHP A;  4BXX J;  1IXC A;  4DW6 A;  4HBL A;  3W6J B;  3BR0 A;  3F8C A;  4RM2 A;  2HQA A;  1DUX C;  4IO9 F;  1ACI A;  1UFM A;  4HNT A;  4G94 A;  2D2W A;  4UUV A;  1W5S A;  3M3Y J;  4M6X A;  4Y13 A;  1DPR A;  4B8X A;  4UVA A;  4V2F A;  1X2N A;  2ISZ A;  3ZXS A;  1GW6 A;  5H2F C;  3QAH A;  5ILU A;  4JX4 A;  2ADU A;  3BWG A;  1YW7 A;  5E20 A;  3I4N J;  2F4M B;  4E7S A;  2CUF A;  2WB1 N;  2BY3 A;  3CME I;  2V79 A;  3HXL A;  1ZLJ A;  4M9X A;  2VJ4 A;  4RLQ A;  2AXT C;  2YSR A;  1XSX A;  4E4H A;  4FTH A;  3WHC A;  1MIJ A;  3SDB A;  1I50 J;  2P5K A;  3C2H A;  3S14 J;  5C4J J;  1XG1 A;  2FU4 A;  3QOE A;  3Q44 A;  1EV7 A;  1XGS A;  4UB6 C;  3CHO A;  4TV7 A;  1K4S A;  2ICW G;  1RKT A;  3CDI A;  2LKS A;  2LBF A;  4YIR X;  4BBS J;  1IRZ A;  4HST A;  4E6K G;  2XF7 A;  2P81 A;  3CUQ B;  4IRG A;  5HS7 A;  4RVB A;  1V5F A;  1VFC A;  3HKZ A;  2HDC A;  4FLQ A;  4BU2 A;  4BHP A;  1ZRF A;  5ICC A;  2GA2 A;  4LLL A;  2NXN B;  4LK0 F;  2LY1 A;  4IEJ A;  2GM4 A;  1YS7 A;  2MSY A;  3OIP A;  3I4M J;  2A61 A;  3GBG A;  2PMH A;  1YJN I;  2HXO A;  2D1H A;  2FBK A;  3RPU D;  3MZY A;  5GPC A;  2XAF A;  3G71 I;  3PUU A;  2PEX A;  3FH7 A;  4KIF A;  2ELH A;  2R7D A;  4KNY A;  3S3N A;  1KQ9 A;  3HBL A;  4XK4 A;  5BPI A;  4OIP F;  2ZFW A;  4BHB A;  2W24 A;  2VOO A;  3ZR8 X;  1IW7 F;  2E35 A;  2WV1 A;  4RAY A;  2HDD A;  2RJI A;  1X1C A;  1IAW A;  1SMY F;  3IH4 A;  1AA7 A;  1ETY A;  2L5Q A;  4IKF A;  4BQN A;  2W1O A;  2XUB A;  5J8F A;  2ZKZ A;  4IOA F;  4XN2 A;  4B48 A;  5DCM B;  1Z05 A;  2JMW A;  2KQR A;  2VQC A;  4KT6 A;  3BG7 A;  4A2U A;  2MC3 A;  4BL0 B;  4JND A;  2DQL A;  2VL8 A;  3K4K A;  4PJ0 C;  4WXC A;  5GAH J;  3ERE D;  1GT0 C;  1EH7 A;  2X0L A;  1RIO H;  2CYY A;  2IP2 A;  5B1A H;  4K5P A;  4XO4 A;  1IN5 A;  2K4J A;  2IS1 A;  1SAU A;  2KL4 A;  2JA2 A;  2EBI A;  4C3H J;  2EA2 A;  4CCK A;  5DD4 A;  3HJE A;  1BOA A;  3I55 I;  3C7J A;  4AR8 A;  4A3I J;  1NHA A;  3PFY A;  3SHF A;  2LDU A;  2PBI A;  4YFN F;  4DIQ A;  4K5L A;  3HEF A;  1GV5 A;  3KEY A;  3KZI C;  2W84 A;  5GAG J;  2K4B A;  1GHC A;  3ZHZ A;  3BQZ A;  4HPQ A;  3H9G A;  1MBH A;  3LSR A;  3HDD A;  3O2P E;  1WFX A;  1DPU A;  3WE3 A;  3OIO A;  1JKP C;  3GFL A;  5J6X A;  5CVJ A;  2A6E F;  3RKQ A;  4L0Y B;  2DXI A;  2GXG A;  4DYC A;  4QPQ A;  2DA2 A;  5F27 A;  1RR8 C;  2DOA A;  3FHN A;  2K9Q A;  2CFX A;  1Q1H A;  4FLO A;  2JA5 J;  3AL0 C;  2M4K A;  2RV8 A;  2JK3 A;  4P55 A;  2DOD A;  3UR3 C;  3FUK A;  3E5X A;  2B61 A;  2F2E A;  2MAP A;  2K40 A;  4XN7 A;  2VXD A;  1OCP A;  2M30 A;  4L9N A;  3F6O A;  4UVC A;  2DU9 A;  4J3B A;  5IT9 Z;  4HQE A;  3ZQ7 A;  3A06 A;  1K6Y A;  1KYZ A;  2E60 A;  3HPH A;  1B8I A;  2FQ3 A;  1SD4 A;  4U7D A;  4XMU A;  2ZME C;  3B6C A;  2B0L A;  1B4A A;  1W7P D;  2DT5 A;  3HTU A;  1E3O C;  4BHC A;  3WTW C;  3GTO J;  3BPV A;  2QQ8 A;  3W6K B;  3A4C A;  4LGW A;  3TW6 A;  2MYS A;  5CYV A;  1UMQ A;  4KUM A;  2K27 A;  3W2W A;  4YG2 F;  3ROU A;  3G2B A;  3A2K A;  2PQ8 A;  3WQR A;  5HLI A;  4CH7 A;  4B4C A;  3GTM J;  3I4P A;  1ITY A;  1MW1 A;  2EZK A;  4RB0 A;  3FXL A;  1T1R A;  1BJA A;  1PYV A;  3PM1 A;  3BTI A;  3AG3 H;  2ZCW A;  2P0W A;  3GZ5 A;  2VC1 A;  1D0Z A;  1FX7 A;  3P9C A;  1FNN A;  4RAF A;  3GFM A;  1AWC A;  5JAZ A;  4I09 A;  1JG9 A;  3I64 A;  2M87 A;  2O3F A;  1HDP A;  3K4C A;  3FMS A;  4HQM A;  2PJR B;  2XQ0 A;  2BYV E;  1ERD A;  2EPF A;  1S7A A;  3KEO A;  4PJN A;  2RQQ A;  1Z3Y A;  4HF1 A;  2R59 A;  1R7J A;  3V7S A;  5FKK A;  2MGQ A;  5J4V A;  4HV5 A;  3IIE A;  3MN2 A;  1UHS A;  1S7O A;  4I2O A;  2KIF A;  1FYL A;  1JI8 A;  1SD5 A;  2HVQ A;  2R5Z B;  4ASN A;  3BP8 A;  3PUF A;  4IHW A;  3B37 A;  3KED A;  3PJR A;  3LWF A;  2QSH X;  2F5E A;  4OAZ A;  4CDG A;  3ZQL A;  2PJP A;  4XMZ A;  4XR6 A;  1OKR A;  3WOD F;  1P2F A;  1R5I D;  4FET A;  2CUZ A;  4KFC A;  4C2U A;  1IV6 A;  3HRS A;  1G5A A;  2DTZ A;  2HPO A;  5EEG A;  2GWR A;  5IYB J;  2TDX A;  2CGP A;  2PI0 A;  1NG7 A;  3Q43 A;  2FEZ A;  3ONQ A;  2FD5 A;  3K4L A;  4V2G A;  1HOM A;  3ABU A;  3O8G A;  1T95 A;  4BXF A;  1QRY A;  1QPI A;  3L2Q A;  3ESW B;  5EZH A;  5FKL A;  3V8L A;  1G8X A;  3HGG A;  2VKE A;  2L7K A;  4OOI A;  4CCM A;  2R7V A;  4A3B J;  4ZYH A;  3K69 A;  4HLY A;  2PLY A;  4Y7N J;  4XKC A;  5L3C A;  2DPD A;  4B47 A;  1J0R A;  1U8B A;  3RC8 A;  5EV7 A;  1WH7 A;  3PIP F;  2CH0 A;  1BM9 A;  2VI6 A;  1U5T A;  2KDO A;  2OU2 A;  5FD5 A;  3WTS C;  3MFK A;  4XRS G;  1Z77 A;  3HRT A;  2ACJ A;  3DKY A;  1XSV A;  4MHG A;  5KK1 A;  3K0L A;  2ME6 A;  2VT2 A;  1K83 J;  1H3L A;  1S72 I;  5CVI A;  4LLG F;  2IBD A;  3L2W A;  3OYK A;  1L3L A;  4GO1 A;  1FC3 A;  1TW2 A;  3VOE A;  5K1Y A;  3K4N A;  4RB3 C;  1P9Q C;  3CHS A;  3KZY A;  4KJZ A;  4A6E A;  2NYX A;  3FHZ A;  2GOM A;  2NS8 A;  4HV6 A;  5E3O A;  2BVM A;  2ZJQ F;  3KZZ A;  3TDZ C;  3CC4 I;  2Q2E B;  1YHQ I;  2P5V A;  2PJR A;  4M3G A;  3KEQ A;  2V1X A;  1H0M A;  2VUM J;  1ONV A;  5D4R A;  2DYR H;  3I9V 2;  2IA0 A;  2ZO4 A;  3GFJ A;  2ID6 A;  3IV5 A;  2JCX A;  1TTY A;  2OJE D;  4BDZ A;  2P5L C;  2DA7 A;  4UVB A;  5IOZ A;  5HDG A;  3RKW A;  3CP8 A;  3RPU A;  4ZX3 A;  3CZK A;  5L3E A;  1MSF C;  4AR1 A;  3H3V K;  2H8R A;  3SJM A;  3KCC A;  4NC7 A;  2V4J C;  2R7Q A;  5A2Q Z;  4Y3O A;  5DYM A;  5E3M A;  5M3M J;  4XO3 A;  1S7E A;  1R1U A;  2LRE A;  2XRL A;  1KU7 A;  5F08 A;  1IUY A;  4P9F A;  5K7Z A;  5HS8 A;  1VQ4 I;  2JSP A;  3QPH A;  5KVR A;  3JSZ A;  2PFB A;  3DTI A;  1JKO C;  2E2H J;  1ON2 A;  3WTU C;  1OYI A;  5C3E J;  3JR9 A;  1E0E A;  3E3V A;  3OY9 A;  5TRD A;  2B9S A;  3U2R A;  4HSR A;  1XMK A;  5H6Q A;  5GTI C;  4IHV A;  3I54 A;  4EJW A;  2QEN A;  2DFI A;  2BBY A;  1DP7 P;  1TT5 B;  1YRN B;  3HHG A;  2JA8 J;  1G6N A;  3GXO A;  3R4K A;  4A93 J;  2NS0 A;  5DD8 A;  4U87 A;  3F8M A;  2HFH A;  2X85 A;  2IS4 A;  3ML6 A;  2H1K A;  2BXY A;  4P1W A;  3S1N J;  1CF7 B;  3K70 D;  3FK6 A;  2JQ7 A;  2PL5 A;  3RYP A;  3AU9 A;  1EA3 A;  4PFP A;  3Q3S A;  1KZH A;  1R4N B;  1X3Z A;  4RDU A;  3H5R A;  2ZXJ A;  3D0S A;  1IG7 A;  5HDN A;  3IWZ A;  5HVQ C;  2CUE A;  4UV8 A;  1GLN A;  3VVL A;  3M9A A;  4A12 A;  2HXI A;  1G4D A;  1LE8 A;  2LMD A;  4U88 A;  4CGZ A;  2FX0 A;  4IOC F;  1MD0 A;  1WJ5 A;  1R9T J;  5FLV A;  1VND A;  3C18 A;  1G3T A;  1Z9C A;  3DU5 A;  3OWT A;  4B09 A;  2DW4 A;  3ZQC A;  3VYS B;  2LRD A;  4FCY A;  4J00 A;  1K79 A;  2K9N A;  2GLO A;  2K85 A;  4HX8 A;  4BBR J;  2O6G E;  5IT9 K;  2GBY A;  3OR1 C;  5IT3 A;  4UHT A;  3CXB A;  1HDD C;  1LVA A;  3MEX A;  4ZQH A;  2KDZ A;  1UG0 A;  3KP2 A;  5DM7 F;  2FXA A;  2VKD A;  1X1D A;  2R3S A;  2QSG X;  1O4X A;  4I98 B;  2LLK A;  3OYC A;  2FNA A;  2F5F A;  2NVX J;  1W7P A;  2ZJP F;  5JBI A;  1WWX A;  2NVT J;  4ETS A;  4S0H B;  2BEO A;  2XHK A;  1WJB A;  3BOQ A;  1KQ0 A;  5E1X A;  4JP0 A;  4XLC A;  4ZYE A;  2JRT A;  2N8G A;  1PJR A;  2MD5 A;  1TNS A;  1WQ2 A;  1OR7 A;  2VBY A;  2XB5 A;  3MWM A;  2Q1Z B;  1IC8 A;  1U5T C;  4PZJ A;  4JX5 A;  4KA4 A;  1FT9 A;  2DOF A;  2Z2S B;  3MCZ A;  3UER A;  2GOX B;  3L7W A;  4IQ4 A;  4ZZD A;  4N4O B;  3WU1 B;  2V6C A;  4GYG A;  4ZW8 A;  3S2D J;  2DFE A;  3PO2 J;  3G1M A;  2OV7 A;  3K1N A;  1XC5 A;  3CCV I;  4AIJ A;  2LOO A;  4ZW6 A;  3KET A;  2AS5 F;  1IV8 A;  2PMU A;  2FSW A;  4QPE A;  1UG2 A;  1FOY A;  3R0I A;  3GTQ J;  2WAQ N;  4CCL A;  3WGH A;  3CHQ A;  4Q4Z F;  3VEP A;  1SFX A;  1TLH B;  2IAI A;  1SFE A;  3DEU A;  1OCR H;  2ZXH A;  2R5Y A;  2VT3 A;  2O7G A;  1YIO A;  3IH3 A;  4LB5 A;  4L5E A;  1Q0H A;  3F72 A;  3JRC A;  2ETH A;  4XL9 A;  2FML A;  2KFD A;  3ZMV A;  4QIR A;  3TO6 A;  2OF7 A;  4WCG A;  3KYC B;  3ULQ B;  1ETQ A;  1FWZ A;  2WB1 A;  2MC4 A;  3IUO A;  1FSE A;  4H4K C;  5L3D A;  3WGI A; 
#chains in the Genus database with same CATH homology
 2W4S A;  2KRC A;  3K4M A;  4RM2 A;  2HQA A;  4FAS D;  3OS2 A;  3OYF A;  4XQF A;  3OMY A;  2AQE A;  5LFA A;  1R0K A;  4HNT A;  3OL4 A;  3TMO A;  2IGM A;  1S9H A;  2K9L A;  4HEA 2;  2UWM A;  4R7L A;  2UUZ A;  2V9K A;  3SYT A;  4K5M A;  3AL0 B;  1GW6 A;  3ZXS A;  4BJ5 C;  4XN4 A;  1BOB A;  4BGD A;  2WAF A;  1NG6 A;  4BE1 A;  4ZN6 A;  2K5C A;  4E7S A;  3FUI A;  1Q0Q A;  2A6T A;  3HXL A;  4C9Y A;  4YRV A;  2VJ4 A;  4RLQ A;  4Y67 A;  3PNY A;  4E4H A;  4QPO A;  3MD2 A;  3SDB A;  4Q4I A;  1YE9 A;  2OUM A;  3C2H A;  5KCM A;  3QOE A;  2E1M C;  3Q44 A;  3CJQ B;  3ZHY A;  3CHO A;  3RQ4 A;  1BR2 A;  2VAS A;  3HOS A;  3CIA A;  2LBF A;  2ZXI A;  4HST A;  1W36 D;  4E6K G;  2XF7 A;  4E7I A;  4RVB A;  1V5F A;  2E5N A;  2IXS A;  3HKZ A;  3SEZ A;  4FLQ A;  4BU2 A;  3LSH A;  4R5T A;  5AEN A;  4BEH A;  1RP3 A;  4FLR A;  1MMG A;  3PSF A;  2LY1 A;  3FBI B;  1MND A;  2KMU A;  4BQO A;  1WJA A;  4LG3 A;  3KX2 A;  3OIP A;  3GBG A;  4XM3 A;  3D5S C;  4CUG A;  4ZX4 A;  3RPU D;  2VPL A;  3BCA A;  3PNT A;  3SZG A;  3PUU A;  2HPI A;  2JCY A;  3FH7 A;  4NC8 A;  3S3N A;  1BR4 A;  4PU2 A;  4F3Q A;  3L2R A;  4OAY A;  3FTZ A;  5HNH A;  3ZR8 X;  2EGH A;  2X1E A;  2RJI A;  1X1C A;  4HNU A;  2LYC A;  5BPP A;  1MW7 A;  1AA7 A;  4IKF A;  2L5Q A;  2JV7 A;  3IAM 2;  4BQN A;  4IQJ A;  3LMM A;  2JVH A;  2W1O A;  5DUL A;  4HRI A;  4R79 A;  1S46 A;  2CS3 A;  4F91 B;  4XN2 A;  3FUN A;  4B48 A;  4E7L A;  1TT0 A;  3EUA A;  4XLE A;  2KQR A;  2VQC A;  3S3M A;  4KT6 A;  3BG7 A;  4E7K A;  4PSW A;  4BL0 B;  4JND A;  1ONO A;  2WA0 A;  5JO0 A;  2VL8 A;  1DQU A;  3K4K A;  4XND A;  5FRM A;  4BS9 A;  2XSJ C;  3ZI0 A;  2JUG A;  3H5A A;  1SG7 A;  4Y33 A;  3M1C A;  2Y1E A;  1Q0L A;  4K5P A;  4XO4 A;  2IS1 A;  2CW8 A;  1SAU A;  2KL4 A;  2LBF B;  5CQG A;  2JA2 A;  2K9M A;  3H35 A;  2WBM A;  1VZ0 A;  2PMZ A;  2BOL A;  4CCK A;  4F92 B;  4XN5 A;  2KLO A;  2HZD A;  4AR8 A;  3J7A Y;  3PFY A;  4BEH B;  5HNF A;  4K5L A;  4DIQ A;  3KEY A;  2HU9 A;  2X1C A;  3CF2 A;  4PUS A;  1ONN A;  3QYE A;  4LIU A;  4XOT A;  3ZHZ A;  4HPQ A;  3E0J B;  3H9G A;  2QKL B;  2A5W A;  2DJI A;  2CFO A;  1WFX A;  1KON A;  1LDK B;  1X3W A;  4AU7 A;  2DT6 A;  4J01 A;  3FTU A;  4DBQ A;  5JHF A;  5HOO A;  3OYG A;  3B7S A;  3HUG B;  3FUF A;  3FTW A;  2W82 A;  4ZDL A;  2L2O A;  5LD2 C;  2DXI A;  3FUJ A;  4XON A;  4QPQ A;  2KZV A;  1OR7 C;  2DOA A;  2VQH A;  2Y0S A;  3FHN A;  2VKH A;  4Y4R A;  4ZDO A;  4FLO A;  2KPM A;  1DGW Y;  3PNV A;  4B3X A;  2F4I A;  3D5R C;  3AL0 C;  2M4K A;  2X6X A;  3UNG C;  3RCO A;  2Y1F A;  3FU3 A;  3RAS A;  3UR3 C;  3FUK A;  2M7A A;  2B61 A;  4BJ6 C;  3BLY A;  3HG9 A;  2VIX A;  2MAP A;  2K3P A;  4XN7 A;  2VXD A;  3EBH A;  3B3B A;  4PSX A;  4CCO A;  3TBI A;  2WAD A;  4J3B A;  1J09 A;  2HPM A;  2ELJ A;  4GAA A;  1WJF A;  4PFO A;  4L2L A;  3CES A;  3A06 A;  4Y6S A;  1K6Y A;  3VWB A;  2QKM B;  2E60 A;  3HPH A;  2V1N A;  4XMU A;  5KHD A;  3ANM A;  2WY8 Q;  2ZSI B;  2KHM A;  1LKX A;  3OYN A;  3OYI A;  1MNE A;  4ZTF A;  3LSI A;  3JT1 A;  4PW4 A;  3MKY B;  2BW3 B;  3A4C A;  1X4O A;  2MYS A;  4CA0 A;  3HL2 A;  4BAC A;  1HS6 A;  3V42 A;  3VSK A;  1LVK A;  3DKX A;  4PVB A;  3W2W A;  4OOE A;  2R7O A;  4BQQ A;  3G2B A;  3A2K A;  4ZW5 A;  3WQR A;  1N75 A;  2VQL A;  4N4N B;  4CH7 A;  4XN9 A;  1MW1 A;  5JMW A;  1T1R A;  2X6Y A;  3DQV C;  3MKW B;  4BUP A;  2X51 A;  1PYV A;  1SQM A;  1Y56 A;  3OL3 A;  1MW0 A;  2W7N A;  2P0W A;  1YX3 A;  2ZSH B;  1IRX A;  4ARF A;  3OYD A;  1OLT A;  2IGO A;  1D0Z A;  5CQE A;  1UAA A;  3AU8 A;  3S3O A;  3DU6 A;  2JVG A;  4RCV A;  4DPR A;  4B43 A;  5JAZ A;  3BG6 A;  1JG9 A;  1HA8 A;  3MMY B;  4BKX A;  3K4C A;  2VJ8 A;  2PJR B;  2XQ0 A;  4KIS A;  3NWS A;  4BE0 A;  1WJD A;  1ERD A;  2WY7 Q;  3BC8 A;  4PJJ A;  2VLA A;  3B7U X;  4PJN A;  2ZFU A;  2RQQ A;  1Z3Y A;  4XLA A;  3S93 A;  2R59 A;  3B7T A;  1D1A A;  3VYR B;  2R7T A;  1JGI A;  3DPU A;  3DTE A;  3B34 A;  3PL8 A;  4RSY A;  4PJM A;  4XMV A;  4ZW7 A;  2V26 A;  3IIE A;  2R7S A;  4XMW A;  2E5Z A;  2KP6 A;  4XNB A;  1JI8 A;  4XLF A;  3VYT B;  2HVQ A;  3B37 A;  3W2A A;  2XPY A;  3HPG A;  3KED A;  4XN8 A;  5JC1 A;  3PJR A;  4KIT B;  1TZL A;  4XN1 A;  3I3L A;  4YEL A;  4OAZ A;  3B2X A;  4XMZ A;  2WPG A;  4XR6 A;  3ZRG A;  4FET A;  2CUZ A;  1ZEL A;  4C2U A;  1G5A A;  2HPO A;  3CZL A;  3HC7 A;  3FUE A;  4KP7 A;  1QHG A;  5CPR B;  1D1C A;  2MD0 A;  3MKZ A;  2R72 A;  3A1Y A;  3UCQ A;  2R7W A;  1NG7 A;  3Q43 A;  3QOD A;  4LIT A;  3ONQ A;  1D0X A;  1MMA A;  3K4L A;  2QJ1 A;  2XPZ A;  2KRH A;  1T95 A;  4BXF A;  3OYH A;  2WZF A;  3RC3 A;  2WAE A;  3L2Q A;  3OR2 C;  1G8X A;  3OYL A;  5CKT A;  2O5R A;  2GTQ A;  2L7K A;  4XNA A;  4CCM A;  2R7V A;  3FUD A;  4XKC A;  4C30 A;  4B47 A;  3OS0 A;  3SEQ A;  3RC8 A;  5EV7 A;  4FLS A;  2AQF A;  2CH0 A;  5FWQ A;  2KDO A;  3QJX A;  1Z7L A;  3DPL C;  3DKY A;  2VXZ A;  4ZQF A;  3WQQ A;  1MMN A;  2BVL A;  1BR1 A;  4X0G A;  2BW3 A;  1H3L A;  2I8D A;  3FU0 A;  3OIQ A;  3L2W A;  3OYK A;  4K5O A;  3OS1 A;  1FMV A;  3ANL A;  2PUS A;  4F93 B;  4IX7 A;  2M0M A;  3M8J A;  3F9K A;  1H19 A;  3K4N A;  3LSM A;  1P9Q C;  3CHS A;  4KJZ A;  3FTX A;  4XMX A;  4AIC A;  2VJJ A;  4R5X A;  4CZC A;  4GRI A;  2GOM A;  3W3C A;  3S8P A;  1MW3 A;  4II3 A;  3IAS 2;  2HNH A;  4ZW3 A;  1V5G A;  2BVM A;  1DGR M;  2Q2E B;  2Z16 A;  4BDY A;  2PJR A;  2VJ5 A;  3ZGK A;  3H0D A;  3C2G A;  3K4B A;  2X1D A;  4XKW A;  4ZDP A;  3AUA A;  3FUL A;  2DCE A;  3I9V 2;  2DQM A;  3N05 A;  2HPT A;  2JCX A;  3IP4 B;  4CCJ A;  4BDZ A;  3H9J A;  1ONP A;  2LY2 A;  4GAE A;  2F5V A;  2VB6 A;  3CP8 A;  2FFL A;  4ZX3 A;  3CZK A;  3K70 C;  3LSG A;  4AR1 A;  4XMY A;  4RLF A;  3VDX A;  4NC7 A;  3OYM A;  4PJL A;  3HOT A;  3D5L A;  3DPT A;  4XLH A;  2V4J C;  2R7Q A;  4RM3 A;  2HVS A;  3W2V A;  4XN3 A;  3CZG A;  4Y3O A;  4A03 A;  3FTY A;  3DTK A;  3LL7 A;  3FU6 A;  5JMP A;  4E7H A;  4XO3 A;  2M7B A;  2LRE A;  1SC5 A;  4MS6 A;  4BE2 A;  4AYS A;  1T0F C;  4D1Q A;  4OWR B;  3B7R L;  2HVR A;  4YEJ A;  4XMT A;  2JD2 A;  3VSL A;  4ZC3 A;  2XDV A;  3L2U A;  2JSP A;  3TL4 X;  2FUG 2;  2UV1 A;  4ZTJ A;  3JSZ A;  3DTI A;  1K5H A;  2PGG A;  3CMM A;  3ZCO A;  3CHP A;  1E0E A;  3K10 A;  2OC6 A;  3FUM A;  3OY9 A;  2LH9 A;  3EUK L;  4HSR A;  4XOP A;  2CV0 A;  3FBN B;  1WJC A;  2NOJ B;  4MKT A;  2ZXG A;  1MMD A;  1G59 A;  1QU3 A;  2L9S A;  1N77 A;  1UEL B;  3VYU B;  3FDY A;  2CV2 A;  3AFH A;  4XN0 A;  3U9W A;  4ANJ A;  4P5O A;  4ZQG A;  5TGT A;  4CSW A;  4R5V A;  3CZE A;  2X6W A;  3H9Q A;  4ZYA A;  4U87 A;  2DQ6 A;  4NNJ A;  2X85 A;  2IS4 A;  2A7O A;  2V6E A;  2MFZ A;  4ITV A;  2IS2 A;  4P1W A;  4Y6P A;  5FRN A;  3K70 D;  4IZZ A;  3FH5 A;  4QUO A;  2PL5 A;  1QHH D;  3FUH A;  4ZJZ A;  3AU9 A;  3B2P A;  1EA3 A;  4PFP A;  2JD0 A;  4FCA A;  3EBI A;  4NQW B;  1X3Z A;  2C82 A;  3H5R A;  4BJT A;  3AKZ A;  2MAB A;  2C5Z A;  5HVQ C;  3L2V A;  4XOR A;  1GLN A;  4JQF A;  3T0Y A;  3VVL A;  1FMW A;  3CZ6 A;  4QME A;  1MVY A;  4K5N A;  2MAO A;  3BCB A;  3DEE A;  1WJ5 A;  3NWT A;  3RTR A;  1X1A A;  4MLO A;  2R7X A;  4XKV A;  3OYA A;  3DU5 A;  3OWT A;  1T1S A;  4XKB A;  4U7B A;  2R70 A;  1WJE A;  3VYS B;  2LRD A;  2DT7 B;  2Y1C A;  4J00 A;  2M4G A;  3K6G A;  4DGW B;  4PK4 A;  3DLA A;  1D1B A;  2IS6 A;  1X19 A;  3OR1 C;  2E1M B;  1Z21 A;  3FTS A;  4DBR A;  2V7F A;  3FHE A;  5DYF A;  2XF5 A;  3E1S A;  4AVZ A;  3OYE A;  4AYB A;  2QVW A;  3CHR A;  1JVS A;  2WZG A;  1UG0 A;  4X2U A;  4ZQH A;  2Y1G A;  2VKD A;  4ZQE A;  1X1D A;  1YX5 A;  1DP3 A;  3VVM A;  4LUP A;  2JD1 A;  3KYL A;  2LC2 A;  2RNG A;  3EUH C;  1V5E A;  4XO5 A;  2M3A A;  3OYC A;  3FTV A;  4ZX5 A;  5JBI A;  3CP2 A;  3WQS B;  2VQG A;  4ZX6 A;  1R6R A;  1ZS2 A;  1WJB A;  2F6C A;  3ANN A;  3QYB A;  3U21 A;  2XAU A;  4XLC A;  2L9N A;  3LFU A;  4NUB A;  1SFK A;  2CMP A;  1PJR A;  1MW2 A;  4EAT A;  2WAQ A;  4JOM A;  4DOZ A;  2Y1D A;  1OR7 A;  3OYJ A;  2CUJ A;  3EBG A;  5DLL A;  2Q1Z B;  2RRE A;  3FKJ A;  3OOU A;  4CXF A;  2VJI A;  4C2T A;  2HDW A;  4II2 A;  4OOF A;  4Q4E A;  2Z2S B;  2R7U A;  3UER A;  3EPZ A;  2GOX B;  4IQ4 A;  5KNL A;  4ZW8 A;  4N4O B;  3K4J A;  2JCV A;  1U0J A;  2OV7 A;  1X4P A;  3OYB A;  2R4G A;  2LOO A;  4ZW6 A;  2W00 A;  2IGN A;  2CW7 A;  1Z3X A;  4QPE A;  3QYF A;  4HG2 A;  4LIV A;  3R0I A;  3T8V A;  5JNL A;  4CCL A;  3S32 A;  3CHQ A;  4D9J A;  4E7Z A;  1R0L A;  3RSN A;  1LFP A;  3PSI A;  1Y6I A;  3FU5 A;  3H5N A;  4NQW A;  3DWL E;  2ZXH A;  1D0Y A;  4RMN A;  4XNF A;  5FRO A;  2LG4 A;  4B44 A;  2O7G A;  3A14 A;  4Y6R A;  2XF6 A;  1N78 A;  1Q0H A;  2XC7 A;  4G6T B;  4AR9 A;  2IGK A;  4XL9 A;  4DJA A;  4QIR A;  4CCN A;  4F52 A;  2CV1 A;  2R7R A;  1W36 C;  3UEQ A;  4ZQT A;  1X1B A;  3LSK A;  4E7J A;  3FH8 A;  4F55 A;  3PUB A;  3CJR B;  2Z1D A;  3ZQQ A;  4QHP A;  4H4K C;  2WB1 A;  2MC4 A;  3IUO A;  5HLT A;  3ZHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...