5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
5HNFA 5HLTA 5HNHA 2VLAA
chains in the Genus database with same CATH superfamily
3B73A 1X3ZB 4LFUA 3V8LA 4I6ZA 5K7FA 1BL0A 1K79A 3ZMZA 4HF1A 4FLRA 2ELKA 4GYIA 2FBIA 2X1EA 4PJMA 3C2HA 4EGZA 5IT3A 4FLQA 2LP0A 4F93B 3IWFA 5DYFA 3DTEA 3MWMA 4JX4A 5F04A 3DLLF 3H3UA 4A0ZA 1Q1VA 3GXOA 4LJZF 1FMWA 2K40A 1I3AA 4MQ9F 4HX7A 3K7AJ 1YHQI 2A61A 2LG4A 5FLXZ 3JTGA 3DPTA 4RB3C 4R5VA 3JW4A 2BYVE 2PUSA 3TO9A 2HXIA 1T33A 1S7AA 2YU9J 3RPQA 2EFNA 2A6EF 1I1GA 4XMTA 2K7LA 4BACA 1WZ2A 3EBGA 2QSGX 2HOAA 1RESA 2JPCA 3I54A 3HOYJ 4GO1A 2KRFA 3R0IA 1O7LA 1MVYA 1YI2I 3DBRB 4NQWA 4CH7A 1VQNI 3FH5A 1JJ8C 2DPDA 5D5XB 2L9VA 3BJOA 2QSFX 2HWVA 5C3EJ 1IV8A 1YITI 4EJVA 2BOLA 3TP0A 3FU0A 4JBAA 4AICA 3FM3A 1Z05A 3FUDA 1IV6A 4U7DA 4ZDLA 4R8HA 1LVKA 4FX0A 2PJRA 2L7ZA 1X19A 3HOTA 4JX6A 4IHXA 4RA2A 1MW7A 4QHPA 3K70D 1LB2A 4HNTA 3O2PE 3RZDJ 3WG9A 1F9NA 1IUFA 3DBLB 2XAFA 1HF0A 5F0HA 4L18B 2JPBA 3F8MA 1FOKA 1XDUA 1BM9A 4II2A 5B1AH 3CD6I 2DMQA 2J5OA 3HUGA 4CA0A 1EF4A 3WODF 2MBFA 4XLFA 3U1KA 1XMKA 4XICA 3F23A 4ZX5A 1H8AC 2XPUA 3CP2A 1G4DA 2M3AA 3W6JB 3OS0A 4ZW7A 4O6JA 4CXFA 3JSZA 5F6FA 4KDPA 1A04A 4IEJA 1D8JA 2VKEA 2A5YB 4BBRJ 5FJ8J 1XMAA 4WX9A 2W7NA 3GWZA 1J7KA 4M74A 2KZGA 4CCKA 5JHFA 1T98A 2KZVA 4I7HA 4LB6B 2HQRA 4NDLA 2X9DA 1LVAA 3QAHA 4DIQA 4XO4A 1YQAA 2EZIA 3FZVA 2QCOA 1Z67A 2ZCWA 1MMGA 2KDOA 2CSOA 3H92A 3G2BA 4OMZA 3GZ5A 2IS2A 4Y15A 5FFZA 3ZMVA 1GVJA 5CVVA 3LAPA 2ADUA 1D1CA 3KZIC 3BJ6A 1R1TA 4U0WA 2XGEA 2RQQA 3S8PA 1BI2A 1HSTA 3RSNA 1HKTA 5F1RA 4NB5A 2P7VB 2X6OA 1YIJI 1U78A 5EV7A 2DA3A 4AC0A 3H3VK 2HVSA 3QODA 3COAC 3I59B 1AHDP 2CW0F 1D5YA 2H6CA 2K3FA 5LFAA 6PAXA 3JRIA 3P7NA 2VBWA 3I4MJ 1PDNC 2ZXGA 1OCCH 4L9NA 3L1PA 3CCEI 2PMZN 2JA5J 3NRVA 3HKZN 3KZZA 3V7SA 5EDNA 2FOWA 2Q2EB 4HRIA 4EGYA 3ZQIA 2BVMA 2IGOA 3K1NA 2DYRH 5H6RA 3VEPA 3BP8A 4HPQA 3P9KA 4CCJA 3LAJA 1U0JA 5GAHJ 4KJZA 5J47A 3FTSA 3KE2A 3LQRA 3TO6A 1ZARA 2HDCA 3QU3A 2F48A 1WRJA 4AYSA 2XF7A 2QBYA 5D5UB 4FASD 1ZG1A 3O6BB 4A3LJ 5B1BH 1W4MA 3PUFA 1TW3A 4MTDA 1XDSA 2M87A 2WC2A 3ANMA 2TCTA 3VODA 1L0OC 1IXSB 2NOJB 1D3YA 4XSXF 4ZYAA 2K86A 3PNTA 4JP0A 4PJJA 2KIMA 5DUKA 4L2LA 2HVQA 1VQPI 3KP6A 2PMHA 2IS4A 3ANLA 2W00A 5M3FJ 4BU2A 2DI3A 2O8KA 2HFHA 5LRRA 1Z6TA 1MMDA 4XRSA 1MSEC 3O8GA 3A1YA 1PUFA 4X2UA 2FEZA 2JA6J 2XV4S 3KP2A 3TMOA 2HPIA 1IF1A 4PUSA 3VWBA 4GCVA 2DA4A 3DPUA 5JI6A 4I0AA 2L7MP 1WKMA 2ZB9A 1WJCA 2DA2A 1Y0NA 2DW4A 4PFOA 1J59A 1X4OA 4L5IA 2CQ7A 4E7JA 4P1WA 5JMPA 1JE8A 1HKQA 1XGSA 4ZYDA 1ZREA 2K5CA 3R0JA 5LHGA 4Q4IA 1HW1A 1OJLA 1LFBA 5FD5A 4E4HA 1XMXA 3A0BC 4FCAA 3KCCA 3S2DJ 1K78B 3WGIA 3LL7A 2O9LA 2V6EA 3GO5A 4Y4RA 3UKGA 1MZBA 3W3CA 5H6QA 1XTAA 3V4GA 2QSHX 4RSYA 3FUJA 3CCYA 4I2OA 2EA4A 1QZYA 2KJBA 3ZMSA 5DCMA 1RI7A 5FRMA 2LY9A 4WF2A 4OINF 1YYVA 4M3DA 3CDHA 4AIHA 2VBYA 1XX5A 5JVGF 4RCVA 4ZX3A 3A06A 4UUSB 3T8TA 1I5ZA 1TW2A 3ZR8X 4IZZA 3W2WA 2HS5A 1R49A 3PIPF 3GX4X 2HTSA 2K3PA 4MO7A 1X2NA 1VFCA 5K7ZA 4BE2A 3S16J 3TW6A 3WTTC 2VIXA 3B6CA 3MMYB 1SMTA 2FNAA 1D0XA 4Y52J 3DCFA 1Y0UA 3H9GA 4QIWN 2XKOA 3FF5A 5ILUA 4N4NB 2KMUA 2M30A 3QPLA 3OYNA 4W97A 4UVBA 3G71I 1A35A 1SD4A 1O3TA 3SJMA 1CF7A 3CC2I 2PLYA 4GFBA 4KMUX 4M3BA 2HKOA 2JVHA 1I39A 5K7HA 2EFQA 5FB2A 5EG0A 4KP7A 2CW7A 3GUDA 3H0GJ 3GLXA 2QZ8A 1MBEA 4RBOA 3OSGA 1F43A 3G1MA 4UB6C 4EQQA 3CCVI 1W5TA 3HL2A 3BJAA 3CMYA 1FOWA 2M7AA 2QKLB 2LY1A 2V79A 2RNJA 1V54H 2A6HF 3CC7I 3EYYA 3PM1A 2RJIA 4AR1A 5DD8A 4LG0B 4B09A 3ROUA 1QVTA 4WXDA 1MBHA 2XB5A 1Z9CA 3ZMUA 4QMEA 5EF6A 2OZ6A 3I53A 1KONA 3H0DA 3K0LA 2WWYA 4P9FA 1XS9A 5FKLA 1IN6A 3F8BA 2GOMA 1Q1HA 5EYRA 5DM7F 3BG3A 4AVZA 4BXFA 2E1MC 4C2UA 3MCZA 5IP6A 2JCYA 2NXNB 2RNGA 1RKTA 2Y1CA 3HIFA 3UCQA 4IL6C 4LIUA 5ERIA 1JKPC 3TW7A 4AIDA 3S14J 4EJOA 4H4KC 4AYBA 4GAEA 1WFXA 2EZHA 3MKZA 2JTVA 2ZNZA 1T1SA 2EGHA 1WJDA 5HOOA 3QJXA 1JGGA 2ESHA 3S15J 1QHHD 2IPQX 3DFGA 2CFOA 1WSUA 3HOUJ 1YW7A 2DQLA 3NEUA 4JX5A 4Y33A 4MEXF 2R7OA 2WB1N 2DPUA 2GXBA 2Z5UA 3F6VA 2YPRA 3T0YA 5K1YA 1UELB 3ZMTA 1FLIA 1VQ4I 3ZHXA 2R4GA 4IX7A 1WH5A 4ZQHA 2BHYA 2IEKA 4GYGA 2IW5A 5D6FA 4UV9A 4BY7J 2EB7A 4BYYA 5A2QZ 1U6GA 2EFPA 2WA0A 2XAHA 5BPIA 4XMVA 3K4JA 2P5VA 3RQ4A 5M5YJ 5FWQA 3CJRB 3CLQA 4WXCA 4ANJA 3WU1B 2M5WA 1MNMC 1P7IA 3ZI0A 5L3BA 4JOMA 2OU2A 1MNDA 2HU9A 5K5RA 2E60A 2HYFA 4ON0A 4AIKA 9ANTA 3ZHYA 1G59A 2V1XA 3B34A 4EEFG 2JV7A 2NVUB 1QO0D 1MBJA 4M6XA 2QJ1A 3ML6A 2NAZA 1P4AA 4RAGA 5BOXA 4HNUA 4EM1A 2LLKA 2JSCA 2STWA 2DLLA 5FKMA 3ZGKA 4A5NA 4Q5SF 4KT5C 4XO3A 5A2QK 1XSDA 1LDDA 2KRHA 2V1NA 3OYBA 3I56I 3GZNB 3U21A 2EINH 4LITA 3ELKA 3BCAA 1ITYA 1S7EA 3PSIA 2HR3A 1TWGJ 3ECOA 4EMSA 3HKZA 2EFWA 4ZDPA 1W7PA 3PQJA 2DBBA 2XRLA 5JVTA 1OYYA 3EUHC 3VB2A 4K5LA 1MBKA 4ZDOA 3LSKA 3TBIA 5CJ9A 4ZW8A 1W0UA 4OWRB 3Q9SA 1ZRDA 3J80Z 5J1YA 4XSZF 3E6DA 5GTHC 1VQ5I 4FQGA 1U8RA 4JQFA 5LGTA 1JHFA 2VQLA 3IC7A 1PP8F 3SZGA 2NNYA 4DBQA 5J4YA 2O0YA 5HDNA 5IYBJ 3L2UA 4IHTA 1Y8QB 1SANA 2DQMA 2CS3A 4CCOA 2ZC2A 5BPPA 5JLWA 1ZHFA 3C2BA 5DLLA 2ZJPF 2KIQA 4A6DA 3QRFF 2O03A 4IVNA 4BJ6C 4OIRF 4A0XA 5KAIC 3CHSA 3GFJA 4PJNA 5M3MJ 2VC1A 4DZJA 1G3YA 5HVQC 3OYIA 3IRQA 3J80K 4A12A 4XN8A 3GTOJ 3KEDA 3BR1A 2QLZA 3JCUC 1APLC 3BR2A 1MH3A 3J7YJ 4XN9A 1O3QA 2P8TA 3CHOA 2KKOA 1K4SA 5D8LB 1YW9A 3FXOA 1W0TA 5JAZA 3I64A 3WTZA 2NYXA 3RC8A 1TP4A 2DT7B 2R0QC 3FXMA 1YX5A 2A6TA 3CMMA 4M71A 3OYLA 1FP2A 3E3VA 3GFMA 2DQRA 3K1MA 3MKYB 3LA2A 2FQ3A 3FTYA 1N75A 1F36A 2VT3A 2HOSA 2HOEA 3WHBA 1PUFB 1KYWA 3G4SI 1R58A 2HOTA 3L9FA 2OF7A 4OOFA 1H89C 1Z77A 4HAMA 1I3QJ 1JTXA 1W5CC 1AWCA 4C3HJ 1ZAOA 3CQZJ 1S9HA 3GLLA 5L3FA 5BMZA 3REOA 2XASA 1EH8A 4LOCA 2R5YA 1UG2A 3HOZJ 2V9VA 4XKBA 3IH3A 1YS7A 3HB9A 3LSTA 1ULYA 1T1RA 2DFIA 3TO7A 4BBSJ 2Y75A 1U9NA 1P92A 1TNSA 5EZGA 1IJWC 1G5AA 2EIJH 2DT6A 5E1ZB 4Q48A 3BOQA 4E7LA 2QQBA 5AONA 3U1DA 4HDUA 2JQ7A 1Q0HA 3B37A 5ICCA 2ZJRF 1BIBA 4MEYF 4MIMA 4XRFA 4DBRA 2UWMA 3MZYA 2H1KA 2RC4A 5HODA 3QP6A 3ABLH 3ERMA 3FUFA 2BZTA 2HNHA 1U5TA 3ZQCA 1WWXA 2ID6A 3BY6A 1BOAA 1ZRCA 4G9YA 1FIAA 2FOKA 5D4RA 3OY9A 4XLHA 2HPMA 2Y0SN 5EGOA 1RUNA 1MBGA 2CGPA 2W82A 1VF9A 1X3WA 2VN2A 1WPKA 2ETHA 3FMQA 4FE7A 4UNOA 2IA0A 2ELHA 3C2GA 4HV5A 1GDTA 2W24A 3GYHX 3H35A 3KX2A 3CLOA 3JSPA 2VOPA 5DDGA 1R1UA 1YTYA 4S0HB 3QQAA 3ZMDA 1S3JA 3L2QA 2MGQA 1FNNA 2P6TA 3A0HC 4N9HA 3LWFA 4A69C 4F52A 3OYMA 2K4BA 4J00A 1BC7C 3OR2C 2VODA 3GTPJ 4L9TA 1QU3A 3LA7A 2Z1DA 1MNEA 2XAUA 3MKLA 1J5YA 1UMQA 4C2TA 4B47A 1X1PA 1BW5A 1VQLI 4PGHA 4QPQA 4Q4ZF 3KZYA 1SFEA 2VOOA 5F27A 2EILH 3LNQA 4FHTA 4LIVA 4ZTFA 3SZPA 3CJTB 2XF5A 1LFPA 4M72A 1BN5A 2D1HA 3Q9VA 3RKXA 2H8RA 2O7OA 1W5SA 4B3AA 3FULA 1VNDA 2XPZA 4PW4A 2X6XA 2GIZA 2K9QA 3CZKA 4X1EA 5CQEA 4Y17A 1T6SA 3DLAA 3HRSA 4R7LA 2R5ZB 4WCGA 4NC6A 1Z1DA 2CWEA 2MLGA 2L3DA 1ZH5A 2Z16A 4XMYA 1HDPA 4KT6A 3KP7A 4CCMA 4E7KA 3ZQLA 1Z3YA 1I27A 2R7SA 1KQ9A 1IN8A 2HEOA 3LSGA 1B4AA 5LRSA 3GTJJ 1QZZA 2QGUA 1HCRA 5TJJA 3RASA 2AQFA 1AKHA 1O57A 4I0BA 4LMYA 3VSLA 1TL8A 4A3DJ 4HLXA 2M4KA 4PCQA 2DT5A 1LE8A 4BGDA 2KHMA 3MN2A 5H2FC 1G6NA 2NS7A 2QQ8A 4XRSG 4G7HF 2L4MA 3FM5A 1P9QC 4Y13A 1ONOA 2MAOA 1Z7UA 5FFXA 1XGOA 3N05A 1FTTA 2HQNA 4M6VA 5DYMA 1WI3A 2ZXWH 3N4MA 2ISZA 3M1CA 1FPQA 3J81K 4AR8A 1B9NA 2Z33A 2EK5A 1FC3A 2E2JJ 4FT8A 1T95A 2WAQA 3S1RJ 3FHZA 5J6XA 1IN4A 2PN6A 2W85A 3CCMI 3HPGA 2GXAA 1ON1A 1B72A 1MJAA 3OYDA 2OCCH 2XAQA 3CUQA 3T1BA 4HF2A 1T0FA 2JMWA 2M1BA 2XRNA 2ISYA 3WE2A 2MLKA 4IXAA 1NHAA 2V9PA 1VQ9I 1P6RA 5J1RA 3HOVJ 4OU0A 5CLSA 4RB2C 3GZ6A 2Y9ZA 2E35A 4II3A 1FT9A 3S32A 3KEQA 2ZO4A 4O3MA 1HA8A 2E2HJ 2COBA 4XNFA 1SAUA 1FMVA 2ZXIA 2VPRA 1Y1VJ 1R4NB 3OMYA 4DZPA 3B2PA 2FUG2 4I98B 1E3HA 1SAXA 4ENMA 1SVMA 3V8JA 4BDYA 4IPAA 3H36A 3VYUB 1GXQA 3K4CA 5FLXK 4BHBA 4RGSA 2QWWA 4XLCA 3K4NA 5HNHA 4HEA2 2W84A 2VL8A 2CW8A 1QZEA 3M1EA 3FKJA 1YG2A 3F21A 5D8KB 3U2RA 3FTWA 2LY2A 5IOZA 2EZKA 3FK6A 4Q47A 4M9SA 2ZSHB 1FWZA 2QM3A 3DTKA 3W6KB 1R4MB 3L00A 3NQOA 4CYCA 2IVMA 3HDDA 4XLPF 2LF7A 3WHCA 1DU0A 2JVGA 3BPXA 3CZLA 5DD4A 3QP5A 3O8HA 4ENNA 1SFUA 4E7IA 3CTAA 2EWNA 3N97A 1D8KA 5LD2C 1LUJB 3P9IA 2PX9A 4BJTA 1HDDC 3G73A 2OZUA 3A01B 3CCQI 3S3OA 5J3LA 2F2EA 1D0ZA 2CUJA 2BY3A 2HDDA 4HOBA 1MW3A 1GVDA 3CZGA 3ZRGA 3WTXC 4AIJA 4OOIA 2HPOA 1SD7A 2VKVA 2F4MB 3TKYA 3MVPA 1OCPA 4ZN6A 4HG2A 3F8FA 3I9V2 1W1WE 2BE5F 1BOBA 3CIAA 3FBNB 4MHGA 2PEXA 5HS7A 3VVLA 1JT0A 2RREA 5CQGA 2O3FA 2P5KA 5DCFA 2CU7A 3JRFA 2KT0A 1SC5A 1FBQA 4F3QA 4NC8A 3WU0A 2GXGA 2FD5A 3WTWC 5KVRA 1K61A 3K6GA 2PFBA 4M6YA 1I50J 3FIWA 1OCOH 2H94A 4CCNA 5ED4A 3ERED 2R7VA 2XC7A 3PJRA 1QHGA 3K4MA 1QRYA 4B4CA 2XAJA 3V7CA 4RLQA 3VOEA 4DPRA 4A3EJ 3DKWA 1E3PA 3LSJA 5F0FA 1MBFA 3CMEI 4S05A 3H9QA 3J7AO 1JUSA 2K9LA 2FX0A 1ETVA 5L3CA 5DTDA 2O61A 3ABMH 2E1OA 2DOEA 5HLHA 2XF6A 1ONVA 2DU9A 1AU7A 1WJEA 4XOTA 1GV5A 3BCBA 1XSVA 2V6CA 3HSRA 3B02A 3TDUC 2R7XA 4MTEA 4XN1A 2QVOA 1V5GA 1YRNB 3EDPA 3KPHA 1HW2A 4XN0A 4KITB 4GGGA 1PP7U 2R93J 2XIGA 3H5RA 2MH9A 2KIFA 3GCMA 3OIOA 1YFHA 1IGNA 2V7FA 2BW3B 1RIOH 4ZYHA 1H3LA 3SFZA 2LFBA 2ZXHA 2FFLA 3CCSI 2LBFA 1H19A 1X4PA 4EJTA 4OIPF 2K85A 2KDZA 5ILSA 4ENJA 1EJ9A 3CCJI 3T8VA 2O8XA 2D2WA 1I6HJ 3SEQA 3GBGA 1EKEA 2E1MB 1RR8C 3MQ0A 2ID3A 2XQ0A 4Z6YA 4ENKA 1RZ4A 3PNVA 2JK3A 4M3FA 1WJAA 5E3LA 4XMXA 4A3MJ 3HGGA 1O4XA 1D1BA 2GM4A 4PJLA 2HPTA 2R7QA 3M9AA 3HG9A 2B63J 5M5WJ 3CDIA 3BZKA 1Y8RB 4V2GA 4UUVA 1H9TA 1U5TB 2L2OA 1S29A 3ZCOA 3J7ZI 4IRGA 2DXIA 1T56A 4M3GA 4BKXA 4RAZA 3FHEA 2CQNA 1ETWA 3NWTA 4WXHA 5EGOB 4LK1F 2LC2A 4Y6SA 1DP7P 1J09A 1K6OA 3ZQFA 1SEUA 2EQRA 4CYDA 1OKRA 1MGTA 2K02A 2K9MA 2LREA 2F5FA 1M1EB 3PUBA 1DGRM 1LKXA 2WV1A 1ZR2A 1MDMA 3CC4I 4J19A 2IT0A 4EATA 2R92J 2AQEA 1UB9A 3KFWX 3M07A 4BY1J 4ZC3A 3FMRA 2X6YA 3FU3A 1R5GA 2X4HA 4UXNA 4E70A 2AXTC 2XPWA 2YUSA 3TP3A 1B9MA 1N77A 3S17J 1NG7A 3BG6A 1J9IA 2JUGA 1RNLA 2HTJA 4P9UA 4V2FA 3E6MA 3ONQA 2EV6A 1P7JA 3LA3A 3H5NA 2E5ZA 1MMAA 1VQMI 3VDXA 2JZYA 5C44J 1SFOJ 1IXRC 4AVPA 2D5VA 5IY5H 3GTGJ 2DOFA 3M8FA 2Y9YA 4A0YA 4X0GA 4EM2A 4DOZA 2LOOA 2L54A 1YIOA 1ETQA 4YG2F 2E7WA 1K4TA 2VJ5A 1SD5A 4G94A 4DQ2A 1LEBA 5JLXA 3O3KA 4JYKA 4Z2YA 2R70A 4P96A 3KIOA 1V55H 4BQOA 4ZTJA 3I4PA 3P9CA 3ZQGA 2D1VA 3HHGA 3C3WA 1AKHB 1ZGWA 2ZJ2A 4A93J 3BPVA 1G3WA 1R1VA 1JGSA 3RPUA 3TDZC 3FK7A 1R0LA 4HW0A 3B6AA 1TWCJ 4BXUA 3K4KA 1TQPA 2W48A 4G7ZF 1REPC 4P55A 2PGGA 4ZQGA 3AG2H 4IOCF 5D5WB 5DEQA 2P6SA 3L2WA 5IP7J 2M0MA 1IN5A 3G3ZA 2FMYA 4HQEA 1S8NA 3B7TA 2MAPA 3OIPA 1FX7A 1JVSA 1KU9A 4JNDA 3PL8A 4MQVA 1VQKI 4X6AJ 4B8XA 3AG4H 3C1DA 1A5JA 1QVUA 2HZDA 1LEAA 3FUMA 1RUOA 2IAIA 1ETKA 1MW0A 3WQRA 5EZHA 1OYWA 2JD0A 1K83J 2H8WA 2X1DA 1HS6A 1VI0A 1WVRA 4L5EA 5CVRA 2J5PA 1HLVA 4HYEA 4XLNF 2EV0A 1NG6A 2JN6A 3DEUA 1B72B 1T8IA 4XMZA 1FIPA 3R60A 3HOSA 2ZFUA 2QF7A 3EBIA 2RVCA 5J8CA 3HC7A 2VKDA 3ESWB 3S3NA 4MS6A 4BEHA 4CO8A 2MABA 5L3EA 1YLFA 2O5RA 3F72A 4EJWA 4E7SA 1RR7A 1U5TC 4L9VA 3HJEA 1D5VA 1WCMJ 4NQWB 5CYVA 3ZQQA 1IRZA 2D45A 1FOXA 3BQYA 1X3ZA 5FKKA 5DM6F 5IPAA 1WJBA 4KUMA 2BXYA 1JKOC 2E1NA 1WJ5A 3LFUA 2LSOA 3V42A 2L4AA 2KQRA 3E5XA 3VYTB 3CUOA 2Y1GA 1WJFA 2PJPA 3DU5A 2CO5A 1TC3C 2PJRB 4KN4X 3EBHA 2DQ6A 3HRUA 1NTCA 3H9JA 1OPCA 3FTZA 2GAUA 1UFMA 3BWGA 2K9SA 4HLYA 2I8DA 2YSRA 3LQQA 2E5NA 3OOPA 2VUMJ 3CHQA 1RRJA 3HSFA 2RQPA 2DCEA 3F9KA 2G9WA 2L7KA 3EPZA 1E2XA 4A5MA 2ACJA 4A3CJ 3A14A 4CYCB 3KYLA 3HUGB 5D4SA 4DYQA 2BVLA 3NARA 4ZW3A 1HSJA 1F4KA 1R7JA 2M8GX 3HRTA 2OTLI 1UHMA 4B43A 2TRTA 2R72A 3FMSA 1GUUA 2YU3A 4R79A 4U88A 4TV7A 2PL5A 5E18F 2R3SA 4P5OA 4RB1A 4E7HA 4KN7X 3WTVC 3LSIA 2V1UA 1JUPA 2R7TA 3NAUA 2A7OA 2KL4A 5TGTA 1ONPA 4N9IA 4ZYEA 1QQIA 1G3SA 2M34A 1GLNA 1TBXA 5E1XA 2PMZA 1P4XA 2GWRA 1B6AA 2M2EA 2NS8A 3OYGA 1ZQ3P 2BEOA 3S3MA 2IJLA 2Y31A 1IXCA 3EQLF 4RGRA 1DP3A 3WE3A 3WTYC 4DNCA 4XMUA 3BLYA 4FX4A 1ETOA 2NVTJ 4Y6RA 1T38A 4E7ZA 2DMPA 1WQ2A 1T39A 3WQQA 2CH0A 2LKXA 1OMIA 4AU7A 3IAM2 2FSWA 4FETA 4IF4A 1S72I 2DMTA 1Z91A 5E3MA 3HTSB 4Y67A 1OCRH 1BA5A 1XSXA 4C9YA 5GAGJ 4IO9F 1OR7A 3P5JA 4KIBA 2EZLA 1YE9A 2VI6A 2OC6A 3E6BA 5KAFC 4A03A 2M0CA 4ZYGA 2OPTA 1KA8A 4RVBA 1B1BA 2ZSIB 3F22A 4BHCA 1R5ID 5E3NA 4MKTA 3FUEA 2WBMA 3CJQB 4IJAA 4R1HA 2JUCA 4PJ0C 3VYSB 1MSFC 4N0BA 1XCVA 3DF8A 2MW8A 4FLOA 1ORKA 4BH9A 2JCVA 5D5VB 4KIFA 1JHHA 2BY0A 2LRDA 1G8XA 2DJIA 5C4JJ 3CUQC 2N8GA 3ANNA 2GIVA 1X58A 2Y69H 3RKYA 2WADA 3HPHA 1D0YA 1H0MA 4IHSA 4KA4A 3PFYA 2QBYB 3GMEA 4V19K 4Q4EA 4CICA 2B9SA 3B7SA 3GEZA 2BXZA 3Q0WA 4IQ4A 1E17A 2F4IA 3C18A 3KYDB 3WGHA 1UG0A 3E97A 3ISPA 4JK1X 3SYTA 2KISA 5CVIA 2DK8A 2JSPA 4CZCA 1UZCA 3I59A 3BZ6A 2F5DA 3BC8A 3GVAA 4UVCA 5ILVA 3DWLE 3BDDA 4LD5A 5ICGA 1HKSA 1T08B 1SG7A 4K5MA 2K27A 5IOYA 1UAAA 1ZGAA 2L7FP 2NVQJ 4D5FA 3FXKA 2VJJA 3ASOH 1KU2A 2JT1A 2Q2EA 4MNUA 1XGMA 2FNPA 3KP5A 4B3XA 1IAWA 4QSHA 1JKQC 2MA3A 1G2HA 2XDVA 1J0RA 5HS8A 3OYKA 3IH4A 2VQCA 1DQUA 1Z0XA 5JFRA 1QPIA 4ZW5A 4CZZA 1U8BA 1O3SA 4CGZA 3CESA 4PFPA 3DEWA 1FBUA 1TT5B 4B1RA 1YJNI 3AL0B 1JKRC 2DMNA 2C6YA 4LLGF 2Q8KA 3BG5A 2DA1A 2VXDA 3QPHA 4PK4A 3DP7A 1DU6A 3FU6A 4I01A 3FUHA 5L3DA 3MFKA 3KETA 3S2WA 5DUIA 3OL3A 3Q44A 1A36A 4I99C 4XNAA 3D0SA 3B7RL 1YX3A 2W25A 5FLVA 5DCMB 2JJ7A 3RDIA 3UR3C 2OAZA 5AIPA 2JRTA 1SFXA 2O6GE 4IHVA 2UXNA 2VPLA 1WI9A 3IH2A 2CYYA 1P2FA 3I5UA 1IN7A 4KNYA 5B3SH 3JRGA 1FOYA 3U9GA 2LR8A 4ZH4F 4G6DA 2HYJA 1D1AA 5DS9A 4G7OF 3ASNH 1KQ0A 2I5UA 3S93A 2ZBKA 3S1QJ 3J7AY 1R36A 5HNFA 2AS5F 1BR2A 1SMYF 3W6VA 2VONA 4CSWA 1ZGJA 4MGRA 1DUXC 2LMDA 1FYMA 1TZLA 2MYSA 1TWAJ 3OL4A 5J8FA 1LFUP 4GRIA 2DOAA 4QPEA 2BBYA 1DDNA 3V7RA 1CF7B 1ONNA 1Z7LA 4LB5A 2C5ZA 4OAZA 1KGSA 1XD7A 1GT0C 3ZQHA 4XN5A 1V5EA 5E3OA 5EG0B 3RTRA 4L0YB 1ETYA 2WZFA 3D1NI 2L0KA 5FD6A 2XGXA 3AG1H 2IXSA 2V9KA 3K4BA 3W2AA 1LJ9A 4PU2A 4UUSA 2OCEA 1JUMA 3LOCA 1POGA 3ZOBA 1A6QA 2P5LC 3TQNA 4DGWB 4D5CA 4K5NA 3FXJA 4A3BJ 3BR0A 2FJ1A 1TWFJ 2HQ5A 2RV8A 5HS9A 1OLTA 5B5EC 1ZYRF 2QKMB 3QOEA 4PGGA 3RCOA 1SQMA 3JREA 4AUXA 5BPDA 1FSHA 2WB1A 3FH7A 2C82A 3L09A 1IG7A 4M3EA 1W7PD 1EH6A 3BTCA 2EIMH 1FEXA 3HYIA 3OYHA 3FXRA 2ZFWA 2ECBA 1YJ9I 2JA7J 3E0JB 1ZLKA 2X51A 5E1WA 4ZX6A 2IBDA 4BQQA 1HBXG 2F6CA 2ZNYA 1VTNC 2VC0A 2STTA 1Q0LA 3I71A 4BS9A 4UHTA 3IKTA 4ZQFA 2HVRA 5IT9Z 4KICA 4F7ZA 1A6IA 3FDYA 3LMMA 1USTA 3WTSC 1NH3A 2FE3A 2OJED 4FISA 3RC3A 2M45A 1HOMA 2YR2A 4HA8A 3I4NJ 4XNDA 3JR9A 3QPSA 2HQAA 2LYCA 3TGNA 3MD2A 3L2CA 3R6SA 4ZZLA 3K69A 3AL0C 5KCMA 1KQ8A 1HXDA 1JG9A 4NUBA 3JTHA 2W4SA 1QNTA 4Y7NJ 4HBLA 3AU9A 4ZW6A 4LG0A 2JA8J 5EEGA 3DKYA 2R7FA 3ZPLA 1IDZA 4ARFA 3F8NA 2Q1ZB 4K2EA 1V4RA 3CO7C 3EYIA 4EV0A 1TWHJ 2X85A 2DN0A 2QENA 4A3JJ 2RN7A 4A3FJ 4R5TA 5HDKA 2L9NA 5IT9K 1QGPA 1TQMA 1XPXA 3IL2A 4BE0A 1QA6A 3RYRA 3RZOJ 3OYJA 3ABUA 3NWSA 1RP3A 3OYFA 1JT6A 2ZKZA 4PVBA 3JRHA 3SDBA 3SFIA 1DPUA 2F5VA 1ZKGA 2MFZA 4AD9A 1VQOI 4XR6A 3UERA 1G3TA 4YFKF 5ICEA 3TOBA 4U0VA 5JBIA 5F0CA 2Y1DA 4BJ5C 3ZP5A 2EA2A 5LHHA 3A02A 5J40A 2Y1EA 2GLOA 2CRGA 4HX8A 3FWEA 4H0EA 4XN7A 4XO5A 2GBYA 2KPMA 3FUNA 3KLOA 5LEJA 3W2VA 2VQGA 3OS2A 2GOXB 1ZN2A 3OV8A 3CXBA 4L9JA 3FXLA 4RGXA 4D1QA 2KRCA 3IRRA 4BQNA 4BXXJ 2Y48A 4XONA 4S04A 5L3GA 4OIQF 2G7HA 1VQ8I 4RGUA 3GFLA 3QYBA 2M7BA 3CZ6A 2OQGA 4AYBN 1W7PB 4C3IJ 3FUKA 5EEAA 1FP1D 5JHUA 4IKFA 5J4VA 2HKXA 4U87A 3OSFA 1WH7A 1ERDA 1USSA 1K7AA 1SVLA 3Q0UA 1R22A 2VKHA 4OIOF 3ZQ7A 3MKWB 3DU6A 1WGXA 2YX7A 4UVAA 2CV1A 3IAS2 2L9RA 1GXPA 2XPYA 1BI0A 3BR5A 5DV5A 4QPOA 2QQAA 1FZPB 1BJAA 1X1AA 2ZMEA 1GHCA 3K1PA 4PSWA 2KFDA 3LFKA 3S1MJ 5M5XJ 1DGWY 2EBIA 3K4LA 1IO2A 2OV7A 2XUBA 3F0CA 4M9XA 4RM2A 4ESJA 2K9NA 1SFKA 1IRXA 3OYAA 5DULA 2A05A 3RJPA 5FKNA 2VBZA 2DA7A 3SQNA 2H27A 5E17F 2Z9OA 3F6OA 3WG7H 4HSTA 2CJJA 3M3YJ 2CUEA 1OISA 1Z21A 3R0AA 4BAYA 2JD1A 2LDUA 4FTHA 1EH7A 2DFHA 3I3LA 2IGNA 3OOUA 2VXZA 2W57A 2XVCA 1OCZH 2IGKA 4XMWA 4Y3OA 4E6KG 3CCLI 4MFDA 2R7RA 2V1DA 5HLTA 2QQ9A 2X48A 4W1UA 3RYPA 4ZJZA 4GDFA 3A03A 3CF2A 1U2WA 5EJCA 5GP9A 3FTXA 4ZQTA 1DPRA 3R61A 3FKIJ 1JJ6C 3K9TA 3DKXA 1YS6A 1U9OA 3GF2A 4XLAA 3G6EI 2DA6A 3QYEA 1HC8A 4XIDA 2DYSH 5KK1A 2O7GA 2XPVA 1TNTA 3OIQA 3WU2C 2FBKA 1UJ8A 1OCTC 3PSFA 3RKWA 1QPMA 2R5YB 1ZTRA 2QUFA 2Y0SA 4OAYA 2H1LA 3BQZA 4HF0A 2DTRA 3HZJA 2RDPA 2NS0A 2CUZA 3V8KA 1E3OC 3GFIA 2GTQA 1XGNA 3OYCA 2FRHA 3PQKA 1SVOA 4OOEA 3K10A 4O5VA 1XC5A 2BY1A 2WV0A 4XKWA 3BROA 4F92B 1H88C 1XN7A 5E79C 4YIRX 1ETXA 3T8RA 3MEXA 4FE4A 2EPFA 4ZX4A 2PI0A 3VFZA 3Q3SA 2LD5A 1K6YA 2NNNA 3FTUA 2G7UA 1BR4A 1X2MA 2AO9A 1YJWI 3HEFA 4I76A 3CCUI 1TTYA 1BC8C 3RQIA 2MC3A 1J2XA 1X3WB 3FUIA 2KP6A 1ZLJA 3WGGA 2WTEA 3E1SA 3SHFA 2X0LA 2VBXA 4J3BA 1EA3A 1A31A 2HYGD 2JRMA 2A68F 1TQIA 4BDZA 3E6CC 2E1CA 1W36D 1B8IA 3JAMZ 5J1UA 4XRMA 5ICFA 2K4JA 2PG4A 4ABZA 1OYIA 4KISA 2F4OB 1ON2A 2HI3A 3KYCB 2B7EA 1OR7C 3Q0VA 4BNCA 3C7JA 2LVSA 2OBPA 2OUMA 2CQQA 3I58A 5FGMA 3CO6C 4IHWA 2WZGA 3PFIA 1JI8A 2XGCA 2BHZA 5E8IA 4BE1A 3VYRB 4XORA 5E8GA 2L5QA 3H1CA 2EV5A 1ODDA 3D5SC 4A3KJ 2QYOA 1FYKA 2E36A 4BQAA 3S1NJ 3FU5A 4RAFA 4AM3A 3B7UX 3CJNA 2Y30A 2EIKH 3OR1C 3HW2A 3WTUC 3DTIA 4QLCU 1RC9A 4GAAA 1Y56A 2B61A 3PUUA 4D7NA 4C2MJ 1HQCA 5IYCJ 1BW6A 3JAMK 3F8CA 1MMSA 2UUZA 4YFNF 4NC7A 4PZJA 2E71A 3CP8A 2R7WA 2GA2A 1IRGA 3VVMA 2XHKA 1MKMA 2DAOA 2ZJQF 3M8EA 4PDKA 3QWLA 4RDUA 4WWCA 2LKSA 2JA2A 1C0WA 2X1CA 1B59A 3VSKA 1MH4A 3FH8A 1IDYA 2GA1A 3FXQA 4OMYA 1VZ0A 1UHSA 1LE8B 3BG9A 5K5QA 1LDKB 3L2VA 1Q0QA 3A4CA 3HRMA 3SEZA 1MJBA 4EVIA 2LF8A 5IYDJ 4ZZDA 2R7DA 3LSMA 2IA1A 3JRAA 3X2QH 4U7BA 2IS6A 3CMAI 3DV8A 1I6XA 5LEKA 3HOWJ 3CHRA 2XSJC 4RS8A 2TDXA 4NNJA 4D7MA 2WY7Q 2M8EA 4LG3A 5GPCA 4LLLA 1YO5C 3GTLJ 3ZN1A 4XKCA 2WAFA 2ICWG 4HNVA 2G0EA 1RKWA 3M7GA 5LLQA 3K70C 3S2HJ 1XG1A 1EV7A 2EH3A 2FF4A 1Z6RA 2KIUA 2WY8Q 4LGWA 2VLAA 2R5ZA 2P81A 2CQXA 3CCRI 2DTZA 3E5UA 2EFOA 3HHHA 2A07F 1ZG3A 3QYFA 2NVYJ 4L0ZB 5FROA 3EUKL 4IRHA 1LDJA 1N25A 3CUQB 3EUAA 4IHYA 1UHWA 4K5PA 3Q5FA 4AWXB 2VE8A 4HDVA 2VT2A 4Y6PA 4BUPA 1ZELA 2ME6A 2XB0X 2CMPA 1F5TA 2JWTA 4XM3A 3CZEA 4CHUA 3IKVA 2PMUA 2IGMA 2OA4A 5C4XJ 4L5JA 2DJNA 1FY7A 2KJCA 3PNYA 2I10A 3UEQA 3OWTA 3SXYA 5JC1A 3LSRA 2ELJA 2XROA 3KP4A 3FTVA 2LH9A 3U9WA 1P4WA 3ZHZA 4KIGA 3K2ZA 3QPTA 3PO3J 2CQKA 2QA4I 4UB8C 3DQVC 3OYEA 2BGCA 3CDLA 3JRBA 4A3GJ 1S46A 2OD5A 3RIRA 3DEEA 3M8JA 2P0WA 5D6EA 3GTMJ 1STZA 2DK5A 2EJRA 4M73A 2NVXJ 1ZRFA 1BI1A 4ASNA 3E7LA 1S7OA 2GZWA 3JSOA 3MAJA 2VJ4A 2F5CA 5AENA 5F64A 2L9SA 4RLFA 2QEXI 2FA5A 3QOPA 2RGVA 1AA7A 4CDGA 1FBSA 3KP3A 2ESNA 3TL4X 1R0KA 3LSHA 4IOAF 1S6LA 2JD2A 3ZXSA 4XLEA 3HM5A 4I02A 2FBHA 3GW2A 1E0EA 5HDGA 5F1JA 4XKVA 2AHQA 1T2KA 3ABKH 3DPLC 1MW2A 1V5FA 1BR1A 1KZHA 3M4OJ 4UUTA 3EETA 5GTIC 3PIOF 1R71A 5JNLA 3HGYA 1Y6IA 3JRCA 1HW5A 4AR9A 3IWZA 5CVJA 2WAQN 2P7CB 1PJRA 4BHPA 4C30A 4M9ZA 4C3JJ 4ZQEA 3A2KA 5JO0A 2PBIA 5BNGA 4RB0A 3PO2J 5GPAA 2ZMEB 4LLNA 1JTYA 4PSXA 1R23A 2MD5A 1X1BA 4EJUA 3AG3H 4XQFA 2LKPA 4G6TB 4MLOA 4EM0B 1X1DA 3H5AA 1AOYA 1MJ9A 4FLSA 3FX3A 2UXXA 4XL9A 3Q43A 1BI3A 5BS6A 5K5OA 2JCXA 4UY8I 2Q0OA 2M9HA 3CHPA 3ULQB 2MD0A 5GAEJ 2H09A 3UNGC 3E5QA 5GADJ 2CV0A 1JXSA 5JMWA 2VJIA 4QWQA 4BL0B 4A2UA 3A01A 1GV2A 4CCLA 1SC7A 3HTUA 4DYCA 3FHNA 3AKZA 2FXAA 3IUOA 4RMNA 2FQ4A 3DBHB 1V3FA 2HZTA 4HV6A 3RI4A 4LK0F 2R7UA 2X6WA 5KNLA 2Z3YA 1BIAA 4U0YA 1L3LA 1UCRA 2VE9A 5AIQA 1LNWA 1PYVA 4FCYA 1T0FC 1W36C 3L2RA 3BTIA 2L02A 3KLNA 4K5OA 2CG4A 4HQMA 5KHDA 2DODA 5E20A 2MC4A 3AUAA 5CPRB 3B2XA 1Y1WJ 1R9TJ 2BY2A 4XN2A 3D5LA 1RETA 2MG4A 4G12A 3HOXJ 1VQ7I 4LUPA 2AXLA 3HSEA 5LBQA 4ESBA 2HDWA 2DFFA 3FISA 2IRFG 4UV8A 1OQYA 4GXOA 1PUEE 4N4OB 2IA2A 4NHJA 3BT9A 5TISC 2NOGA 2CV2A 3BR3A 2IP2A 1Y39A 2QVWA 1KYZA 1ZG5A 1R5HA 2LBFB 1Z3XA 3OS1A 4XNBA 2Y2ZA 2H6BA 4G8XA 2Y1FA 2E7XA 5LGNA 1CQTA 4XK4A 3RPUD 3BTLA 1MIJA 2LTPA 3BR6A 3L7WA 5LHIA 4XN3A 3G1OA 3KEYA 2OQRA 1ZK8A 5FKOA 4CUGA 3SZTA 3I55I 2VB6A 1YW8A 2Z99A 5CVUA 1JGIA 5FRNA 2ZXJA 2RAEA 4ITVA 2WPGA 1KU3A 1F1ZA 1H9GA 1FTZA 2A5WA 5B66C 2COMA 1YRNA 1U3EM 1GW6A 2DDBA 2A3SA 5F08A 5TRDA 1OFCX 5BQTA 3AU8A 4YIFA 3AAFA 1I1SA 2VJ8A 5LGUA 4YRVA 3HXLA 2RKHA 2Y0MA 2UZKA 2BW3A 2FU4A 2V4JC 2VASA 3T5XA 4RAYA 4B48A 1MDMB 3FBIB 1XCBA 3CF5F 1LQ1A 1B8IB 4A3IJ 2YS9A 1FYLA 4MFEA 3H3ZA 3IV5A 2ZMEC 4HX4A 5H20A 2DMUA 3ECHA 1TLHB 2CFXA 1O3RA 4YFXF 1ZS2A 3ABTA 4F91B 1TT0A 2GQQA 2HXOA 5JR3A 3F3XA 4ESFA 1SD6A 4J01A 4DW6A 3BG7A 4G6QA 1MMNA 2XKPA 4D9JA 1IC8A 4XOPA 3BTJA 1IUYA 1ACIA 3G1LA 2R59A 2IS1A 4QUOA 2DFEA 2OTJI 1BBYA 2BV6A 2F5EA 3VPRA 2ECCA 3IP4B 2LK2A 2M4GA 4IQJA 2PQ8A 4RM3A 1K78A 4IRIA 4B44A 4D0PA 2E34A 2L01A 5FO5A 4QIRA 4YEJA 4YIIA 5IP9J 1NK3P 1J75A 3FXUA 2KLOA 1QBJA 1FSEA 4WK8F 1KU7A 1ZR4A 2DO7A 2E2IJ 2XSDC 2LNBA 1S5LC 3HBLA 2A69F 3K2AA 3QU6A 1O7FA 2UV1A 3JRDA 4NBQA 2P4WA 3DXJF 1FJLA 2YX4A 4ETSA 2R7ZJ 1YOVB 3AFHA 4XN4A 4XBFA 3GTQJ 3IHUA 5HLGA 3B3BA 1XB4A 2FMLA 4HZFA 4KYWA 2CUFA 4QTRA 1LPQA 3JT1A 1NK2P 3WQSB 1VQ6I 3MZHA 4A6EA 1ENHA 1WHUA 2VQHA 1R00A 3BZCA 3R4KA 1RPWA 2NRAC 1K5HA 4KFCA 1PVEA 3LSPA 2MSYA 4HSRA 2HGCA 4KMFA 5CKTA 2ME0A 3I0TA 1X1CA 2W1OA 3J81Z 3KEOA 1BJZA 2WAEA 4YELA 1N78A 1X3UA 3MZ8A 4R5XA 3RKQA 4I09A 5HLIA 2XAGA 5EEHA 1IW7F 3D5RC 3TOAA 1MW1A 3IIEA 2XGDA 4DYRA 1IRFA 1MD0A 1CGPA 2DDAA 2Z2SB 2V26A 4BEHB 2E19A 1R6RA 3ZN0A 3SDGA 5FLMJ 3GTKJ 3EUHA 1IZ1A 4DJAA 2DA5A 2MH2A 4F55A 2B0LA 3TEDA
chains in the Genus database with same CATH topology
2O7GA 2X1DA 1HS6A 4XN9A 3CHOA 3OIQA 1NG6A 4FLRA 5JAZA 3PSFA 3RC8A 2DT7B 2X1EA 4XMZA 4PJMA 3C2HA 3HOSA 1YX5A 2ZFUA 2Y0SA 2A6TA 3CMMA 4OAYA 4F93B 3OYLA 3EBIA 4FLQA 3HC7A 3MKYB 2VKDA 3S3NA 4MS6A 4BEHA 3DTEA 5DYFA 2MABA 2CUZA 2O5RA 3FTYA 1N75A 4E7SA 2GTQA 1FMWA 4NQWB 3ZQQA 3OYCA 4OOFA 4OOEA 3K10A 1X3ZA 2LG4A 1WJBA 4XKWA 3DPTA 1WJ5A 4F92B 4R5VA 3LFUA 1S9HA 3V42A 2PUSA 2KQRA 3VYTB 4XMTA 4ZX4A 4BACA 4XKBA 2Y1GA 1WJFA 3EBGA 3DU5A 1T1RA 2PJRB 3EBHA 2DQ6A 1K6YA 3R0IA 3FTUA 1MVYA 3H9JA 1BR4A 3FTZA 1G5AA 4NQWA 2I8DA 4CH7A 3FH5A 2DT6A 2E5NA 3CHQA 3FUIA 4E7LA 2KP6A 3E1SA 1Q0HA 3B37A 2DCEA 3F9KA 2BOLA 3FU0A 2L7KA 3EPZA 4J3BA 4AICA 1EA3A 4DBRA 2UWMA 3A14A 3FUDA 3KYLA 3HUGB 4ZDLA 4BDZA 1W36D 1LVKA 2BVLA 4ZW3A 2PJRA 1X19A 3FUFA 2HNHA 3HOTA 4KISA 1MW7A 3OY9A 2HPMA 4B43A 4XLHA 4QHPA 1OR7C 3K70D 4HNTA 2R72A 2OUMA 2WZGA 1JI8A 2W82A 1X3WA 4R79A 4BE1A 3VYRB 4XORA 3C2GA 2PL5A 4P5OA 2L5QA 4E7HA 2R7TA 3D5SC 3LSIA 3H35A 3KX2A 2A7OA 2KL4A 3FU5A 5TGTA 4II2A 1ONPA 3B7UX 4CA0A 1GLNA 3OR1C 4XLFA 2PMZA 3DTIA 3OYGA 4ZX5A 3CP2A 3L2QA 3S3MA 4GAAA 1Y56A 2M3AA 4F52A 3OS0A 3OYMA 4J00A 2B61A 3JSZA 1DP3A 3PUUA 4ZW7A 4CXFA 3OR2C 1QU3A 3BLYA 4XMUA 2Z1DA 1MNEA 2XAUA 4Y6RA 2UUZA 4C2TA 4E7ZA 4NC7A 4B47A 3CP8A 2W7NA 3WQQA 2CH0A 2R7WA 4QPQA 3VVMA 4CCKA 4AU7A 3IAM2 5JHFA 4FETA 2KZVA 4LIVA 4ZTFA 2XF5A 4DIQA 1LFPA 4XO4A 4Y67A 2JA2A 2X1CA 4C9YA 1MMGA 3VSKA 2KDOA 1OR7A 3FH8A 3G2BA 1YE9A 2OC6A 4A03A 2IS2A 3FULA 4PW4A 2XPZA 1VZ0A 2X6XA 4RVBA 2ZSIB 3CZKA 3L2VA 1LDKB 5CQEA 1Q0QA 3A4CA 3SEZA 3DLAA 4R7LA 4MKTA 3FUEA 1D1CA 2WBMA 3CJQB 3LSMA 3VYSB 2RQQA 3S8PA 4U7BA 2IS6A 2Z16A 4XMYA 3RSNA 4KT6A 4CCMA 4E7KA 4FLOA 1Z3YA 3CHRA 2XSJC 2JCVA 2R7SA 5EV7A 3LSGA 2HVSA 2LRDA 3QODA 1G8XA 2DJIA 2AQFA 4NNJA 3RASA 2WY7Q 4LG3A 3ANNA 3VSLA 5LFAA 2WADA 3HPHA 2M4KA 4XKCA 2WAFA 1D0YA 3K70C 2ZXGA 3PFYA 4BGDA 2KHMA 4Q4EA 3B7SA 2WY8Q 4IQ4A 2VLAA 2F4IA 1UG0A 1P9QC 3SYTA 2Q2EB 4HRIA 3QYFA 1ONOA 2MAOA 2BVMA 2IGOA 3N05A 5FROA 3EUKL 2JSPA 4CZCA 3EUAA 4HPQA 3M1CA 4K5PA 4CCJA 4AR8A 1U0JA 4KJZA 3FTSA 3BC8A 4Y6PA 3DWLE 4BUPA 1ZELA 4AYSA 2XF7A 1SG7A 4K5MA 2CMPA 4FASD 1UAAA 1T95A 2WAQA 4XM3A 3CZEA 3ANMA 2IGMA 2VJJA 2NOJB 3HPGA 3PNYA 4ZYAA 3UEQA 3OWTA 3PNTA 4PJJA 5JC1A 2ELJA 4L2LA 4B3XA 2HVQA 3FTVA 3OYDA 2LH9A 3U9WA 3ZHZA 3ANLA 2IS4A 2W00A 2XDVA 4BU2A 3OYKA 3DQVC 2VQCA 1DQUA 3OYEA 1MMDA 1S46A 4ZW5A 3DEEA 3M8JA 3A1YA 2P0WA 4X2UA 3CESA 4PFPA 4II3A 3S32A 3TMOA 2HPIA 3AL0B 4PUSA 3VWBA 1HA8A 2VJ4A 3DPUA 4XNFA 2VXDA 4PK4A 5AENA 1SAUA 3FUHA 1FMVA 2L9SA 2ZXIA 3OMYA 4RLFA 3B2PA 3FU6A 1WJCA 2FUG2 1AA7A 4PFOA 1X4OA 4BDYA 3OL3A 3Q44A 4XNAA 3TL4X 4E7JA 3LSHA 1R0KA 3VYUB 3B7RL 1YX3A 3K4CA 2JD2A 4P1WA 5JMPA 3UR3C 3ZXSA 4XLEA 4XLCA 3K4NA 5HNHA 4HEA2 2VL8A 2CW8A 2K5CA 1E0EA 4XKVA 3FKJA 2VPLA 3DPLC 4Q4IA 1MW2A 4E4HA 1V5FA 1BR1A 3FTWA 2LY2A 4FCAA 5JNLA 1Y6IA 2ZSHB 3LL7A 2V6EA 3DTKA 4Y4RA 4AR9A 1D1AA 3W3CA 4RSYA 1PJRA 4C30A 3FUJA 3S93A 3J7AY 4ZQEA 2JVGA 5HNFA 1BR2A 3A2KA 3CZLA 5JO0A 4CSWA 5FRMA 4E7IA 1TZLA 4PSXA 5LD2C 2MYSA 1X1BA 3A06A 4RCVA 4ZX3A 4BJTA 4XQFA 3OL4A 3ZR8X 4IZZA 3W2WA 4GRIA 2DOAA 4G6TB 3S3OA 4MLOA 4QPEA 1ONNA 1X1DA 1D0ZA 1Z7LA 2CUJA 3H5AA 2C5ZA 2K3PA 4OAZA 1MW3A 3CZGA 4FLSA 3ZRGA 4BE2A 4XN5A 4XL9A 2HPOA 3Q43A 1V5EA 2VIXA 4KP7A 2JCXA 3RTRA 2WZFA 3MMYB 1D0XA 3CHPA 4ZN6A 3H9GA 4HG2A 3I9V2 2MD0A 2IXSA 2KMUA 1BOBA 2V9KA 3K4BA 4N4NB 3UNGC 3FBNB 3OYNA 2CV0A 3W2AA 3CIAA 4PU2A 5JMWA 2VJIA 3VVLA 4BL0B 2RREA 5CQGA 4CCLA 1SC5A 3FHNA 3AKZA 4F3QA 3IUOA 4NC8A 4RMNA 4DGWB 4K5NA 2JVHA 3K6GA 4CCNA 2R7UA 2X6WA 5KNLA 2R7VA 1OLTA 2XC7A 2QKMB 3QOEA 1PYVA 2CW7A 1T0FC 1W36C 3RCOA 3L2RA 3PJRA 1SQMA 1QHGA 4K5OA 2WB1A 3K4MA 3FH7A 5KHDA 2C82A 2MC4A 3AUAA 5CPRB 3B2XA 4RLQA 4DPRA 4XN2A 3D5LA 3OYHA 3HL2A 4LUPA 2M7AA 3E0JB 2QKLB 2HDWA 2LY1A 3H9QA 2X51A 2K9LA 4N4OB 4ZX6A 2RJIA 4AR1A 4BQQA 2F6CA 2CV2A 1Q0LA 2XF6A 2QVWA 4BS9A 2LBFB 1WJEA 4XOTA 4ZQFA 1Z3XA 3OS1A 2HVRA 4XNBA 4QMEA 3BCBA 3FDYA 2R7XA 1KONA 3LMMA 3H0DA 2Y1FA 4XN1A 2GOMA 1V5GA 3RPUD 3RC3A 4XNDA 4XN0A 4AVZA 4KITB 4BXFA 2E1MC 2HQAA 2LYCA 4C2UA 3MD2A 3AL0C 3H5RA 4XN3A 5KCMA 2JCYA 1JG9A 3KEYA 2RNGA 4NUBA 2Y1CA 2W4SA 3UCQA 4CUGA 2V7FA 4LIUA 4ZW6A 2BW3B 3AU9A 1H3LA 2VB6A 4GAEA 4H4KC 4AYBA 2ZXHA 5FRNA 1JGIA 1WFXA 3DKYA 2FFLA 4ARFA 4ITVA 3MKZA 2LBFA 1H19A 1X4PA 1T1SA 2WPGA 2EGHA 2Q1ZB 1WJDA 5HOOA 3QJXA 2A5WA 3T8VA 1QHHD 2X85A 2CFOA 1GW6A 3SEQA 3GBGA 2E1MB 2XQ0A 3AU8A 4Y33A 4R5TA 2R7OA 2L9NA 3PNVA 2VJ8A 1WJAA 4YRVA 3HXLA 4BE0A 4XMXA 3T0YA 2BW3A 1D1BA 3OYJA 3NWSA 1RP3A 2V4JC 3OYFA 2VASA 4PJLA 4PVBA 2HPTA 1UELB 3SDBA 4B48A 2R7QA 3ZHXA 2R4GA 3HG9A 3FBIB 4IX7A 2F5VA 4ZQHA 2MFZA 4XR6A 3UERA 5JBIA 2L2OA 3ZCOA 2DXIA 2Y1DA 4BKXA 3FHEA 4BJ5C 3NWTA 1ZS2A 2LC2A 2WA0A 2Y1EA 4Y6SA 4XMVA 4F91B 1J09A 1TT0A 3K4JA 4XN7A 4XO5A 3RQ4A 5FWQA 3CJRB 2K9MA 2LREA 2KPMA 3PUBA 4J01A 3BG7A 3FUNA 1DGRM 1LKXA 2VQGA 3W2VA 1MMNA 2GOXB 4ANJA 4D9JA 3OS2A 3ZI0A 4JOMA 1MNDA 2HU9A 4EATA 2E60A 2AQEA 4XOPA 2KRCA 4D1QA 4BQNA 4ZC3A 3ZHYA 4XONA 1G59A 3B34A 2X6YA 3FU3A 2R59A 2IS1A 3QYBA 2JV7A 2M7BA 4QUOA 3CZ6A 3FUKA 3IP4B 4IKFA 2QJ1A 1N77A 4U87A 2M4GA 1NG7A 3BG6A 4IQJA 4RM3A 2JUGA 4HNUA 1ERDA 4B44A 4QIRA 3ONQA 4YEJA 3ZGKA 3H5NA 2E5ZA 1MMAA 3VDXA 2VKHA 4XO3A 2KLOA 3MKWB 3DU6A 2KRHA 2V1NA 3OYBA 2CV1A 3IAS2 2XPYA 3U21A 4LITA 4QPOA 3BCAA 3PSIA 4X0GA 1X1AA 3HKZA 4ZDPA 4PSWA 4DOZA 2LOOA 2UV1A 3EUHC 4K5LA 1DGWY 2VJ5A 3K4LA 2OV7A 4ZDOA 4RM2A 3LSKA 3TBIA 4ZW8A 3AFHA 1SFKA 1IRXA 3OYAA 4XN4A 5DULA 4OWRB 2R70A 3B3BA 4BQOA 4ZTJA 3WQSB 3JT1A 4JQFA 2VQHA 2VQLA 4HSTA 3SZGA 1Z21A 4DBQA 1K5HA 2JD1A 3L2UA 4HSRA 1R0LA 3I3LA 3K4KA 2IGNA 2PGGA 2DQMA 3OOUA 2CS3A 5CKTA 2VXZA 4ZQGA 4CCOA 1X1CA 2W1OA 5BPPA 3L2WA 2IGKA 4XMWA 4Y3OA 2M0MA 4E6KG 5DLLA 3B7TA 2WAEA 4YELA 1N78A 2R7RA 2MAPA 5HLTA 4R5XA 3OIPA 1JVSA 4ZJZA 3PL8A 3CF2A 4BJ6C 4JNDA 3D5RC 1MW1A 3IIEA 3CHSA 3FTXA 4ZQTA 4PJNA 2HZDA 2Z2SB 3FUMA 2V26A 4BEHB 1MW0A 3DKXA 5HVQC 1R6RA 3OYIA 4XLAA 3WQRA 2JD0A 4XN8A 4DJAA 4F55A 3QYEA 3KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNF A;  5HLT A;  5HNH A;  2VLA A; 
#chains in the Genus database with same CATH topology
 3B73 A;  1X3Z B;  4LFU A;  3V8L A;  4I6Z A;  5K7F A;  1BL0 A;  1K79 A;  3ZMZ A;  4HF1 A;  4FLR A;  2ELK A;  4GYI A;  2FBI A;  2X1E A;  4PJM A;  3C2H A;  4EGZ A;  5IT3 A;  4FLQ A;  2LP0 A;  4F93 B;  3IWF A;  5DYF A;  3DTE A;  3MWM A;  4JX4 A;  5F04 A;  3DLL F;  3H3U A;  4A0Z A;  1Q1V A;  3GXO A;  4LJZ F;  1FMW A;  2K40 A;  1I3A A;  4MQ9 F;  4HX7 A;  3K7A J;  1YHQ I;  2A61 A;  2LG4 A;  5FLX Z;  3JTG A;  3DPT A;  4RB3 C;  4R5V A;  3JW4 A;  2BYV E;  2PUS A;  3TO9 A;  2HXI A;  1T33 A;  1S7A A;  2YU9 J;  3RPQ A;  2EFN A;  2A6E F;  1I1G A;  4XMT A;  2K7L A;  4BAC A;  1WZ2 A;  3EBG A;  2QSG X;  2HOA A;  1RES A;  2JPC A;  3I54 A;  3HOY J;  4GO1 A;  2KRF A;  3R0I A;  1O7L A;  1MVY A;  1YI2 I;  3DBR B;  4NQW A;  4CH7 A;  1VQN I;  3FH5 A;  1JJ8 C;  2DPD A;  5D5X B;  2L9V A;  3BJO A;  2QSF X;  2HWV A;  5C3E J;  1IV8 A;  1YIT I;  4EJV A;  2BOL A;  3TP0 A;  3FU0 A;  4JBA A;  4AIC A;  3FM3 A;  1Z05 A;  3FUD A;  1IV6 A;  4U7D A;  4ZDL A;  4R8H A;  1LVK A;  4FX0 A;  2PJR A;  2L7Z A;  1X19 A;  3HOT A;  4JX6 A;  4IHX A;  4RA2 A;  1MW7 A;  4QHP A;  3K70 D;  1LB2 A;  4HNT A;  3O2P E;  3RZD J;  3WG9 A;  1F9N A;  1IUF A;  3DBL B;  2XAF A;  1HF0 A;  5F0H A;  4L18 B;  2JPB A;  3F8M A;  1FOK A;  1XDU A;  1BM9 A;  4II2 A;  5B1A H;  3CD6 I;  2DMQ A;  2J5O A;  3HUG A;  4CA0 A;  1EF4 A;  3WOD F;  2MBF A;  4XLF A;  3U1K A;  1XMK A;  4XIC A;  3F23 A;  4ZX5 A;  1H8A C;  2XPU A;  3CP2 A;  1G4D A;  2M3A A;  3W6J B;  3OS0 A;  4ZW7 A;  4O6J A;  4CXF A;  3JSZ A;  5F6F A;  4KDP A;  1A04 A;  4IEJ A;  1D8J A;  2VKE A;  2A5Y B;  4BBR J;  5FJ8 J;  1XMA A;  4WX9 A;  2W7N A;  3GWZ A;  1J7K A;  4M74 A;  2KZG A;  4CCK A;  5JHF A;  1T98 A;  2KZV A;  4I7H A;  4LB6 B;  2HQR A;  4NDL A;  2X9D A;  1LVA A;  3QAH A;  4DIQ A;  4XO4 A;  1YQA A;  2EZI A;  3FZV A;  2QCO A;  1Z67 A;  2ZCW A;  1MMG A;  2KDO A;  2CSO A;  3H92 A;  3G2B A;  4OMZ A;  3GZ5 A;  2IS2 A;  4Y15 A;  5FFZ A;  3ZMV A;  1GVJ A;  5CVV A;  3LAP A;  2ADU A;  1D1C A;  3KZI C;  3BJ6 A;  1R1T A;  4U0W A;  2XGE A;  2RQQ A;  3S8P A;  1BI2 A;  1HST A;  3RSN A;  1HKT A;  5F1R A;  4NB5 A;  2P7V B;  2X6O A;  1YIJ I;  1U78 A;  5EV7 A;  2DA3 A;  4AC0 A;  3H3V K;  2HVS A;  3QOD A;  3COA C;  3I59 B;  1AHD P;  2CW0 F;  1D5Y A;  2H6C A;  2K3F A;  5LFA A;  6PAX A;  3JRI A;  3P7N A;  2VBW A;  3I4M J;  1PDN C;  2ZXG A;  1OCC H;  4L9N A;  3L1P A;  3CCE I;  2PMZ N;  2JA5 J;  3NRV A;  3HKZ N;  3KZZ A;  3V7S A;  5EDN A;  2FOW A;  2Q2E B;  4HRI A;  4EGY A;  3ZQI A;  2BVM A;  2IGO A;  3K1N A;  2DYR H;  5H6R A;  3VEP A;  3BP8 A;  4HPQ A;  3P9K A;  4CCJ A;  3LAJ A;  1U0J A;  5GAH J;  4KJZ A;  5J47 A;  3FTS A;  3KE2 A;  3LQR A;  3TO6 A;  1ZAR A;  2HDC A;  3QU3 A;  2F48 A;  1WRJ A;  4AYS A;  2XF7 A;  2QBY A;  5D5U B;  4FAS D;  1ZG1 A;  3O6B B;  4A3L J;  5B1B H;  1W4M A;  3PUF A;  1TW3 A;  4MTD A;  1XDS A;  2M87 A;  2WC2 A;  3ANM A;  2TCT A;  3VOD A;  1L0O C;  1IXS B;  2NOJ B;  1D3Y A;  4XSX F;  4ZYA A;  2K86 A;  3PNT A;  4JP0 A;  4PJJ A;  2KIM A;  5DUK A;  4L2L A;  2HVQ A;  1VQP I;  3KP6 A;  2PMH A;  2IS4 A;  3ANL A;  2W00 A;  5M3F J;  4BU2 A;  2DI3 A;  2O8K A;  2HFH A;  5LRR A;  1Z6T A;  1MMD A;  4XRS A;  1MSE C;  3O8G A;  3A1Y A;  1PUF A;  4X2U A;  2FEZ A;  2JA6 J;  2XV4 S;  3KP2 A;  3TMO A;  2HPI A;  1IF1 A;  4PUS A;  3VWB A;  4GCV A;  2DA4 A;  3DPU A;  5JI6 A;  4I0A A;  2L7M P;  1WKM A;  2ZB9 A;  1WJC A;  2DA2 A;  1Y0N A;  2DW4 A;  4PFO A;  1J59 A;  1X4O A;  4L5I A;  2CQ7 A;  4E7J A;  4P1W A;  5JMP A;  1JE8 A;  1HKQ A;  1XGS A;  4ZYD A;  1ZRE A;  2K5C A;  3R0J A;  5LHG A;  4Q4I A;  1HW1 A;  1OJL A;  1LFB A;  5FD5 A;  4E4H A;  1XMX A;  3A0B C;  4FCA A;  3KCC A;  3S2D J;  1K78 B;  3WGI A;  3LL7 A;  2O9L A;  2V6E A;  3GO5 A;  4Y4R A;  3UKG A;  1MZB A;  3W3C A;  5H6Q A;  1XTA A;  3V4G A;  2QSH X;  4RSY A;  3FUJ A;  3CCY A;  4I2O A;  2EA4 A;  1QZY A;  2KJB A;  3ZMS A;  5DCM A;  1RI7 A;  5FRM A;  2LY9 A;  4WF2 A;  4OIN F;  1YYV A;  4M3D A;  3CDH A;  4AIH A;  2VBY A;  1XX5 A;  5JVG F;  4RCV A;  4ZX3 A;  3A06 A;  4UUS B;  3T8T A;  1I5Z A;  1TW2 A;  3ZR8 X;  4IZZ A;  3W2W A;  2HS5 A;  1R49 A;  3PIP F;  3GX4 X;  2HTS A;  2K3P A;  4MO7 A;  1X2N A;  1VFC A;  5K7Z A;  4BE2 A;  3S16 J;  3TW6 A;  3WTT C;  2VIX A;  3B6C A;  3MMY B;  1SMT A;  2FNA A;  1D0X A;  4Y52 J;  3DCF A;  1Y0U A;  3H9G A;  4QIW N;  2XKO A;  3FF5 A;  5ILU A;  4N4N B;  2KMU A;  2M30 A;  3QPL A;  3OYN A;  4W97 A;  4UVB A;  3G71 I;  1A35 A;  1SD4 A;  1O3T A;  3SJM A;  1CF7 A;  3CC2 I;  2PLY A;  4GFB A;  4KMU X;  4M3B A;  2HKO A;  2JVH A;  1I39 A;  5K7H A;  2EFQ A;  5FB2 A;  5EG0 A;  4KP7 A;  2CW7 A;  3GUD A;  3H0G J;  3GLX A;  2QZ8 A;  1MBE A;  4RBO A;  3OSG A;  1F43 A;  3G1M A;  4UB6 C;  4EQQ A;  3CCV I;  1W5T A;  3HL2 A;  3BJA A;  3CMY A;  1FOW A;  2M7A A;  2QKL B;  2LY1 A;  2V79 A;  2RNJ A;  1V54 H;  2A6H F;  3CC7 I;  3EYY A;  3PM1 A;  2RJI A;  4AR1 A;  5DD8 A;  4LG0 B;  4B09 A;  3ROU A;  1QVT A;  4WXD A;  1MBH A;  2XB5 A;  1Z9C A;  3ZMU A;  4QME A;  5EF6 A;  2OZ6 A;  3I53 A;  1KON A;  3H0D A;  3K0L A;  2WWY A;  4P9F A;  1XS9 A;  5FKL A;  1IN6 A;  3F8B A;  2GOM A;  1Q1H A;  5EYR A;  5DM7 F;  3BG3 A;  4AVZ A;  4BXF A;  2E1M C;  4C2U A;  3MCZ A;  5IP6 A;  2JCY A;  2NXN B;  2RNG A;  1RKT A;  2Y1C A;  3HIF A;  3UCQ A;  4IL6 C;  4LIU A;  5ERI A;  1JKP C;  3TW7 A;  4AID A;  3S14 J;  4EJO A;  4H4K C;  4AYB A;  4GAE A;  1WFX A;  2EZH A;  3MKZ A;  2JTV A;  2ZNZ A;  1T1S A;  2EGH A;  1WJD A;  5HOO A;  3QJX A;  1JGG A;  2ESH A;  3S15 J;  1QHH D;  2IPQ X;  3DFG A;  2CFO A;  1WSU A;  3HOU J;  1YW7 A;  2DQL A;  3NEU A;  4JX5 A;  4Y33 A;  4MEX F;  2R7O A;  2WB1 N;  2DPU A;  2GXB A;  2Z5U A;  3F6V A;  2YPR A;  3T0Y A;  5K1Y A;  1UEL B;  3ZMT A;  1FLI A;  1VQ4 I;  3ZHX A;  2R4G A;  4IX7 A;  1WH5 A;  4ZQH A;  2BHY A;  2IEK A;  4GYG A;  2IW5 A;  5D6F A;  4UV9 A;  4BY7 J;  2EB7 A;  4BYY A;  5A2Q Z;  1U6G A;  2EFP A;  2WA0 A;  2XAH A;  5BPI A;  4XMV A;  3K4J A;  2P5V A;  3RQ4 A;  5M5Y J;  5FWQ A;  3CJR B;  3CLQ A;  4WXC A;  4ANJ A;  3WU1 B;  2M5W A;  1MNM C;  1P7I A;  3ZI0 A;  5L3B A;  4JOM A;  2OU2 A;  1MND A;  2HU9 A;  5K5R A;  2E60 A;  2HYF A;  4ON0 A;  4AIK A;  9ANT A;  3ZHY A;  1G59 A;  2V1X A;  3B34 A;  4EEF G;  2JV7 A;  2NVU B;  1QO0 D;  1MBJ A;  4M6X A;  2QJ1 A;  3ML6 A;  2NAZ A;  1P4A A;  4RAG A;  5BOX A;  4HNU A;  4EM1 A;  2LLK A;  2JSC A;  2STW A;  2DLL A;  5FKM A;  3ZGK A;  4A5N A;  4Q5S F;  4KT5 C;  4XO3 A;  5A2Q K;  1XSD A;  1LDD A;  2KRH A;  2V1N A;  3OYB A;  3I56 I;  3GZN B;  3U21 A;  2EIN H;  4LIT A;  3ELK A;  3BCA A;  1ITY A;  1S7E A;  3PSI A;  2HR3 A;  1TWG J;  3ECO A;  4EMS A;  3HKZ A;  2EFW A;  4ZDP A;  1W7P A;  3PQJ A;  2DBB A;  2XRL A;  5JVT A;  1OYY A;  3EUH C;  3VB2 A;  4K5L A;  1MBK A;  4ZDO A;  3LSK A;  3TBI A;  5CJ9 A;  4ZW8 A;  1W0U A;  4OWR B;  3Q9S A;  1ZRD A;  3J80 Z;  5J1Y A;  4XSZ F;  3E6D A;  5GTH C;  1VQ5 I;  4FQG A;  1U8R A;  4JQF A;  5LGT A;  1JHF A;  2VQL A;  3IC7 A;  1PP8 F;  3SZG A;  2NNY A;  4DBQ A;  5J4Y A;  2O0Y A;  5HDN A;  5IYB J;  3L2U A;  4IHT A;  1Y8Q B;  1SAN A;  2DQM A;  2CS3 A;  4CCO A;  2ZC2 A;  5BPP A;  5JLW A;  1ZHF A;  3C2B A;  5DLL A;  2ZJP F;  2KIQ A;  4A6D A;  3QRF F;  2O03 A;  4IVN A;  4BJ6 C;  4OIR F;  4A0X A;  5KAI C;  3CHS A;  3GFJ A;  4PJN A;  5M3M J;  2VC1 A;  4DZJ A;  1G3Y A;  5HVQ C;  3OYI A;  3IRQ A;  3J80 K;  4A12 A;  4XN8 A;  3GTO J;  3KED A;  3BR1 A;  2QLZ A;  3JCU C;  1APL C;  3BR2 A;  1MH3 A;  3J7Y J;  4XN9 A;  1O3Q A;  2P8T A;  3CHO A;  2KKO A;  1K4S A;  5D8L B;  1YW9 A;  3FXO A;  1W0T A;  5JAZ A;  3I64 A;  3WTZ A;  2NYX A;  3RC8 A;  1TP4 A;  2DT7 B;  2R0Q C;  3FXM A;  1YX5 A;  2A6T A;  3CMM A;  4M71 A;  3OYL A;  1FP2 A;  3E3V A;  3GFM A;  2DQR A;  3K1M A;  3MKY B;  3LA2 A;  2FQ3 A;  3FTY A;  1N75 A;  1F36 A;  2VT3 A;  2HOS A;  2HOE A;  3WHB A;  1PUF B;  1KYW A;  3G4S I;  1R58 A;  2HOT A;  3L9F A;  2OF7 A;  4OOF A;  1H89 C;  1Z77 A;  4HAM A;  1I3Q J;  1JTX A;  1W5C C;  1AWC A;  4C3H J;  1ZAO A;  3CQZ J;  1S9H A;  3GLL A;  5L3F A;  5BMZ A;  3REO A;  2XAS A;  1EH8 A;  4LOC A;  2R5Y A;  1UG2 A;  3HOZ J;  2V9V A;  4XKB A;  3IH3 A;  1YS7 A;  3HB9 A;  3LST A;  1ULY A;  1T1R A;  2DFI A;  3TO7 A;  4BBS J;  2Y75 A;  1U9N A;  1P92 A;  1TNS A;  5EZG A;  1IJW C;  1G5A A;  2EIJ H;  2DT6 A;  5E1Z B;  4Q48 A;  3BOQ A;  4E7L A;  2QQB A;  5AON A;  3U1D A;  4HDU A;  2JQ7 A;  1Q0H A;  3B37 A;  5ICC A;  2ZJR F;  1BIB A;  4MEY F;  4MIM A;  4XRF A;  4DBR A;  2UWM A;  3MZY A;  2H1K A;  2RC4 A;  5HOD A;  3QP6 A;  3ABL H;  3ERM A;  3FUF A;  2BZT A;  2HNH A;  1U5T A;  3ZQC A;  1WWX A;  2ID6 A;  3BY6 A;  1BOA A;  1ZRC A;  4G9Y A;  1FIA A;  2FOK A;  5D4R A;  3OY9 A;  4XLH A;  2HPM A;  2Y0S N;  5EGO A;  1RUN A;  1MBG A;  2CGP A;  2W82 A;  1VF9 A;  1X3W A;  2VN2 A;  1WPK A;  2ETH A;  3FMQ A;  4FE7 A;  4UNO A;  2IA0 A;  2ELH A;  3C2G A;  4HV5 A;  1GDT A;  2W24 A;  3GYH X;  3H35 A;  3KX2 A;  3CLO A;  3JSP A;  2VOP A;  5DDG A;  1R1U A;  1YTY A;  4S0H B;  3QQA A;  3ZMD A;  1S3J A;  3L2Q A;  2MGQ A;  1FNN A;  2P6T A;  3A0H C;  4N9H A;  3LWF A;  4A69 C;  4F52 A;  3OYM A;  2K4B A;  4J00 A;  1BC7 C;  3OR2 C;  2VOD A;  3GTP J;  4L9T A;  1QU3 A;  3LA7 A;  2Z1D A;  1MNE A;  2XAU A;  3MKL A;  1J5Y A;  1UMQ A;  4C2T A;  4B47 A;  1X1P A;  1BW5 A;  1VQL I;  4PGH A;  4QPQ A;  4Q4Z F;  3KZY A;  1SFE A;  2VOO A;  5F27 A;  2EIL H;  3LNQ A;  4FHT A;  4LIV A;  4ZTF A;  3SZP A;  3CJT B;  2XF5 A;  1LFP A;  4M72 A;  1BN5 A;  2D1H A;  3Q9V A;  3RKX A;  2H8R A;  2O7O A;  1W5S A;  4B3A A;  3FUL A;  1VND A;  2XPZ A;  4PW4 A;  2X6X A;  2GIZ A;  2K9Q A;  3CZK A;  4X1E A;  5CQE A;  4Y17 A;  1T6S A;  3DLA A;  3HRS A;  4R7L A;  2R5Z B;  4WCG A;  4NC6 A;  1Z1D A;  2CWE A;  2MLG A;  2L3D A;  1ZH5 A;  2Z16 A;  4XMY A;  1HDP A;  4KT6 A;  3KP7 A;  4CCM A;  4E7K A;  3ZQL A;  1Z3Y A;  1I27 A;  2R7S A;  1KQ9 A;  1IN8 A;  2HEO A;  3LSG A;  1B4A A;  5LRS A;  3GTJ J;  1QZZ A;  2QGU A;  1HCR A;  5TJJ A;  3RAS A;  2AQF A;  1AKH A;  1O57 A;  4I0B A;  4LMY A;  3VSL A;  1TL8 A;  4A3D J;  4HLX A;  2M4K A;  4PCQ A;  2DT5 A;  1LE8 A;  4BGD A;  2KHM A;  3MN2 A;  5H2F C;  1G6N A;  2NS7 A;  2QQ8 A;  4XRS G;  4G7H F;  2L4M A;  3FM5 A;  1P9Q C;  4Y13 A;  1ONO A;  2MAO A;  1Z7U A;  5FFX A;  1XGO A;  3N05 A;  1FTT A;  2HQN A;  4M6V A;  5DYM A;  1WI3 A;  2ZXW H;  3N4M A;  2ISZ A;  3M1C A;  1FPQ A;  3J81 K;  4AR8 A;  1B9N A;  2Z33 A;  2EK5 A;  1FC3 A;  2E2J J;  4FT8 A;  1T95 A;  2WAQ A;  3S1R J;  3FHZ A;  5J6X A;  1IN4 A;  2PN6 A;  2W85 A;  3CCM I;  3HPG A;  2GXA A;  1ON1 A;  1B72 A;  1MJA A;  3OYD A;  2OCC H;  2XAQ A;  3CUQ A;  3T1B A;  4HF2 A;  1T0F A;  2JMW A;  2M1B A;  2XRN A;  2ISY A;  3WE2 A;  2MLK A;  4IXA A;  1NHA A;  2V9P A;  1VQ9 I;  1P6R A;  5J1R A;  3HOV J;  4OU0 A;  5CLS A;  4RB2 C;  3GZ6 A;  2Y9Z A;  2E35 A;  4II3 A;  1FT9 A;  3S32 A;  3KEQ A;  2ZO4 A;  4O3M A;  1HA8 A;  2E2H J;  2COB A;  4XNF A;  1SAU A;  1FMV A;  2ZXI A;  2VPR A;  1Y1V J;  1R4N B;  3OMY A;  4DZP A;  3B2P A;  2FUG 2;  4I98 B;  1E3H A;  1SAX A;  4ENM A;  1SVM A;  3V8J A;  4BDY A;  4IPA A;  3H36 A;  3VYU B;  1GXQ A;  3K4C A;  5FLX K;  4BHB A;  4RGS A;  2QWW A;  4XLC A;  3K4N A;  5HNH A;  4HEA 2;  2W84 A;  2VL8 A;  2CW8 A;  1QZE A;  3M1E A;  3FKJ A;  1YG2 A;  3F21 A;  5D8K B;  3U2R A;  3FTW A;  2LY2 A;  5IOZ A;  2EZK A;  3FK6 A;  4Q47 A;  4M9S A;  2ZSH B;  1FWZ A;  2QM3 A;  3DTK A;  3W6K B;  1R4M B;  3L00 A;  3NQO A;  4CYC A;  2IVM A;  3HDD A;  4XLP F;  2LF7 A;  3WHC A;  1DU0 A;  2JVG A;  3BPX A;  3CZL A;  5DD4 A;  3QP5 A;  3O8H A;  4ENN A;  1SFU A;  4E7I A;  3CTA A;  2EWN A;  3N97 A;  1D8K A;  5LD2 C;  1LUJ B;  3P9I A;  2PX9 A;  4BJT A;  1HDD C;  3G73 A;  2OZU A;  3A01 B;  3CCQ I;  3S3O A;  5J3L A;  2F2E A;  1D0Z A;  2CUJ A;  2BY3 A;  2HDD A;  4HOB A;  1MW3 A;  1GVD A;  3CZG A;  3ZRG A;  3WTX C;  4AIJ A;  4OOI A;  2HPO A;  1SD7 A;  2VKV A;  2F4M B;  3TKY A;  3MVP A;  1OCP A;  4ZN6 A;  4HG2 A;  3F8F A;  3I9V 2;  1W1W E;  2BE5 F;  1BOB A;  3CIA A;  3FBN B;  4MHG A;  2PEX A;  5HS7 A;  3VVL A;  1JT0 A;  2RRE A;  5CQG A;  2O3F A;  2P5K A;  5DCF A;  2CU7 A;  3JRF A;  2KT0 A;  1SC5 A;  1FBQ A;  4F3Q A;  4NC8 A;  3WU0 A;  2GXG A;  2FD5 A;  3WTW C;  5KVR A;  1K61 A;  3K6G A;  2PFB A;  4M6Y A;  1I50 J;  3FIW A;  1OCO H;  2H94 A;  4CCN A;  5ED4 A;  3ERE D;  2R7V A;  2XC7 A;  3PJR A;  1QHG A;  3K4M A;  1QRY A;  4B4C A;  2XAJ A;  3V7C A;  4RLQ A;  3VOE A;  4DPR A;  4A3E J;  3DKW A;  1E3P A;  3LSJ A;  5F0F A;  1MBF A;  3CME I;  4S05 A;  3H9Q A;  3J7A O;  1JUS A;  2K9L A;  2FX0 A;  1ETV A;  5L3C A;  5DTD A;  2O61 A;  3ABM H;  2E1O A;  2DOE A;  5HLH A;  2XF6 A;  1ONV A;  2DU9 A;  1AU7 A;  1WJE A;  4XOT A;  1GV5 A;  3BCB A;  1XSV A;  2V6C A;  3HSR A;  3B02 A;  3TDU C;  2R7X A;  4MTE A;  4XN1 A;  2QVO A;  1V5G A;  1YRN B;  3EDP A;  3KPH A;  1HW2 A;  4XN0 A;  4KIT B;  4GGG A;  1PP7 U;  2R93 J;  2XIG A;  3H5R A;  2MH9 A;  2KIF A;  3GCM A;  3OIO A;  1YFH A;  1IGN A;  2V7F A;  2BW3 B;  1RIO H;  4ZYH A;  1H3L A;  3SFZ A;  2LFB A;  2ZXH A;  2FFL A;  3CCS I;  2LBF A;  1H19 A;  1X4P A;  4EJT A;  4OIP F;  2K85 A;  2KDZ A;  5ILS A;  4ENJ A;  1EJ9 A;  3CCJ I;  3T8V A;  2O8X A;  2D2W A;  1I6H J;  3SEQ A;  3GBG A;  1EKE A;  2E1M B;  1RR8 C;  3MQ0 A;  2ID3 A;  2XQ0 A;  4Z6Y A;  4ENK A;  1RZ4 A;  3PNV A;  2JK3 A;  4M3F A;  1WJA A;  5E3L A;  4XMX A;  4A3M J;  3HGG A;  1O4X A;  1D1B A;  2GM4 A;  4PJL A;  2HPT A;  2R7Q A;  3M9A A;  3HG9 A;  2B63 J;  5M5W J;  3CDI A;  3BZK A;  1Y8R B;  4V2G A;  4UUV A;  1H9T A;  1U5T B;  2L2O A;  1S29 A;  3ZCO A;  3J7Z I;  4IRG A;  2DXI A;  1T56 A;  4M3G A;  4BKX A;  4RAZ A;  3FHE A;  2CQN A;  1ETW A;  3NWT A;  4WXH A;  5EGO B;  4LK1 F;  2LC2 A;  4Y6S A;  1DP7 P;  1J09 A;  1K6O A;  3ZQF A;  1SEU A;  2EQR A;  4CYD A;  1OKR A;  1MGT A;  2K02 A;  2K9M A;  2LRE A;  2F5F A;  1M1E B;  3PUB A;  1DGR M;  1LKX A;  2WV1 A;  1ZR2 A;  1MDM A;  3CC4 I;  4J19 A;  2IT0 A;  4EAT A;  2R92 J;  2AQE A;  1UB9 A;  3KFW X;  3M07 A;  4BY1 J;  4ZC3 A;  3FMR A;  2X6Y A;  3FU3 A;  1R5G A;  2X4H A;  4UXN A;  4E70 A;  2AXT C;  2XPW A;  2YUS A;  3TP3 A;  1B9M A;  1N77 A;  3S17 J;  1NG7 A;  3BG6 A;  1J9I A;  2JUG A;  1RNL A;  2HTJ A;  4P9U A;  4V2F A;  3E6M A;  3ONQ A;  2EV6 A;  1P7J A;  3LA3 A;  3H5N A;  2E5Z A;  1MMA A;  1VQM I;  3VDX A;  2JZY A;  5C44 J;  1SFO J;  1IXR C;  4AVP A;  2D5V A;  5IY5 H;  3GTG J;  2DOF A;  3M8F A;  2Y9Y A;  4A0Y A;  4X0G A;  4EM2 A;  4DOZ A;  2LOO A;  2L54 A;  1YIO A;  1ETQ A;  4YG2 F;  2E7W A;  1K4T A;  2VJ5 A;  1SD5 A;  4G94 A;  4DQ2 A;  1LEB A;  5JLX A;  3O3K A;  4JYK A;  4Z2Y A;  2R70 A;  4P96 A;  3KIO A;  1V55 H;  4BQO A;  4ZTJ A;  3I4P A;  3P9C A;  3ZQG A;  2D1V A;  3HHG A;  3C3W A;  1AKH B;  1ZGW A;  2ZJ2 A;  4A93 J;  3BPV A;  1G3W A;  1R1V A;  1JGS A;  3RPU A;  3TDZ C;  3FK7 A;  1R0L A;  4HW0 A;  3B6A A;  1TWC J;  4BXU A;  3K4K A;  1TQP A;  2W48 A;  4G7Z F;  1REP C;  4P55 A;  2PGG A;  4ZQG A;  3AG2 H;  4IOC F;  5D5W B;  5DEQ A;  2P6S A;  3L2W A;  5IP7 J;  2M0M A;  1IN5 A;  3G3Z A;  2FMY A;  4HQE A;  1S8N A;  3B7T A;  2MAP A;  3OIP A;  1FX7 A;  1JVS A;  1KU9 A;  4JND A;  3PL8 A;  4MQV A;  1VQK I;  4X6A J;  4B8X A;  3AG4 H;  3C1D A;  1A5J A;  1QVU A;  2HZD A;  1LEA A;  3FUM A;  1RUO A;  2IAI A;  1ETK A;  1MW0 A;  3WQR A;  5EZH A;  1OYW A;  2JD0 A;  1K83 J;  2H8W A;  2X1D A;  1HS6 A;  1VI0 A;  1WVR A;  4L5E A;  5CVR A;  2J5P A;  1HLV A;  4HYE A;  4XLN F;  2EV0 A;  1NG6 A;  2JN6 A;  3DEU A;  1B72 B;  1T8I A;  4XMZ A;  1FIP A;  3R60 A;  3HOS A;  2ZFU A;  2QF7 A;  3EBI A;  2RVC A;  5J8C A;  3HC7 A;  2VKD A;  3ESW B;  3S3N A;  4MS6 A;  4BEH A;  4CO8 A;  2MAB A;  5L3E A;  1YLF A;  2O5R A;  3F72 A;  4EJW A;  4E7S A;  1RR7 A;  1U5T C;  4L9V A;  3HJE A;  1D5V A;  1WCM J;  4NQW B;  5CYV A;  3ZQQ A;  1IRZ A;  2D45 A;  1FOX A;  3BQY A;  1X3Z A;  5FKK A;  5DM6 F;  5IPA A;  1WJB A;  4KUM A;  2BXY A;  1JKO C;  2E1N A;  1WJ5 A;  3LFU A;  2LSO A;  3V42 A;  2L4A A;  2KQR A;  3E5X A;  3VYT B;  3CUO A;  2Y1G A;  1WJF A;  2PJP A;  3DU5 A;  2CO5 A;  1TC3 C;  2PJR B;  4KN4 X;  3EBH A;  2DQ6 A;  3HRU A;  1NTC A;  3H9J A;  1OPC A;  3FTZ A;  2GAU A;  1UFM A;  3BWG A;  2K9S A;  4HLY A;  2I8D A;  2YSR A;  3LQQ A;  2E5N A;  3OOP A;  2VUM J;  3CHQ A;  1RRJ A;  3HSF A;  2RQP A;  2DCE A;  3F9K A;  2G9W A;  2L7K A;  3EPZ A;  1E2X A;  4A5M A;  2ACJ A;  4A3C J;  3A14 A;  4CYC B;  3KYL A;  3HUG B;  5D4S A;  4DYQ A;  2BVL A;  3NAR A;  4ZW3 A;  1HSJ A;  1F4K A;  1R7J A;  2M8G X;  3HRT A;  2OTL I;  1UHM A;  4B43 A;  2TRT A;  2R72 A;  3FMS A;  1GUU A;  2YU3 A;  4R79 A;  4U88 A;  4TV7 A;  2PL5 A;  5E18 F;  2R3S A;  4P5O A;  4RB1 A;  4E7H A;  4KN7 X;  3WTV C;  3LSI A;  2V1U A;  1JUP A;  2R7T A;  3NAU A;  2A7O A;  2KL4 A;  5TGT A;  1ONP A;  4N9I A;  4ZYE A;  1QQI A;  1G3S A;  2M34 A;  1GLN A;  1TBX A;  5E1X A;  2PMZ A;  1P4X A;  2GWR A;  1B6A A;  2M2E A;  2NS8 A;  3OYG A;  1ZQ3 P;  2BEO A;  3S3M A;  2IJL A;  2Y31 A;  1IXC A;  3EQL F;  4RGR A;  1DP3 A;  3WE3 A;  3WTY C;  4DNC A;  4XMU A;  3BLY A;  4FX4 A;  1ETO A;  2NVT J;  4Y6R A;  1T38 A;  4E7Z A;  2DMP A;  1WQ2 A;  1T39 A;  3WQQ A;  2CH0 A;  2LKX A;  1OMI A;  4AU7 A;  3IAM 2;  2FSW A;  4FET A;  4IF4 A;  1S72 I;  2DMT A;  1Z91 A;  5E3M A;  3HTS B;  4Y67 A;  1OCR H;  1BA5 A;  1XSX A;  4C9Y A;  5GAG J;  4IO9 F;  1OR7 A;  3P5J A;  4KIB A;  2EZL A;  1YE9 A;  2VI6 A;  2OC6 A;  3E6B A;  5KAF C;  4A03 A;  2M0C A;  4ZYG A;  2OPT A;  1KA8 A;  4RVB A;  1B1B A;  2ZSI B;  3F22 A;  4BHC A;  1R5I D;  5E3N A;  4MKT A;  3FUE A;  2WBM A;  3CJQ B;  4IJA A;  4R1H A;  2JUC A;  4PJ0 C;  3VYS B;  1MSF C;  4N0B A;  1XCV A;  3DF8 A;  2MW8 A;  4FLO A;  1ORK A;  4BH9 A;  2JCV A;  5D5V B;  4KIF A;  1JHH A;  2BY0 A;  2LRD A;  1G8X A;  2DJI A;  5C4J J;  3CUQ C;  2N8G A;  3ANN A;  2GIV A;  1X58 A;  2Y69 H;  3RKY A;  2WAD A;  3HPH A;  1D0Y A;  1H0M A;  4IHS A;  4KA4 A;  3PFY A;  2QBY B;  3GME A;  4V19 K;  4Q4E A;  4CIC A;  2B9S A;  3B7S A;  3GEZ A;  2BXZ A;  3Q0W A;  4IQ4 A;  1E17 A;  2F4I A;  3C18 A;  3KYD B;  3WGH A;  1UG0 A;  3E97 A;  3ISP A;  4JK1 X;  3SYT A;  2KIS A;  5CVI A;  2DK8 A;  2JSP A;  4CZC A;  1UZC A;  3I59 A;  3BZ6 A;  2F5D A;  3BC8 A;  3GVA A;  4UVC A;  5ILV A;  3DWL E;  3BDD A;  4LD5 A;  5ICG A;  1HKS A;  1T08 B;  1SG7 A;  4K5M A;  2K27 A;  5IOY A;  1UAA A;  1ZGA A;  2L7F P;  2NVQ J;  4D5F A;  3FXK A;  2VJJ A;  3ASO H;  1KU2 A;  2JT1 A;  2Q2E A;  4MNU A;  1XGM A;  2FNP A;  3KP5 A;  4B3X A;  1IAW A;  4QSH A;  1JKQ C;  2MA3 A;  1G2H A;  2XDV A;  1J0R A;  5HS8 A;  3OYK A;  3IH4 A;  2VQC A;  1DQU A;  1Z0X A;  5JFR A;  1QPI A;  4ZW5 A;  4CZZ A;  1U8B A;  1O3S A;  4CGZ A;  3CES A;  4PFP A;  3DEW A;  1FBU A;  1TT5 B;  4B1R A;  1YJN I;  3AL0 B;  1JKR C;  2DMN A;  2C6Y A;  4LLG F;  2Q8K A;  3BG5 A;  2DA1 A;  2VXD A;  3QPH A;  4PK4 A;  3DP7 A;  1DU6 A;  3FU6 A;  4I01 A;  3FUH A;  5L3D A;  3MFK A;  3KET A;  3S2W A;  5DUI A;  3OL3 A;  3Q44 A;  1A36 A;  4I99 C;  4XNA A;  3D0S A;  3B7R L;  1YX3 A;  2W25 A;  5FLV A;  5DCM B;  2JJ7 A;  3RDI A;  3UR3 C;  2OAZ A;  5AIP A;  2JRT A;  1SFX A;  2O6G E;  4IHV A;  2UXN A;  2VPL A;  1WI9 A;  3IH2 A;  2CYY A;  1P2F A;  3I5U A;  1IN7 A;  4KNY A;  5B3S H;  3JRG A;  1FOY A;  3U9G A;  2LR8 A;  4ZH4 F;  4G6D A;  2HYJ A;  1D1A A;  5DS9 A;  4G7O F;  3ASN H;  1KQ0 A;  2I5U A;  3S93 A;  2ZBK A;  3S1Q J;  3J7A Y;  1R36 A;  5HNF A;  2AS5 F;  1BR2 A;  1SMY F;  3W6V A;  2VON A;  4CSW A;  1ZGJ A;  4MGR A;  1DUX C;  2LMD A;  1FYM A;  1TZL A;  2MYS A;  1TWA J;  3OL4 A;  5J8F A;  1LFU P;  4GRI A;  2DOA A;  4QPE A;  2BBY A;  1DDN A;  3V7R A;  1CF7 B;  1ONN A;  1Z7L A;  4LB5 A;  2C5Z A;  4OAZ A;  1KGS A;  1XD7 A;  1GT0 C;  3ZQH A;  4XN5 A;  1V5E A;  5E3O A;  5EG0 B;  3RTR A;  4L0Y B;  1ETY A;  2WZF A;  3D1N I;  2L0K A;  5FD6 A;  2XGX A;  3AG1 H;  2IXS A;  2V9K A;  3K4B A;  3W2A A;  1LJ9 A;  4PU2 A;  4UUS A;  2OCE A;  1JUM A;  3LOC A;  1POG A;  3ZOB A;  1A6Q A;  2P5L C;  3TQN A;  4DGW B;  4D5C A;  4K5N A;  3FXJ A;  4A3B J;  3BR0 A;  2FJ1 A;  1TWF J;  2HQ5 A;  2RV8 A;  5HS9 A;  1OLT A;  5B5E C;  1ZYR F;  2QKM B;  3QOE A;  4PGG A;  3RCO A;  1SQM A;  3JRE A;  4AUX A;  5BPD A;  1FSH A;  2WB1 A;  3FH7 A;  2C82 A;  3L09 A;  1IG7 A;  4M3E A;  1W7P D;  1EH6 A;  3BTC A;  2EIM H;  1FEX A;  3HYI A;  3OYH A;  3FXR A;  2ZFW A;  2ECB A;  1YJ9 I;  2JA7 J;  3E0J B;  1ZLK A;  2X51 A;  5E1W A;  4ZX6 A;  2IBD A;  4BQQ A;  1HBX G;  2F6C A;  2ZNY A;  1VTN C;  2VC0 A;  2STT A;  1Q0L A;  3I71 A;  4BS9 A;  4UHT A;  3IKT A;  4ZQF A;  2HVR A;  5IT9 Z;  4KIC A;  4F7Z A;  1A6I A;  3FDY A;  3LMM A;  1UST A;  3WTS C;  1NH3 A;  2FE3 A;  2OJE D;  4FIS A;  3RC3 A;  2M45 A;  1HOM A;  2YR2 A;  4HA8 A;  3I4N J;  4XND A;  3JR9 A;  3QPS A;  2HQA A;  2LYC A;  3TGN A;  3MD2 A;  3L2C A;  3R6S A;  4ZZL A;  3K69 A;  3AL0 C;  5KCM A;  1KQ8 A;  1HXD A;  1JG9 A;  4NUB A;  3JTH A;  2W4S A;  1QNT A;  4Y7N J;  4HBL A;  3AU9 A;  4ZW6 A;  4LG0 A;  2JA8 J;  5EEG A;  3DKY A;  2R7F A;  3ZPL A;  1IDZ A;  4ARF A;  3F8N A;  2Q1Z B;  4K2E A;  1V4R A;  3CO7 C;  3EYI A;  4EV0 A;  1TWH J;  2X85 A;  2DN0 A;  2QEN A;  4A3J J;  2RN7 A;  4A3F J;  4R5T A;  5HDK A;  2L9N A;  5IT9 K;  1QGP A;  1TQM A;  1XPX A;  3IL2 A;  4BE0 A;  1QA6 A;  3RYR A;  3RZO J;  3OYJ A;  3ABU A;  3NWS A;  1RP3 A;  3OYF A;  1JT6 A;  2ZKZ A;  4PVB A;  3JRH A;  3SDB A;  3SFI A;  1DPU A;  2F5V A;  1ZKG A;  2MFZ A;  4AD9 A;  1VQO I;  4XR6 A;  3UER A;  1G3T A;  4YFK F;  5ICE A;  3TOB A;  4U0V A;  5JBI A;  5F0C A;  2Y1D A;  4BJ5 C;  3ZP5 A;  2EA2 A;  5LHH A;  3A02 A;  5J40 A;  2Y1E A;  2GLO A;  2CRG A;  4HX8 A;  3FWE A;  4H0E A;  4XN7 A;  4XO5 A;  2GBY A;  2KPM A;  3FUN A;  3KLO A;  5LEJ A;  3W2V A;  2VQG A;  3OS2 A;  2GOX B;  1ZN2 A;  3OV8 A;  3CXB A;  4L9J A;  3FXL A;  4RGX A;  4D1Q A;  2KRC A;  3IRR A;  4BQN A;  4BXX J;  2Y48 A;  4XON A;  4S04 A;  5L3G A;  4OIQ F;  2G7H A;  1VQ8 I;  4RGU A;  3GFL A;  3QYB A;  2M7B A;  3CZ6 A;  2OQG A;  4AYB N;  1W7P B;  4C3I J;  3FUK A;  5EEA A;  1FP1 D;  5JHU A;  4IKF A;  5J4V A;  2HKX A;  4U87 A;  3OSF A;  1WH7 A;  1ERD A;  1USS A;  1K7A A;  1SVL A;  3Q0U A;  1R22 A;  2VKH A;  4OIO F;  3ZQ7 A;  3MKW B;  3DU6 A;  1WGX A;  2YX7 A;  4UVA A;  2CV1 A;  3IAS 2;  2L9R A;  1GXP A;  2XPY A;  1BI0 A;  3BR5 A;  5DV5 A;  4QPO A;  2QQA A;  1FZP B;  1BJA A;  1X1A A;  2ZME A;  1GHC A;  3K1P A;  4PSW A;  2KFD A;  3LFK A;  3S1M J;  5M5X J;  1DGW Y;  2EBI A;  3K4L A;  1IO2 A;  2OV7 A;  2XUB A;  3F0C A;  4M9X A;  4RM2 A;  4ESJ A;  2K9N A;  1SFK A;  1IRX A;  3OYA A;  5DUL A;  2A05 A;  3RJP A;  5FKN A;  2VBZ A;  2DA7 A;  3SQN A;  2H27 A;  5E17 F;  2Z9O A;  3F6O A;  3WG7 H;  4HST A;  2CJJ A;  3M3Y J;  2CUE A;  1OIS A;  1Z21 A;  3R0A A;  4BAY A;  2JD1 A;  2LDU A;  4FTH A;  1EH7 A;  2DFH A;  3I3L A;  2IGN A;  3OOU A;  2VXZ A;  2W57 A;  2XVC A;  1OCZ H;  2IGK A;  4XMW A;  4Y3O A;  4E6K G;  3CCL I;  4MFD A;  2R7R A;  2V1D A;  5HLT A;  2QQ9 A;  2X48 A;  4W1U A;  3RYP A;  4ZJZ A;  4GDF A;  3A03 A;  3CF2 A;  1U2W A;  5EJC A;  5GP9 A;  3FTX A;  4ZQT A;  1DPR A;  3R61 A;  3FKI J;  1JJ6 C;  3K9T A;  3DKX A;  1YS6 A;  1U9O A;  3GF2 A;  4XLA A;  3G6E I;  2DA6 A;  3QYE A;  1HC8 A;  4XID A;  2DYS H;  5KK1 A;  2O7G A;  2XPV A;  1TNT A;  3OIQ A;  3WU2 C;  2FBK A;  1UJ8 A;  1OCT C;  3PSF A;  3RKW A;  1QPM A;  2R5Y B;  1ZTR A;  2QUF A;  2Y0S A;  4OAY A;  2H1L A;  3BQZ A;  4HF0 A;  2DTR A;  3HZJ A;  2RDP A;  2NS0 A;  2CUZ A;  3V8K A;  1E3O C;  3GFI A;  2GTQ A;  1XGN A;  3OYC A;  2FRH A;  3PQK A;  1SVO A;  4OOE A;  3K10 A;  4O5V A;  1XC5 A;  2BY1 A;  2WV0 A;  4XKW A;  3BRO A;  4F92 B;  1H88 C;  1XN7 A;  5E79 C;  4YIR X;  1ETX A;  3T8R A;  3MEX A;  4FE4 A;  2EPF A;  4ZX4 A;  2PI0 A;  3VFZ A;  3Q3S A;  2LD5 A;  1K6Y A;  2NNN A;  3FTU A;  2G7U A;  1BR4 A;  1X2M A;  2AO9 A;  1YJW I;  3HEF A;  4I76 A;  3CCU I;  1TTY A;  1BC8 C;  3RQI A;  2MC3 A;  1J2X A;  1X3W B;  3FUI A;  2KP6 A;  1ZLJ A;  3WGG A;  2WTE A;  3E1S A;  3SHF A;  2X0L A;  2VBX A;  4J3B A;  1EA3 A;  1A31 A;  2HYG D;  2JRM A;  2A68 F;  1TQI A;  4BDZ A;  3E6C C;  2E1C A;  1W36 D;  1B8I A;  3JAM Z;  5J1U A;  4XRM A;  5ICF A;  2K4J A;  2PG4 A;  4ABZ A;  1OYI A;  4KIS A;  2F4O B;  1ON2 A;  2HI3 A;  3KYC B;  2B7E A;  1OR7 C;  3Q0V A;  4BNC A;  3C7J A;  2LVS A;  2OBP A;  2OUM A;  2CQQ A;  3I58 A;  5FGM A;  3CO6 C;  4IHW A;  2WZG A;  3PFI A;  1JI8 A;  2XGC A;  2BHZ A;  5E8I A;  4BE1 A;  3VYR B;  4XOR A;  5E8G A;  2L5Q A;  3H1C A;  2EV5 A;  1ODD A;  3D5S C;  4A3K J;  2QYO A;  1FYK A;  2E36 A;  4BQA A;  3S1N J;  3FU5 A;  4RAF A;  4AM3 A;  3B7U X;  3CJN A;  2Y30 A;  2EIK H;  3OR1 C;  3HW2 A;  3WTU C;  3DTI A;  4QLC U;  1RC9 A;  4GAA A;  1Y56 A;  2B61 A;  3PUU A;  4D7N A;  4C2M J;  1HQC A;  5IYC J;  1BW6 A;  3JAM K;  3F8C A;  1MMS A;  2UUZ A;  4YFN F;  4NC7 A;  4PZJ A;  2E71 A;  3CP8 A;  2R7W A;  2GA2 A;  1IRG A;  3VVM A;  2XHK A;  1MKM A;  2DAO A;  2ZJQ F;  3M8E A;  4PDK A;  3QWL A;  4RDU A;  4WWC A;  2LKS A;  2JA2 A;  1C0W A;  2X1C A;  1B59 A;  3VSK A;  1MH4 A;  3FH8 A;  1IDY A;  2GA1 A;  3FXQ A;  4OMY A;  1VZ0 A;  1UHS A;  1LE8 B;  3BG9 A;  5K5Q A;  1LDK B;  3L2V A;  1Q0Q A;  3A4C A;  3HRM A;  3SEZ A;  1MJB A;  4EVI A;  2LF8 A;  5IYD J;  4ZZD A;  2R7D A;  3LSM A;  2IA1 A;  3JRA A;  3X2Q H;  4U7B A;  2IS6 A;  3CMA I;  3DV8 A;  1I6X A;  5LEK A;  3HOW J;  3CHR A;  2XSJ C;  4RS8 A;  2TDX A;  4NNJ A;  4D7M A;  2WY7 Q;  2M8E A;  4LG3 A;  5GPC A;  4LLL A;  1YO5 C;  3GTL J;  3ZN1 A;  4XKC A;  2WAF A;  2ICW G;  4HNV A;  2G0E A;  1RKW A;  3M7G A;  5LLQ A;  3K70 C;  3S2H J;  1XG1 A;  1EV7 A;  2EH3 A;  2FF4 A;  1Z6R A;  2KIU A;  2WY8 Q;  4LGW A;  2VLA A;  2R5Z A;  2P81 A;  2CQX A;  3CCR I;  2DTZ A;  3E5U A;  2EFO A;  3HHH A;  2A07 F;  1ZG3 A;  3QYF A;  2NVY J;  4L0Z B;  5FRO A;  3EUK L;  4IRH A;  1LDJ A;  1N25 A;  3CUQ B;  3EUA A;  4IHY A;  1UHW A;  4K5P A;  3Q5F A;  4AWX B;  2VE8 A;  4HDV A;  2VT2 A;  4Y6P A;  4BUP A;  1ZEL A;  2ME6 A;  2XB0 X;  2CMP A;  1F5T A;  2JWT A;  4XM3 A;  3CZE A;  4CHU A;  3IKV A;  2PMU A;  2IGM A;  2OA4 A;  5C4X J;  4L5J A;  2DJN A;  1FY7 A;  2KJC A;  3PNY A;  2I10 A;  3UEQ A;  3OWT A;  3SXY A;  5JC1 A;  3LSR A;  2ELJ A;  2XRO A;  3KP4 A;  3FTV A;  2LH9 A;  3U9W A;  1P4W A;  3ZHZ A;  4KIG A;  3K2Z A;  3QPT A;  3PO3 J;  2CQK A;  2QA4 I;  4UB8 C;  3DQV C;  3OYE A;  2BGC A;  3CDL A;  3JRB A;  4A3G J;  1S46 A;  2OD5 A;  3RIR A;  3DEE A;  3M8J A;  2P0W A;  5D6E A;  3GTM J;  1STZ A;  2DK5 A;  2EJR A;  4M73 A;  2NVX J;  1ZRF A;  1BI1 A;  4ASN A;  3E7L A;  1S7O A;  2GZW A;  3JSO A;  3MAJ A;  2VJ4 A;  2F5C A;  5AEN A;  5F64 A;  2L9S A;  4RLF A;  2QEX I;  2FA5 A;  3QOP A;  2RGV A;  1AA7 A;  4CDG A;  1FBS A;  3KP3 A;  2ESN A;  3TL4 X;  1R0K A;  3LSH A;  4IOA F;  1S6L A;  2JD2 A;  3ZXS A;  4XLE A;  3HM5 A;  4I02 A;  2FBH A;  3GW2 A;  1E0E A;  5HDG A;  5F1J A;  4XKV A;  2AHQ A;  1T2K A;  3ABK H;  3DPL C;  1MW2 A;  1V5F A;  1BR1 A;  1KZH A;  3M4O J;  4UUT A;  3EET A;  5GTI C;  3PIO F;  1R71 A;  5JNL A;  3HGY A;  1Y6I A;  3JRC A;  1HW5 A;  4AR9 A;  3IWZ A;  5CVJ A;  2WAQ N;  2P7C B;  1PJR A;  4BHP A;  4C30 A;  4M9Z A;  4C3J J;  4ZQE A;  3A2K A;  5JO0 A;  2PBI A;  5BNG A;  4RB0 A;  3PO2 J;  5GPA A;  2ZME B;  4LLN A;  1JTY A;  4PSX A;  1R23 A;  2MD5 A;  1X1B A;  4EJU A;  3AG3 H;  4XQF A;  2LKP A;  4G6T B;  4MLO A;  4EM0 B;  1X1D A;  3H5A A;  1AOY A;  1MJ9 A;  4FLS A;  3FX3 A;  2UXX A;  4XL9 A;  3Q43 A;  1BI3 A;  5BS6 A;  5K5O A;  2JCX A;  4UY8 I;  2Q0O A;  2M9H A;  3CHP A;  3ULQ B;  2MD0 A;  5GAE J;  2H09 A;  3UNG C;  3E5Q A;  5GAD J;  2CV0 A;  1JXS A;  5JMW A;  2VJI A;  4QWQ A;  4BL0 B;  4A2U A;  3A01 A;  1GV2 A;  4CCL A;  1SC7 A;  3HTU A;  4DYC A;  3FHN A;  3AKZ A;  2FXA A;  3IUO A;  4RMN A;  2FQ4 A;  3DBH B;  1V3F A;  2HZT A;  4HV6 A;  3RI4 A;  4LK0 F;  2R7U A;  2X6W A;  5KNL A;  2Z3Y A;  1BIA A;  4U0Y A;  1L3L A;  1UCR A;  2VE9 A;  5AIQ A;  1LNW A;  1PYV A;  4FCY A;  1T0F C;  1W36 C;  3L2R A;  3BTI A;  2L02 A;  3KLN A;  4K5O A;  2CG4 A;  4HQM A;  5KHD A;  2DOD A;  5E20 A;  2MC4 A;  3AUA A;  5CPR B;  3B2X A;  1Y1W J;  1R9T J;  2BY2 A;  4XN2 A;  3D5L A;  1RET A;  2MG4 A;  4G12 A;  3HOX J;  1VQ7 I;  4LUP A;  2AXL A;  3HSE A;  5LBQ A;  4ESB A;  2HDW A;  2DFF A;  3FIS A;  2IRF G;  4UV8 A;  1OQY A;  4GXO A;  1PUE E;  4N4O B;  2IA2 A;  4NHJ A;  3BT9 A;  5TIS C;  2NOG A;  2CV2 A;  3BR3 A;  2IP2 A;  1Y39 A;  2QVW A;  1KYZ A;  1ZG5 A;  1R5H A;  2LBF B;  1Z3X A;  3OS1 A;  4XNB A;  2Y2Z A;  2H6B A;  4G8X A;  2Y1F A;  2E7X A;  5LGN A;  1CQT A;  4XK4 A;  3RPU D;  3BTL A;  1MIJ A;  2LTP A;  3BR6 A;  3L7W A;  5LHI A;  4XN3 A;  3G1O A;  3KEY A;  2OQR A;  1ZK8 A;  5FKO A;  4CUG A;  3SZT A;  3I55 I;  2VB6 A;  1YW8 A;  2Z99 A;  5CVU A;  1JGI A;  5FRN A;  2ZXJ A;  2RAE A;  4ITV A;  2WPG A;  1KU3 A;  1F1Z A;  1H9G A;  1FTZ A;  2A5W A;  5B66 C;  2COM A;  1YRN A;  1U3E M;  1GW6 A;  2DDB A;  2A3S A;  5F08 A;  5TRD A;  1OFC X;  5BQT A;  3AU8 A;  4YIF A;  3AAF A;  1I1S A;  2VJ8 A;  5LGU A;  4YRV A;  3HXL A;  2RKH A;  2Y0M A;  2UZK A;  2BW3 A;  2FU4 A;  2V4J C;  2VAS A;  3T5X A;  4RAY A;  4B48 A;  1MDM B;  3FBI B;  1XCB A;  3CF5 F;  1LQ1 A;  1B8I B;  4A3I J;  2YS9 A;  1FYL A;  4MFE A;  3H3Z A;  3IV5 A;  2ZME C;  4HX4 A;  5H20 A;  2DMU A;  3ECH A;  1TLH B;  2CFX A;  1O3R A;  4YFX F;  1ZS2 A;  3ABT A;  4F91 B;  1TT0 A;  2GQQ A;  2HXO A;  5JR3 A;  3F3X A;  4ESF A;  1SD6 A;  4J01 A;  4DW6 A;  3BG7 A;  4G6Q A;  1MMN A;  2XKP A;  4D9J A;  1IC8 A;  4XOP A;  3BTJ A;  1IUY A;  1ACI A;  3G1L A;  2R59 A;  2IS1 A;  4QUO A;  2DFE A;  2OTJ I;  1BBY A;  2BV6 A;  2F5E A;  3VPR A;  2ECC A;  3IP4 B;  2LK2 A;  2M4G A;  4IQJ A;  2PQ8 A;  4RM3 A;  1K78 A;  4IRI A;  4B44 A;  4D0P A;  2E34 A;  2L01 A;  5FO5 A;  4QIR A;  4YEJ A;  4YII A;  5IP9 J;  1NK3 P;  1J75 A;  3FXU A;  2KLO A;  1QBJ A;  1FSE A;  4WK8 F;  1KU7 A;  1ZR4 A;  2DO7 A;  2E2I J;  2XSD C;  2LNB A;  1S5L C;  3HBL A;  2A69 F;  3K2A A;  3QU6 A;  1O7F A;  2UV1 A;  3JRD A;  4NBQ A;  2P4W A;  3DXJ F;  1FJL A;  2YX4 A;  4ETS A;  2R7Z J;  1YOV B;  3AFH A;  4XN4 A;  4XBF A;  3GTQ J;  3IHU A;  5HLG A;  3B3B A;  1XB4 A;  2FML A;  4HZF A;  4KYW A;  2CUF A;  4QTR A;  1LPQ A;  3JT1 A;  1NK2 P;  3WQS B;  1VQ6 I;  3MZH A;  4A6E A;  1ENH A;  1WHU A;  2VQH A;  1R00 A;  3BZC A;  3R4K A;  1RPW A;  2NRA C;  1K5H A;  4KFC A;  1PVE A;  3LSP A;  2MSY A;  4HSR A;  2HGC A;  4KMF A;  5CKT A;  2ME0 A;  3I0T A;  1X1C A;  2W1O A;  3J81 Z;  3KEO A;  1BJZ A;  2WAE A;  4YEL A;  1N78 A;  1X3U A;  3MZ8 A;  4R5X A;  3RKQ A;  4I09 A;  5HLI A;  2XAG A;  5EEH A;  1IW7 F;  3D5R C;  3TOA A;  1MW1 A;  3IIE A;  2XGD A;  4DYR A;  1IRF A;  1MD0 A;  1CGP A;  2DDA A;  2Z2S B;  2V26 A;  4BEH B;  2E19 A;  1R6R A;  3ZN0 A;  3SDG A;  5FLM J;  3GTK J;  3EUH A;  1IZ1 A;  4DJA A;  2DA5 A;  2MH2 A;  4F55 A;  2B0L A;  3TED A; 
#chains in the Genus database with same CATH homology
 2O7G A;  2X1D A;  1HS6 A;  4XN9 A;  3CHO A;  3OIQ A;  1NG6 A;  4FLR A;  5JAZ A;  3PSF A;  3RC8 A;  2DT7 B;  2X1E A;  4XMZ A;  4PJM A;  3C2H A;  3HOS A;  1YX5 A;  2ZFU A;  2Y0S A;  2A6T A;  3CMM A;  4OAY A;  4F93 B;  3OYL A;  3EBI A;  4FLQ A;  3HC7 A;  3MKY B;  2VKD A;  3S3N A;  4MS6 A;  4BEH A;  3DTE A;  5DYF A;  2MAB A;  2CUZ A;  2O5R A;  3FTY A;  1N75 A;  4E7S A;  2GTQ A;  1FMW A;  4NQW B;  3ZQQ A;  3OYC A;  4OOF A;  4OOE A;  3K10 A;  1X3Z A;  2LG4 A;  1WJB A;  4XKW A;  3DPT A;  1WJ5 A;  4F92 B;  4R5V A;  3LFU A;  1S9H A;  3V42 A;  2PUS A;  2KQR A;  3VYT B;  4XMT A;  4ZX4 A;  4BAC A;  4XKB A;  2Y1G A;  1WJF A;  3EBG A;  3DU5 A;  1T1R A;  2PJR B;  3EBH A;  2DQ6 A;  1K6Y A;  3R0I A;  3FTU A;  1MVY A;  3H9J A;  1BR4 A;  3FTZ A;  1G5A A;  4NQW A;  2I8D A;  4CH7 A;  3FH5 A;  2DT6 A;  2E5N A;  3CHQ A;  3FUI A;  4E7L A;  2KP6 A;  3E1S A;  1Q0H A;  3B37 A;  2DCE A;  3F9K A;  2BOL A;  3FU0 A;  2L7K A;  3EPZ A;  4J3B A;  4AIC A;  1EA3 A;  4DBR A;  2UWM A;  3A14 A;  3FUD A;  3KYL A;  3HUG B;  4ZDL A;  4BDZ A;  1W36 D;  1LVK A;  2BVL A;  4ZW3 A;  2PJR A;  1X19 A;  3FUF A;  2HNH A;  3HOT A;  4KIS A;  1MW7 A;  3OY9 A;  2HPM A;  4B43 A;  4XLH A;  4QHP A;  1OR7 C;  3K70 D;  4HNT A;  2R72 A;  2OUM A;  2WZG A;  1JI8 A;  2W82 A;  1X3W A;  4R79 A;  4BE1 A;  3VYR B;  4XOR A;  3C2G A;  2PL5 A;  4P5O A;  2L5Q A;  4E7H A;  2R7T A;  3D5S C;  3LSI A;  3H35 A;  3KX2 A;  2A7O A;  2KL4 A;  3FU5 A;  5TGT A;  4II2 A;  1ONP A;  3B7U X;  4CA0 A;  1GLN A;  3OR1 C;  4XLF A;  2PMZ A;  3DTI A;  3OYG A;  4ZX5 A;  3CP2 A;  3L2Q A;  3S3M A;  4GAA A;  1Y56 A;  2M3A A;  4F52 A;  3OS0 A;  3OYM A;  4J00 A;  2B61 A;  3JSZ A;  1DP3 A;  3PUU A;  4ZW7 A;  4CXF A;  3OR2 C;  1QU3 A;  3BLY A;  4XMU A;  2Z1D A;  1MNE A;  2XAU A;  4Y6R A;  2UUZ A;  4C2T A;  4E7Z A;  4NC7 A;  4B47 A;  3CP8 A;  2W7N A;  3WQQ A;  2CH0 A;  2R7W A;  4QPQ A;  3VVM A;  4CCK A;  4AU7 A;  3IAM 2;  5JHF A;  4FET A;  2KZV A;  4LIV A;  4ZTF A;  2XF5 A;  4DIQ A;  1LFP A;  4XO4 A;  4Y67 A;  2JA2 A;  2X1C A;  4C9Y A;  1MMG A;  3VSK A;  2KDO A;  1OR7 A;  3FH8 A;  3G2B A;  1YE9 A;  2OC6 A;  4A03 A;  2IS2 A;  3FUL A;  4PW4 A;  2XPZ A;  1VZ0 A;  2X6X A;  4RVB A;  2ZSI B;  3CZK A;  3L2V A;  1LDK B;  5CQE A;  1Q0Q A;  3A4C A;  3SEZ A;  3DLA A;  4R7L A;  4MKT A;  3FUE A;  1D1C A;  2WBM A;  3CJQ B;  3LSM A;  3VYS B;  2RQQ A;  3S8P A;  4U7B A;  2IS6 A;  2Z16 A;  4XMY A;  3RSN A;  4KT6 A;  4CCM A;  4E7K A;  4FLO A;  1Z3Y A;  3CHR A;  2XSJ C;  2JCV A;  2R7S A;  5EV7 A;  3LSG A;  2HVS A;  2LRD A;  3QOD A;  1G8X A;  2DJI A;  2AQF A;  4NNJ A;  3RAS A;  2WY7 Q;  4LG3 A;  3ANN A;  3VSL A;  5LFA A;  2WAD A;  3HPH A;  2M4K A;  4XKC A;  2WAF A;  1D0Y A;  3K70 C;  2ZXG A;  3PFY A;  4BGD A;  2KHM A;  4Q4E A;  3B7S A;  2WY8 Q;  4IQ4 A;  2VLA A;  2F4I A;  1UG0 A;  1P9Q C;  3SYT A;  2Q2E B;  4HRI A;  3QYF A;  1ONO A;  2MAO A;  2BVM A;  2IGO A;  3N05 A;  5FRO A;  3EUK L;  2JSP A;  4CZC A;  3EUA A;  4HPQ A;  3M1C A;  4K5P A;  4CCJ A;  4AR8 A;  1U0J A;  4KJZ A;  3FTS A;  3BC8 A;  4Y6P A;  3DWL E;  4BUP A;  1ZEL A;  4AYS A;  2XF7 A;  1SG7 A;  4K5M A;  2CMP A;  4FAS D;  1UAA A;  1T95 A;  2WAQ A;  4XM3 A;  3CZE A;  3ANM A;  2IGM A;  2VJJ A;  2NOJ B;  3HPG A;  3PNY A;  4ZYA A;  3UEQ A;  3OWT A;  3PNT A;  4PJJ A;  5JC1 A;  2ELJ A;  4L2L A;  4B3X A;  2HVQ A;  3FTV A;  3OYD A;  2LH9 A;  3U9W A;  3ZHZ A;  3ANL A;  2IS4 A;  2W00 A;  2XDV A;  4BU2 A;  3OYK A;  3DQV C;  2VQC A;  1DQU A;  3OYE A;  1MMD A;  1S46 A;  4ZW5 A;  3DEE A;  3M8J A;  3A1Y A;  2P0W A;  4X2U A;  3CES A;  4PFP A;  4II3 A;  3S32 A;  3TMO A;  2HPI A;  3AL0 B;  4PUS A;  3VWB A;  1HA8 A;  2VJ4 A;  3DPU A;  4XNF A;  2VXD A;  4PK4 A;  5AEN A;  1SAU A;  3FUH A;  1FMV A;  2L9S A;  2ZXI A;  3OMY A;  4RLF A;  3B2P A;  3FU6 A;  1WJC A;  2FUG 2;  1AA7 A;  4PFO A;  1X4O A;  4BDY A;  3OL3 A;  3Q44 A;  4XNA A;  3TL4 X;  4E7J A;  3LSH A;  1R0K A;  3VYU B;  3B7R L;  1YX3 A;  3K4C A;  2JD2 A;  4P1W A;  5JMP A;  3UR3 C;  3ZXS A;  4XLE A;  4XLC A;  3K4N A;  5HNH A;  4HEA 2;  2VL8 A;  2CW8 A;  2K5C A;  1E0E A;  4XKV A;  3FKJ A;  2VPL A;  3DPL C;  4Q4I A;  1MW2 A;  4E4H A;  1V5F A;  1BR1 A;  3FTW A;  2LY2 A;  4FCA A;  5JNL A;  1Y6I A;  2ZSH B;  3LL7 A;  2V6E A;  3DTK A;  4Y4R A;  4AR9 A;  1D1A A;  3W3C A;  4RSY A;  1PJR A;  4C30 A;  3FUJ A;  3S93 A;  3J7A Y;  4ZQE A;  2JVG A;  5HNF A;  1BR2 A;  3A2K A;  3CZL A;  5JO0 A;  4CSW A;  5FRM A;  4E7I A;  1TZL A;  4PSX A;  5LD2 C;  2MYS A;  1X1B A;  3A06 A;  4RCV A;  4ZX3 A;  4BJT A;  4XQF A;  3OL4 A;  3ZR8 X;  4IZZ A;  3W2W A;  4GRI A;  2DOA A;  4G6T B;  3S3O A;  4MLO A;  4QPE A;  1ONN A;  1X1D A;  1D0Z A;  1Z7L A;  2CUJ A;  3H5A A;  2C5Z A;  2K3P A;  4OAZ A;  1MW3 A;  3CZG A;  4FLS A;  3ZRG A;  4BE2 A;  4XN5 A;  4XL9 A;  2HPO A;  3Q43 A;  1V5E A;  2VIX A;  4KP7 A;  2JCX A;  3RTR A;  2WZF A;  3MMY B;  1D0X A;  3CHP A;  4ZN6 A;  3H9G A;  4HG2 A;  3I9V 2;  2MD0 A;  2IXS A;  2KMU A;  1BOB A;  2V9K A;  3K4B A;  4N4N B;  3UNG C;  3FBN B;  3OYN A;  2CV0 A;  3W2A A;  3CIA A;  4PU2 A;  5JMW A;  2VJI A;  3VVL A;  4BL0 B;  2RRE A;  5CQG A;  4CCL A;  1SC5 A;  3FHN A;  3AKZ A;  4F3Q A;  3IUO A;  4NC8 A;  4RMN A;  4DGW B;  4K5N A;  2JVH A;  3K6G A;  4CCN A;  2R7U A;  2X6W A;  5KNL A;  2R7V A;  1OLT A;  2XC7 A;  2QKM B;  3QOE A;  1PYV A;  2CW7 A;  1T0F C;  1W36 C;  3RCO A;  3L2R A;  3PJR A;  1SQM A;  1QHG A;  4K5O A;  2WB1 A;  3K4M A;  3FH7 A;  5KHD A;  2C82 A;  2MC4 A;  3AUA A;  5CPR B;  3B2X A;  4RLQ A;  4DPR A;  4XN2 A;  3D5L A;  3OYH A;  3HL2 A;  4LUP A;  2M7A A;  3E0J B;  2QKL B;  2HDW A;  2LY1 A;  3H9Q A;  2X51 A;  2K9L A;  4N4O B;  4ZX6 A;  2RJI A;  4AR1 A;  4BQQ A;  2F6C A;  2CV2 A;  1Q0L A;  2XF6 A;  2QVW A;  4BS9 A;  2LBF B;  1WJE A;  4XOT A;  4ZQF A;  1Z3X A;  3OS1 A;  2HVR A;  4XNB A;  4QME A;  3BCB A;  3FDY A;  2R7X A;  1KON A;  3LMM A;  3H0D A;  2Y1F A;  4XN1 A;  2GOM A;  1V5G A;  3RPU D;  3RC3 A;  4XND A;  4XN0 A;  4AVZ A;  4KIT B;  4BXF A;  2E1M C;  2HQA A;  2LYC A;  4C2U A;  3MD2 A;  3AL0 C;  3H5R A;  4XN3 A;  5KCM A;  2JCY A;  1JG9 A;  3KEY A;  2RNG A;  4NUB A;  2Y1C A;  2W4S A;  3UCQ A;  4CUG A;  2V7F A;  4LIU A;  4ZW6 A;  2BW3 B;  3AU9 A;  1H3L A;  2VB6 A;  4GAE A;  4H4K C;  4AYB A;  2ZXH A;  5FRN A;  1JGI A;  1WFX A;  3DKY A;  2FFL A;  4ARF A;  4ITV A;  3MKZ A;  2LBF A;  1H19 A;  1X4P A;  1T1S A;  2WPG A;  2EGH A;  2Q1Z B;  1WJD A;  5HOO A;  3QJX A;  2A5W A;  3T8V A;  1QHH D;  2X85 A;  2CFO A;  1GW6 A;  3SEQ A;  3GBG A;  2E1M B;  2XQ0 A;  3AU8 A;  4Y33 A;  4R5T A;  2R7O A;  2L9N A;  3PNV A;  2VJ8 A;  1WJA A;  4YRV A;  3HXL A;  4BE0 A;  4XMX A;  3T0Y A;  2BW3 A;  1D1B A;  3OYJ A;  3NWS A;  1RP3 A;  2V4J C;  3OYF A;  2VAS A;  4PJL A;  4PVB A;  2HPT A;  1UEL B;  3SDB A;  4B48 A;  2R7Q A;  3ZHX A;  2R4G A;  3HG9 A;  3FBI B;  4IX7 A;  2F5V A;  4ZQH A;  2MFZ A;  4XR6 A;  3UER A;  5JBI A;  2L2O A;  3ZCO A;  2DXI A;  2Y1D A;  4BKX A;  3FHE A;  4BJ5 C;  3NWT A;  1ZS2 A;  2LC2 A;  2WA0 A;  2Y1E A;  4Y6S A;  4XMV A;  4F91 B;  1J09 A;  1TT0 A;  3K4J A;  4XN7 A;  4XO5 A;  3RQ4 A;  5FWQ A;  3CJR B;  2K9M A;  2LRE A;  2KPM A;  3PUB A;  4J01 A;  3BG7 A;  3FUN A;  1DGR M;  1LKX A;  2VQG A;  3W2V A;  1MMN A;  2GOX B;  4ANJ A;  4D9J A;  3OS2 A;  3ZI0 A;  4JOM A;  1MND A;  2HU9 A;  4EAT A;  2E60 A;  2AQE A;  4XOP A;  2KRC A;  4D1Q A;  4BQN A;  4ZC3 A;  3ZHY A;  4XON A;  1G59 A;  3B34 A;  2X6Y A;  3FU3 A;  2R59 A;  2IS1 A;  3QYB A;  2JV7 A;  2M7B A;  4QUO A;  3CZ6 A;  3FUK A;  3IP4 B;  4IKF A;  2QJ1 A;  1N77 A;  4U87 A;  2M4G A;  1NG7 A;  3BG6 A;  4IQJ A;  4RM3 A;  2JUG A;  4HNU A;  1ERD A;  4B44 A;  4QIR A;  3ONQ A;  4YEJ A;  3ZGK A;  3H5N A;  2E5Z A;  1MMA A;  3VDX A;  2VKH A;  4XO3 A;  2KLO A;  3MKW B;  3DU6 A;  2KRH A;  2V1N A;  3OYB A;  2CV1 A;  3IAS 2;  2XPY A;  3U21 A;  4LIT A;  4QPO A;  3BCA A;  3PSI A;  4X0G A;  1X1A A;  3HKZ A;  4ZDP A;  4PSW A;  4DOZ A;  2LOO A;  2UV1 A;  3EUH C;  4K5L A;  1DGW Y;  2VJ5 A;  3K4L A;  2OV7 A;  4ZDO A;  4RM2 A;  3LSK A;  3TBI A;  4ZW8 A;  3AFH A;  1SFK A;  1IRX A;  3OYA A;  4XN4 A;  5DUL A;  4OWR B;  2R70 A;  3B3B A;  4BQO A;  4ZTJ A;  3WQS B;  3JT1 A;  4JQF A;  2VQH A;  2VQL A;  4HST A;  3SZG A;  1Z21 A;  4DBQ A;  1K5H A;  2JD1 A;  3L2U A;  4HSR A;  1R0L A;  3I3L A;  3K4K A;  2IGN A;  2PGG A;  2DQM A;  3OOU A;  2CS3 A;  5CKT A;  2VXZ A;  4ZQG A;  4CCO A;  1X1C A;  2W1O A;  5BPP A;  3L2W A;  2IGK A;  4XMW A;  4Y3O A;  2M0M A;  4E6K G;  5DLL A;  3B7T A;  2WAE A;  4YEL A;  1N78 A;  2R7R A;  2MAP A;  5HLT A;  4R5X A;  3OIP A;  1JVS A;  4ZJZ A;  3PL8 A;  3CF2 A;  4BJ6 C;  4JND A;  3D5R C;  1MW1 A;  3IIE A;  3CHS A;  3FTX A;  4ZQT A;  4PJN A;  2HZD A;  2Z2S B;  3FUM A;  2V26 A;  4BEH B;  1MW0 A;  3DKX A;  5HVQ C;  1R6R A;  3OYI A;  4XLA A;  3WQR A;  2JD0 A;  4XN8 A;  4DJA A;  4F55 A;  3QYE A;  3KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...