5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
b'NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
2VLAA 5HLTA 5HNHA 5HNFA
chains in the Genus database with same CATH superfamily
4G12A 3R4KA 4QIRA 3F72A 3AL0B 1YLFA 3WGHA 1XGOA 2GOMA 1ZK8A 1X1DA 1KQ8A 2CS3A 3DPUA 2L9SA 1ZRDA 1W5TA 4BKXA 5L3EA 1ZH5A 4D5FA 1H9TA 3GO5A 2NAZA 1SD4A 1JUMA 4FISA 5C4JJ 2M7AA 2NNNA 4FHTA 5HNHA 1SQMA 3CZGA 4UV9A 3OR2C 1MIJA 5LGUA 3RYPA 3DP7A 3WTZA 5ICCA 1SFKA 3RQ4A 5ILUA 2JMWA 2FSWA 3TO6A 1O3SA 4KNYA 4L0ZB 3HUGB 2DYRH 4LIUA 3A01A 4EEFG 5FLXZ 2MBFA 2DPDA 3MZHA 1HKSA 3FXQA 1TTYA 1LNWA 2CQKA 1POGA 1USSA 2M34A 1Y39A 3E5UA 5LRSA 2LREA 3DV8A 2L3DA 5EDNA 1U9NA 3MZYA 2HOSA 1SANA 1SFOJ 4NC6A 3B02A 3S1MJ 2VOPA 3T0YA 5EGOA 4RAZA 5LEKA 3JSZA 4AR8A 1D3YA 1TBXA 2G7HA 1WJDA 1IN4A 2DQLA 1F4KA 2C82A 4XN1A 1J5YA 2JA8J 1A31A 3GZNB 1OJLA 3ML6A 1YO5C 4Z6YA 2CRGA 2XF5A 3ERMA 1R1UA 4LUPA 4G8XA 5D4RA 2KIUA 2DK5A 4BE2A 2NXNB 4PJLA 2W84A 1UG2A 2FQ4A 2I5UA 5E8GA 2ZJQF 2AXLA 3COAC 2DFEA 2WB1A 2P81A 2W7NA 3DQVC 1WI3A 4M73A 1V5FA 3UCQA 1EF4A 2ZXHA 1X19A 3IH3A 3GMEA 3BZ6A 3F22A 3BJOA 3DBRB 3FTSA 3C7JA 4ZYAA 3LSHA 4XNDA 5E8IA 5FLXK 1BI0A 5E3MA 3MKYB 5M5YJ 5H20A 1LEAA 5DD4A 1T1RA 1EV7A 1MW1A 3RKXA 2E19A 2PEXA 2CFXA 3WU0A 5IYCJ 3T8VA 3OR1C 1IN6A 2IBDA 4XLCA 1U5TB 3UR3C 1ZKGA 4EQQA 2E7XA 3OYBA 4BE1A 1X58A 1I50J 1CGPA 3CHOA 4OU0A 1SD7A 2Z5UA 5JVGF 3FTYA 1I39A 1JHFA 1LPQA 3IWZA 2XQ0A 2H09A 3L2QA 2CQXA 5JHUA 5M5XJ 1IRFA 5B1BH 2GAUA 1UCRA 2QWWA 3UNGC 3JTGA 2QKLB 4BXUA 2FNPA 2PG4A 4BXFA 1T95A 5J1RA 1IN5A 3FTWA 4BNCA 4FLSA 1IV8A 1EA3A 5GTHC 1U9OA 2UXXA 2IS1A 5C44J 1EH6A 1RETA 1G5AA 3MZ8A 2F5DA 2CQNA 2R7VA 3CJRB 5F0FA 2D45A 2XAQA 4XN8A 2G0EA 1Z77A 3B7RL 1OLTA 4E7ZA 5J4YA 1DP7P 3ULQB 3C2GA 5HDGA 3BP8A 1MJAA 3K10A 3LSGA 3JRBA 1Z1DA 2EV0A 3P9CA 1IUYA 5BPPA 1HQCA 2WAQA 2LMDA 4JBAA 3K7AJ 2DMTA 2K86A 4AVPA 1N25A 2HQNA 3GTJJ 1P2FA 3M4OJ 3BQZA 3FUHA 4LITA 2HTJA 4CCMA 2M3AA 1Z7LA 4V19K 3Q43A 5D5XB 4AUXA 3CC4I 2VONA 3FH8A 3DEUA 3S1RJ 2L9NA 2HEOA 5B1AH 2VXZA 1R6RA 4LB5A 3DTEA 3IIEA 1DGWY 2HGCA 2KHMA 2PFBA 3OYHA 1B9NA 1T33A 1B59A 3JAMZ 4PJJA 3BR3A 1GXPA 4TV7A 2VBZA 4MGRA 3HRUA 2EQRA 4BQQA 2XF6A 2MC4A 2XIGA 4UUSB 2QBYB 1Q1HA 4DYCA 3AU9A 3FH7A 2MYSA 2TRTA 4I76A 1VQ4I 2STTA 3IRRA 3RDIA 5D5UB 4LLNA 5HS8A 3R60A 2QKMB 2PUSA 1U8BA 2KJCA 1T0FA 3S93A 2QVWA 3I5UA 2FBKA 1FTZA 2FX0A 3FMSA 4P96A 4J01A 2CG4A 1ONNA 2LG4A 1SAXA 1SVOA 2XPYA 4C2UA 5GAGJ 3OSFA 5FFZA 3OV8A 4ZX3A 2BHYA 1AKHA 1OKRA 2DDBA 1TQIA 5DUKA 1FYKA 2P4WA 2LBFB 1BOBA 3S8PA 1CF7B 2JUGA 3S17J 1FLIA 3GLXA 3I9V2 3V8KA 4X0GA 2O7GA 2MC3A 3PNVA 2Y1DA 4OIQF 3V7CA 1R1TA 5BPIA 5GTIC 4XLHA 3SFIA 4YFNF 2VI6A 4A3MJ 2E2HJ 4OIPF 2E5NA 3ZQQA 3B7UX 2JQ7A 4XIDA 1LJ9A 3I71A 3IWFA 2R7SA 4WK8F 3ABTA 2KMUA 2UXNA 2GXBA 1U8RA 5HNFA 2FOWA 4FTHA 2DLLA 3W6KB 4PZJA 3DEEA 1QPMA 4WXCA 3PSFA 5CLSA 2DJIA 3QOPA 1FC3A 2DODA 3MAJA 2DFFA 2DU9A 2R7OA 4ZX6A 2DDAA 1TZLA 2OCEA 2LR8A 4M3GA 3ASNH 4BGDA 1FOWA 1WJEA 2PJRA 1KGSA 2GWRA 2M45A 1DQUA 1QHGA 1YW7A 2ELKA 5EYRA 3I4MJ 1O7LA 4LG0A 3ZN1A 1TC3C 1MKMA 1NTCA 1N75A 3OYCA 3E6DA 4AU7A 5IY5H 1H3LA 1VQ8I 1XDSA 3F8FA 3M8JA 5H6RA 2XROA 1K6YA 1GT0C 3WTXC 3FKIJ 3KETA 1FMVA 3QJXA 5AENA 4CICA 5M5WJ 3BR6A 4F92B 4YRVA 3CP8A 4AVZA 1QU3A 3CD6I 2QQBA 3TOAA 2VPRA 2L4AA 1LE8B 2ZO4A 1LVAA 3CUQC 2ZC2A 4A3KJ 2Q2EA 4JOMA 1IRGA 4WX9A 3E97A 2QUFA 4X1EA 3W3CA 1ZARA 1H88C 1ETXA 3BG6A 2BY1A 4L18B 3CJNA 1V5GA 4C3HJ 1Z05A 2R93J 1X3ZB 3SDGA 3JRCA 3CCYA 1YJWI 3V7SA 2M87A 2MGQA 3HGGA 2HQ5A 4QHPA 1ETKA 4XMTA 4HQEA 1X2MA 2P5VA 4HOBA 2A05A 4OWRB 2B7EA 4LGWA 5FRMA 3S16J 4XL9A 3BLYA 5CVRA 2LKXA 2QEXI 4C2MJ 4RAGA 4HX8A 1ZR2A 1WVRA 2JZYA 1ZRCA 3ABKH 3CDHA 4I7HA 1TLHB 4J19A 3CHQA 2DQMA 4DQ2A 1BC7C 3PJRA 2A7OA 2FD5A 1YI2I 5F1RA 4XICA 5BOXA 3L2WA 1IRXA 2Y2ZA 1SFXA 1SAUA 3OMYA 1JGIA 4EJUA 3FBNB 3OYNA 4DIQA 5LHGA 2ZJPF 1XPXA 4RAFA 2JWTA 5IT3A 3F8BA 3S2WA 5HLGA 4X6AJ 3K2AA 1S8NA 2QVOA 1HCRA 4KA4A 4ZW6A 1FWZA 2KPMA 2QF7A 3D0SA 4RMNA 4ZZLA 4XN5A 1AHDP 3LSJA 3SZTA 2HVSA 2BGCA 3CJTB 1MJ9A 3GTLJ 2DA1A 2VQGA 4JX6A 2RC4A 2EZLA 2HYGD 2WBMA 3BTCA 3HKZN 1GV5A 1NK3P 5EEHA 1KU2A 2X6WA 3SJMA 3T5XA 4OOIA 3HC7A 2O8KA 1BI1A 4NQWA 2D5VA 4ESFA 3HOXJ 2K27A 3DWLE 4S04A 2NVYJ 4ZQGA 1Z91A 1DPRA 3R0AA 2ECBA 3CUQA 1QZEA 3JSOA 2FNAA 2M8GX 4E7SA 4M3DA 2BV6A 3NQOA 4IRHA 1T6SA 1DPUA 5JMPA 2KIQA 1U78A 3ZMZA 5HLIA 1IRZA 1RUNA 2BHZA 3S15J 2YX4A 2PMZN 4RM3A 3DF8A 1XCVA 1HW2A 4GYIA 2DQ6A 3ZRGA 3J80Z 3J7YJ 3EUHC 4Y6SA 1JE8A 2HVQA 2EWNA 4A3IJ 1K78B 5AONA 1YJ9I 2LSOA 1Z0XA 1ZELA 2IP2A 2HPIA 2JSCA 4L9JA 4UB8C 1IV6A 2FXAA 3VSKA 2QJ1A 2R7FA 4OOFA 3M1CA 3CZKA 3FUDA 4OAZA 1PUFA 1S7OA 5CVIA 4XN7A 4Z2YA 1K5HA 3N4MA 1ONPA 4WXDA 4ZZDA 4A0ZA 2P5KA 1RKWA 5K5OA 2TCTA 3EPZA 5ILSA 1R5GA 2LP0A 4RVBA 2ADUA 3KE2A 1GV2A 3IL2A 3BTLA 2CW8A 3F8NA 1XN7A 4EJOA 3FF5A 1UHMA 3RPUD 2DCEA 1D8KA 4ZYDA 3VODA 2DMQA 1B6AA 1O3QA 3IUOA 4XOTA 2VUMJ 3U2RA 5J8CA 3KZYA 3OYIA 1G4DA 5DTDA 2JUCA 1E3OC 4OMZA 1YIOA 4FCYA 1Z3YA 3ZQHA 3J80K 4CO8A 2UV1A 3P9KA 4U87A 2YR2A 1GW6A 4V2GA 3WG9A 4IZZA 1X3WB 2P7VB 5DCFA 1VQ7I 2ISZA 1MSEC 1Q0QA 4MTDA 4EM1A 2VXDA 2W00A 4M6VA 2EFWA 3LSIA 2LDUA 3E0JB 2G9WA 3LA7A 3RASA 4AIHA 1Z67A 2EZKA 3LQRA 3ZQLA 2VE8A 3BR2A 3TEDA 3SEQA 3MD2A 3PO3J 4AYBA 3ERED 3ZQFA 3LWFA 5L3DA 1WZ2A 1S9HA 1S72I 2EZHA 3EUHA 3HSRA 4MEYF 5FD6A 1JUSA 2CYYA 3GZ5A 2PGGA 1P6RA 1ZGAA 1TQMA 3CO7C 4EM2A 1E3PA 1IZ1A 1W7PD 1PP8F 4LD5A 2VN2A 3FIWA 4XRFA 5ED4A 5J3LA 3A0HC 4F52A 1ITYA 2F5FA 3DFGA 3B2XA 2HU9A 3F8CA 1GVJA 1ZAOA 4BDYA 4PUSA 2E2JJ 2K4BA 3VVMA 2KP6A 3HPHA 2WB1N 2DO7A 1H89C 4KUMA 2NOJB 4AC0A 4PJNA 4CDGA 3I4NJ 1WI9A 3CMAI 5J6XA 1IXRC 3SZGA 5CVUA 1O3RA 1HSTA 1HOMA 3ZMVA 1V55H 3U9GA 3HTSB 5GPAA 4Q4IA 4UUVA 2HOTA 5LLQA 2EV6A 1EH7A 5CVVA 2V1XA 1B72B 2RNGA 2HKOA 4ANJA 3GW2A 2F2EA 4MEXF 2BXZA 4QSHA 3KYLA 3VFZA 2L4MA 3OS2A 1ZGJA 2EGHA 2DBBA 3K1PA 4XN3A 1X4OA 1YOVB 1ERDA 4IOAF 4RM2A 1EH8A 5K1YA 2VPLA 1YX3A 2Q0OA 4P5OA 1ZS2A 2YSRA 3ONQA 1QPIA 2HWVA 4ZDOA 2ESNA 3IKVA 5CYVA 1Z7UA 3DKWA 1AU7A 2E71A 3W2WA 2DFHA 3FXOA 1OCRH 3REOA 3WU2C 2CW0F 2E1OA 2K9QA 3MCZA 5HDNA 3ISPA 4Y52J 3V8JA 4H4KC 3TP0A 4HZFA 1VQ6I 4M3EA 4BH9A 5FLVA 2IEKA 4G6QA 3L2RA 4HA8A 1WRJA 1Z3XA 4EM0B 3BDDA 3HBLA 1P4WA 1BI3A 3PUFA 1MNMC 2XPWA 2YX7A 3FULA 2X4HA 2ZXIA 3P5JA 4HX7A 4BJTA 3U9WA 1YX5A 3S2HJ 2XHKA 4AICA 2O5RA 2O7OA 1UHSA 2WWYA 3OYMA 2ZFWA 1XMXA 2VKHA 1J9IA 2QQ9A 3CCSI 3I59A 2R70A 2L9RA 3IV5A 3OOPA 1IF1A 2O03A 2ACJA 1YHQI 1LQ1A 3KEDA 3DLAA 2H8RA 4LK1F 3PM1A 3FHNA 4A2UA 1RC9A 3HGYA 1GHCA 2OF7A 1ZTRA 3CCVI 2F5EA 3BCBA 4ASNA 2J5PA 3HDDA 2R4GA 3JRFA 3FHZA 4Q4EA 1OYWA 2XPZA 2BVMA 2MH2A 2PX9A 2VC1A 2V9KA 1Z9CA 1NH3A 1FIPA 2AQFA 2ZMEC 3ZQCA 3OYLA 1MJBA 5D6FA 2K3FA 3RJPA 3GFMA 3HOWJ 4XN2A 4A03A 2R7UA 3FM3A 4AR9A 5F1JA 2CUJA 1OCTC 5E79C 2VJJA 4GAAA 2E1MB 3NARA 5E3LA 4D0PA 4HNVA 2R7WA 4A12A 4E7HA 3FU5A 4FCAA 5ICEA 3KLNA 9ANTA 4A93J 1SC5A 1D5YA 3H3UA 2FA5A 1P4AA 2IS6A 3BQYA 3SQNA 3GX4X 3EUKL 3KIOA 1YIJI 5JC1A 3FMQA 3A02A 3DU5A 3LSKA 3K4CA 2A6TA 4IRGA 4GO1A 4C3IJ 1JG9A 3GXOA 1IDZA 2IGKA 4HW0A 4PCQA 2WZGA 3S3NA 4XRSG 2L9VA 2HZTA 1WWXA 1XCBA 1QQIA 3HSFA 2K4JA 3K6GA 5EG0A 2VOOA 4N4NB 3R6SA 4UUTA 3DKYA 2V1DA 1FP1D 1R5HA 2Y1CA 2DW4A 1BC8C 4DGWB 2LYCA 3OYGA 3BPXA 3B6AA 1OPCA 4LFUA 1K83J 4PK4A 4B44A 2IRFG 1R1VA 2KIFA 2IAIA 4XBFA 4RCVA 3D5SC 3ZXSA 4JQFA 4Y33A 4ZQEA 3QYEA 3BZCA 2P7CB 2LY2A 2VC0A 5L3GA 1TWAJ 5ERIA 3EBHA 4UV8A 1UB9A 1RIOH 6PAXA 1R0KA 2VASA 2JTVA 3ZMUA 1OR7A 5EF6A 2OV7A 2A69F 2IW5A 3K70D 2R7ZJ 2JD1A 5KHDA 1YS7A 3TDUC 5EZHA 3AG3H 2ZMEA 4A69C 3GFJA 3ANLA 1MBEA 3H3VK 4PFOA 2ZXWH 4FLQA 3G1OA 1D0XA 2F5VA 2N8GA 3DBHB 4G6DA 2JD0A 4EGZA 4BBRJ 3F6OA 4AWXB 3FK7A 4RGSA 3Q9VA 5H2FC 3K4JA 5FROA 1MDMB 2K9LA 3DPLC 2EZIA 4V2FA 4C3JJ 1MZBA 3FU0A 4EJTA 1S7AA 4L9NA 3JRDA 3FTZA 1S6LA 2R0QC 2VJ8A 2VJ5A 5DYMA 1R58A 2DFIA 2DA4A 2IGOA 3FUEA 1ODDA 1UJ8A 4I0BA 5KCMA 2MLGA 5J47A 3ZGKA 3GFLA 1L0OC 1WJFA 2QM3A 2Z2SB 5DEQA 1D1BA 4M72A 3ZHXA 1MMGA 3KP2A 4Q47A 5M3MJ 1QGPA 3HRSA 4L5EA 4YFKF 2DA2A 3CP2A 4ZTFA 1XTAA 3LMMA 5DV5A 4HV6A 5FKMA 4CXFA 2M7BA 3K9TA 1HDPA 1OMIA 2QLZA 1X3WA 4L9TA 3HOZJ 3TOBA 4K5OA 3HJEA 2RQQA 4M6YA 3FUIA 2Y1EA 1A6QA 1U6GA 1Z21A 2ZJ2A 3CLOA 1XG1A 4BHPA 2F6CA 3SDBA 3ZMDA 5J40A 4KIBA 3CCUI 2RV8A 3H9QA 3KX2A 2E1NA 4RDUA 3IKTA 3EUAA 1ULYA 1D8JA 3O2PE 4ZJZA 2R7DA 1OCOH 2AHQA 4MTEA 5D6EA 3ZQIA 1P9QC 2Y0MA 4KN7X 5IP7J 2JVGA 2XV4S 1F1ZA 1ENHA 2ID6A 2PBIA 3BJAA 1YRNB 2FEZA 2HDDA 3MEXA 3TQNA 1JKOC 4AM3A 3LAJA 1ON1A 2CQ7A 5E18F 1RPWA 2PMUA 2RJIA 1UHWA 4YIRX 2A68F 5LRRA 3EYYA 4PFPA 4ZQTA 3A0BC 2X6XA 3TO9A 2HQAA 2CW7A 5GPCA 1JT0A 2DK8A 2L54A 2M1BA 2F48A 2KKOA 3RC8A 5JI6A 1KYWA 1MGTA 5HLTA 1I1SA 2YU3A 1MNDA 2AXTC 4MNUA 2WC2A 3VPRA 3ZOBA 4F7ZA 4HRIA 3LOCA 4XO3A 4Y17A 5J1YA 1H9GA 4JK1X 2BW3B 4Q4ZF 2DTRA 4Y3OA 1F5TA 5DM7F 2ZBKA 3GWZA 3OYEA 4K5MA 3W2AA 2XC7A 1LDJA 3N05A 4HLXA 1FMWA 2QQAA 3HHGA 3HTUA 3GTPJ 2XDVA 2LNBA 2JA5J 3ZI0A 1B8IA 1I6XA 1G8XA 2X1CA 2KLOA 2LF7A 1LDKB 1I27A 2KISA 2E1MC 3RKWA 1I3QJ 2R5ZB 2AO9A 4M9XA 2GIVA 5D5VB 4FQGA 4NC7A 4IXAA 2EBIA 2R5YB 3FXUA 4PDKA 4II2A 4BS9A 3J7ZI 3QPLA 4BY7J 3FUKA 3FUJA 2CV2A 2X48A 3KZIC 4ESBA 4CYCA 1YFHA 2ZNYA 5CQGA 3JREA 3MKZA 1XS9A 2WPGA 2E2IJ 1OISA 1W0TA 5KVRA 4XLEA 3I54A 3VYTB 3B34A 2K40A 1LKXA 4B48A 3LSPA 3AL0C 4CZZA 1TP4A 1SVLA 1APLC 3ZQ7A 2JV7A 4XORA 3V7RA 1Q0HA 3F3XA 4UNOA 1A5JA 3JAMK 1FBSA 4OAYA 4KT6A 2HI3A 4X2UA 4BAYA 2Y0SN 4U0WA 3VYRB 2ZKZA 2EFQA 4IHXA 4BBSJ 2XAGA 5B5EC 3HL2A 2P0WA 3CO6C 4QIWN 4AIKA 1BL0A 4UVAA 2HS5A 4D1QA 5J1UA 3I4PA 2EIJH 3BR5A 4OIRF 5IOYA 4BEHA 2IT0A 4AD9A 1CQTA 2WA0A 2STWA 3CZLA 2GLOA 1UAAA 2W1OA 3AKZA 1Z6RA 4R7LA 2OTJI 3H1CA 4UHTA 3VSLA 5DCMA 1FEXA 3DTIA 3E1SA 3H0GJ 3LQQA 3X2QH 5CVJA 4FX4A 4XNAA 3WGIA 2YS9A 5D5WB 4A3JJ 3B3BA 1G2HA 2M9HA 4IHYA 1ZLKA 1W0UA 3H36A 1E17A 2EIMH 4KP7A 3MKWB 2O9LA 3GTQJ 1UZCA 5DD8A 4D7MA 3K4LA 3PL8A 3QWLA 2V26A 4GGGA 2L2OA 3Q3SA 2VT2A 3C2HA 1K61A 2VQCA 4IEJA 3GZ6A 2V79A 4BDZA 4ZTJA 2HYFA 4XNFA 5FD5A 1PP7U 2CH0A 2K9NA 1IC8A 1H0MA 1OCPA 3BWGA 2F5CA 1X1PA 2D2WA 4IVNA 2HPOA 3JT1A 1RKTA 2QENA 2RGVA 4HDVA 1QA6A 1K79A 1GVDA 1X2NA 2DYSH 3M9AA 5D8LB 4ZW3A 3O8GA 2KZVA 4Y6PA 2XASA 5BNGA 5E1WA 4GRIA 1S5LC 2JA2A 2Q8KA 4AYSA 2QGUA 2DXIA 2HOAA 1U5TC 2FBIA 1R00A 2OCCH 3AU8A 4XMYA 2OQRA 2M4GA 1P4XA 4F93B 2MG4A 4A6EA 1KQ0A 2IGNA 1F36A 3MVPA 4XSXF 5LD2C 4M6XA 2GXGA 4MIMA 2NRAC 2IA2A 2IS2A 5FRNA 1Z6TA 1ORKA 2AS5F 1BR1A 3HUGA 3TDZC 3WQSB 1QNTA 4IPAA 3P9IA 2FBHA 1RNLA 4M9SA 2DOFA 5JHFA 1JTYA 1S7EA 3CTAA 1MMNA 1E0EA 5LHHA 2GM4A 1FOXA 4DBQA 4EJWA 5LEJA 2EFOA 1IW7F 1WPKA 2V4JC 4CA0A 3CF5F 1XSDA 3D5RC 3KEYA 2DOEA 1SG7A 1TWGJ 3CQZJ 2E5ZA 1KZHA 1N77A 3R0JA 3WU1B 3L2CA 5TRDA 2K7LA 3QQAA 2L02A 1YTYA 3WTSC 1BW5A 3SYTA 3MQ0A 3SXYA 3AG2H 3EQLF 3LSMA 4KICA 2K85A 4FASD 2JPBA 1VQKI 3UERA 1HW5A 3O8HA 3CLQA 3CCLI 4KJZA 2XKOA 4DYQA 4BACA 1BJZA 4BXXJ 1MW3A 3HSEA 1SC7A 3VB2A 2V9PA 1O3TA 1I1GA 5JO0A 1W36D 1WFXA 2LD5A 1BJAA 3QP5A 3ANMA 1JJ6C 4IHWA 2XRLA 4N9HA 4BJ6C 4HBLA 4R5TA 5J4VA 1F43A 3QOEA 3OSGA 2YU9J 4E4HA 4FETA 4ENMA 2W24A 4RGUA 3CDLA 4HF2A 1R0LA 2BYVE 4MS6A 2E36A 4F91B 3H5NA 3F21A 2JRTA 2JPCA 1G6NA 1VI0A 1XC5A 1U5TA 3A03A 1EKEA 4G7HF 1NK2P 2JCVA 2PL5A 2Y30A 1T39A 4RBOA 3BY6A 1YW8A 5FWQA 2GQQA 2MW8A 3M8FA 3E7LA 4GYGA 1XSVA 3VYUB 1ZR4A 2E35A 1R23A 1O4XA 3A01B 2HPMA 3FU3A 3GYHX 1O57A 1SD6A 1FIAA 1ZN2A 3SFZA 1D5VA 3CMEI 4O3MA 1VQOI 1T8IA 2ELHA 3FISA 2BE5F 1I3AA 1MMDA 1TW2A 4QLCU 2NNYA 1W7PB 1WSUA 3ZR8X 5EGOB 2DI3A 2K02A 1T38A 1DU0A 3ABLH 2YPRA 1NHAA 2JRMA 4B1RA 4FLRA 3LNQA 2OAZA 5BMZA 2ETHA 1X3UA 2GA2A 3KYDB 1IN7A 3BJ6A 3OIOA 3PNYA 1AWCA 3J81Z 4N4OB 4JP0A 4A3CJ 2B0LA 4EVIA 4A6DA 2ELJA 3KZZA 1TWFJ 2E7WA 1TNTA 1IDYA 3GVAA 4M71A 2EINH 3WQRA 1QVTA 4KFCA 2R7RA 2NS0A 3WTTC 2XPVA 5CPRB 5FFXA 4ENJA 2MSYA 2VJIA 3CMMA 3RPQA 5E17F 5JMWA 2DMPA 2IJLA 4YIFA 1ZRFA 4BHCA 1ONOA 2A6EF 3QPSA 5EEGA 3PIPF 1MW0A 3HW2A 3Q44A 1KQ9A 2RN7A 3OIPA 1QRYA 1D1AA 5JLWA 2BOLA 2H94A 4UUSA 2QBYA 4UXNA 4D5CA 4UY8I 2EPFA 1B4AA 4MQ9F 1FJLA 1MBJA 1DP3A 4KMUX 3PNTA 3GTOJ 2X1EA 2M4KA 2D1HA 3O6BB 2CFOA 4RAYA 5HLHA 1BR4A 2GZWA 4GCVA 3IC7A 3J81K 2Y75A 5KK1A 4JX4A 4HDUA 4N9IA 1LVKA 1USTA 2W85A 1JVSA 2L01A 1U0JA 3GTKJ 3L9FA 2EFNA 2MLKA 2YUSA 4XSZF 2LBFA 4KN4X 2EB7A 1CF7A 2NYXA 4A3GJ 4HPQA 4HQMA 2K5CA 3G2BA 3FMRA 4WWCA 3I64A 1MW7A 5DS9A 2XRNA 1G59A 2FFLA 4AIDA 1BIAA 3WQQA 2QA4I 4LOCA 4Q48A 1OCCH 3T1BA 4LJZF 1U2WA 4Y15A 4L0YB 2E60A 2HOEA 1UG0A 2V1NA 5JLXA 3JW4A 4NB5A 3F8MA 4EJVA 4LLLA 5FKKA 1ZGWA 4AR1A 4MFDA 2ME0A 3G4SI 2X6YA 4KISA 3A06A 3JRAA 4XONA 4HYEA 5TJJA 2JT1A 1XMAA 2RVCA 1UFMA 3JRIA 5L3CA 2O61A 1TT0A 2LY1A 1G3TA 3KFWX 5IT9Z 4ZDPA 4R5VA 2V6EA 3FXJA 2H27A 1XD7A 4M74A 4IKFA 4K5NA 3HPGA 3BT9A 2R7TA 4NC8A 2LVSA 4NBQA 4RLQA 1HLVA 3FXRA 4CCJA 3RCOA 3GLLA 3WTWC 4ZW5A 2HXIA 4R1HA 2MH9A 3PUUA 2WAQN 5EV7A 2JA7J 1RESA 3FUFA 4HAMA 4R5XA 3ECHA 1MH4A 2KL4A 2LTPA 3NRVA 1OFCX 2NVQJ 3ZP5A 1IAWA 4S05A 1JT6A 5HVQC 2W4SA 5IOZA 3KP5A 3AUAA 3WTUC 5LFAA 2LFBA 4E6KG 1VQ9I 5M3FJ 2Y1FA 2HXOA 1AKHB 3GEZA 4E7KA 4GDFA 1LE8A 2Z33A 2P5LC 2CWEA 2LRDA 1FPQA 1WJBA 2ID3A 3MN2A 4D7NA 3PQKA 2FUG2 2COMA 1W4MA 1ACIA 3A1YA 3OWTA 1D1CA 3ELKA 2UZKA 1TWCJ 1FYMA 1LFPA 4Y67A 1X3ZA 3HKZA 2R3SA 2KDZA 3LAPA 3K4MA 2L7ZA 2XSJC 1MBKA 2Q1ZB 3HXLA 3G73A 1VQMI 1XGNA 2NVXJ 4A5MA 2H8WA 3M1EA 3CMYA 1KU7A 4IRIA 1XX5A 1HKQA 2VLAA 3N97A 5IP6A 3FK6A 4I2OA 4C2TA 2GOXB 3L00A 2FF4A 2MFZA 2EA4A 2VQHA 3G71I 2XVCA 4ARFA 1QVUA 4RGXA 2PJRB 3BOQA 2PMZA 1ETVA 3GTGJ 2ZXGA 3OYKA 3G6EI 1GDTA 3ANNA 3WODF 2M0CA 4LG0B 2HQRA 2W48A 3R61A 1JXSA 2EJRA 3TGNA 5KAFC 3G3ZA 3BPVA 4ETSA 4NHJA 4K5LA 4MKTA 3LL7A 1VTNC 3K69A 2HNHA 2J5OA 2Y31A 1VZ0A 1IO2A 5E1XA 3CCRI 3F0CA 4DNCA 3OYFA 1HC8A 1Q1VA 3FBIB 1WKMA 1WH7A 3CF2A 5E3NA 3I53A 4XKBA 3H5RA 4EV0A 3RPUA 1MH3A 1R71A 4A3DJ 3PFYA 3H0DA 3UKGA 4RB0A 1IGNA 3NWSA 4HF0A 3MWMA 3B7SA 4U0VA 2HYJA 3RZDJ 4FLOA 1FSEA 4EMSA 3VOEA 1MSFC 3EETA 1ON2A 4ZW8A 4ESJA 2M8EA 3HZJA 2BY2A 1GUUA 3HRTA 4GAEA 1HDDC 4J3BA 2RDPA 1P92A 1X1AA 4BQAA 3F6VA 4DPRA 3BR0A 1JI8A 1M1EB 1SFEA 2DT6A 2X9DA 3KLOA 4K5PA 4WF2A 1ZG3A 4P9UA 1MBGA 4QMEA 2A07F 1K78A 1R9TJ 3HOUJ 3GTMJ 3PFIA 2IA0A 4CCLA 4ZQHA 3VYSB 4CSWA 2PMHA 5TGTA 2ECCA 3B2PA 3OL4A 2TDXA 1T56A 1ETOA 4P55A 3SHFA 5E3OA 3QRFF 4BQOA 4XLPF 2WAFA 3H3ZA 4FE4A 3BG5A 3KCCA 3DPTA 5KAIC 2KQRA 4ZH4F 1HW1A 2XB0X 4G9YA 3TW7A 3K4BA 4ZC3A 2CUFA 2HZDA 1J0RA 3LA3A 3E6MA 4XQFA 3CC7I 3G1LA 4YFXF 1W7PA 2VIXA 1MVYA 3RKYA 5J8FA 3FTUA 2CMPA 2VKEA 4Y7NJ 2X85A 4E7JA 2V7FA 4PJMA 2OTLI 1WGXA 3RKQA 2MAOA 5JAZA 1T98A 4XN0A 1MW2A 1Y6IA 5FB2A 3SEZA 1HF0A 4IHVA 1TT5B 4XK4A 3PSIA 4XRMA 1OCZH 1ZQ3P 1R36A 1FZPB 1YS6A 3HRMA 1Y8RB 3U21A 2H6CA 4NQWB 2ICWG 2KRFA 5FLMJ 5GAHJ 2BZTA 2R92J 4YG2F 4IOCF 2NS8A 3CCEI 3U1DA 1FBUA 3CUQB 3DBLB 4G7OF 4DOZA 2V6CA 4ITVA 4WXHA 1ONVA 4PSXA 5F0CA 1IXSB 2K9SA 3ABUA 2Y9ZA 1HBXG 2VBYA 4FT8A 4FX0A 2AQEA 3K1NA 2Y48A 2LK2A 3BTJA 2BXYA 3TKYA 2NOGA 2VBXA 1E2XA 2FE3A 2BVLA 2LF8A 2XSDC 1ZG5A 3DCFA 3QPTA 4XN9A 3F23A 4M9ZA 4CH7A 2H1KA 1W1WE 4A3LJ 1S3JA 1S46A 1V5EA 1Y0UA 1XSXA 2RQPA 1G3SA 1PUEE 1P7JA 5TISC 1WH5A 2B63J 4A3EJ 3MFKA 1T0FC 1P7IA 2WV1A 2HDWA 1IG7A 3S1QJ 4HSTA 2IXSA 1Y0NA 3ZCOA 3FTXA 2XGEA 3ZHYA 2UWMA 1PUFB 2Z16A 1T1SA 3FUMA 1E3HA 3B73A 3Q9SA 2A61A 1D0YA 4I98B 4KITB 3CJQB 2FRHA 2MABA 4IQJA 1QO0D 1XGSA 4HF1A 4IQ4A 1W5CC 2XAHA 3K4NA 1VQLI 3FKJA 4O6JA 4EATA 1HA8A 2NVUB 4ON0A 1SFUA 4HG2A 5L3BA 4P9FA 2HR3A 3OS1A 5JR3A 1PYVA 2NS7A 2PQ8A 4U7BA 4E7LA 2K3PA 4UVCA 3ZMSA 5LBQA 5GP9A 1B72A 5FKOA 5D4SA 2GXAA 2VBWA 3IP4B 4JNDA 5K5RA 1NG6A 2WY8Q 1J59A 3RIRA 2EK5A 3AFHA 2QSHX 1TQPA 4NUBA 3T8TA 3RQIA 5GAEJ 1J09A 3CHPA 1WCMJ 3QU3A 3OOUA 1X1BA 4L5IA 4W97A 4A5NA 3CCMI 2LC2A 1W5SA 4PGGA 2WAEA 2CUEA 4N0BA 5ILVA 4YELA 1XDUA 2QCOA 1BBYA 2ZFUA 2JSPA 2H1LA 2WADA 3NAUA 5FO5A 1K6OA 2PI0A 5DYFA 4XKCA 2B9SA 2M30A 1R5ID 2WTEA 3QPHA 3K70C 3V4GA 1JGSA 5E20A 4CYDA 3E3VA 2ZCWA 1VQ5I 2HVRA 4OINF 3FWEA 4I02A 5DM6F 1MBHA 3TP3A 3WTYC 1GXQA 3GCMA 5JVTA 3WTVC 1STZA 4RSYA 3AG4H 3LSRA 2DOAA 4XKVA 1DGRM 1T2KA 2LLKA 1KONA 1J75A 3DTKA 3HOYJ 2JN6A 4Y4RA 2F4IA 2OPTA 2BY3A 4E70A 4CGZA 4QPEA 3QP6A 1A04A 3CXBA 3EBIA 4G94A 2E1CA 3LSTA 2QSFX 3M7GA 4CUGA 4I09A 3FZVA 2LKSA 4P1WA 3A14A 4XN4A 3FM5A 1KU3A 4M3BA 4LK0F 3BROA 5B3SH 4F3QA 2DT7B 3WE2A 2Y9YA 2I8DA 1A6IA 1BOAA 2Z1DA 2L7KA 3BC8A 3HOSA 2OBPA 5BPDA 1REPC 2RREA 2EV5A 4W1UA 3EYIA 3K0LA 2FMLA 4AYBN 1U3EM 3FUNA 3MMYB 3VDXA 1QZYA 2XKPA 2CJJA 3K4KA 1J7KA 4YIIA 2CV0A 3LA2A 1TNSA 3FHEA 3CHSA 5JNLA 3LFUA 3RZOJ 1S29A 4HLYA 1FY7A 1WHUA 3F9KA 2LKPA 5K7FA 3RC3A 3IRQA 2DA6A 1IUFA 1SD5A 4IHSA 1ETYA 5CKTA 3BR1A 5LHIA 2D1VA 1RR7A 1JTXA 1Y8QB 4DZPA 4A3FJ 2Z9OA 5K5QA 3R0IA 1BA5A 2X51A 4R8HA 5KNLA 4QTRA 5EZGA 2RAEA 1T08B 1SMTA 3H9JA 3SZPA 4PW4A 4L5JA 1YYVA 2JVHA 1LB2A 1BN5A 4G7ZF 2A5YB 1PJRA 1R7JA 2DMNA 2BBYA 1ZREA 3HIFA 4PSWA 3C2BA 1K7AA 3FTVA 1N78A 5EJCA 5HDKA 2ZSHB 1B1BA 2MD0A 1FBQA 4QWQA 4I0AA 2RKHA 5ICFA 4U88A 3EDPA 5IP9J 2CV1A 4PGHA 1TWHJ 2VE9A 2PLYA 3CDIA 4WCGA 3K1MA 1MD0A 3H9GA 3GBGA 3KEQA 3D5LA 2CQQA 2VQLA 1X1CA 2MA3A 2DA7A 4XO4A 3I59B 1BI2A 5B66C 3FU6A 1VQPI 2XUBA 1JKQC 4BQNA 1VQNI 3VVLA 3HM5A 4QPOA 4I99C 1MNEA 2O0YA 4F55A 3L1PA 3GFIA 3L2VA 5FJ8J 3DU6A 1JHHA 4IX7A 2CO5A 3GF2A 1ZLJA 5ICGA 2IA1A 1JKPC 1LUJB 4XMVA 1FX7A 2M5WA 3V8LA 4XLFA 1WJ5A 5AIPA 3Q0WA 1I5ZA 2CGPA 4XLNF 2KIMA 4XM3A 3ROUA 4DYRA 2MD5A 4B3XA 3OY9A 2F4MB 1BR2A 2JA6J 1Y56A 2VJ4A 3Q5FA 2V9VA 2GTQA 4ZX4A 1BM9A 2XGDA 3WE3A 1DU6A 2ZJRF 2DN0A 3HOVJ 2X6OA 1A36A 4ZX5A 3ABMH 1OYYA 2JK3A 2VT3A 4DJAA 4HNTA 4XMUA 5D8KB 4KIGA 1MDMA 5EEAA 2L7FP 4MLOA 4MFEA 4S0HB 2L7MP 4B4CA 4IF4A 2DMUA 5BQTA 2OC6A 5H6QA 1PDNC 1VFCA 2VB6A 2QYOA 4XMXA 3E6CC 2E34A 4KYWA 3L7WA 5A2QZ 3CESA 1D0ZA 1ETWA 2R72A 2O8XA 2XAUA 3C1DA 4OOEA 1HXDA 3BZKA 4LIVA 5F27A 4ZYGA 1YQAA 3TMOA 1YG2A 5EG0B 2QQ8A 3BG3A 3KEOA 2R59A 2OZ6A 1C0WA 4XLAA 2K9MA 5CQEA 4PVBA 3FH5A 4L2LA 2Z3YA 2EILH 2XF7A 4NNJA 5HS9A 3EBGA 1AA7A 1XMKA 4BHBA 2C5ZA 2COBA 2LY9A 3NWTA 2FJ1A 5HOOA 1RP3A 3QYFA 4HNUA 4ENKA 3Q0UA 3ZHZA 2Z99A 1R22A 3ESWB 3K2ZA 3BG7A 3TO7A 3CZ6A 1R4NB 4IO9F 1MMSA 4ZQFA 3CHRA 2WZFA 4BJ5C 1Y1VJ 4BUPA 4KMFA 1I6HJ 3MKLA 5K7HA 2RNJA 2DAOA 2FQ3A 5FGMA 4U0YA 1FP2A 5FKLA 2KRHA 1PVEA 3I0TA 4CCNA 1O7FA 4ENNA 2ESHA 3KPHA 1JUPA 2L5QA 2IPQX 1GLNA 4O5VA 4XKWA 4BL0B 4LB6B 3S3MA 3V42A 1UELB 3TBIA 2HTSA 3QU6A 2B61A 2ZMEB 2VODA 5A2QK 3CZEA 1B9MA 1EJ9A 1TW3A 4XOPA 3L09A 2X1DA 3RSNA 4I6ZA 3A4CA 1Y1WJ 5JBIA 1JGGA 3CC2I 2JD2A 3B7TA 2XAFA 3ECOA 3IAM2 1L3LA 4B09A 1OYIA 3J7AY 1FOKA 2X0LA 1YRNA 3ASOH 2VL8A 5C4XJ 3H35A 2W25A 5K7ZA 5F08A 5FKNA 4PU2A 2DTZA 4ZN6A 3PIOF 1BIBA 4HSRA 3U1KA 2QZ8A 2P6TA 1HS6A 1LDDA 1NG7A 3JTHA 3HG9A 3WHBA 4RB1A 3I56I 1RZ4A 2L0KA 1FYLA 4IHTA 1F9NA 3S14J 1SVMA 1UMQA 4JYKA 2ME6A 3VWBA 3G1MA 2O6GE 3W2VA 3DKXA 2CU7A 2DJNA 4YEJA 3ZN0A 1HKTA 1K4SA 3KP4A 2DQRA 2EIKH 4EGYA 2XAJA 3PO2J 4G6TB 2VKVA 2BW3A 2Y0SA 1G3YA 3L2UA 2KRCA 3QODA 4BE0A 4IL6C 4A0XA 2A5WA 3OYJA 4H0EA 3HHHA 3W6JB 2HKXA 4B43A 3KYCB 1X4PA 3OYDA 4OIOF 1H19A 3CUOA 2QSGX 1LFUP 3CIAA 4RB2C 1YITI 3NEUA 2ZB9A 2KFDA 4CHUA 4GXOA 2KDOA 3S3OA 2R5ZA 3UEQA 4KT5C 1FOYA 5L3FA 2GA1A 3QAHA 3BCAA 2R5YA 1H8AC 2NVTJ 3M3YJ 3DEWA 5CJ9A 4LMYA 3JR9A 2HDCA 1IJWC 2JCYA 4B47A 1QHHD 5DDGA 2O3FA 2EH3A 1VNDA 3VEPA 3IH4A 4D9JA 2GBYA 1V54H 2IVMA 4ZDLA 2KT0A 2FOKA 2M0MA 2KJBA 1FNNA 3WHCA 1LEBA 1KYZA 4QUOA 4MHGA 4C30A 4Y13A 1AOYA 3I58A 3IHUA 2ZSIB 5DLLA 2A3SA 5DULA 3Q0VA 1HSJA 1W36C 4ZYEA 5IYDJ 3WGGA 1J2XA 5HS7A 4Q5SF 2JCXA 2Y69H 2C6YA 2XB5A 2OJED 1KU9A 1WJAA 1VF9A 4L9VA 4XO5A 3PUBA 4UB6C 4A3BJ 1YJNI 3JSPA 1SEUA 4U7DA 4XMWA 4CCKA 4MQVA 2FU4A 3T8RA 5F0HA 5HODA 2WY7Q 3P7NA 3RI4A 4B3AA 4ZW7A 1RUOA 4PJ0C 3TW6A 4UVBA 2XPUA 1YE9A 3FXLA 1JKRC 2ZNZA 1MMAA 3H92A 1LFBA 2DPUA 4OMYA 2V1UA 3OS0A 4NDLA 3S32A 3CCJI 3OIQA 1SMYF 3OL3A 4BY1J 3J7AO 3CCQI 2LH9A 1B8IB 4DW6A 4CZCA 2R7XA 3H5AA 3RTRA 3D1NI 2OU2A 3PQJA 5C3EJ 3B37A 4HX4A 4J00A 1XGMA 2M2EA 3C18A 3HOTA 1ZG1A 1KA8A 5F64A 4M3FA 1DDNA 4KDPA 4E7IA 3ZPLA 2FMYA 2PN6A 1BW6A 4BYYA 4LLGF 4FE7A 3FXKA 2I10A 4CYCB 1V4RA 1R4MB 1ZYRF 3KP6A 4Y6RA 1MBFA 3HB9A 3I55I 3FX3A 5AIQA 3HYIA 5BS6A 2LOOA 4GFBA 3LFKA 3S2DJ 2GIZA 1FTTA 1JJ8C 4BU2A 2MAPA 3AG1H 3I3LA 1IN8A 2HPTA 3FXMA 4HV5A 3WG7H 2HFHA 3B6CA 3A2KA 1RI7A 1FT9A 2A6HF 5IT9K 5GADJ 3JRGA 4I01A 2BY0A 2G7UA 3JCUC 1RR8C 2OZUA 3QYBA 2ZXJA 2OD5A 2XGCA 5DUIA 1G3WA 3TL4X 2DT5A 4XRSA 1XB4A 2KZGA 2OQGA 3M8EA 4XR6A 3KP7A 4KIFA 4B8XA 4JX5A 4R79A 5E1ZB 1WJCA 3S1NJ 2CSOA 1ETQA 3KP3A 4LG3A 4BEHB 2CUZA 1R49A 2Y1GA 2OA4A 2H6BA 4ABZA 1Q0LA 1IXCA 2BEOA 5LGNA 5IPAA 2IGMA 1TL8A 2W82A 5DCMB 4HEA2 4AIJA 3ZMTA 2DA5A 1DUXC 1OR7C 3E5XA 3JRHA 2WV0A 3C3WA 2ISYA 2IS4A 1V3FA 4RLFA 1OQYA 1QBJA 3E6BA 1K4TA 1FSHA 4A0YA 1RRJA 3ZQGA 3HEFA 1YW9A 4RGRA 2P6SA 1WQ2A 2DA3A 3DXJF 3DLLF 4DBRA 5IYBJ 5LGTA 3BG9A 2W57A 4ZYHA 2P8TA 3AAFA 3W6VA 5F6FA 2VKDA 4K2EA 2F4OB 5JFRA 2JJ7A 4MO7A 2OUMA 4DZJA 4RA2A 3O3KA 2EFPA 4IJAA 2PJPA 3M07A 3E5QA 2EA2A 5F04A 1ZHFA 4QPQA 3GUDA 4RB3C 4CCOA 2R7QA 3BTIA 4II3A 4XMZA 1QZZA 2UUZA 2Q2EB 3IAS2 4RS8A 1A35A 3OYAA 3FDYA 3IH2A 4XNBA 3RYRA 4C9YA 2XGXA
chains in the Genus database with same CATH topology
4PUSA 2V4JC 2WAEA 4CA0A 4QIRA 3VVMA 2KP6A 3HPHA 3D5RC 3KEYA 4YELA 3AL0B 1SG7A 2NOJB 2JSPA 2WADA 2ZFUA 4PJNA 5DYFA 2E5ZA 2GOMA 1X1DA 4XKCA 2CS3A 3DPUA 2L9SA 3SZGA 1N77A 3K70C 4BKXA 3SYTA 3LSMA 2HVRA 4Q4IA 2M7AA 1SQMA 5HNHA 3CZGA 4FASD 3OR2C 1SFKA 3RQ4A 3UERA 2RNGA 4ANJA 3HUGB 4KJZA 4RSYA 4LIUA 4BACA 1MW3A 3KYLA 2DOAA 4XKVA 1DGRM 3OS2A 2EGHA 5JO0A 4XN3A 1X4OA 1W36D 1WFXA 1ERDA 1KONA 3ANMA 3DTKA 4Y4RA 4RM2A 2F4IA 2LREA 4BJ6C 2VPLA 1YX3A 4R5TA 4QPEA 4P5OA 3QOEA 1ZS2A 3EBIA 3ONQA 4ZDOA 4E4HA 4FETA 3W2WA 3JSZA 1R0LA 3T0YA 4AR8A 4MS6A 4F91B 3H5NA 4CUGA 1WJDA 2C82A 4XN1A 4P1WA 3A14A 4XN4A 4H4KC 2XF5A 4LUPA 2JCVA 2PL5A 4F3QA 2DT7B 5FWQA 4BE2A 4PJLA 2I8DA 3VYUB 3L2RA 1Z3XA 3BC8A 2L7KA 2Z1DA 3HOSA 2WB1A 2RREA 2HPMA 2W7NA 3DQVC 3FU3A 3UCQA 1V5FA 3FUNA 2ZXHA 1X19A 3MMYB 3VDXA 3K4KA 5JNLA 2CV0A 3FULA 3FHEA 3CHSA 3LFUA 1MMDA 2ZXIA 3FTSA 4ZYAA 3LSHA 3F9KA 4XNDA 4BJTA 3U9WA 1YX5A 3MKYB 3RC3A 4AICA 2O5RA 3ZR8X 1T1RA 1MW1A 5CKTA 3OYMA 2VKHA 3T8VA 3OR1C 3R0IA 2R70A 2X51A 5KNLA 4XLCA 3UR3C 4FLRA 3OYBA 4BE1A 3KEDA 3DLAA 3CHOA 3H9JA 3PNYA 3FTYA 3FHNA 4PW4A 4N4OB 2JVHA 2XQ0A 3BCBA 1PJRA 3L2QA 2ELJA 2R4GA 4PSWA 4Q4EA 3WQRA 2XPZA 2BVMA 3UNGC 2QKLB 3FTVA 1N78A 2R7RA 4BXFA 1T95A 2V9KA 2ZSHB 3FTWA 2MD0A 5CPRB 4FLSA 1EA3A 2AQFA 2IS1A 3OYLA 2VJIA 3CMMA 1G5AA 5JMWA 2CV1A 2R7VA 4XN2A 3CJRB 4A03A 4XN8A 3H9GA 3GBGA 2R7UA 3D5LA 2VQLA 3B7RL 1OLTA 4E7ZA 4AR9A 1X1CA 2CUJA 3C2GA 1ONOA 2VJJA 3K10A 3LSGA 4XO4A 4GAAA 2E1MB 1MW0A 5BPPA 3Q44A 4E7HA 2R7WA 4FCAA 3FU5A 3FU6A 2WAQA 3OIPA 4BQNA 1D1AA 2BOLA 3VVLA 1SC5A 4QPOA 1DP3A 1MNEA 4F55A 2IS6A 3PNTA 3L2VA 2X1EA 2M4KA 3DU6A 3EUKL 4IX7A 3FUHA 5JC1A 4LITA 2CFOA 4CCMA 3DU5A 1BR4A 3K4CA 3LSKA 2A6TA 2M3AA 1Z7LA 3Q43A 1JG9A 4XMVA 4XLFA 1WJ5A 2IGKA 3FH8A 2WZGA 3S3NA 2L9NA 1LVKA 2VXZA 4XM3A 1R6RA 3K6GA 3DTEA 1JVSA 3IIEA 4N4NB 1DGWY 4B3XA 3OY9A 1BR2A 1U0JA 3DKYA 2KHMA 2Y1CA 3OYHA 1Y56A 2VJ4A 4DGWB 2LYCA 3OYGA 2LBFA 2GTQA 4PJJA 4ZX4A 4HPQA 2K5CA 3G2BA 4PK4A 4B44A 1MW7A 4RCVA 4BQQA 4ZX5A 2XF6A 2MC4A 3D5SC 3ZXSA 1G59A 4JQFA 4Y33A 4DJAA 2FFLA 4HNTA 3AU9A 4XMUA 4ZQEA 3QYEA 2MYSA 3FH7A 2LY2A 4MLOA 2OC6A 2E60A 3EBHA 1UG0A 2QKMB 2V1NA 2VB6A 2PUSA 4XMXA 1R0KA 3S93A 2VASA 2QVWA 3CESA 4AR1A 1D0ZA 2R72A 1OR7A 2XAUA 4J01A 4OOEA 2OV7A 2X6YA 4KISA 3A06A 1ONNA 4XONA 2LG4A 4LIVA 3K70D 2XPYA 4C2UA 2JD1A 5KHDA 3TMOA 2R59A 3ANLA 4XLAA 4ZX3A 1TT0A 2K9MA 2LY1A 5CQEA 4PVBA 4PFOA 3FH5A 4ZDPA 4R5VA 4L2LA 3EBGA 4FLQA 2XF7A 4NNJA 2LBFB 1AA7A 2V6EA 1BOBA 3S8PA 2C5ZA 1D0XA 2F5VA 2JUGA 3NWTA 2JD0A 4IKFA 5HOOA 1RP3A 3I9V2 4K5NA 3QYFA 3HPGA 4HNUA 4X0GA 4NC8A 2R7TA 2O7GA 3PNVA 2Y1DA 3ZHZA 3BG7A 3K4JA 3CZ6A 4RLQA 4XLHA 3RCOA 5FROA 4CCJA 4ZQFA 2K9LA 3DPLC 2E5NA 4ZW5A 3CHRA 3ZQQA 2WZFA 4BJ5C 3B7UX 3FU0A 5EV7A 4BUPA 3PUUA 3FUFA 2R7SA 3FTZA 4R5XA 2KMUA 2VJ8A 2KL4A 2VJ5A 5HNFA 2KRHA 2IGOA 4CCNA 3FUEA 2L5QA 5HVQC 3DEEA 1GLNA 2W4SA 3PSFA 4XKWA 4BL0B 3S3MA 3V42A 1UELB 2DJIA 3TBIA 5LFAA 3AUAA 5KCMA 4E6KG 2B61A 3ZGKA 2R7OA 4ZX6A 1WJFA 2Y1FA 3CZEA 1TZLA 2Z2SB 4E7KA 4XOPA 1D1BA 2X1DA 3RSNA 3ZHXA 2LRDA 1MMGA 3A4CA 1WJBA 4BGDA 5JBIA 2JD2A 3B7TA 1WJEA 2PJRA 2FUG2 3IAM2 3CP2A 3J7AY 4ZTFA 3A1YA 3OWTA 3LMMA 1DQUA 1D1CA 1QHGA 4CXFA 2M7BA 2VL8A 1LFPA 1X3WA 3H35A 4Y67A 1X3ZA 1N75A 3OYCA 3HKZA 4AU7A 1H3LA 4PU2A 3K4MA 4ZN6A 3M8JA 4K5OA 4HSRA 2RQQA 3FUIA 2XSJC 2Y1EA 2Q1ZB 3HXLA 1HS6A 1NG7A 1Z21A 1K6YA 3HG9A 1FMVA 2F6CA 3QJXA 5AENA 3SDBA 2VLAA 3KX2A 3H9QA 4F92B 3VWBA 4C2TA 4YRVA 2GOXB 3CP8A 4AVZA 3W2VA 1QU3A 2MFZA 3DKXA 3EUAA 2VQHA 4YEJA 4ZJZA 4G6TB 4ARFA 2BW3A 2Y0SA 3L2UA 2KRCA 3QODA 4BE0A 4JOMA 2PJRB 2PMZA 2A5WA 3OYJA 1P9QC 3W3CA 2JVGA 2ZXGA 4B43A 3OYKA 3ANNA 1X4PA 3BG6A 3OYDA 1V5GA 1H19A 2RJIA 3CIAA 4PFPA 4ZQTA 2KDOA 3S3OA 3UEQA 4K5LA 4MKTA 4QHPA 2X6XA 3LL7A 4XMTA 2HNHA 2HQAA 3BCAA 2CW7A 1VZ0A 4OWRB 2JCYA 5FRMA 4B47A 4XL9A 3BLYA 1QHHD 3OYFA 3RC8A 3FBIB 4D9JA 3CF2A 5HLTA 4ZDLA 3CHQA 1MNDA 4XKBA 2DQMA 4HRIA 2M0MA 3H5RA 3PJRA 2A7OA 4XO3A 4QUOA 3PFYA 3H0DA 4C30A 2BW3B 3L2WA 4Y3OA 3NWSA 1IRXA 3OMYA 1SAUA 3OYEA 1JGIA 4K5MA 3W2AA 2XC7A 3FBNB 3N05A 3B7SA 1FMWA 2ZSIB 3OYNA 4FLOA 4DIQA 2XDVA 5DLLA 5DULA 1W36C 3ZI0A 4ZW8A 1G8XA 2X1CA 2KLOA 1LDKB 2JCXA 4ZW6A 2KPMA 4GAEA 1WJAA 2E1MC 4J3BA 4RMNA 4XO5A 3PUBA 1X1AA 4XN5A 4DPRA 2HVSA 4NC7A 1JI8A 4XMWA 2DT6A 4CCKA 2VQGA 4K5PA 4II2A 2WY7Q 4BS9A 2WBMA 3FUKA 4QMEA 3FUJA 4ZW7A 2CV2A 2X6WA 4CCLA 4ZQHA 5CQGA 3VYSB 4CSWA 3HC7A 5TGTA 3MKZA 1YE9A 2WPGA 4NQWA 3B2PA 3OL4A 3DWLE 4XLEA 4BQOA 1MMAA 2WAFA 3VYTB 3B34A 4B48A 1LKXA 4ZQGA 3OS0A 3S32A 4E7SA 3OIQA 3DPTA 3AL0C 2KQRA 3OL3A 2JV7A 4XORA 1Q0HA 3K4BA 4ZC3A 5JMPA 2HZDA 2LH9A 4XQFA 4OAYA 4KT6A 4X2UA 2VIXA 4CZCA 2R7XA 3H5AA 1MVYA 3RTRA 3VYRB 3FTUA 2CMPA 4RM3A 2X85A 3HL2A 4E7JA 2V7FA 2P0WA 4PJMA 3B37A 5JAZA 2MAOA 4J00A 2DQ6A 3ZRGA 3HOTA 1MW2A 4XN0A 1Y6IA 4D1QA 3SEZA 3EUHC 4E7IA 4BEHA 3CZLA 4Y6SA 2HVQA 2WA0A 3PSIA 1ZELA 2HPIA 1UAAA 2W1OA 4Y6RA 3AKZA 3U21A 3VSKA 2QJ1A 4NQWB 4R7LA 3VSLA 4OOFA 3M1CA 3CZKA 2LOOA 3DTIA 3E1SA 4BU2A 4OAZA 3FUDA 4XN7A 3I3LA 2MAPA 1K5HA 2HPTA 4DOZA 1ONPA 4XNAA 3A2KA 4ITVA 4PSXA 3B3BA 3EPZA 4RVBA 3QYBA 2AQEA 4KP7A 3MKWB 3TL4X 2CW8A 3K4LA 2BVLA 3PL8A 4XR6A 2V26A 3RPUD 2DCEA 4R79A 2L2OA 4XN9A 1WJCA 3C2HA 4CH7A 2VQCA 3IUOA 4LG3A 4XOTA 2CUZA 4BEHB 2Y1GA 4BDZA 4ZTJA 3OYIA 1Q0LA 1S46A 1V5EA 4XNFA 2CH0A 2IGMA 1Z3YA 2HPOA 1T0FC 2W82A 2HDWA 3JT1A 4HEA2 2UV1A 4HSTA 2IXSA 3ZHYA 3ZCOA 3FTXA 1OR7C 4U87A 2UWMA 2Z16A 1T1SA 3FUMA 2IS4A 1GW6A 4ZW3A 4RLFA 4IZZA 2KZVA 1D0YA 4Y6PA 4GRIA 4KITB 3CJQB 2JA2A 2MABA 4AYSA 4DBRA 4IQJA 2DXIA 1Q0QA 2VXDA 2W00A 4IQ4A 3LSIA 3AU8A 3K4NA 4XMYA 3E0JB 2M4GA 3FKJA 1HA8A 2VKDA 4EATA 4F93B 3RASA 2OUMA 4HG2A 2IGNA 5LD2C 3SEQA 3MD2A 4AYBA 2IS2A 3OS1A 5FRNA 1PYVA 4E7LA 4U7BA 2K3PA 1S9HA 4QPQA 1BR1A 3IP4B 4JNDA 2PGGA 3WQSB 1NG6A 2WY8Q 4CCOA 2R7QA 4II3A 3AFHA 4XMZA 4NUBA 2UUZA 2Q2EB 3IAS2 1J09A 5JHFA 4F52A 3CHPA 3OYAA 3FDYA 1MMNA 3OOUA 1E0EA 1X1BA 3B2XA 4XNBA 2HU9A 3WQQA 4DBQA 2LC2A 4C9YA 4BDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HLT A;  5HNH A;  5HNF A; 
#chains in the Genus database with same CATH topology
 4G12 A;  3R4K A;  4QIR A;  3F72 A;  3AL0 B;  1YLF A;  3WGH A;  1XGO A;  2GOM A;  1ZK8 A;  1X1D A;  1KQ8 A;  2CS3 A;  3DPU A;  2L9S A;  1ZRD A;  1W5T A;  4BKX A;  5L3E A;  1ZH5 A;  4D5F A;  1H9T A;  3GO5 A;  2NAZ A;  1SD4 A;  1JUM A;  4FIS A;  5C4J J;  2M7A A;  2NNN A;  4FHT A;  5HNH A;  1SQM A;  3CZG A;  4UV9 A;  3OR2 C;  1MIJ A;  5LGU A;  3RYP A;  3DP7 A;  3WTZ A;  5ICC A;  1SFK A;  3RQ4 A;  5ILU A;  2JMW A;  2FSW A;  3TO6 A;  1O3S A;  4KNY A;  4L0Z B;  3HUG B;  2DYR H;  4LIU A;  3A01 A;  4EEF G;  5FLX Z;  2MBF A;  2DPD A;  3MZH A;  1HKS A;  3FXQ A;  1TTY A;  1LNW A;  2CQK A;  1POG A;  1USS A;  2M34 A;  1Y39 A;  3E5U A;  5LRS A;  2LRE A;  3DV8 A;  2L3D A;  5EDN A;  1U9N A;  3MZY A;  2HOS A;  1SAN A;  1SFO J;  4NC6 A;  3B02 A;  3S1M J;  2VOP A;  3T0Y A;  5EGO A;  4RAZ A;  5LEK A;  3JSZ A;  4AR8 A;  1D3Y A;  1TBX A;  2G7H A;  1WJD A;  1IN4 A;  2DQL A;  1F4K A;  2C82 A;  4XN1 A;  1J5Y A;  2JA8 J;  1A31 A;  3GZN B;  1OJL A;  3ML6 A;  1YO5 C;  4Z6Y A;  2CRG A;  2XF5 A;  3ERM A;  1R1U A;  4LUP A;  4G8X A;  5D4R A;  2KIU A;  2DK5 A;  4BE2 A;  2NXN B;  4PJL A;  2W84 A;  1UG2 A;  2FQ4 A;  2I5U A;  5E8G A;  2ZJQ F;  2AXL A;  3COA C;  2DFE A;  2WB1 A;  2P81 A;  2W7N A;  3DQV C;  1WI3 A;  4M73 A;  1V5F A;  3UCQ A;  1EF4 A;  2ZXH A;  1X19 A;  3IH3 A;  3GME A;  3BZ6 A;  3F22 A;  3BJO A;  3DBR B;  3FTS A;  3C7J A;  4ZYA A;  3LSH A;  4XND A;  5E8I A;  5FLX K;  1BI0 A;  5E3M A;  3MKY B;  5M5Y J;  5H20 A;  1LEA A;  5DD4 A;  1T1R A;  1EV7 A;  1MW1 A;  3RKX A;  2E19 A;  2PEX A;  2CFX A;  3WU0 A;  5IYC J;  3T8V A;  3OR1 C;  1IN6 A;  2IBD A;  4XLC A;  1U5T B;  3UR3 C;  1ZKG A;  4EQQ A;  2E7X A;  3OYB A;  4BE1 A;  1X58 A;  1I50 J;  1CGP A;  3CHO A;  4OU0 A;  1SD7 A;  2Z5U A;  5JVG F;  3FTY A;  1I39 A;  1JHF A;  1LPQ A;  3IWZ A;  2XQ0 A;  2H09 A;  3L2Q A;  2CQX A;  5JHU A;  5M5X J;  1IRF A;  5B1B H;  2GAU A;  1UCR A;  2QWW A;  3UNG C;  3JTG A;  2QKL B;  4BXU A;  2FNP A;  2PG4 A;  4BXF A;  1T95 A;  5J1R A;  1IN5 A;  3FTW A;  4BNC A;  4FLS A;  1IV8 A;  1EA3 A;  5GTH C;  1U9O A;  2UXX A;  2IS1 A;  5C44 J;  1EH6 A;  1RET A;  1G5A A;  3MZ8 A;  2F5D A;  2CQN A;  2R7V A;  3CJR B;  5F0F A;  2D45 A;  2XAQ A;  4XN8 A;  2G0E A;  1Z77 A;  3B7R L;  1OLT A;  4E7Z A;  5J4Y A;  1DP7 P;  3ULQ B;  3C2G A;  5HDG A;  3BP8 A;  1MJA A;  3K10 A;  3LSG A;  3JRB A;  1Z1D A;  2EV0 A;  3P9C A;  1IUY A;  5BPP A;  1HQC A;  2WAQ A;  2LMD A;  4JBA A;  3K7A J;  2DMT A;  2K86 A;  4AVP A;  1N25 A;  2HQN A;  3GTJ J;  1P2F A;  3M4O J;  3BQZ A;  3FUH A;  4LIT A;  2HTJ A;  4CCM A;  2M3A A;  1Z7L A;  4V19 K;  3Q43 A;  5D5X B;  4AUX A;  3CC4 I;  2VON A;  3FH8 A;  3DEU A;  3S1R J;  2L9N A;  2HEO A;  5B1A H;  2VXZ A;  1R6R A;  4LB5 A;  3DTE A;  3IIE A;  1DGW Y;  2HGC A;  2KHM A;  2PFB A;  3OYH A;  1B9N A;  1T33 A;  1B59 A;  3JAM Z;  4PJJ A;  3BR3 A;  1GXP A;  4TV7 A;  2VBZ A;  4MGR A;  3HRU A;  2EQR A;  4BQQ A;  2XF6 A;  2MC4 A;  2XIG A;  4UUS B;  2QBY B;  1Q1H A;  4DYC A;  3AU9 A;  3FH7 A;  2MYS A;  2TRT A;  4I76 A;  1VQ4 I;  2STT A;  3IRR A;  3RDI A;  5D5U B;  4LLN A;  5HS8 A;  3R60 A;  2QKM B;  2PUS A;  1U8B A;  2KJC A;  1T0F A;  3S93 A;  2QVW A;  3I5U A;  2FBK A;  1FTZ A;  2FX0 A;  3FMS A;  4P96 A;  4J01 A;  2CG4 A;  1ONN A;  2LG4 A;  1SAX A;  1SVO A;  2XPY A;  4C2U A;  5GAG J;  3OSF A;  5FFZ A;  3OV8 A;  4ZX3 A;  2BHY A;  1AKH A;  1OKR A;  2DDB A;  1TQI A;  5DUK A;  1FYK A;  2P4W A;  2LBF B;  1BOB A;  3S8P A;  1CF7 B;  2JUG A;  3S17 J;  1FLI A;  3GLX A;  3I9V 2;  3V8K A;  4X0G A;  2O7G A;  2MC3 A;  3PNV A;  2Y1D A;  4OIQ F;  3V7C A;  1R1T A;  5BPI A;  5GTI C;  4XLH A;  3SFI A;  4YFN F;  2VI6 A;  4A3M J;  2E2H J;  4OIP F;  2E5N A;  3ZQQ A;  3B7U X;  2JQ7 A;  4XID A;  1LJ9 A;  3I71 A;  3IWF A;  2R7S A;  4WK8 F;  3ABT A;  2KMU A;  2UXN A;  2GXB A;  1U8R A;  5HNF A;  2FOW A;  4FTH A;  2DLL A;  3W6K B;  4PZJ A;  3DEE A;  1QPM A;  4WXC A;  3PSF A;  5CLS A;  2DJI A;  3QOP A;  1FC3 A;  2DOD A;  3MAJ A;  2DFF A;  2DU9 A;  2R7O A;  4ZX6 A;  2DDA A;  1TZL A;  2OCE A;  2LR8 A;  4M3G A;  3ASN H;  4BGD A;  1FOW A;  1WJE A;  2PJR A;  1KGS A;  2GWR A;  2M45 A;  1DQU A;  1QHG A;  1YW7 A;  2ELK A;  5EYR A;  3I4M J;  1O7L A;  4LG0 A;  3ZN1 A;  1TC3 C;  1MKM A;  1NTC A;  1N75 A;  3OYC A;  3E6D A;  4AU7 A;  5IY5 H;  1H3L A;  1VQ8 I;  1XDS A;  3F8F A;  3M8J A;  5H6R A;  2XRO A;  1K6Y A;  1GT0 C;  3WTX C;  3FKI J;  3KET A;  1FMV A;  3QJX A;  5AEN A;  4CIC A;  5M5W J;  3BR6 A;  4F92 B;  4YRV A;  3CP8 A;  4AVZ A;  1QU3 A;  3CD6 I;  2QQB A;  3TOA A;  2VPR A;  2L4A A;  1LE8 B;  2ZO4 A;  1LVA A;  3CUQ C;  2ZC2 A;  4A3K J;  2Q2E A;  4JOM A;  1IRG A;  4WX9 A;  3E97 A;  2QUF A;  4X1E A;  3W3C A;  1ZAR A;  1H88 C;  1ETX A;  3BG6 A;  2BY1 A;  4L18 B;  3CJN A;  1V5G A;  4C3H J;  1Z05 A;  2R93 J;  1X3Z B;  3SDG A;  3JRC A;  3CCY A;  1YJW I;  3V7S A;  2M87 A;  2MGQ A;  3HGG A;  2HQ5 A;  4QHP A;  1ETK A;  4XMT A;  4HQE A;  1X2M A;  2P5V A;  4HOB A;  2A05 A;  4OWR B;  2B7E A;  4LGW A;  5FRM A;  3S16 J;  4XL9 A;  3BLY A;  5CVR A;  2LKX A;  2QEX I;  4C2M J;  4RAG A;  4HX8 A;  1ZR2 A;  1WVR A;  2JZY A;  1ZRC A;  3ABK H;  3CDH A;  4I7H A;  1TLH B;  4J19 A;  3CHQ A;  2DQM A;  4DQ2 A;  1BC7 C;  3PJR A;  2A7O A;  2FD5 A;  1YI2 I;  5F1R A;  4XIC A;  5BOX A;  3L2W A;  1IRX A;  2Y2Z A;  1SFX A;  1SAU A;  3OMY A;  1JGI A;  4EJU A;  3FBN B;  3OYN A;  4DIQ A;  5LHG A;  2ZJP F;  1XPX A;  4RAF A;  2JWT A;  5IT3 A;  3F8B A;  3S2W A;  5HLG A;  4X6A J;  3K2A A;  1S8N A;  2QVO A;  1HCR A;  4KA4 A;  4ZW6 A;  1FWZ A;  2KPM A;  2QF7 A;  3D0S A;  4RMN A;  4ZZL A;  4XN5 A;  1AHD P;  3LSJ A;  3SZT A;  2HVS A;  2BGC A;  3CJT B;  1MJ9 A;  3GTL J;  2DA1 A;  2VQG A;  4JX6 A;  2RC4 A;  2EZL A;  2HYG D;  2WBM A;  3BTC A;  3HKZ N;  1GV5 A;  1NK3 P;  5EEH A;  1KU2 A;  2X6W A;  3SJM A;  3T5X A;  4OOI A;  3HC7 A;  2O8K A;  1BI1 A;  4NQW A;  2D5V A;  4ESF A;  3HOX J;  2K27 A;  3DWL E;  4S04 A;  2NVY J;  4ZQG A;  1Z91 A;  1DPR A;  3R0A A;  2ECB A;  3CUQ A;  1QZE A;  3JSO A;  2FNA A;  2M8G X;  4E7S A;  4M3D A;  2BV6 A;  3NQO A;  4IRH A;  1T6S A;  1DPU A;  5JMP A;  2KIQ A;  1U78 A;  3ZMZ A;  5HLI A;  1IRZ A;  1RUN A;  2BHZ A;  3S15 J;  2YX4 A;  2PMZ N;  4RM3 A;  3DF8 A;  1XCV A;  1HW2 A;  4GYI A;  2DQ6 A;  3ZRG A;  3J80 Z;  3J7Y J;  3EUH C;  4Y6S A;  1JE8 A;  2HVQ A;  2EWN A;  4A3I J;  1K78 B;  5AON A;  1YJ9 I;  2LSO A;  1Z0X A;  1ZEL A;  2IP2 A;  2HPI A;  2JSC A;  4L9J A;  4UB8 C;  1IV6 A;  2FXA A;  3VSK A;  2QJ1 A;  2R7F A;  4OOF A;  3M1C A;  3CZK A;  3FUD A;  4OAZ A;  1PUF A;  1S7O A;  5CVI A;  4XN7 A;  4Z2Y A;  1K5H A;  3N4M A;  1ONP A;  4WXD A;  4ZZD A;  4A0Z A;  2P5K A;  1RKW A;  5K5O A;  2TCT A;  3EPZ A;  5ILS A;  1R5G A;  2LP0 A;  4RVB A;  2ADU A;  3KE2 A;  1GV2 A;  3IL2 A;  3BTL A;  2CW8 A;  3F8N A;  1XN7 A;  4EJO A;  3FF5 A;  1UHM A;  3RPU D;  2DCE A;  1D8K A;  4ZYD A;  3VOD A;  2DMQ A;  1B6A A;  1O3Q A;  3IUO A;  4XOT A;  2VUM J;  3U2R A;  5J8C A;  3KZY A;  3OYI A;  1G4D A;  5DTD A;  2JUC A;  1E3O C;  4OMZ A;  1YIO A;  4FCY A;  1Z3Y A;  3ZQH A;  3J80 K;  4CO8 A;  2UV1 A;  3P9K A;  4U87 A;  2YR2 A;  1GW6 A;  4V2G A;  3WG9 A;  4IZZ A;  1X3W B;  2P7V B;  5DCF A;  1VQ7 I;  2ISZ A;  1MSE C;  1Q0Q A;  4MTD A;  4EM1 A;  2VXD A;  2W00 A;  4M6V A;  2EFW A;  3LSI A;  2LDU A;  3E0J B;  2G9W A;  3LA7 A;  3RAS A;  4AIH A;  1Z67 A;  2EZK A;  3LQR A;  3ZQL A;  2VE8 A;  3BR2 A;  3TED A;  3SEQ A;  3MD2 A;  3PO3 J;  4AYB A;  3ERE D;  3ZQF A;  3LWF A;  5L3D A;  1WZ2 A;  1S9H A;  1S72 I;  2EZH A;  3EUH A;  3HSR A;  4MEY F;  5FD6 A;  1JUS A;  2CYY A;  3GZ5 A;  2PGG A;  1P6R A;  1ZGA A;  1TQM A;  3CO7 C;  4EM2 A;  1E3P A;  1IZ1 A;  1W7P D;  1PP8 F;  4LD5 A;  2VN2 A;  3FIW A;  4XRF A;  5ED4 A;  5J3L A;  3A0H C;  4F52 A;  1ITY A;  2F5F A;  3DFG A;  3B2X A;  2HU9 A;  3F8C A;  1GVJ A;  1ZAO A;  4BDY A;  4PUS A;  2E2J J;  2K4B A;  3VVM A;  2KP6 A;  3HPH A;  2WB1 N;  2DO7 A;  1H89 C;  4KUM A;  2NOJ B;  4AC0 A;  4PJN A;  4CDG A;  3I4N J;  1WI9 A;  3CMA I;  5J6X A;  1IXR C;  3SZG A;  5CVU A;  1O3R A;  1HST A;  1HOM A;  3ZMV A;  1V55 H;  3U9G A;  3HTS B;  5GPA A;  4Q4I A;  4UUV A;  2HOT A;  5LLQ A;  2EV6 A;  1EH7 A;  5CVV A;  2V1X A;  1B72 B;  2RNG A;  2HKO A;  4ANJ A;  3GW2 A;  2F2E A;  4MEX F;  2BXZ A;  4QSH A;  3KYL A;  3VFZ A;  2L4M A;  3OS2 A;  1ZGJ A;  2EGH A;  2DBB A;  3K1P A;  4XN3 A;  1X4O A;  1YOV B;  1ERD A;  4IOA F;  4RM2 A;  1EH8 A;  5K1Y A;  2VPL A;  1YX3 A;  2Q0O A;  4P5O A;  1ZS2 A;  2YSR A;  3ONQ A;  1QPI A;  2HWV A;  4ZDO A;  2ESN A;  3IKV A;  5CYV A;  1Z7U A;  3DKW A;  1AU7 A;  2E71 A;  3W2W A;  2DFH A;  3FXO A;  1OCR H;  3REO A;  3WU2 C;  2CW0 F;  2E1O A;  2K9Q A;  3MCZ A;  5HDN A;  3ISP A;  4Y52 J;  3V8J A;  4H4K C;  3TP0 A;  4HZF A;  1VQ6 I;  4M3E A;  4BH9 A;  5FLV A;  2IEK A;  4G6Q A;  3L2R A;  4HA8 A;  1WRJ A;  1Z3X A;  4EM0 B;  3BDD A;  3HBL A;  1P4W A;  1BI3 A;  3PUF A;  1MNM C;  2XPW A;  2YX7 A;  3FUL A;  2X4H A;  2ZXI A;  3P5J A;  4HX7 A;  4BJT A;  3U9W A;  1YX5 A;  3S2H J;  2XHK A;  4AIC A;  2O5R A;  2O7O A;  1UHS A;  2WWY A;  3OYM A;  2ZFW A;  1XMX A;  2VKH A;  1J9I A;  2QQ9 A;  3CCS I;  3I59 A;  2R70 A;  2L9R A;  3IV5 A;  3OOP A;  1IF1 A;  2O03 A;  2ACJ A;  1YHQ I;  1LQ1 A;  3KED A;  3DLA A;  2H8R A;  4LK1 F;  3PM1 A;  3FHN A;  4A2U A;  1RC9 A;  3HGY A;  1GHC A;  2OF7 A;  1ZTR A;  3CCV I;  2F5E A;  3BCB A;  4ASN A;  2J5P A;  3HDD A;  2R4G A;  3JRF A;  3FHZ A;  4Q4E A;  1OYW A;  2XPZ A;  2BVM A;  2MH2 A;  2PX9 A;  2VC1 A;  2V9K A;  1Z9C A;  1NH3 A;  1FIP A;  2AQF A;  2ZME C;  3ZQC A;  3OYL A;  1MJB A;  5D6F A;  2K3F A;  3RJP A;  3GFM A;  3HOW J;  4XN2 A;  4A03 A;  2R7U A;  3FM3 A;  4AR9 A;  5F1J A;  2CUJ A;  1OCT C;  5E79 C;  2VJJ A;  4GAA A;  2E1M B;  3NAR A;  5E3L A;  4D0P A;  4HNV A;  2R7W A;  4A12 A;  4E7H A;  3FU5 A;  4FCA A;  5ICE A;  3KLN A;  9ANT A;  4A93 J;  1SC5 A;  1D5Y A;  3H3U A;  2FA5 A;  1P4A A;  2IS6 A;  3BQY A;  3SQN A;  3GX4 X;  3EUK L;  3KIO A;  1YIJ I;  5JC1 A;  3FMQ A;  3A02 A;  3DU5 A;  3LSK A;  3K4C A;  2A6T A;  4IRG A;  4GO1 A;  4C3I J;  1JG9 A;  3GXO A;  1IDZ A;  2IGK A;  4HW0 A;  4PCQ A;  2WZG A;  3S3N A;  4XRS G;  2L9V A;  2HZT A;  1WWX A;  1XCB A;  1QQI A;  3HSF A;  2K4J A;  3K6G A;  5EG0 A;  2VOO A;  4N4N B;  3R6S A;  4UUT A;  3DKY A;  2V1D A;  1FP1 D;  1R5H A;  2Y1C A;  2DW4 A;  1BC8 C;  4DGW B;  2LYC A;  3OYG A;  3BPX A;  3B6A A;  1OPC A;  4LFU A;  1K83 J;  4PK4 A;  4B44 A;  2IRF G;  1R1V A;  2KIF A;  2IAI A;  4XBF A;  4RCV A;  3D5S C;  3ZXS A;  4JQF A;  4Y33 A;  4ZQE A;  3QYE A;  3BZC A;  2P7C B;  2LY2 A;  2VC0 A;  5L3G A;  1TWA J;  5ERI A;  3EBH A;  4UV8 A;  1UB9 A;  1RIO H;  6PAX A;  1R0K A;  2VAS A;  2JTV A;  3ZMU A;  1OR7 A;  5EF6 A;  2OV7 A;  2A69 F;  2IW5 A;  3K70 D;  2R7Z J;  2JD1 A;  5KHD A;  1YS7 A;  3TDU C;  5EZH A;  3AG3 H;  2ZME A;  4A69 C;  3GFJ A;  3ANL A;  1MBE A;  3H3V K;  4PFO A;  2ZXW H;  4FLQ A;  3G1O A;  1D0X A;  2F5V A;  2N8G A;  3DBH B;  4G6D A;  2JD0 A;  4EGZ A;  4BBR J;  3F6O A;  4AWX B;  3FK7 A;  4RGS A;  3Q9V A;  5H2F C;  3K4J A;  5FRO A;  1MDM B;  2K9L A;  3DPL C;  2EZI A;  4V2F A;  4C3J J;  1MZB A;  3FU0 A;  4EJT A;  1S7A A;  4L9N A;  3JRD A;  3FTZ A;  1S6L A;  2R0Q C;  2VJ8 A;  2VJ5 A;  5DYM A;  1R58 A;  2DFI A;  2DA4 A;  2IGO A;  3FUE A;  1ODD A;  1UJ8 A;  4I0B A;  5KCM A;  2MLG A;  5J47 A;  3ZGK A;  3GFL A;  1L0O C;  1WJF A;  2QM3 A;  2Z2S B;  5DEQ A;  1D1B A;  4M72 A;  3ZHX A;  1MMG A;  3KP2 A;  4Q47 A;  5M3M J;  1QGP A;  3HRS A;  4L5E A;  4YFK F;  2DA2 A;  3CP2 A;  4ZTF A;  1XTA A;  3LMM A;  5DV5 A;  4HV6 A;  5FKM A;  4CXF A;  2M7B A;  3K9T A;  1HDP A;  1OMI A;  2QLZ A;  1X3W A;  4L9T A;  3HOZ J;  3TOB A;  4K5O A;  3HJE A;  2RQQ A;  4M6Y A;  3FUI A;  2Y1E A;  1A6Q A;  1U6G A;  1Z21 A;  2ZJ2 A;  3CLO A;  1XG1 A;  4BHP A;  2F6C A;  3SDB A;  3ZMD A;  5J40 A;  4KIB A;  3CCU I;  2RV8 A;  3H9Q A;  3KX2 A;  2E1N A;  4RDU A;  3IKT A;  3EUA A;  1ULY A;  1D8J A;  3O2P E;  4ZJZ A;  2R7D A;  1OCO H;  2AHQ A;  4MTE A;  5D6E A;  3ZQI A;  1P9Q C;  2Y0M A;  4KN7 X;  5IP7 J;  2JVG A;  2XV4 S;  1F1Z A;  1ENH A;  2ID6 A;  2PBI A;  3BJA A;  1YRN B;  2FEZ A;  2HDD A;  3MEX A;  3TQN A;  1JKO C;  4AM3 A;  3LAJ A;  1ON1 A;  2CQ7 A;  5E18 F;  1RPW A;  2PMU A;  2RJI A;  1UHW A;  4YIR X;  2A68 F;  5LRR A;  3EYY A;  4PFP A;  4ZQT A;  3A0B C;  2X6X A;  3TO9 A;  2HQA A;  2CW7 A;  5GPC A;  1JT0 A;  2DK8 A;  2L54 A;  2M1B A;  2F48 A;  2KKO A;  3RC8 A;  5JI6 A;  1KYW A;  1MGT A;  5HLT A;  1I1S A;  2YU3 A;  1MND A;  2AXT C;  4MNU A;  2WC2 A;  3VPR A;  3ZOB A;  4F7Z A;  4HRI A;  3LOC A;  4XO3 A;  4Y17 A;  5J1Y A;  1H9G A;  4JK1 X;  2BW3 B;  4Q4Z F;  2DTR A;  4Y3O A;  1F5T A;  5DM7 F;  2ZBK A;  3GWZ A;  3OYE A;  4K5M A;  3W2A A;  2XC7 A;  1LDJ A;  3N05 A;  4HLX A;  1FMW A;  2QQA A;  3HHG A;  3HTU A;  3GTP J;  2XDV A;  2LNB A;  2JA5 J;  3ZI0 A;  1B8I A;  1I6X A;  1G8X A;  2X1C A;  2KLO A;  2LF7 A;  1LDK B;  1I27 A;  2KIS A;  2E1M C;  3RKW A;  1I3Q J;  2R5Z B;  2AO9 A;  4M9X A;  2GIV A;  5D5V B;  4FQG A;  4NC7 A;  4IXA A;  2EBI A;  2R5Y B;  3FXU A;  4PDK A;  4II2 A;  4BS9 A;  3J7Z I;  3QPL A;  4BY7 J;  3FUK A;  3FUJ A;  2CV2 A;  2X48 A;  3KZI C;  4ESB A;  4CYC A;  1YFH A;  2ZNY A;  5CQG A;  3JRE A;  3MKZ A;  1XS9 A;  2WPG A;  2E2I J;  1OIS A;  1W0T A;  5KVR A;  4XLE A;  3I54 A;  3VYT B;  3B34 A;  2K40 A;  1LKX A;  4B48 A;  3LSP A;  3AL0 C;  4CZZ A;  1TP4 A;  1SVL A;  1APL C;  3ZQ7 A;  2JV7 A;  4XOR A;  3V7R A;  1Q0H A;  3F3X A;  4UNO A;  1A5J A;  3JAM K;  1FBS A;  4OAY A;  4KT6 A;  2HI3 A;  4X2U A;  4BAY A;  2Y0S N;  4U0W A;  3VYR B;  2ZKZ A;  2EFQ A;  4IHX A;  4BBS J;  2XAG A;  5B5E C;  3HL2 A;  2P0W A;  3CO6 C;  4QIW N;  4AIK A;  1BL0 A;  4UVA A;  2HS5 A;  4D1Q A;  5J1U A;  3I4P A;  2EIJ H;  3BR5 A;  4OIR F;  5IOY A;  4BEH A;  2IT0 A;  4AD9 A;  1CQT A;  2WA0 A;  2STW A;  3CZL A;  2GLO A;  1UAA A;  2W1O A;  3AKZ A;  1Z6R A;  4R7L A;  2OTJ I;  3H1C A;  4UHT A;  3VSL A;  5DCM A;  1FEX A;  3DTI A;  3E1S A;  3H0G J;  3LQQ A;  3X2Q H;  5CVJ A;  4FX4 A;  4XNA A;  3WGI A;  2YS9 A;  5D5W B;  4A3J J;  3B3B A;  1G2H A;  2M9H A;  4IHY A;  1ZLK A;  1W0U A;  3H36 A;  1E17 A;  2EIM H;  4KP7 A;  3MKW B;  2O9L A;  3GTQ J;  1UZC A;  5DD8 A;  4D7M A;  3K4L A;  3PL8 A;  3QWL A;  2V26 A;  4GGG A;  2L2O A;  3Q3S A;  2VT2 A;  3C2H A;  1K61 A;  2VQC A;  4IEJ A;  3GZ6 A;  2V79 A;  4BDZ A;  4ZTJ A;  2HYF A;  4XNF A;  5FD5 A;  1PP7 U;  2CH0 A;  2K9N A;  1IC8 A;  1H0M A;  1OCP A;  3BWG A;  2F5C A;  1X1P A;  2D2W A;  4IVN A;  2HPO A;  3JT1 A;  1RKT A;  2QEN A;  2RGV A;  4HDV A;  1QA6 A;  1K79 A;  1GVD A;  1X2N A;  2DYS H;  3M9A A;  5D8L B;  4ZW3 A;  3O8G A;  2KZV A;  4Y6P A;  2XAS A;  5BNG A;  5E1W A;  4GRI A;  1S5L C;  2JA2 A;  2Q8K A;  4AYS A;  2QGU A;  2DXI A;  2HOA A;  1U5T C;  2FBI A;  1R00 A;  2OCC H;  3AU8 A;  4XMY A;  2OQR A;  2M4G A;  1P4X A;  4F93 B;  2MG4 A;  4A6E A;  1KQ0 A;  2IGN A;  1F36 A;  3MVP A;  4XSX F;  5LD2 C;  4M6X A;  2GXG A;  4MIM A;  2NRA C;  2IA2 A;  2IS2 A;  5FRN A;  1Z6T A;  1ORK A;  2AS5 F;  1BR1 A;  3HUG A;  3TDZ C;  3WQS B;  1QNT A;  4IPA A;  3P9I A;  2FBH A;  1RNL A;  4M9S A;  2DOF A;  5JHF A;  1JTY A;  1S7E A;  3CTA A;  1MMN A;  1E0E A;  5LHH A;  2GM4 A;  1FOX A;  4DBQ A;  4EJW A;  5LEJ A;  2EFO A;  1IW7 F;  1WPK A;  2V4J C;  4CA0 A;  3CF5 F;  1XSD A;  3D5R C;  3KEY A;  2DOE A;  1SG7 A;  1TWG J;  3CQZ J;  2E5Z A;  1KZH A;  1N77 A;  3R0J A;  3WU1 B;  3L2C A;  5TRD A;  2K7L A;  3QQA A;  2L02 A;  1YTY A;  3WTS C;  1BW5 A;  3SYT A;  3MQ0 A;  3SXY A;  3AG2 H;  3EQL F;  3LSM A;  4KIC A;  2K85 A;  4FAS D;  2JPB A;  1VQK I;  3UER A;  1HW5 A;  3O8H A;  3CLQ A;  3CCL I;  4KJZ A;  2XKO A;  4DYQ A;  4BAC A;  1BJZ A;  4BXX J;  1MW3 A;  3HSE A;  1SC7 A;  3VB2 A;  2V9P A;  1O3T A;  1I1G A;  5JO0 A;  1W36 D;  1WFX A;  2LD5 A;  1BJA A;  3QP5 A;  3ANM A;  1JJ6 C;  4IHW A;  2XRL A;  4N9H A;  4BJ6 C;  4HBL A;  4R5T A;  5J4V A;  1F43 A;  3QOE A;  3OSG A;  2YU9 J;  4E4H A;  4FET A;  4ENM A;  2W24 A;  4RGU A;  3CDL A;  4HF2 A;  1R0L A;  2BYV E;  4MS6 A;  2E36 A;  4F91 B;  3H5N A;  3F21 A;  2JRT A;  2JPC A;  1G6N A;  1VI0 A;  1XC5 A;  1U5T A;  3A03 A;  1EKE A;  4G7H F;  1NK2 P;  2JCV A;  2PL5 A;  2Y30 A;  1T39 A;  4RBO A;  3BY6 A;  1YW8 A;  5FWQ A;  2GQQ A;  2MW8 A;  3M8F A;  3E7L A;  4GYG A;  1XSV A;  3VYU B;  1ZR4 A;  2E35 A;  1R23 A;  1O4X A;  3A01 B;  2HPM A;  3FU3 A;  3GYH X;  1O57 A;  1SD6 A;  1FIA A;  1ZN2 A;  3SFZ A;  1D5V A;  3CME I;  4O3M A;  1VQO I;  1T8I A;  2ELH A;  3FIS A;  2BE5 F;  1I3A A;  1MMD A;  1TW2 A;  4QLC U;  2NNY A;  1W7P B;  1WSU A;  3ZR8 X;  5EGO B;  2DI3 A;  2K02 A;  1T38 A;  1DU0 A;  3ABL H;  2YPR A;  1NHA A;  2JRM A;  4B1R A;  4FLR A;  3LNQ A;  2OAZ A;  5BMZ A;  2ETH A;  1X3U A;  2GA2 A;  3KYD B;  1IN7 A;  3BJ6 A;  3OIO A;  3PNY A;  1AWC A;  3J81 Z;  4N4O B;  4JP0 A;  4A3C J;  2B0L A;  4EVI A;  4A6D A;  2ELJ A;  3KZZ A;  1TWF J;  2E7W A;  1TNT A;  1IDY A;  3GVA A;  4M71 A;  2EIN H;  3WQR A;  1QVT A;  4KFC A;  2R7R A;  2NS0 A;  3WTT C;  2XPV A;  5CPR B;  5FFX A;  4ENJ A;  2MSY A;  2VJI A;  3CMM A;  3RPQ A;  5E17 F;  5JMW A;  2DMP A;  2IJL A;  4YIF A;  1ZRF A;  4BHC A;  1ONO A;  2A6E F;  3QPS A;  5EEG A;  3PIP F;  1MW0 A;  3HW2 A;  3Q44 A;  1KQ9 A;  2RN7 A;  3OIP A;  1QRY A;  1D1A A;  5JLW A;  2BOL A;  2H94 A;  4UUS A;  2QBY A;  4UXN A;  4D5C A;  4UY8 I;  2EPF A;  1B4A A;  4MQ9 F;  1FJL A;  1MBJ A;  1DP3 A;  4KMU X;  3PNT A;  3GTO J;  2X1E A;  2M4K A;  2D1H A;  3O6B B;  2CFO A;  4RAY A;  5HLH A;  1BR4 A;  2GZW A;  4GCV A;  3IC7 A;  3J81 K;  2Y75 A;  5KK1 A;  4JX4 A;  4HDU A;  4N9I A;  1LVK A;  1UST A;  2W85 A;  1JVS A;  2L01 A;  1U0J A;  3GTK J;  3L9F A;  2EFN A;  2MLK A;  2YUS A;  4XSZ F;  2LBF A;  4KN4 X;  2EB7 A;  1CF7 A;  2NYX A;  4A3G J;  4HPQ A;  4HQM A;  2K5C A;  3G2B A;  3FMR A;  4WWC A;  3I64 A;  1MW7 A;  5DS9 A;  2XRN A;  1G59 A;  2FFL A;  4AID A;  1BIA A;  3WQQ A;  2QA4 I;  4LOC A;  4Q48 A;  1OCC H;  3T1B A;  4LJZ F;  1U2W A;  4Y15 A;  4L0Y B;  2E60 A;  2HOE A;  1UG0 A;  2V1N A;  5JLX A;  3JW4 A;  4NB5 A;  3F8M A;  4EJV A;  4LLL A;  5FKK A;  1ZGW A;  4AR1 A;  4MFD A;  2ME0 A;  3G4S I;  2X6Y A;  4KIS A;  3A06 A;  3JRA A;  4XON A;  4HYE A;  5TJJ A;  2JT1 A;  1XMA A;  2RVC A;  1UFM A;  3JRI A;  5L3C A;  2O61 A;  1TT0 A;  2LY1 A;  1G3T A;  3KFW X;  5IT9 Z;  4ZDP A;  4R5V A;  2V6E A;  3FXJ A;  2H27 A;  1XD7 A;  4M74 A;  4IKF A;  4K5N A;  3HPG A;  3BT9 A;  2R7T A;  4NC8 A;  2LVS A;  4NBQ A;  4RLQ A;  1HLV A;  3FXR A;  4CCJ A;  3RCO A;  3GLL A;  3WTW C;  4ZW5 A;  2HXI A;  4R1H A;  2MH9 A;  3PUU A;  2WAQ N;  5EV7 A;  2JA7 J;  1RES A;  3FUF A;  4HAM A;  4R5X A;  3ECH A;  1MH4 A;  2KL4 A;  2LTP A;  3NRV A;  1OFC X;  2NVQ J;  3ZP5 A;  1IAW A;  4S05 A;  1JT6 A;  5HVQ C;  2W4S A;  5IOZ A;  3KP5 A;  3AUA A;  3WTU C;  5LFA A;  2LFB A;  4E6K G;  1VQ9 I;  5M3F J;  2Y1F A;  2HXO A;  1AKH B;  3GEZ A;  4E7K A;  4GDF A;  1LE8 A;  2Z33 A;  2P5L C;  2CWE A;  2LRD A;  1FPQ A;  1WJB A;  2ID3 A;  3MN2 A;  4D7N A;  3PQK A;  2FUG 2;  2COM A;  1W4M A;  1ACI A;  3A1Y A;  3OWT A;  1D1C A;  3ELK A;  2UZK A;  1TWC J;  1FYM A;  1LFP A;  4Y67 A;  1X3Z A;  3HKZ A;  2R3S A;  2KDZ A;  3LAP A;  3K4M A;  2L7Z A;  2XSJ C;  1MBK A;  2Q1Z B;  3HXL A;  3G73 A;  1VQM I;  1XGN A;  2NVX J;  4A5M A;  2H8W A;  3M1E A;  3CMY A;  1KU7 A;  4IRI A;  1XX5 A;  1HKQ A;  2VLA A;  3N97 A;  5IP6 A;  3FK6 A;  4I2O A;  4C2T A;  2GOX B;  3L00 A;  2FF4 A;  2MFZ A;  2EA4 A;  2VQH A;  3G71 I;  2XVC A;  4ARF A;  1QVU A;  4RGX A;  2PJR B;  3BOQ A;  2PMZ A;  1ETV A;  3GTG J;  2ZXG A;  3OYK A;  3G6E I;  1GDT A;  3ANN A;  3WOD F;  2M0C A;  4LG0 B;  2HQR A;  2W48 A;  3R61 A;  1JXS A;  2EJR A;  3TGN A;  5KAF C;  3G3Z A;  3BPV A;  4ETS A;  4NHJ A;  4K5L A;  4MKT A;  3LL7 A;  1VTN C;  3K69 A;  2HNH A;  2J5O A;  2Y31 A;  1VZ0 A;  1IO2 A;  5E1X A;  3CCR I;  3F0C A;  4DNC A;  3OYF A;  1HC8 A;  1Q1V A;  3FBI B;  1WKM A;  1WH7 A;  3CF2 A;  5E3N A;  3I53 A;  4XKB A;  3H5R A;  4EV0 A;  3RPU A;  1MH3 A;  1R71 A;  4A3D J;  3PFY A;  3H0D A;  3UKG A;  4RB0 A;  1IGN A;  3NWS A;  4HF0 A;  3MWM A;  3B7S A;  4U0V A;  2HYJ A;  3RZD J;  4FLO A;  1FSE A;  4EMS A;  3VOE A;  1MSF C;  3EET A;  1ON2 A;  4ZW8 A;  4ESJ A;  2M8E A;  3HZJ A;  2BY2 A;  1GUU A;  3HRT A;  4GAE A;  1HDD C;  4J3B A;  2RDP A;  1P92 A;  1X1A A;  4BQA A;  3F6V A;  4DPR A;  3BR0 A;  1JI8 A;  1M1E B;  1SFE A;  2DT6 A;  2X9D A;  3KLO A;  4K5P A;  4WF2 A;  1ZG3 A;  4P9U A;  1MBG A;  4QME A;  2A07 F;  1K78 A;  1R9T J;  3HOU J;  3GTM J;  3PFI A;  2IA0 A;  4CCL A;  4ZQH A;  3VYS B;  4CSW A;  2PMH A;  5TGT A;  2ECC A;  3B2P A;  3OL4 A;  2TDX A;  1T56 A;  1ETO A;  4P55 A;  3SHF A;  5E3O A;  3QRF F;  4BQO A;  4XLP F;  2WAF A;  3H3Z A;  4FE4 A;  3BG5 A;  3KCC A;  3DPT A;  5KAI C;  2KQR A;  4ZH4 F;  1HW1 A;  2XB0 X;  4G9Y A;  3TW7 A;  3K4B A;  4ZC3 A;  2CUF A;  2HZD A;  1J0R A;  3LA3 A;  3E6M A;  4XQF A;  3CC7 I;  3G1L A;  4YFX F;  1W7P A;  2VIX A;  1MVY A;  3RKY A;  5J8F A;  3FTU A;  2CMP A;  2VKE A;  4Y7N J;  2X85 A;  4E7J A;  2V7F A;  4PJM A;  2OTL I;  1WGX A;  3RKQ A;  2MAO A;  5JAZ A;  1T98 A;  4XN0 A;  1MW2 A;  1Y6I A;  5FB2 A;  3SEZ A;  1HF0 A;  4IHV A;  1TT5 B;  4XK4 A;  3PSI A;  4XRM A;  1OCZ H;  1ZQ3 P;  1R36 A;  1FZP B;  1YS6 A;  3HRM A;  1Y8R B;  3U21 A;  2H6C A;  4NQW B;  2ICW G;  2KRF A;  5FLM J;  5GAH J;  2BZT A;  2R92 J;  4YG2 F;  4IOC F;  2NS8 A;  3CCE I;  3U1D A;  1FBU A;  3CUQ B;  3DBL B;  4G7O F;  4DOZ A;  2V6C A;  4ITV A;  4WXH A;  1ONV A;  4PSX A;  5F0C A;  1IXS B;  2K9S A;  3ABU A;  2Y9Z A;  1HBX G;  2VBY A;  4FT8 A;  4FX0 A;  2AQE A;  3K1N A;  2Y48 A;  2LK2 A;  3BTJ A;  2BXY A;  3TKY A;  2NOG A;  2VBX A;  1E2X A;  2FE3 A;  2BVL A;  2LF8 A;  2XSD C;  1ZG5 A;  3DCF A;  3QPT A;  4XN9 A;  3F23 A;  4M9Z A;  4CH7 A;  2H1K A;  1W1W E;  4A3L J;  1S3J A;  1S46 A;  1V5E A;  1Y0U A;  1XSX A;  2RQP A;  1G3S A;  1PUE E;  1P7J A;  5TIS C;  1WH5 A;  2B63 J;  4A3E J;  3MFK A;  1T0F C;  1P7I A;  2WV1 A;  2HDW A;  1IG7 A;  3S1Q J;  4HST A;  2IXS A;  1Y0N A;  3ZCO A;  3FTX A;  2XGE A;  3ZHY A;  2UWM A;  1PUF B;  2Z16 A;  1T1S A;  3FUM A;  1E3H A;  3B73 A;  3Q9S A;  2A61 A;  1D0Y A;  4I98 B;  4KIT B;  3CJQ B;  2FRH A;  2MAB A;  4IQJ A;  1QO0 D;  1XGS A;  4HF1 A;  4IQ4 A;  1W5C C;  2XAH A;  3K4N A;  1VQL I;  3FKJ A;  4O6J A;  4EAT A;  1HA8 A;  2NVU B;  4ON0 A;  1SFU A;  4HG2 A;  5L3B A;  4P9F A;  2HR3 A;  3OS1 A;  5JR3 A;  1PYV A;  2NS7 A;  2PQ8 A;  4U7B A;  4E7L A;  2K3P A;  4UVC A;  3ZMS A;  5LBQ A;  5GP9 A;  1B72 A;  5FKO A;  5D4S A;  2GXA A;  2VBW A;  3IP4 B;  4JND A;  5K5R A;  1NG6 A;  2WY8 Q;  1J59 A;  3RIR A;  2EK5 A;  3AFH A;  2QSH X;  1TQP A;  4NUB A;  3T8T A;  3RQI A;  5GAE J;  1J09 A;  3CHP A;  1WCM J;  3QU3 A;  3OOU A;  1X1B A;  4L5I A;  4W97 A;  4A5N A;  3CCM I;  2LC2 A;  1W5S A;  4PGG A;  2WAE A;  2CUE A;  4N0B A;  5ILV A;  4YEL A;  1XDU A;  2QCO A;  1BBY A;  2ZFU A;  2JSP A;  2H1L A;  2WAD A;  3NAU A;  5FO5 A;  1K6O A;  2PI0 A;  5DYF A;  4XKC A;  2B9S A;  2M30 A;  1R5I D;  2WTE A;  3QPH A;  3K70 C;  3V4G A;  1JGS A;  5E20 A;  4CYD A;  3E3V A;  2ZCW A;  1VQ5 I;  2HVR A;  4OIN F;  3FWE A;  4I02 A;  5DM6 F;  1MBH A;  3TP3 A;  3WTY C;  1GXQ A;  3GCM A;  5JVT A;  3WTV C;  1STZ A;  4RSY A;  3AG4 H;  3LSR A;  2DOA A;  4XKV A;  1DGR M;  1T2K A;  2LLK A;  1KON A;  1J75 A;  3DTK A;  3HOY J;  2JN6 A;  4Y4R A;  2F4I A;  2OPT A;  2BY3 A;  4E70 A;  4CGZ A;  4QPE A;  3QP6 A;  1A04 A;  3CXB A;  3EBI A;  4G94 A;  2E1C A;  3LST A;  2QSF X;  3M7G A;  4CUG A;  4I09 A;  3FZV A;  2LKS A;  4P1W A;  3A14 A;  4XN4 A;  3FM5 A;  1KU3 A;  4M3B A;  4LK0 F;  3BRO A;  5B3S H;  4F3Q A;  2DT7 B;  3WE2 A;  2Y9Y A;  2I8D A;  1A6I A;  1BOA A;  2Z1D A;  2L7K A;  3BC8 A;  3HOS A;  2OBP A;  5BPD A;  1REP C;  2RRE A;  2EV5 A;  4W1U A;  3EYI A;  3K0L A;  2FML A;  4AYB N;  1U3E M;  3FUN A;  3MMY B;  3VDX A;  1QZY A;  2XKP A;  2CJJ A;  3K4K A;  1J7K A;  4YII A;  2CV0 A;  3LA2 A;  1TNS A;  3FHE A;  3CHS A;  5JNL A;  3LFU A;  3RZO J;  1S29 A;  4HLY A;  1FY7 A;  1WHU A;  3F9K A;  2LKP A;  5K7F A;  3RC3 A;  3IRQ A;  2DA6 A;  1IUF A;  1SD5 A;  4IHS A;  1ETY A;  5CKT A;  3BR1 A;  5LHI A;  2D1V A;  1RR7 A;  1JTX A;  1Y8Q B;  4DZP A;  4A3F J;  2Z9O A;  5K5Q A;  3R0I A;  1BA5 A;  2X51 A;  4R8H A;  5KNL A;  4QTR A;  5EZG A;  2RAE A;  1T08 B;  1SMT A;  3H9J A;  3SZP A;  4PW4 A;  4L5J A;  1YYV A;  2JVH A;  1LB2 A;  1BN5 A;  4G7Z F;  2A5Y B;  1PJR A;  1R7J A;  2DMN A;  2BBY A;  1ZRE A;  3HIF A;  4PSW A;  3C2B A;  1K7A A;  3FTV A;  1N78 A;  5EJC A;  5HDK A;  2ZSH B;  1B1B A;  2MD0 A;  1FBQ A;  4QWQ A;  4I0A A;  2RKH A;  5ICF A;  4U88 A;  3EDP A;  5IP9 J;  2CV1 A;  4PGH A;  1TWH J;  2VE9 A;  2PLY A;  3CDI A;  4WCG A;  3K1M A;  1MD0 A;  3H9G A;  3GBG A;  3KEQ A;  3D5L A;  2CQQ A;  2VQL A;  1X1C A;  2MA3 A;  2DA7 A;  4XO4 A;  3I59 B;  1BI2 A;  5B66 C;  3FU6 A;  1VQP I;  2XUB A;  1JKQ C;  4BQN A;  1VQN I;  3VVL A;  3HM5 A;  4QPO A;  4I99 C;  1MNE A;  2O0Y A;  4F55 A;  3L1P A;  3GFI A;  3L2V A;  5FJ8 J;  3DU6 A;  1JHH A;  4IX7 A;  2CO5 A;  3GF2 A;  1ZLJ A;  5ICG A;  2IA1 A;  1JKP C;  1LUJ B;  4XMV A;  1FX7 A;  2M5W A;  3V8L A;  4XLF A;  1WJ5 A;  5AIP A;  3Q0W A;  1I5Z A;  2CGP A;  4XLN F;  2KIM A;  4XM3 A;  3ROU A;  4DYR A;  2MD5 A;  4B3X A;  3OY9 A;  2F4M B;  1BR2 A;  2JA6 J;  1Y56 A;  2VJ4 A;  3Q5F A;  2V9V A;  2GTQ A;  4ZX4 A;  1BM9 A;  2XGD A;  3WE3 A;  1DU6 A;  2ZJR F;  2DN0 A;  3HOV J;  2X6O A;  1A36 A;  4ZX5 A;  3ABM H;  1OYY A;  2JK3 A;  2VT3 A;  4DJA A;  4HNT A;  4XMU A;  5D8K B;  4KIG A;  1MDM A;  5EEA A;  2L7F P;  4MLO A;  4MFE A;  4S0H B;  2L7M P;  4B4C A;  4IF4 A;  2DMU A;  5BQT A;  2OC6 A;  5H6Q A;  1PDN C;  1VFC A;  2VB6 A;  2QYO A;  4XMX A;  3E6C C;  2E34 A;  4KYW A;  3L7W A;  5A2Q Z;  3CES A;  1D0Z A;  1ETW A;  2R72 A;  2O8X A;  2XAU A;  3C1D A;  4OOE A;  1HXD A;  3BZK A;  4LIV A;  5F27 A;  4ZYG A;  1YQA A;  3TMO A;  1YG2 A;  5EG0 B;  2QQ8 A;  3BG3 A;  3KEO A;  2R59 A;  2OZ6 A;  1C0W A;  4XLA A;  2K9M A;  5CQE A;  4PVB A;  3FH5 A;  4L2L A;  2Z3Y A;  2EIL H;  2XF7 A;  4NNJ A;  5HS9 A;  3EBG A;  1AA7 A;  1XMK A;  4BHB A;  2C5Z A;  2COB A;  2LY9 A;  3NWT A;  2FJ1 A;  5HOO A;  1RP3 A;  3QYF A;  4HNU A;  4ENK A;  3Q0U A;  3ZHZ A;  2Z99 A;  1R22 A;  3ESW B;  3K2Z A;  3BG7 A;  3TO7 A;  3CZ6 A;  1R4N B;  4IO9 F;  1MMS A;  4ZQF A;  3CHR A;  2WZF A;  4BJ5 C;  1Y1V J;  4BUP A;  4KMF A;  1I6H J;  3MKL A;  5K7H A;  2RNJ A;  2DAO A;  2FQ3 A;  5FGM A;  4U0Y A;  1FP2 A;  5FKL A;  2KRH A;  1PVE A;  3I0T A;  4CCN A;  1O7F A;  4ENN A;  2ESH A;  3KPH A;  1JUP A;  2L5Q A;  2IPQ X;  1GLN A;  4O5V A;  4XKW A;  4BL0 B;  4LB6 B;  3S3M A;  3V42 A;  1UEL B;  3TBI A;  2HTS A;  3QU6 A;  2B61 A;  2ZME B;  2VOD A;  5A2Q K;  3CZE A;  1B9M A;  1EJ9 A;  1TW3 A;  4XOP A;  3L09 A;  2X1D A;  3RSN A;  4I6Z A;  3A4C A;  1Y1W J;  5JBI A;  1JGG A;  3CC2 I;  2JD2 A;  3B7T A;  2XAF A;  3ECO A;  3IAM 2;  1L3L A;  4B09 A;  1OYI A;  3J7A Y;  1FOK A;  2X0L A;  1YRN A;  3ASO H;  2VL8 A;  5C4X J;  3H35 A;  2W25 A;  5K7Z A;  5F08 A;  5FKN A;  4PU2 A;  2DTZ A;  4ZN6 A;  3PIO F;  1BIB A;  4HSR A;  3U1K A;  2QZ8 A;  2P6T A;  1HS6 A;  1LDD A;  1NG7 A;  3JTH A;  3HG9 A;  3WHB A;  4RB1 A;  3I56 I;  1RZ4 A;  2L0K A;  1FYL A;  4IHT A;  1F9N A;  3S14 J;  1SVM A;  1UMQ A;  4JYK A;  2ME6 A;  3VWB A;  3G1M A;  2O6G E;  3W2V A;  3DKX A;  2CU7 A;  2DJN A;  4YEJ A;  3ZN0 A;  1HKT A;  1K4S A;  3KP4 A;  2DQR A;  2EIK H;  4EGY A;  2XAJ A;  3PO2 J;  4G6T B;  2VKV A;  2BW3 A;  2Y0S A;  1G3Y A;  3L2U A;  2KRC A;  3QOD A;  4BE0 A;  4IL6 C;  4A0X A;  2A5W A;  3OYJ A;  4H0E A;  3HHH A;  3W6J B;  2HKX A;  4B43 A;  3KYC B;  1X4P A;  3OYD A;  4OIO F;  1H19 A;  3CUO A;  2QSG X;  1LFU P;  3CIA A;  4RB2 C;  1YIT I;  3NEU A;  2ZB9 A;  2KFD A;  4CHU A;  4GXO A;  2KDO A;  3S3O A;  2R5Z A;  3UEQ A;  4KT5 C;  1FOY A;  5L3F A;  2GA1 A;  3QAH A;  3BCA A;  2R5Y A;  1H8A C;  2NVT J;  3M3Y J;  3DEW A;  5CJ9 A;  4LMY A;  3JR9 A;  2HDC A;  1IJW C;  2JCY A;  4B47 A;  1QHH D;  5DDG A;  2O3F A;  2EH3 A;  1VND A;  3VEP A;  3IH4 A;  4D9J A;  2GBY A;  1V54 H;  2IVM A;  4ZDL A;  2KT0 A;  2FOK A;  2M0M A;  2KJB A;  1FNN A;  3WHC A;  1LEB A;  1KYZ A;  4QUO A;  4MHG A;  4C30 A;  4Y13 A;  1AOY A;  3I58 A;  3IHU A;  2ZSI B;  5DLL A;  2A3S A;  5DUL A;  3Q0V A;  1HSJ A;  1W36 C;  4ZYE A;  5IYD J;  3WGG A;  1J2X A;  5HS7 A;  4Q5S F;  2JCX A;  2Y69 H;  2C6Y A;  2XB5 A;  2OJE D;  1KU9 A;  1WJA A;  1VF9 A;  4L9V A;  4XO5 A;  3PUB A;  4UB6 C;  4A3B J;  1YJN I;  3JSP A;  1SEU A;  4U7D A;  4XMW A;  4CCK A;  4MQV A;  2FU4 A;  3T8R A;  5F0H A;  5HOD A;  2WY7 Q;  3P7N A;  3RI4 A;  4B3A A;  4ZW7 A;  1RUO A;  4PJ0 C;  3TW6 A;  4UVB A;  2XPU A;  1YE9 A;  3FXL A;  1JKR C;  2ZNZ A;  1MMA A;  3H92 A;  1LFB A;  2DPU A;  4OMY A;  2V1U A;  3OS0 A;  4NDL A;  3S32 A;  3CCJ I;  3OIQ A;  1SMY F;  3OL3 A;  4BY1 J;  3J7A O;  3CCQ I;  2LH9 A;  1B8I B;  4DW6 A;  4CZC A;  2R7X A;  3H5A A;  3RTR A;  3D1N I;  2OU2 A;  3PQJ A;  5C3E J;  3B37 A;  4HX4 A;  4J00 A;  1XGM A;  2M2E A;  3C18 A;  3HOT A;  1ZG1 A;  1KA8 A;  5F64 A;  4M3F A;  1DDN A;  4KDP A;  4E7I A;  3ZPL A;  2FMY A;  2PN6 A;  1BW6 A;  4BYY A;  4LLG F;  4FE7 A;  3FXK A;  2I10 A;  4CYC B;  1V4R A;  1R4M B;  1ZYR F;  3KP6 A;  4Y6R A;  1MBF A;  3HB9 A;  3I55 I;  3FX3 A;  5AIQ A;  3HYI A;  5BS6 A;  2LOO A;  4GFB A;  3LFK A;  3S2D J;  2GIZ A;  1FTT A;  1JJ8 C;  4BU2 A;  2MAP A;  3AG1 H;  3I3L A;  1IN8 A;  2HPT A;  3FXM A;  4HV5 A;  3WG7 H;  2HFH A;  3B6C A;  3A2K A;  1RI7 A;  1FT9 A;  2A6H F;  5IT9 K;  5GAD J;  3JRG A;  4I01 A;  2BY0 A;  2G7U A;  3JCU C;  1RR8 C;  2OZU A;  3QYB A;  2ZXJ A;  2OD5 A;  2XGC A;  5DUI A;  1G3W A;  3TL4 X;  2DT5 A;  4XRS A;  1XB4 A;  2KZG A;  2OQG A;  3M8E A;  4XR6 A;  3KP7 A;  4KIF A;  4B8X A;  4JX5 A;  4R79 A;  5E1Z B;  1WJC A;  3S1N J;  2CSO A;  1ETQ A;  3KP3 A;  4LG3 A;  4BEH B;  2CUZ A;  1R49 A;  2Y1G A;  2OA4 A;  2H6B A;  4ABZ A;  1Q0L A;  1IXC A;  2BEO A;  5LGN A;  5IPA A;  2IGM A;  1TL8 A;  2W82 A;  5DCM B;  4HEA 2;  4AIJ A;  3ZMT A;  2DA5 A;  1DUX C;  1OR7 C;  3E5X A;  3JRH A;  2WV0 A;  3C3W A;  2ISY A;  2IS4 A;  1V3F A;  4RLF A;  1OQY A;  1QBJ A;  3E6B A;  1K4T A;  1FSH A;  4A0Y A;  1RRJ A;  3ZQG A;  3HEF A;  1YW9 A;  4RGR A;  2P6S A;  1WQ2 A;  2DA3 A;  3DXJ F;  3DLL F;  4DBR A;  5IYB J;  5LGT A;  3BG9 A;  2W57 A;  4ZYH A;  2P8T A;  3AAF A;  3W6V A;  5F6F A;  2VKD A;  4K2E A;  2F4O B;  5JFR A;  2JJ7 A;  4MO7 A;  2OUM A;  4DZJ A;  4RA2 A;  3O3K A;  2EFP A;  4IJA A;  2PJP A;  3M07 A;  3E5Q A;  2EA2 A;  5F04 A;  1ZHF A;  4QPQ A;  3GUD A;  4RB3 C;  4CCO A;  2R7Q A;  3BTI A;  4II3 A;  4XMZ A;  1QZZ A;  2UUZ A;  2Q2E B;  3IAS 2;  4RS8 A;  1A35 A;  3OYA A;  3FDY A;  3IH2 A;  4XNB A;  3RYR A;  4C9Y A;  2XGX A; 
#chains in the Genus database with same CATH homology
 4PUS A;  2V4J C;  2WAE A;  4CA0 A;  4QIR A;  3VVM A;  2KP6 A;  3HPH A;  3D5R C;  3KEY A;  4YEL A;  3AL0 B;  1SG7 A;  2NOJ B;  2JSP A;  2WAD A;  2ZFU A;  4PJN A;  5DYF A;  2E5Z A;  2GOM A;  1X1D A;  4XKC A;  2CS3 A;  3DPU A;  2L9S A;  3SZG A;  1N77 A;  3K70 C;  4BKX A;  3SYT A;  3LSM A;  2HVR A;  4Q4I A;  2M7A A;  1SQM A;  5HNH A;  3CZG A;  4FAS D;  3OR2 C;  1SFK A;  3RQ4 A;  3UER A;  2RNG A;  4ANJ A;  3HUG B;  4KJZ A;  4RSY A;  4LIU A;  4BAC A;  1MW3 A;  3KYL A;  2DOA A;  4XKV A;  1DGR M;  3OS2 A;  2EGH A;  5JO0 A;  4XN3 A;  1X4O A;  1W36 D;  1WFX A;  1ERD A;  1KON A;  3ANM A;  3DTK A;  4Y4R A;  4RM2 A;  2F4I A;  2LRE A;  4BJ6 C;  2VPL A;  1YX3 A;  4R5T A;  4QPE A;  4P5O A;  3QOE A;  1ZS2 A;  3EBI A;  3ONQ A;  4ZDO A;  4E4H A;  4FET A;  3W2W A;  3JSZ A;  1R0L A;  3T0Y A;  4AR8 A;  4MS6 A;  4F91 B;  3H5N A;  4CUG A;  1WJD A;  2C82 A;  4XN1 A;  4P1W A;  3A14 A;  4XN4 A;  4H4K C;  2XF5 A;  4LUP A;  2JCV A;  2PL5 A;  4F3Q A;  2DT7 B;  5FWQ A;  4BE2 A;  4PJL A;  2I8D A;  3VYU B;  3L2R A;  1Z3X A;  3BC8 A;  2L7K A;  2Z1D A;  3HOS A;  2WB1 A;  2RRE A;  2HPM A;  2W7N A;  3DQV C;  3FU3 A;  3UCQ A;  1V5F A;  3FUN A;  2ZXH A;  1X19 A;  3MMY B;  3VDX A;  3K4K A;  5JNL A;  2CV0 A;  3FUL A;  3FHE A;  3CHS A;  3LFU A;  1MMD A;  2ZXI A;  3FTS A;  4ZYA A;  3LSH A;  3F9K A;  4XND A;  4BJT A;  3U9W A;  1YX5 A;  3MKY B;  3RC3 A;  4AIC A;  2O5R A;  3ZR8 X;  1T1R A;  1MW1 A;  5CKT A;  3OYM A;  2VKH A;  3T8V A;  3OR1 C;  3R0I A;  2R70 A;  2X51 A;  5KNL A;  4XLC A;  3UR3 C;  4FLR A;  3OYB A;  4BE1 A;  3KED A;  3DLA A;  3CHO A;  3H9J A;  3PNY A;  3FTY A;  3FHN A;  4PW4 A;  4N4O B;  2JVH A;  2XQ0 A;  3BCB A;  1PJR A;  3L2Q A;  2ELJ A;  2R4G A;  4PSW A;  4Q4E A;  3WQR A;  2XPZ A;  2BVM A;  3UNG C;  2QKL B;  3FTV A;  1N78 A;  2R7R A;  4BXF A;  1T95 A;  2V9K A;  2ZSH B;  3FTW A;  2MD0 A;  5CPR B;  4FLS A;  1EA3 A;  2AQF A;  2IS1 A;  3OYL A;  2VJI A;  3CMM A;  1G5A A;  5JMW A;  2CV1 A;  2R7V A;  4XN2 A;  3CJR B;  4A03 A;  4XN8 A;  3H9G A;  3GBG A;  2R7U A;  3D5L A;  2VQL A;  3B7R L;  1OLT A;  4E7Z A;  4AR9 A;  1X1C A;  2CUJ A;  3C2G A;  1ONO A;  2VJJ A;  3K10 A;  3LSG A;  4XO4 A;  4GAA A;  2E1M B;  1MW0 A;  5BPP A;  3Q44 A;  4E7H A;  2R7W A;  4FCA A;  3FU5 A;  3FU6 A;  2WAQ A;  3OIP A;  4BQN A;  1D1A A;  2BOL A;  3VVL A;  1SC5 A;  4QPO A;  1DP3 A;  1MNE A;  4F55 A;  2IS6 A;  3PNT A;  3L2V A;  2X1E A;  2M4K A;  3DU6 A;  3EUK L;  4IX7 A;  3FUH A;  5JC1 A;  4LIT A;  2CFO A;  4CCM A;  3DU5 A;  1BR4 A;  3K4C A;  3LSK A;  2A6T A;  2M3A A;  1Z7L A;  3Q43 A;  1JG9 A;  4XMV A;  4XLF A;  1WJ5 A;  2IGK A;  3FH8 A;  2WZG A;  3S3N A;  2L9N A;  1LVK A;  2VXZ A;  4XM3 A;  1R6R A;  3K6G A;  3DTE A;  1JVS A;  3IIE A;  4N4N B;  1DGW Y;  4B3X A;  3OY9 A;  1BR2 A;  1U0J A;  3DKY A;  2KHM A;  2Y1C A;  3OYH A;  1Y56 A;  2VJ4 A;  4DGW B;  2LYC A;  3OYG A;  2LBF A;  2GTQ A;  4PJJ A;  4ZX4 A;  4HPQ A;  2K5C A;  3G2B A;  4PK4 A;  4B44 A;  1MW7 A;  4RCV A;  4BQQ A;  4ZX5 A;  2XF6 A;  2MC4 A;  3D5S C;  3ZXS A;  1G59 A;  4JQF A;  4Y33 A;  4DJA A;  2FFL A;  4HNT A;  3AU9 A;  4XMU A;  4ZQE A;  3QYE A;  2MYS A;  3FH7 A;  2LY2 A;  4MLO A;  2OC6 A;  2E60 A;  3EBH A;  1UG0 A;  2QKM B;  2V1N A;  2VB6 A;  2PUS A;  4XMX A;  1R0K A;  3S93 A;  2VAS A;  2QVW A;  3CES A;  4AR1 A;  1D0Z A;  2R72 A;  1OR7 A;  2XAU A;  4J01 A;  4OOE A;  2OV7 A;  2X6Y A;  4KIS A;  3A06 A;  1ONN A;  4XON A;  2LG4 A;  4LIV A;  3K70 D;  2XPY A;  4C2U A;  2JD1 A;  5KHD A;  3TMO A;  2R59 A;  3ANL A;  4XLA A;  4ZX3 A;  1TT0 A;  2K9M A;  2LY1 A;  5CQE A;  4PVB A;  4PFO A;  3FH5 A;  4ZDP A;  4R5V A;  4L2L A;  3EBG A;  4FLQ A;  2XF7 A;  4NNJ A;  2LBF B;  1AA7 A;  2V6E A;  1BOB A;  3S8P A;  2C5Z A;  1D0X A;  2F5V A;  2JUG A;  3NWT A;  2JD0 A;  4IKF A;  5HOO A;  1RP3 A;  3I9V 2;  4K5N A;  3QYF A;  3HPG A;  4HNU A;  4X0G A;  4NC8 A;  2R7T A;  2O7G A;  3PNV A;  2Y1D A;  3ZHZ A;  3BG7 A;  3K4J A;  3CZ6 A;  4RLQ A;  4XLH A;  3RCO A;  5FRO A;  4CCJ A;  4ZQF A;  2K9L A;  3DPL C;  2E5N A;  4ZW5 A;  3CHR A;  3ZQQ A;  2WZF A;  4BJ5 C;  3B7U X;  3FU0 A;  5EV7 A;  4BUP A;  3PUU A;  3FUF A;  2R7S A;  3FTZ A;  4R5X A;  2KMU A;  2VJ8 A;  2KL4 A;  2VJ5 A;  5HNF A;  2KRH A;  2IGO A;  4CCN A;  3FUE A;  2L5Q A;  5HVQ C;  3DEE A;  1GLN A;  2W4S A;  3PSF A;  4XKW A;  4BL0 B;  3S3M A;  3V42 A;  1UEL B;  2DJI A;  3TBI A;  5LFA A;  3AUA A;  5KCM A;  4E6K G;  2B61 A;  3ZGK A;  2R7O A;  4ZX6 A;  1WJF A;  2Y1F A;  3CZE A;  1TZL A;  2Z2S B;  4E7K A;  4XOP A;  1D1B A;  2X1D A;  3RSN A;  3ZHX A;  2LRD A;  1MMG A;  3A4C A;  1WJB A;  4BGD A;  5JBI A;  2JD2 A;  3B7T A;  1WJE A;  2PJR A;  2FUG 2;  3IAM 2;  3CP2 A;  3J7A Y;  4ZTF A;  3A1Y A;  3OWT A;  3LMM A;  1DQU A;  1D1C A;  1QHG A;  4CXF A;  2M7B A;  2VL8 A;  1LFP A;  1X3W A;  3H35 A;  4Y67 A;  1X3Z A;  1N75 A;  3OYC A;  3HKZ A;  4AU7 A;  1H3L A;  4PU2 A;  3K4M A;  4ZN6 A;  3M8J A;  4K5O A;  4HSR A;  2RQQ A;  3FUI A;  2XSJ C;  2Y1E A;  2Q1Z B;  3HXL A;  1HS6 A;  1NG7 A;  1Z21 A;  1K6Y A;  3HG9 A;  1FMV A;  2F6C A;  3QJX A;  5AEN A;  3SDB A;  2VLA A;  3KX2 A;  3H9Q A;  4F92 B;  3VWB A;  4C2T A;  4YRV A;  2GOX B;  3CP8 A;  4AVZ A;  3W2V A;  1QU3 A;  2MFZ A;  3DKX A;  3EUA A;  2VQH A;  4YEJ A;  4ZJZ A;  4G6T B;  4ARF A;  2BW3 A;  2Y0S A;  3L2U A;  2KRC A;  3QOD A;  4BE0 A;  4JOM A;  2PJR B;  2PMZ A;  2A5W A;  3OYJ A;  1P9Q C;  3W3C A;  2JVG A;  2ZXG A;  4B43 A;  3OYK A;  3ANN A;  1X4P A;  3BG6 A;  3OYD A;  1V5G A;  1H19 A;  2RJI A;  3CIA A;  4PFP A;  4ZQT A;  2KDO A;  3S3O A;  3UEQ A;  4K5L A;  4MKT A;  4QHP A;  2X6X A;  3LL7 A;  4XMT A;  2HNH A;  2HQA A;  3BCA A;  2CW7 A;  1VZ0 A;  4OWR B;  2JCY A;  5FRM A;  4B47 A;  4XL9 A;  3BLY A;  1QHH D;  3OYF A;  3RC8 A;  3FBI B;  4D9J A;  3CF2 A;  5HLT A;  4ZDL A;  3CHQ A;  1MND A;  4XKB A;  2DQM A;  4HRI A;  2M0M A;  3H5R A;  3PJR A;  2A7O A;  4XO3 A;  4QUO A;  3PFY A;  3H0D A;  4C30 A;  2BW3 B;  3L2W A;  4Y3O A;  3NWS A;  1IRX A;  3OMY A;  1SAU A;  3OYE A;  1JGI A;  4K5M A;  3W2A A;  2XC7 A;  3FBN B;  3N05 A;  3B7S A;  1FMW A;  2ZSI B;  3OYN A;  4FLO A;  4DIQ A;  2XDV A;  5DLL A;  5DUL A;  1W36 C;  3ZI0 A;  4ZW8 A;  1G8X A;  2X1C A;  2KLO A;  1LDK B;  2JCX A;  4ZW6 A;  2KPM A;  4GAE A;  1WJA A;  2E1M C;  4J3B A;  4RMN A;  4XO5 A;  3PUB A;  1X1A A;  4XN5 A;  4DPR A;  2HVS A;  4NC7 A;  1JI8 A;  4XMW A;  2DT6 A;  4CCK A;  2VQG A;  4K5P A;  4II2 A;  2WY7 Q;  4BS9 A;  2WBM A;  3FUK A;  4QME A;  3FUJ A;  4ZW7 A;  2CV2 A;  2X6W A;  4CCL A;  4ZQH A;  5CQG A;  3VYS B;  4CSW A;  3HC7 A;  5TGT A;  3MKZ A;  1YE9 A;  2WPG A;  4NQW A;  3B2P A;  3OL4 A;  3DWL E;  4XLE A;  4BQO A;  1MMA A;  2WAF A;  3VYT B;  3B34 A;  4B48 A;  1LKX A;  4ZQG A;  3OS0 A;  3S32 A;  4E7S A;  3OIQ A;  3DPT A;  3AL0 C;  2KQR A;  3OL3 A;  2JV7 A;  4XOR A;  1Q0H A;  3K4B A;  4ZC3 A;  5JMP A;  2HZD A;  2LH9 A;  4XQF A;  4OAY A;  4KT6 A;  4X2U A;  2VIX A;  4CZC A;  2R7X A;  3H5A A;  1MVY A;  3RTR A;  3VYR B;  3FTU A;  2CMP A;  4RM3 A;  2X85 A;  3HL2 A;  4E7J A;  2V7F A;  2P0W A;  4PJM A;  3B37 A;  5JAZ A;  2MAO A;  4J00 A;  2DQ6 A;  3ZRG A;  3HOT A;  1MW2 A;  4XN0 A;  1Y6I A;  4D1Q A;  3SEZ A;  3EUH C;  4E7I A;  4BEH A;  3CZL A;  4Y6S A;  2HVQ A;  2WA0 A;  3PSI A;  1ZEL A;  2HPI A;  1UAA A;  2W1O A;  4Y6R A;  3AKZ A;  3U21 A;  3VSK A;  2QJ1 A;  4NQW B;  4R7L A;  3VSL A;  4OOF A;  3M1C A;  3CZK A;  2LOO A;  3DTI A;  3E1S A;  4BU2 A;  4OAZ A;  3FUD A;  4XN7 A;  3I3L A;  2MAP A;  1K5H A;  2HPT A;  4DOZ A;  1ONP A;  4XNA A;  3A2K A;  4ITV A;  4PSX A;  3B3B A;  3EPZ A;  4RVB A;  3QYB A;  2AQE A;  4KP7 A;  3MKW B;  3TL4 X;  2CW8 A;  3K4L A;  2BVL A;  3PL8 A;  4XR6 A;  2V26 A;  3RPU D;  2DCE A;  4R79 A;  2L2O A;  4XN9 A;  1WJC A;  3C2H A;  4CH7 A;  2VQC A;  3IUO A;  4LG3 A;  4XOT A;  2CUZ A;  4BEH B;  2Y1G A;  4BDZ A;  4ZTJ A;  3OYI A;  1Q0L A;  1S46 A;  1V5E A;  4XNF A;  2CH0 A;  2IGM A;  1Z3Y A;  2HPO A;  1T0F C;  2W82 A;  2HDW A;  3JT1 A;  4HEA 2;  2UV1 A;  4HST A;  2IXS A;  3ZHY A;  3ZCO A;  3FTX A;  1OR7 C;  4U87 A;  2UWM A;  2Z16 A;  1T1S A;  3FUM A;  2IS4 A;  1GW6 A;  4ZW3 A;  4RLF A;  4IZZ A;  2KZV A;  1D0Y A;  4Y6P A;  4GRI A;  4KIT B;  3CJQ B;  2JA2 A;  2MAB A;  4AYS A;  4DBR A;  4IQJ A;  2DXI A;  1Q0Q A;  2VXD A;  2W00 A;  4IQ4 A;  3LSI A;  3AU8 A;  3K4N A;  4XMY A;  3E0J B;  2M4G A;  3FKJ A;  1HA8 A;  2VKD A;  4EAT A;  4F93 B;  3RAS A;  2OUM A;  4HG2 A;  2IGN A;  5LD2 C;  3SEQ A;  3MD2 A;  4AYB A;  2IS2 A;  3OS1 A;  5FRN A;  1PYV A;  4E7L A;  4U7B A;  2K3P A;  1S9H A;  4QPQ A;  1BR1 A;  3IP4 B;  4JND A;  2PGG A;  3WQS B;  1NG6 A;  2WY8 Q;  4CCO A;  2R7Q A;  4II3 A;  3AFH A;  4XMZ A;  4NUB A;  2UUZ A;  2Q2E B;  3IAS 2;  1J09 A;  5JHF A;  4F52 A;  3CHP A;  3OYA A;  3FDY A;  1MMN A;  3OOU A;  1E0E A;  1X1B A;  3B2X A;  4XNB A;  2HU9 A;  3WQQ A;  4DBQ A;  2LC2 A;  4C9Y A;  4BDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...