5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
5HLTA 2VLAA 5HNFA 5HNHA
chains in the Genus database with same CATH superfamily
1BJZA 3QPLA 1XSXA 5K5OA 3JRDA 3GZNB 5FB2A 4K2EA 4LG0B 1BR4A 1TC3C 3MQ0A 4ABZA 2QYOA 3E6CC 3KZZA 4IZZA 4D5CA 4OMYA 3K4BA 4XO3A 4NNJA 1R4MB 4EJTA 2A7OA 3MKYB 2JJ7A 3PNVA 3K6GA 4JP0A 5CQGA 4EJUA 3I59B 1W36C 2H94A 3ZQHA 2CW7A 4RM2A 1X3ZB 3VEPA 2O6GE 3HOTA 2GXBA 3ABMH 2ZXGA 4UHTA 4RDUA 2DJIA 2UWMA 5FD6A 2M4KA 5JVTA 2R7XA 1T08B 5J6XA 3KP3A 2M45A 2O5RA 3A4CA 4RVBA 1S9HA 3ZMZA 4ZW5A 3R0JA 5GAEJ 3WG9A 3HL2A 3B6CA 1YX3A 1SD7A 2L54A 4JQFA 1U5TC 4KJZA 5L3BA 5F1RA 5HDNA 2ESNA 4H4KC 3IH4A 2JK3A 3S3OA 3E5XA 3GVAA 2XVCA 3FXLA 4GRIA 4ZX6A 2BVMA 1X58A 3CIAA 2BW3A 1QVUA 3P7NA 4E7LA 2NOJB 3AG3H 2EZHA 1Z77A 2EFOA 3GBGA 1WI3A 2W57A 2FXAA 4HNTA 1YYVA 4BKXA 5J8CA 2HPOA 3HKZA 1VQ9I 1OPCA 5CJ9A 2EIJH 2PBIA 3QPSA 4OOEA 1B72A 2R3SA 2X51A 4GCVA 3JRFA 2K5CA 2EV0A 1G3WA 3B73A 1WKMA 5EG0A 3BR6A 2DODA 1Z1DA 2VT2A 4CXFA 1A31A 4ZZDA 3CZLA 2BEOA 3QQAA 3VYSB 1ACIA 4UUTA 1SEUA 1TWGJ 5ED4A 3U9GA 4L2LA 1GVDA 2X6YA 3A03A 4CYCA 1WJBA 2HTJA 2L02A 4I99C 3CZ6A 4EQQA 1IUYA 4BGDA 3NWTA 2CW0F 1TTYA 1HDDC 4RM3A 1SQMA 2GA2A 3SEQA 4A93J 4CH7A 4B47A 1MW3A 3AG1H 2L7ZA 3SZGA 4KN7X 4CZCA 1G8XA 4EGYA 2E60A 2C6YA 2EPFA 2WB1N 2ZC2A 5HLGA 3L2RA 4IVNA 4XSZF 4E70A 1UCRA 1OLTA 1OJLA 4ZW8A 2HVSA 2BXZA 1BIBA 1T38A 4JNDA 4XRFA 3DLLF 3SZTA 4HNVA 4I02A 3KZIC 2ZXWH 5BNGA 2LYCA 3K0LA 1M1EB 3ZQIA 1YJ9I 4OMZA 3CLOA 5K5RA 4WX9A 3Q0UA 3ABUA 2JCVA 2PG4A 2XGCA 5K7HA 1T2KA 2KDZA 4FLOA 4AVPA 2FD5A 2KHMA 4V2FA 3C2BA 1QPMA 3FU3A 1F36A 1F9NA 3VOEA 1HSJA 1JUPA 4U0YA 3O6BB 3FX3A 1TBXA 1G3YA 3MMYB 1ZR2A 3AL0B 2QKMB 2LREA 5TISC 1R1UA 4ZDPA 1IRFA 3FUNA 4ENNA 1XGSA 2XRLA 2LSOA 2MH9A 2PFBA 3OIPA 3CO6C 4ZW7A 2DMPA 2GLOA 2TCTA 2OBPA 3S15J 2VONA 3H9QA 1U2WA 4L5JA 2Z3YA 3BR0A 1R1VA 1JG9A 4E6KG 3ROUA 2YX4A 1W5SA 3JRHA 5ICEA 3QAHA 3I53A 1W7PB 2F4MB 1FWZA 3RQIA 4P9UA 1R0KA 4AR1A 3I55I 2K4BA 3OS0A 3HOXJ 1ZK8A 1MBFA 4XN4A 5IT3A 3E5UA 1H8AC 4P9FA 2PEXA 2JD0A 1OCZH 1Y6IA 2JCXA 2PUSA 2XQ0A 2Y9YA 2E1MC 1J59A 4DOZA 1KQ8A 4QPOA 5K1YA 1TLHB 2GAUA 1UHWA 5K7ZA 1QPIA 2EGHA 2PMHA 3GZ6A 3CHQA 2IS2A 4KN4X 4V2GA 1U5TB 2A6EF 3TMOA 2DDBA 4XMZA 2OC6A 4FHTA 2F5FA 2DQLA 2XUBA 3LFUA 2IT0A 5LHGA 3CD6I 2DDAA 4AU7A 4N0BA 3D1NI 2RAEA 1ITYA 5D5UB 2IGMA 1G3TA 2C82A 1R23A 2D2WA 1SFOJ 3LSHA 4IPAA 4UVAA 3OY9A 1U78A 4JYKA 1WSUA 2P5KA 3K70C 3TOBA 1KU7A 3PO2J 4A3DJ 1ZG5A 4H0EA 2X85A 4ESFA 2NRAC 1S8NA 2WWYA 1TW3A 1VQ4I 2R93J 1UAAA 2PLYA 1T33A 3LAJA 1FEXA 1G59A 5J8FA 2F2EA 5LHIA 5D6EA 2X6OA 2XV4S 1DU0A 4LLGF 3O8HA 3T8TA 3DEWA 5FRMA 3VSKA 5LLQA 1Z05A 1D3YA 4ON0A 4P55A 2BHYA 2XROA 3F8BA 2RQQA 4ZQHA 4CO8A 4BBSJ 3K4LA 1WGXA 2B61A 3ECOA 5KAIC 3G4SI 4IXAA 1R71A 2DK8A 2XPVA 3OL3A 2BXYA 1I3AA 3K4CA 3QODA 2V26A 3BLYA 3CCSI 5IT9Z 1RPWA 2HKOA 5AIQA 1J75A 1PP8F 4XRSG 3MAJA 1BM9A 4AC0A 5EG0B 4FE7A 2PMZN 5GAHJ 5FFZA 1MW1A 2P7CB 1O3SA 4AR8A 1TWFJ 3RPUD 3CC7I 5F27A 2LC2A 3GTPJ 1Z67A 2DA4A 1ZLJA 4BS9A 2WV0A 1EA3A 5D5XB 2LRDA 2UZKA 1HC8A 5IYDJ 3A0HC 5DS9A 2IS6A 3RDIA 2O7GA 4EJVA 4BNCA 2MC4A 3RKXA 2ZB9A 3QJXA 2ZXJA 2G7UA 3S1QJ 2QWWA 2K9NA 4HW0A 2DU9A 4BYYA 4IRGA 1SMTA 2R7FA 4RA2A 2KRHA 3LSRA 4M71A 3COAC 1KU3A 1PYVA 2BZTA 1YTYA 1IDYA 3FZVA 4XN7A 1R6RA 1FTTA 2WPGA 2BGCA 4LLLA 2KFDA 3GFLA 3GFIA 1AKHA 2EB7A 3IRRA 1BN5A 4QSHA 4A3LJ 5JMWA 5JI6A 2GOMA 1Z21A 4B3XA 3RASA 3ERMA 3ZMSA 3B34A 5IT9K 1MZBA 4XOTA 1GV5A 2RNJA 5F0CA 2PGGA 1XMKA 2KJBA 3CCRI 2OF7A 4CHUA 5CQEA 2OTJI 1KGSA 2ZJ2A 3ZHZA 2QA4I 3OWTA 3CCVI 2KISA 3H0DA 2GXAA 4IQJA 3M3YJ 4XN0A 2KZVA 2DA5A 1X3UA 2Z2SB 4R5XA 4EM0B 3LMMA 3W2VA 2H1KA 4QPQA 1GXQA 5DV5A 2JZYA 5CVJA 3RIRA 2KIFA 3T8VA 3GLXA 2Q8KA 2X1DA 5ICFA 3DBLB 3PIOF 4AIHA 1OMIA 1R5ID 1BR2A 1FMVA 2O61A 3JTHA 5EZGA 3M7GA 4XNAA 1J09A 1ON1A 3WHBA 3MKWB 2HPMA 4FX0A 1LDDA 3BQYA 3OYCA 1IN4A 2OQGA 4RGRA 2QBYA 3OYJA 2K4JA 2KIUA 4CYDA 1MBGA 3B7RL 1UMQA 1JHHA 2EFQA 4HF1A 4A3JJ 5DULA 2DMNA 2C5ZA 2W25A 4F55A 5E3MA 2EV5A 3L2VA 1Z3XA 4CDGA 2R7TA 2IA0A 2Z99A 2FFLA 4GDFA 5F04A 2HKXA 3H5RA 1ZH5A 3PUUA 2FF4A 3DV8A 1ZYRF 1H3LA 3UCQA 2OQRA 2RKHA 3GTJJ 1XSVA 2L7FP 3I64A 3A06A 5FO5A 1WPKA 3MKLA 2VKEA 2JUCA 1IRZA 4LGWA 2Y9ZA 1RRJA 4M6YA 3ANNA 2KIMA 1VQNI 3G3ZA 5D5VB 4IHYA 3N97A 2JRMA 4G7ZF 3RTRA 1IG7A 4RB2C 3F8NA 1RUNA 3E7LA 3KZYA 1AOYA 5KHDA 3IHUA 3HPGA 2M0CA 3OYDA 2ADUA 3X2QH 1HLVA 3CESA 3NARA 4ITVA 1WJEA 3J80K 1O3RA 3ZP5A 4B8XA 2OZ6A 3H9GA 3OYIA 2GZWA 1HF0A 3FXRA 3HRUA 3SXYA 2TDXA 5D8LB 2A3SA 3K70D 1MMNA 4HQMA 3SQNA 4RAFA 3OSGA 1GLNA 5M3FJ 4Y67A 4ENMA 2V6CA 3E5QA 1G5AA 2B9SA 4EEFG 3FU6A 3BC8A 4GAAA 5BPPA 3RCOA 1G6NA 1MMDA 2YU3A 2OU2A 1JGIA 5FLMJ 4LB5A 4QHPA 2DJNA 3BG9A 3OOPA 4CCLA 2DQMA 2JTVA 2A6TA 1WJAA 4CA0A 4KIGA 2CUFA 4NC8A 4XMUA 1AKHB 3HHGA 3W6VA 2Y1EA 1T56A 3QP6A 4AYSA 3RPQA 4IF4A 2RREA 2HQ5A 3OYMA 1D0ZA 3GLLA 3VFZA 2WAQA 2FMLA 4A0YA 3LSIA 1SD4A 2QGUA 2M8EA 3WQSB 4RMNA 3I4NJ 4PFOA 1ZKGA 5FWQA 3WU2C 5DM6F 3S2DJ 4ESJA 3G2BA 3S32A 4XLPF 2X48A 5B1BH 4OOIA 3DPUA 1H0MA 2B0LA 4WCGA 3HUGB 4BE1A 2PJPA 2IA1A 4I0AA 4AIJA 5CVIA 1ON2A 1OCTC 2R7OA 3KLOA 1W36D 4UVBA 3J81K 2COBA 1WFXA 3TL4X 4BQOA 5EV7A 2JSCA 2VASA 2IGNA 3I58A 3GTQJ 3KEQA 3E97A 4BHPA 1OYYA 1B59A 1BI3A 1BC8C 1XX5A 1NH3A 2WB1A 4D1QA 1YW8A 1IN5A 1YQAA 1Z91A 2Y48A 1YIOA 3MD2A 4PJNA 3RYPA 2HQRA 4GFBA 1T1RA 4BXFA 4BQQA 3E6BA 5HLIA 1UJ8A 2LH9A 1MNEA 3G71I 2VBYA 4UXNA 5FKNA 1BA5A 3IWZA 1WZ2A 2AQEA 4XM3A 2AHQA 4GXOA 1K5HA 4K5NA 2MYSA 3R0AA 2Z1DA 2VT3A 3FBNB 4ENJA 2VQLA 1MNMC 2EZLA 4R5VA 5FKLA 4Q5SF 2PI0A 2E36A 3H0GJ 3ZQCA 3OSFA 4S04A 3C2HA 2WA0A 3FULA 2HPTA 1WVRA 3BQZA 3HZJA 4U7DA 2E1OA 4XN5A 2CH0A 4C2TA 1P92A 4PGHA 3BTCA 4A5MA 2FUG2 3CC4I 3PM1A 4QUOA 5TGTA 2FNPA 3JRAA 5DUIA 4M9XA 1P4AA 2YUSA 3BZKA 1P4XA 5E1WA 2JPCA 1R9TJ 2DQ6A 4IL6C 1HCRA 2ISZA 3WGHA 1R49A 2A05A 4IX7A 2OJED 4W1UA 2XAFA 4ESBA 2JSPA 1WJCA 3CJNA 4AIKA 1JKRC 3HSRA 1ONOA 3FUEA 4D7NA 3IIEA 3K4KA 5HVQC 1RETA 2CYYA 2EA2A 3O3KA 1RR8C 2Q1ZB 4HX7A 4XLCA 4BJ6C 1Q0LA 3GCMA 3S3NA 2EILH 1Y1WJ 4RB3C 1XSDA 2COMA 2KKOA 4KICA 4K5OA 4QMEA 2LF7A 2VQHA 3OS1A 3NAUA 5L3EA 2HXOA 4Y7NJ 1RIOH 1Q1VA 2GIZA 1R36A 1I6HJ 1T1SA 1ZS2A 3FUFA 2V1UA 1T0FA 5BPIA 2CQXA 4A3IJ 1XB4A 1F5TA 2AS5F 1TWAJ 1W4MA 2PJRA 2BY3A 3BTIA 1OKRA 2EFWA 2NOGA 3EPZA 3K2ZA 2ETHA 1K4SA 4M74A 1P7IA 3CTAA 3BG5A 1RKTA 1MJAA 4L9TA 2Y31A 1MMSA 1TQMA 2Y0SN 1U9NA 1G4DA 2VI6A 2CV1A 2DFFA 3OYFA 2KP6A 4QIWN 1NG6A 5FKMA 2RQPA 1PP7U 1LKXA 1S7EA 2Y1DA 4XK4A 2P5LC 4KDPA 2VL8A 3GMEA 5CLSA 5B3SH 4OIQF 3L00A 1LDKB 4OIOF 3FUJA 5ERIA 3HM5A 5FROA 4ZQFA 3SFIA 1V4RA 3BT9A 5M3MJ 2NVXJ 3C18A 1OYIA 4J01A 4HBLA 4A2UA 4AM3A 5D4SA 1SVMA 2X1EA 1S46A 4C2UA 3CJTB 3OYHA 1AU7A 2QQAA 4A6DA 4HPQA 3MCZA 4LIUA 5B5EC 1S3JA 1ZGWA 1K7AA 3GF2A 3JCUC 2OCCH 3FHZA 4UY8I 1R5GA 3EYIA 3A01B 2VQCA 5JLWA 3EBHA 3SFZA 3A0BC 1IXRC 1MJ9A 3G1MA 2Z5UA 2DN0A 4LG3A 1ONNA 4ZTFA 4KP7A 4KMUX 4DNCA 2NXNB 1OCRH 1IC8A 2WC2A 2LK2A 3HC7A 5BOXA 1T98A 1MSEC 1QHGA 1O7FA 4MLOA 3B2PA 2K3FA 2DBBA 4WWCA 2ECCA 2ZXHA 1U3EM 3OMYA 5D6FA 1JTYA 3E1SA 1BOAA 3GEZA 1RESA 4IRHA 1FSHA 1HQCA 1UHSA 2NS8A 3MWMA 2GQQA 4NC7A 3WGGA 3B02A 1VQOI 4ZJZA 1VTNC 4V19K 4Q4EA 2QQBA 3F0CA 4PCQA 3ZCOA 1E3HA 4I01A 1FOKA 2QM3A 1WRJA 1FMWA 1REPC 1X4OA 3CHPA 2X9DA 1MBEA 3BR5A 2WZFA 1I50J 3ZPLA 4S0HB 3FIWA 1P2FA 4B3AA 2OUMA 2R92J 2E7XA 3W6KB 2JA5J 4A12A 4JX6A 3ESWB 2VBXA 3B2XA 2HGCA 2LDUA 1BBYA 4B48A 3IH3A 4IRIA 3FK6A 1HW2A 3PO3J 2XC7A 3P9IA 1W5CC 2KDOA 1LE8B 2O8KA 1SAXA 4AIDA 4ARFA 1ZGJA 2HOTA 2CW8A 2JV7A 4G9YA 4BDYA 2KZGA 1FOYA 1OCPA 1TZLA 3BTLA 1KQ9A 2X4HA 4PJJA 2Y0MA 3DTEA 5EEHA 3K69A 4BE0A 2NVTJ 2M4GA 1WCMJ 3IAM2 3ONQA 2P81A 2DPDA 4XICA 1KQ0A 3FTUA 2A07F 2HDDA 3U9WA 1D5YA 3HXLA 4OU0A 2QVWA 3JREA 1JE8A 2K3PA 1Y8RB 4HSTA 1JT0A 2LKSA 2JRTA 2MD5A 1FPQA 2OA4A 1GUUA 5L3DA 2QENA 1EJ9A 1MDMA 5JC1A 4HX4A 3HKZN 4HF0A 2H6CA 4R79A 1RI7A 3DTIA 3K1MA 2ELKA 3FUMA 5LRSA 3FBIB 2HU9A 3S93A 1ZG1A 2LY1A 4YIRX 2XDVA 1CQTA 1FY7A 3HB9A 1EH8A 3A1YA 2Y2ZA 2MAPA 1XS9A 3HTUA 1QZEA 2VKVA 5JR3A 3W6JB 4L18B 1OR7A 1SFUA 2NNYA 3ZGKA 4UB8C 2JT1A 4AVZA 3CCEI 2DXIA 2E19A 4EGZA 4YEJA 4A3MJ 5FRNA 3VVLA 4XLFA 2QSGX 2VE9A 4R1HA 3KP5A 1ETYA 1IN6A 5JVGF 4QWQA 3TQNA 2JA2A 3VWBA 3FXQA 3A01A 1MSFC 1ODDA 3G1OA 4WXDA 2BY1A 5LD2C 3J7AY 5CVUA 2YR2A 1T95A 2WAEA 1H88C 1ETVA 4P5OA 3FTWA 1MMAA 1YJNI 2MGQA 2F4OB 2W24A 5M5YJ 5FKKA 5J4YA 1YFHA 3DPTA 1XMAA 3DCFA 2JQ7A 4RSYA 4KNYA 1BJAA 1TNSA 4LITA 1X1PA 3KYCB 3MFKA 1N78A 4BH9A 2OD5A 3CP8A 1I5ZA 2DA6A 4IO9F 1SFXA 1X2NA 3W3CA 1YJWI 2LY2A 2M7BA 4XMYA 1K79A 3EBGA 5E3NA 3P9CA 2X1CA 3BWGA 4X2UA 1P9QC 1UB9A 4ZW3A 3BG3A 2CJJA 3B7SA 3S1NJ 3LSGA 2BOLA 3C2GA 4X1EA 2ACJA 1PVEA 5HLTA 1Z9CA 2XKPA 2DT6A 3WTTC 5H6RA 1LVAA 2P7VB 4MQVA 4A69C 4EATA 5HODA 3CHOA 4NUBA 1ZRFA 1L3LA 1FTZA 4JBAA 1N25A 3HOSA 3CCUI 3HSFA 2L01A 4Y17A 1F4KA 3FKJA 3CZEA 5EF6A 2ZJQF 2HOAA 2HS5A 4II3A 3ABLH 5JFRA 3RKYA 3R0IA 4G8XA 2DOAA 2ZBKA 1VQ8I 3FXUA 2IRFG 3V7SA 3IH2A 5A2QK 2JMWA 5F0FA 2STTA 4NHJA 4XN1A 4U88A 1AHDP 1E3OC 4E7ZA 5GTIC 2IVMA 1GV2A 1XG1A 1TT5B 3U1DA 1JKPC 1OYWA 2XRNA 1ZQ3P 1X1DA 2CS3A 2BE5F 4QIRA 4AR9A 4UUVA 2LMDA 4D0PA 2A6HF 3M07A 4Y6SA 4MTEA 4PJ0C 4Y33A 3ASOH 1HDPA 2YSRA 3DF8A 3PQJA 5KCMA 3FTVA 3K10A 1D0YA 4Y3OA 2XF7A 3LQQA 1FBSA 3UR3C 1Z3YA 2CUJA 5CVRA 4NQWB 2R5YB 2I10A 3FMRA 4GAEA 4E7JA 4L9VA 2BVLA 2VPRA 2I8DA 1RP3A 2FBHA 3CUQC 4XLNF 2VXDA 2UUZA 3FK7A 1A6IA 4PFPA 4C9YA 5DM7F 2G0EA 4FE4A 1SG7A 2CUEA 2W4SA 2RJIA 1IDZA 1T0FC 3SDGA 4FLRA 3DPLC 5H2FC 3R61A 3BR1A 4EJOA 1AWCA 2JD1A 1TNTA 2Z16A 1S6LA 3BZ6A 4HX8A 2A61A 1D1BA 4DZPA 5JMPA 5GPAA 3QWLA 1ZARA 2EJRA 2X6WA 4XO5A 2LOOA 3TP0A 3HGGA 1ZTRA 2IBDA 4XKBA 3AKZA 4Y6PA 1WJ5A 3BJOA 1TW2A 3BY6A 1K4TA 4ZH4F 3BR3A 2W85A 2VJ8A 4YFXF 1DP7P 1FP1D 4PJMA 4ZQTA 4UUSA 1FC3A 2VN2A 4AICA 2L7KA 2N8GA 3UERA 1HA8A 3HW2A 4M3BA 5CKTA 1NTCA 1CGPA 2V6EA 3GTLJ 4LLNA 1R0LA 2HDWA 5F08A 2IJLA 1VI0A 3AFHA 3OYLA 5DYMA 4DZJA 4U87A 2BY0A 2MA3A 3Q44A 2HNHA 2ICWG 4EVIA 3IV5A 1ZAOA 2QBYB 5F1JA 4BQNA 1HXDA 4ZYDA 1JGSA 2DFIA 2EFNA 3ZQ7A 3HRSA 3V4GA 5HDGA 2R4GA 2A5YB 2H09A 5JNLA 1U8BA 4ANJA 4MKTA 4I0BA 1DGRM 4L9NA 1KZHA 1JUSA 2R7DA 1T6SA 2XSDC 2Z33A 4OOFA 2ZXIA 4IQ4A 4Z6YA 2E34A 5C4JJ 1JJ8C 5FD5A 5DEQA 1W0TA 2XSJC 2XGEA 4RGSA 4M9SA 2E71A 3NQOA 2CSOA 3CUOA 3IWFA 1K61A 3FXKA 4IHTA 3H3UA 3HOWJ 4XKVA 2L9RA 3DKXA 3ANMA 3B7UX 1UG2A 3KEDA 5DCFA 5M5WJ 2A5WA 2OZUA 3HOYJ 3HSEA 4KISA 5K7FA 5FLXK 1JI8A 1QO0D 1TQIA 2LY9A 4N4NB 1LUJB 4P1WA 1W5TA 6PAXA 2DYRH 3FM5A 4M73A 1EKEA 4BY1J 2R7SA 1IF1A 2L7MP 4N9IA 4ZQGA 2M0MA 3AG2H 3F8MA 4ASNA 3ANLA 1YG2A 3RKWA 5FJ8J 4HG2A 4ZQEA 2VC1A 4MNUA 4IHSA 3FH7A 2PX9A 3PUBA 1XGOA 4M6XA 2L9NA 1B9NA 3TGNA 2HR3A 3CUQA 2FSWA 4XMWA 4KIBA 1RC9A 5J1YA 4HLXA 4XBFA 1N75A 4Y52J 1V54H 2XF6A 3M1EA 3FMQA 3B3BA 1FIAA 3FTZA 4RS8A 1HKTA 2CO5A 3FTYA 1RR7A 4E7KA 3DBRB 2RNGA 1V5EA 1R1TA 3JRCA 3C3WA 1VQMI 2VKDA 2E5NA 3ELKA 3ZQFA 4CICA 1DGWY 2DCEA 2F6CA 3CHSA 5DD4A 4D5FA 4XQFA 4AWXB 3F21A 2M9HA 3IUOA 4B09A 2HZTA 3KP2A 4HLYA 1SFKA 4E7IA 1R58A 4E4HA 5HLHA 2LNBA 1O3QA 1SC5A 2CQ7A 1BI0A 3CMMA 1KU9A 4RB0A 5IOYA 3FDYA 3AU9A 3REOA 1DP3A 2K40A 2L3DA 2DA1A 3D5LA 3TDZC 3S1RJ 5E8IA 1PUFA 1D8KA 1HW1A 2STWA 1V5GA 3JSOA 2KT0A 1TQPA 3H35A 3M4OJ 3TP3A 4DBQA 5LGNA 3F23A 2DQRA 1V55H 3DBHB 3SHFA 2QEXI 4BACA 3P5JA 2KL4A 1BOBA 3D5SC 4XKWA 3HOVJ 2O7OA 3IL2A 1ZRCA 2JCYA 4XNBA 2OTLI 3GXOA 3V8JA 3G6EI 1FT9A 1Z7LA 1B1BA 2DFEA 2CRGA 5EEGA 1DU6A 1K6YA 5EDNA 2L2OA 1I27A 5E8GA 3B6AA 5E18F 3DEEA 2ME0A 5GAGJ 4Q4ZF 4L9JA 3Q9SA 2W7NA 1D1CA 3KETA 5B66C 1HSTA 2VB6A 1YRNA 2XAUA 4AYBA 1A35A 1RUOA 4O3MA 2W82A 3OYEA 2VPLA 3V7CA 2MSYA 2ZMEB 1WH7A 4M3DA 2DLLA 2RN7A 4MEXF 3FUKA 5E20A 4OINF 1W7PD 2JA8J 3LNQA 5LHHA 3S17J 3ULQB 4IEJA 4KT6A 2XB0X 3H1CA 4DPRA 5FGMA 1Q0QA 2HZDA 3OOUA 2M87A 2HDCA 3TOAA 3UKGA 3L9FA 3HUGA 1IN8A 2CQKA 1KYWA 2E1MB 4HV6A 3RZDJ 1J2XA 3FHEA 3ABKH 1MNDA 3NRVA 3SYTA 1MKMA 3K4MA 4L0ZB 3TO7A 2NVYJ 2X0LA 1IGNA 3S2WA 2XF5A 1IJWC 2XPUA 2JD2A 3ZQLA 5IP9J 3JRIA 5LRRA 2O8XA 3JTGA 2HOSA 2D1HA 2L9VA 1BIAA 3MZYA 4ZYGA 3RI4A 3WHCA 4A3FJ 5J4VA 4FQGA 3Q0VA 1F1ZA 2EFPA 1USSA 2EH3A 3I56I 3WTXC 3OIQA 3WG7H 4N4OB 1AA7A 2GTQA 4HAMA 4F91B 1Z0XA 4WXHA 1A04A 1X3WB 2EIMH 2EQRA 2DTRA 3H5NA 2H6BA 2NNNA 3WE3A 4E7SA 1NK3P 4LJZF 4PSWA 5A2QZ 1TL8A 4F92B 4DGWB 2VBZA 2K85A 5EGOB 4BEHB 4NDLA 3HOUJ 4LK1F 2DYSH 4HDVA 1X3ZA 1IXCA 3T1BA 4BBRJ 1BR1A 5E3LA 3JRGA 4KUMA 2R7ZJ 4DBRA 1JKQC 3JSZA 4C2MJ 2EZKA 2AQFA 4YELA 2OV7A 3LSKA 3FKIJ 3QP5A 3MVPA 4LIVA 3TDUC 3DKYA 1VNDA 2DMQA 5F6FA 4P96A 3BG6A 3CJQB 1OFCX 2M5WA 2Z9OA 1UG0A 3CO7C 3Q0WA 3L2CA 4BHCA 3F6VA 2ISYA 3EUHA 2FOKA 4Y6RA 3HGYA 5D4RA 2RV8A 3DU5A 3KYDB 1VQLI 4XR6A 4BL0B 2ELJA 4GYIA 5HS7A 3U21A 2F5DA 3FXOA 3HHHA 3HBLA 4PZJA 1X19A 4XSXF 4CYCB 1X1AA 4JOMA 3HDDA 3J7AO 3EQLF 1L0OC 1I1GA 1YX5A 4B1RA 2IGOA 4I76A 4Q4IA 5DD8A 1X2MA 3AUAA 2O3FA 3OYKA 4HEA2 4XL9A 3QYEA 3RC8A 5IYBJ 1G3SA 4ZTJA 1JTXA 5D8KB 4LK0F 3RPUA 3V7RA 4ZYEA 3CMEI 5L3CA 3KEYA 2IS4A 2DO7A 2Y1CA 2PL5A 4JX4A 3EUAA 3HYIA 2JWTA 3K4NA 4FTHA 1O7LA 3QU6A 2ESHA 3T0YA 1FBQA 3KYLA 3I9V2 2H8WA 1ETWA 3DTKA 1UELB 3TO6A 2BBYA 1ERDA 2EINH 4BHBA 1Y0NA 3JT1A 3QPTA 2V1XA 5L3FA 3GZ5A 1B8IB 2QJ1A 2W48A 1YE9A 3O8GA 1YRNB 4LD5A 2LKPA 4M6VA 2HQNA 1FOXA 3FH5A 2R7QA 4XRMA 3H5AA 3CF5F 2AO9A 4NQWA 1JXSA 3ZI0A 1ETXA 3IKVA 3FXJA 2FE3A 3ASNH 4ZN6A 1UZCA 1GW6A 2G9WA 2IEKA 3D5RC 2HQAA 3FUIA 1UHMA 3F9KA 3T5XA 2V9VA 3DKWA 5E79C 4FX4A 2EA4A 3K4JA 2QQ9A 3NWSA 3AU8A 4ETSA 2FA5A 2VLAA 4A0XA 1K78B 1JKOC 2DT7B 4XN9A 3U2RA 4ZX5A 1FP2A 5C44J 3PQKA 1FYMA 1V5FA 2BY2A 3F6OA 1YW9A 4FCAA 5HNFA 4PJLA 2PQ8A 2R7RA 2H8RA 2K02A 3PIPF 1VQKI 2QSFX 2MLGA 1B72B 4B4CA 5J40A 2ECBA 2Y30A 2GA1A 4YRVA 2W1OA 4OAZA 5D5WB 3SJMA 3CCYA 4HNUA 2LLKA 2OAZA 2CV0A 3HEFA 2HYGD 2PMZA 1ETKA 5C3EJ 2VUMJ 3UEQA 2DT5A 3V42A 2FOWA 2YX7A 3K9TA 1IRGA 1W1WE 2E35A 2UXNA 3RZOJ 5DLLA 1TWCJ 3NEUA 2R5ZA 2CG4A 3DQVC 3WE2A 4DYQA 2BYVE 3RC3A 1VQ5I 4PVBA 1YS7A 4U7BA 5ILSA 3OYAA 1YO5C 2FMYA 3R4KA 4A6EA 2DA2A 4MHGA 1MW7A 4N9HA 1U8RA 2VC0A 1MH3A 1LB2A 4A3GJ 2Y0SA 2QZ8A 4EMSA 3FTXA 2NAZA 1XC5A 1Z6TA 1V3FA 1B9MA 2YU9J 2ZMEC 2WZGA 2HYJA 5JO0A 5LGUA 4FT8A 3OS2A 2WTEA 3LSJA 2K7LA 2W00A 2O0YA 4U0VA 2CWEA 3K1NA 3CC2I 1A6QA 3S16J 3W2WA 2FNAA 4CZZA 3QOEA 2MAOA 4K5LA 3U1KA 4Y4RA 2Y69H 3HPHA 4MO7A 3FF5A 3FMSA 2XKOA 1Q0HA 2CMPA 3MN2A 3TO9A 2M2EA 5E1ZB 1J7KA 4ZZLA 3RSNA 3EBIA 3HOZJ 3H3ZA 1DDNA 2Q2EA 3G73A 1NK2P 1IRXA 4GO1A 5F0HA 3Q5FA 4FASD 3FU0A 1IUFA 2JN6A 3HJEA 1SFEA 2HVRA 2V9KA 2B63J 1PJRA 4J00A 2ZNZA 2M7AA 3LAPA 2LG4A 1PUFB 4B43A 1GXPA 1S29A 2G7HA 4Y15A 1VF9A 4X6AJ 1WWXA 2IP2A 4XONA 3RKQA 5LEKA 3PFYA 3CCLI 1PUEE 1MVYA 3ZHYA 1KYZA 2FEZA 1C0WA 2LBFA 2Y1FA 2DTZA 1GDTA 1B6AA 1LDJA 1MBKA 4Q47A 2AXLA 1I3QJ 1MIJA 3OYBA 4HDUA 2WAFA 3DWLE 3LA7A 1O57A 1DPUA 3GFJA 3J80Z 3LSMA 1ONPA 5AENA 1KU2A 1QZZA 2ZSIB 3CDHA 3ISPA 2FX0A 1R5HA 4M3FA 2ME6A 4MFEA 1LNWA 3LA3A 2QVOA 1DQUA 3WTWC 3K2AA 3BROA 3QYBA 1FYKA 1I6XA 1XN7A 1LJ9A 2L4AA 1QVTA 3EETA 2CGPA 3M8EA 1H89C 3B7TA 1FBUA 1WHUA 2DAOA 2MH2A 4JK1X 5FLXZ 2EZIA 2XB5A 4K5MA 3VDXA 2VOPA 3J81Z 3F22A 4O5VA 3OL4A 5ICGA 4UNOA 4FLSA 4IKFA 4A0ZA 1FX7A 2GBYA 1X1CA 2CQQA 4AYBN 2IAIA 5E17F 5HS9A 1OQYA 1FSEA 2E2HJ 3H9JA 2LTPA 3PSIA 3CZGA 3OIOA 1XGMA 4CSWA 4CCMA 5JHUA 1K83J 5EJCA 2IW5A 3PSFA 3ZRGA 4DW6A 5J1RA 2R5YA 3FH8A 1HOMA 2R5ZB 4OAYA 3S14J 1STZA 3ZMVA 2WY7Q 1YHQI 3CMYA 2JVHA 1IAWA 2A69F 3RJPA 3OYGA 4PU2A 2HPIA 3CXBA 3BP8A 1SMYF 3FM3A 2XPWA 5J47A 5LGTA 1MMGA 3L2WA 3EUHC 4U0WA 3R6SA 5IOZA 4CCNA 1J9IA 1ENHA 3E3VA 3ML6A 3DXJF 4M3EA 5CPRB 4G12A 5IP7J 3GTGJ 1BI2A 3LOCA 1H19A 1BI1A 4ENKA 4J19A 2OPTA 5TJJA 5J3LA 2IPQX 1EH7A 4BQAA 1POGA 5C4XJ 3TKYA 1O4XA 4XKCA 2VKHA 2JUGA 3L1PA 4IHWA 2MLKA 3Q43A 2BV6A 2DFHA 1QNTA 3GWZA 4I98B 3ZN0A 4G6TB 5DCMB 1QBJA 1BW6A 3AAFA 2E7WA 1X3WA 2CUZA 2XAJA 3TW7A 2K9QA 2P6TA 4CCKA 4L5EA 1QU3A 2ZCWA 2L4MA 2LVSA 4GGGA 4MGRA 4MQ9F 1Y56A 4II2A 4EM1A 3LL7A 3V8LA 3CMAI 3VVMA 4EV0A 2D1VA 5HS8A 4HOBA 4LB6B 5JAZA 4L5IA 3BCAA 2LBFB 2XASA 3LSPA 5GPCA 3CUQB 1S7OA 2KRCA 3E0JB 4G6QA 2MC3A 1K6OA 3KP4A 3FXMA 1YI2I 2QLZA 4XOPA 3GX4X 4HF2A 5EZHA 3OR2C 4RAGA 3E6DA 1CF7A 2EWNA 3FHNA 2MBFA 3KE2A 2Q0OA 1R4NB 3CDLA 1XTAA 4MS6A 2PJRB 2RDPA 3FISA 1TP4A 4BDZA 2VODA 1QZYA 2CQNA 5HOOA 4IHVA 3VSLA 2J5PA 1IN7A 4A3BJ 4QPEA 2EBIA 1HKQA 1KONA 1MGTA 3BJAA 3FTSA 1GVJA 3EYYA 1BL0A 4HV5A 2EV6A 3BR2A 2CFXA 3HIFA 1CF7B 2WADA 2KRFA 3HTSB 4BY7J 3WU1B 3L2UA 4XO4A 2F5VA 4WK8F 1D0XA 5HNHA 4FCYA 1JVSA 2K86A 3M9AA 5ILUA 3TEDA 3DP7A 3GFMA 3FUHA 4BUPA 2F48A 4YG2F 5AONA 1QGPA 1LQ1A 5CYVA 4XNDA 4ZC3A 4HYEA 1JHFA 4RB1A 2RC4A 4KT5C 5K5QA 1GHCA 4YFNF 4K5PA 1LFUP 3P9KA 1W7PA 3ZQGA 4I09A 1VQ6I 3C1DA 3I4PA 2CV2A 4RCVA 4PDKA 1QQIA 1OCCH 2M34A 2V79A 4NBQA 2FQ3A 2DOEA 3CDIA 1JJ6C 4EM2A 4X0GA 2LR8A 1I1SA 3S2HJ 4FETA 4HSRA 1X1BA 2WV1A 3M1CA 1E3PA 3DEUA 5BMZA 1IZ1A 2M3AA 3ZOBA 1GT0C 1USTA 4HRIA 4KMFA 2XAGA 3M8JA 5EGOA 3WQRA 4M9ZA 2IA2A 1XCVA 3F3XA 3CZKA 4A3CJ 5BQTA 2P8TA 1LEAA 2JPBA 4F3QA 1H9GA 3N05A 1IO2A 1SVLA 2KQRA 4MTDA 4XN8A 2FQ4A 2ZMEA 4GYGA 4MEYF 5KVRA 5LFAA 4Q48A 1LFBA 1FLIA 5LEJA 4XORA 4RLQA 1R00A 2KIQA 2V4JC 1T8IA 2GWRA 4NC6A 2XGDA 3K1PA 3IAS2 3KCCA 3TBIA 4YIFA 5ILVA 5IYCJ 2RGVA 4S05A 3BJ6A 1IV6A 2IGKA 3R60A 2E1CA 5J1UA 2M30A 3QOPA 2EK5A 2QCOA 1ZR4A 3K7AJ 1ETQA 2ZJPF 1BW5A 1S5LC 1SANA 3IKTA 2K9MA 2ZFWA 1LFPA 3A2KA 5M5XJ 1ORKA 3ERED 3WQQA 3BOQA 3JW4A 4XN3A 3PNYA 2VIXA 4A3KJ 3FWEA 2M8GX 1XD7A 2ID3A 2YPRA 3LA2A 3I0TA 3MEXA 2GM4A 4OIPF 3QRFF 3S8PA 3JRBA 3ZMUA 1DUXC 4ZDLA 1A5JA 3I54A 5JHFA 1B4AA 3FUDA 4XLEA 4KYWA 1QHHD 3ZMTA 4UV9A 4IHXA 1O3TA 2HXIA 2RVCA 1OISA 1Y39A 1JUMA 3VYTB 3WTSC 2P0WA 4PSXA 3CCQI 1XGNA 1E17A 1D1AA 2NVUB 2KMUA 1OCOH 1ETOA 4PUSA 3CLQA 4LMYA 1A36A 1HS6A 5KK1A 2DMUA 3WU0A 4PGGA 3H3VK 1HW5A 5DTDA 1ZGAA 1Y8QB 3C7JA 3WODF 2R70A 4BU2A 1JT6A 5JBIA 2ZNYA 2QSHX 4RLFA 2VBWA 3H36A 2P5VA 2PMUA 2DA7A 4HZFA 5JLXA 5IPAA 3IC7A 4UV8A 4ZYAA 2R7WA 3D0SA 2JVGA 4Z2YA 2LP0A 1R7JA 1RKWA 1RNLA 3ZMDA 1N77A 4DIQA 4BE2A 1JGGA 2MABA 2DI3A 4XRSA 1E0EA 1ZHFA 3F8CA 5KAFC 5FFXA 2A68F 4BAYA 3CCMI 1W0UA 3F72A 3BZCA 5BS6A 1E2XA 3S1MJ 3PFIA 1BC7C 4A03A 5DYFA 4XMVA 1ZG3A 2VE8A 5B1AH 4RGXA 1RZ4A 3IP4B 4F7ZA 2R0QC 2XAQA 4OWRB 1MJBA 1XCBA 4XIDA 1WH5A 2QQ8A 4PK4A 2QUFA 4D7MA 4XN2A 2GIVA 4JX5A 2HTSA 3M8FA 2LF8A 1R22A 2HEOA 1P6RA 3GW2A 1EH6A 4XNFA 4EJWA 2DK5A 2NS7A 4PW4A 2DW4A 1WJFA 2KLOA 5TRDA 1LVKA 1LE8A 2R59A 1IV8A 1U5TA 2UV1A 2DMTA 2VQGA 1YW7A 3ABTA 3PL8A 4G7OF 2ZO4A 4LG0A 3AG4H 1ULYA 4C30A 2E1NA 2WBMA 1Q1HA 1VFCA 3KEOA 3MZHA 3ZQQA 2VXZA 1Z7UA 3ZHXA 2L9SA 3SZPA 3VYUB 1EF4A 1I39A 3LWFA 4I7HA 4DJAA 4CCJA 3WGIA 3I4MJ 2WAQN 1SC7A 3PNTA 1HKSA 1SD6A 5H20A 5KNLA 2WY8Q 4FLQA 4O6JA 4OIRF 4LOCA 4KFCA 4XLAA 3CQZJ 3MKZA 1MH4A 2B7EA 3BCBA 3QU3A 2VOOA 4R8HA 2D45A 1X4PA 5F64A 4WXCA 3PUFA 4D9JA 3L09A 3V8KA 5GTHC 3LQRA 3EUKL 2LD5A 4IOAF 2LFBA 4RAYA 4J3BA 1NG7A 4AUXA 4BEHA 4DQ2A 1T39A 2V1NA 1D8JA 3WTZA 2F5CA 1Z6RA 3DLAA 3GUDA 4AD9A 1Y0UA 4QLCU 2Y1GA 3AL0C 4RBOA 1ZREA 2BW3B 3VYRB 2ZFUA 1IW7F 3OV8A 3GTMJ 2DOFA 3QPHA 5GP9A 1ZN2A 2V1DA 2K27A 3JAMK 2MW8A 3CF2A 4CUGA 1MBJA 4DYRA 1MW2A 2I5UA 2M1BA 3BPVA 4XMXA 2CU7A 1Y1VJ 2MG4A 3OYNA 2QF7A 1XPXA 2IXSA 4Y13A 2XHKA 2PN6A 3KP6A 1SD5A 3KIOA 4YFKF 3B37A 5EYRA 4KITB 2FJ1A 2HOEA 4C3HJ 4IOCF 3CJRB 1P4WA 2FBIA 3ZN1A 4BXUA 3HRMA 1XDUA 2P6SA 1VQ7I 3DU6A 4RGUA 2Q2EB 4F93B 1APLC 4R5TA 4CCOA 2Y75A 2HFHA 5HDKA 3WTVC 3GYHX 1VQPI 2CFOA 3KP7A 1YLFA 4C3IJ 1PDNC 2JA6J 5IP6A 5GADJ 4HQEA 3UNGC 4B44A 4I6ZA 2VJJA 3TW6A 4ZDOA 3SEZA 4NB5A 2FU4A 2H1LA 2NS0A 1WJDA 3N4MA 2AXTC 4IJAA 5AIPA 1ZELA 3WTYC 2O9LA 4UVCA 2EIKH 4ZX4A 2XPYA 5EEAA 2FBKA 1B8IA 1NHAA 3GTKJ 3T8RA 2E2IJ 4YIIA 3MZ8A 2UXXA 3HRTA 2J5OA 5L3GA 2OCEA 3Q9VA 3ZXSA 1DPRA 1FOWA 4A5NA 2TRTA 2ZKZA 2ZSHB 1OR7C 2K9LA 1D5VA 4XMTA 1J5YA 5LBQA 2VJ5A 3LSTA 4E7HA 1LEBA 2DA3A 3ZR8X 3S3MA 2HYFA 3GO5A 3RQ4A 1HBXG 1UFMA 5DDGA 4M72A 3VPRA 2MFZA 4R7LA 2ZJRF 3IRQA 3CCJI 4DYCA 2QKLB 3JSPA 2KJCA 1YITI 4M3GA 1FYLA 1SAUA 3J7YJ 1LPQA 1EV7A 4ZYHA 2K9SA 3H92A 2F5EA 1J0RA 1QRYA 1YOVB 4CGZA 2V7FA 3VODA 1YS6A 5FLVA 2W84A 5E1XA 4G6DA 3QYFA 3BPXA 2MD0A 3JR9A 2HI3A 2HVQA 2R7VA 4W97A 3G1LA 3CP2A 3RYRA 1WQ2A 4HA8A 3LFKA 1KA8A 3BTJA 3OR1C 2R7UA 2L5QA 1ZRDA 2V9PA 3A14A 2HWVA 9ANTA 1G2HA 1K78A 3I59A 5CVVA 2FRHA 1U6GA 1MDMB 3KX2A 4I2OA 3E6MA 2F4IA 2XIGA 1S72I 1QA6A 4L0YB 2JA7J 3I5UA 4TV7A 3JAMZ 5ICCA 3L2QA 1FJLA 1XMXA 2ID6A 4WF2A 2X6XA 4G7HF 2R72A 2IS1A 3A02A 4UUSB 3DFGA 3I71A 5BPDA 1ONVA 2E5ZA 3O2PE 3BG7A 1TT0A 3Q3SA 1U9OA 1FNNA 3BDDA 1S7AA 1SVOA 4QTRA 5H6QA 3KLNA 5IY5H 4RAZA 1WI9A 4G94A 3KFWX 4MFDA 4XLHA 2NVQJ 3L7WA 2XAHA 3GTOJ 4BJTA 3CHRA 4LFUA 4ZX3A 2P4WA 3SDBA 4KA4A 4ZW6A 1VZ0A 2H27A 3ECHA 3EDPA 3KPHA 4UB6C 1YIJI 5FKOA 4BXXJ 1IXSB 1MW0A 5E3OA 1FIPA 2KPMA 2GXGA 4MIMA 1MD0A 1XDSA 5DCMA 2YS9A 1H9TA 2VJIA 3FU5A 1FZPB 2GOXB 3WTUC 2BHZA 2VJ4A 4A3EJ 1F43A 2NYXA 1U0JA 2O03A 4F52A 4LUPA 3I3LA 4KIFA 2LKXA 4BJ5C 1ZLKA 2D5VA 3VB2A 2XGXA 1MBHA 2E2JJ 2DPUA 3PJRA 3F8FA 2XPZA 4FISA 1P7JA 2ELHA 2L0KA 4C3JJ 5DUKA 3J7ZI 3HG9A 1TWHJ 3W2AA
chains in the Genus database with same CATH topology
3FH7A 3PUBA 3Q43A 3C2HA 2L9NA 2WA0A 3FULA 2HPTA 4G6TB 4XN5A 2CH0A 4C2TA 1X3WA 2CUZA 1BR4A 2FUG2 4QUOA 4XMWA 4CCKA 5TGTA 1QU3A 1N75A 1Y56A 4II2A 2XF6A 3LL7A 3VVMA 4IZZA 3K4BA 4XO3A 4NNJA 2DQ6A 3B3BA 2A7OA 3MKYB 3FTZA 3PNVA 3K6GA 5CQGA 5JAZA 3FTYA 4E7KA 1W36C 3BCAA 2LBFB 2RNGA 1V5EA 2CW7A 4RM2A 4IX7A 2VKDA 2E5NA 2JSPA 1WJCA 2KRCA 3HOTA 2ZXGA 3E0JB 2DJIA 2UWMA 1ONOA 3FUEA 1DGWY 2DCEA 2F6CA 2M4KA 2R7XA 3K4KA 3CHSA 4XQFA 4XOPA 5HVQC 3IIEA 3OR2C 2Q1ZB 4XLCA 1Q0LA 2O5RA 4BJ6C 3IUOA 3FHNA 3A4CA 1S9HA 4RVBA 4ZW5A 4MS6A 2PJRB 1SFKA 3HL2A 4E7IA 1YX3A 3S3NA 4JQFA 4E4HA 4KJZA 4BDZA 5HOOA 3VSLA 1SC5A 4K5OA 4QPEA 4QMEA 4H4KC 3CMMA 3S3OA 2VQHA 1KONA 3OS1A 3FDYA 4GRIA 3AU9A 4ZX6A 2BVMA 3FTSA 1DP3A 3CIAA 2BW3A 3D5LA 2WADA 1V5GA 1T1SA 1ZS2A 3H35A 4E7LA 2NOJB 3L2UA 3FUFA 2F5VA 4XO4A 1D0XA 3GBGA 5HNHA 1JVSA 4DBQA 4HNTA 4BKXA 3FUHA 2HPOA 3HKZA 4BUPA 2PJRA 4OOEA 4BACA 4XNDA 4XKWA 2KL4A 1BOBA 2X51A 3D5SC 4ZC3A 2JCYA 4XMXA 4XNBA 2K5CA 1Z7LA 3EPZA 4K5PA 4CXFA 1K6YA 3CZLA 2CV2A 4RCVA 2L2OA 3VYSB 2CV1A 3OYFA 2KP6A 3DEEA 4L2LA 4X0GA 1NG6A 1D1CA 2X6YA 2W7NA 1WJBA 1LKXA 2VB6A 2XAUA 4AYBA 2Y1DA 3CZ6A 2VL8A 4FETA 4HSRA 1LDKB 4BGDA 1X1BA 2W82A 3NWTA 3OYEA 4RM3A 2VPLA 3M1CA 3FUJA 5FROA 1SQMA 3SEQA 4ZQFA 2M3AA 4CH7A 3FUKA 4B47A 4HRIA 1MW3A 3M8JA 3SZGA 4CZCA 1G8XA 4KT6A 3WQRA 4DPRA 4J01A 2E60A 1Q0QA 2HZDA 2X1EA 3OOUA 3L2RA 4C2UA 1S46A 3CZKA 3OYHA 1OLTA 2E1MB 4F3QA 4ZW8A 4HPQA 2HVSA 3N05A 2KQRA 4LIUA 3FHEA 4JNDA 4XN8A 1MNDA 3SYTA 3K4MA 5LFAA 4XORA 4RLQA 2XF5A 2VQCA 2LYCA 2V4JC 3EBHA 2JD2A 4LG3A 1ONNA 2JCVA 3IAS2 4ZTFA 4KP7A 4FLOA 3TBIA 2KHMA 3FU3A 2IGKA 3HC7A 3OIQA 1QHGA 3MMYB 1AA7A 4MLOA 4N4OB 2GTQA 3B2PA 4F91B 3AL0B 4ZQEA 2K9MA 2QKMB 1LFPA 2LREA 2ZXHA 3OMYA 4ZDPA 3A2KA 3E1SA 4E7SA 3H5NA 3WQQA 4NC7A 4XN3A 3PNYA 2VIXA 3FUNA 4ZJZA 4Q4EA 4PSWA 3CHQA 3ZCOA 4F92B 4DGWB 3OIPA 3S8PA 4ZW7A 4BEHB 1FMWA 4ZDLA 1X3ZA 3H9QA 1X4OA 5JHFA 3CHPA 1BR1A 3FUDA 1JG9A 4E6KG 3JSZA 4DBRA 4XLEA 2WZFA 4YELA 2AQFA 2OV7A 3LSKA 1QHHD 4LIVA 3DKYA 2OUMA 3BG6A 3CJQB 3VYTB 2P0WA 4PSXA 1R0KA 4AR1A 1D1AA 1UG0A 3OS0A 3B2XA 4B48A 2KMUA 4XN4A 4PUSA 1HS6A 2XC7A 4Y6RA 2KDOA 3DU5A 1Y6IA 2JD0A 4XR6A 2JCXA 2PUSA 4BL0B 2ELJA 2E1MC 4BU2A 3U21A 4DOZA 2R70A 4QPOA 2XQ0A 4AYSA 1X19A 5JBIA 1X1AA 4JOMA 4RLFA 2EGHA 4ARFA 1YX5A 2CW8A 2JV7A 4BDYA 2IGOA 2IS2A 4Q4IA 1TZLA 4ZYAA 3TMOA 3AUAA 3OYKA 2OC6A 2R7WA 4XMZA 3LFUA 4HEA2 2JVGA 4XL9A 4PJJA 1N77A 3QYEA 3RC8A 3DTEA 4AU7A 4DIQA 4BE2A 4ZTJA 2MABA 4BE0A 2M4GA 1E0EA 3IAM2 2IGMA 3ONQA 3KEYA 2IS4A 2Y1CA 2PL5A 2C82A 3FTUA 3U9WA 3HXLA 2QVWA 3LSHA 3OY9A 3EUAA 3K4NA 2K3PA 3T0YA 4HSTA 3K70C 3KYLA 5DYFA 4A03A 3I9V2 4XMVA 3DTKA 2X85A 1UELB 1ERDA 3IP4B 1UAAA 1G59A 5JC1A 4OWRB 3JT1A 4R79A 3DTIA 3FUMA 4PK4A 3VSKA 5FRMA 2QJ1A 1YE9A 3FBIB 2HU9A 4XN2A 3S93A 4ZQHA 2RQQA 3K4LA 3FH5A 2LY1A 2XDVA 2R7QA 2B61A 3H5AA 4XNFA 3A1YA 4NQWA 2MAPA 3ZI0A 4PW4A 3OL3A 3QODA 3K4CA 2V26A 4ZN6A 3BLYA 1GW6A 1WJFA 2KLOA 1OR7A 3D5RC 1LVKA 2HQAA 2R59A 3FUIA 3F9KA 3ZGKA 2UV1A 3K4JA 2VQGA 4AVZA 3PL8A 3NWSA 2DXIA 3AU8A 1MW1A 4YEJA 5FRNA 3VVLA 4XLFA 4C30A 4AR8A 3RPUD 2VLAA 2WBMA 2LC2A 2DT7B 4XN9A 4ZX5A 3ZQQA 2JA2A 1V5FA 4BS9A 3VWBA 1EA3A 4FCAA 2VXZA 3J7AY 2LRDA 5LD2C 2L9SA 3ZHXA 5HNFA 4PJLA 3VYUB 2IS6A 2O7GA 2R7RA 1T95A 4DJAA 2WAEA 4CCJA 2MC4A 3QJXA 4P5OA 3FTWA 3PNTA 1MMAA 5KNLA 2WY8Q 4FLQA 3DPTA 4RSYA 4XLAA 4YRVA 2W1OA 3BCBA 4OAZA 3MKZA 4HNUA 1X4PA 2KRHA 4LITA 2CV0A 4D9JA 1N78A 2PMZA 1PYVA 3CP8A 3UEQA 3EUKL 3V42A 4XN7A 1R6RA 3W3CA 4J3BA 2LY2A 1NG7A 4BEHA 2WPGA 2M7BA 4XMYA 2V1NA 5DLLA 3EBGA 5JMWA 3DLAA 2GOMA 1Z21A 2X1CA 3DQVC 1P9QC 4B3XA 3AL0C 2Y1GA 4X2UA 3RASA 4ZW3A 2BW3B 3VYRB 2ZFUA 3B34A 3B7SA 3RC3A 4XOTA 3LSGA 4PVBA 2BOLA 3C2GA 4U7BA 3OYAA 2PGGA 5HLTA 3CF2A 4CUGA 5CQEA 1MW2A 1MW7A 2DT6A 3ZHZA 4EATA 3CHOA 3OWTA 4NUBA 3H0DA 3OYNA 4IQJA 2IXSA 4XN0A 2KZVA 2Y0SA 2Z2SB 3HOSA 3FTXA 4R5XA 3LMMA 3W2VA 4QPQA 3B37A 3FKJA 3CZEA 4KITB 2WZGA 5JO0A 3T8VA 4II3A 3OS2A 2X1DA 3CJRB 3R0IA 2W00A 2DOAA 1BR2A 1FMVA 4XNAA 1J09A 3DU6A 2Q2EB 3W2WA 4F93B 4R5TA 4CCOA 3MKWB 2HPMA 3QOEA 2MAOA 4XN1A 3OYCA 4K5LA 4E7ZA 2CFOA 3OYJA 4Y4RA 3HPHA 1X1DA 3B7RL 2CS3A 3UNGC 4B44A 5DULA 2VJJA 4ZDOA 3SEZA 2C5ZA 4QIRA 4AR9A 4F55A 1WJDA 4Y6SA 3L2VA 1Z3XA 1ZELA 2R7TA 4Y33A 1Q0HA 2CMPA 2FFLA 5KCMA 3FTVA 3PUUA 3H5RA 2XPYA 4ZX4A 3K10A 1D0YA 3RSNA 4Y3OA 1H3LA 3EBIA 3UCQA 2XF7A 3UR3C 1Z3YA 1IRXA 2CUJA 4NQWB 4FASD 3FU0A 3A06A 4GAEA 4E7JA 3ZXSA 2BVLA 2HVRA 2I8DA 1RP3A 2VXDA 2V9KA 2UUZA 4C9YA 4PFPA 1PJRA 3ANNA 4J00A 2ZSHB 1OR7C 2M7AA 1SG7A 2K9LA 2RJIA 2W4SA 4XMTA 2LG4A 1T0FC 4B43A 3RTRA 4FLRA 2VJ5A 4E7HA 3DPLC 3ZR8X 5KHDA 3S3MA 3HPGA 3RQ4A 2JD1A 2Z16A 3OYDA 4XONA 3CESA 2MFZA 4ITVA 1D1BA 1WJEA 4R7LA 3PFYA 1MVYA 5JMPA 3H9GA 3OYIA 3ZHYA 2QKLB 2X6WA 4XO5A 2LOOA 2LBFA 1SAUA 2Y1FA 3K70D 1MMNA 4XKBA 3AKZA 4Y6PA 1GLNA 2V7FA 1WJ5A 4Y67A 3OYBA 2WAFA 3DWLE 1G5AA 3FU6A 3BC8A 4GAAA 3LSMA 5BPPA 3RCOA 1ONPA 1MMDA 2VJ8A 5AENA 2ZSIB 3QYFA 4PJMA 4ZQTA 2MD0A 1JGIA 2HVQA 2R7VA 4AICA 4QHPA 2L7KA 4CCLA 3CP2A 2DQMA 3UERA 1HA8A 2A6TA 1DQUA 1WJAA 4CA0A 5CKTA 3OR1C 4NC8A 3QYBA 4XMUA 2V6EA 2R7UA 2L5QA 2Y1EA 3A14A 1R0LA 2HDWA 2RREA 3OYMA 3AFHA 3OYLA 4U87A 3B7TA 1D0ZA 3KX2A 3Q44A 2WAQA 2F4IA 3LSIA 4K5MA 2HNHA 3VDXA 3L2QA 3WQSB 4RMNA 4BQNA 2X6XA 4PFOA 2R72A 2IS1A 5FWQA 3G2BA 3OL4A 3S32A 4FLSA 3DPUA 4IKFA 2E5ZA 2R4GA 1X1CA 3BG7A 5JNLA 4ANJA 3HUGB 1TT0A 4BE1A 1DGRM 4MKTA 4OOFA 3H9JA 2ZXIA 4IQ4A 3PSIA 3CZGA 2R7OA 1W36D 4CSWA 1WFXA 4CCMA 3TL4X 4BQOA 2XSJC 5EV7A 2VASA 2IGNA 3PSFA 4XLHA 3ZRGA 3FH8A 4BJTA 3CHRA 4ZX3A 2WB1A 4OAYA 4D1QA 3SDBA 4ZW6A 1VZ0A 2WY7Q 2JVHA 4XKVA 3DKXA 3ANMA 3B7UX 4PU2A 3MD2A 3OYGA 4PJNA 1T1RA 2HPIA 1MW0A 4BXFA 4BQQA 3KEDA 2A5WA 2KPMA 2LH9A 1MMGA 1MNEA 3L2WA 3EUHC 4KISA 1JI8A 2VJIA 3FU5A 4CCNA 2GOXB 2VJ4A 4N4NB 1U0JA 2AQEA 4XM3A 4P1WA 4F52A 1K5HA 5CPRB 3I3LA 4K5NA 4LUPA 2MYSA 2Z1DA 3FBNB 1H19A 4BJ5C 2R7SA 3PJRA 4ZQGA 2M0MA 2VQLA 4R5VA 2XPZA 3ANLA 4HG2A 2VKHA 4XKCA 2JUGA 3HG9A 3W2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLT A;  2VLA A;  5HNF A;  5HNH A; 
#chains in the Genus database with same CATH topology
 1BJZ A;  3QPL A;  1XSX A;  5K5O A;  3JRD A;  3GZN B;  5FB2 A;  4K2E A;  4LG0 B;  1BR4 A;  1TC3 C;  3MQ0 A;  4ABZ A;  2QYO A;  3E6C C;  3KZZ A;  4IZZ A;  4D5C A;  4OMY A;  3K4B A;  4XO3 A;  4NNJ A;  1R4M B;  4EJT A;  2A7O A;  3MKY B;  2JJ7 A;  3PNV A;  3K6G A;  4JP0 A;  5CQG A;  4EJU A;  3I59 B;  1W36 C;  2H94 A;  3ZQH A;  2CW7 A;  4RM2 A;  1X3Z B;  3VEP A;  2O6G E;  3HOT A;  2GXB A;  3ABM H;  2ZXG A;  4UHT A;  4RDU A;  2DJI A;  2UWM A;  5FD6 A;  2M4K A;  5JVT A;  2R7X A;  1T08 B;  5J6X A;  3KP3 A;  2M45 A;  2O5R A;  3A4C A;  4RVB A;  1S9H A;  3ZMZ A;  4ZW5 A;  3R0J A;  5GAE J;  3WG9 A;  3HL2 A;  3B6C A;  1YX3 A;  1SD7 A;  2L54 A;  4JQF A;  1U5T C;  4KJZ A;  5L3B A;  5F1R A;  5HDN A;  2ESN A;  4H4K C;  3IH4 A;  2JK3 A;  3S3O A;  3E5X A;  3GVA A;  2XVC A;  3FXL A;  4GRI A;  4ZX6 A;  2BVM A;  1X58 A;  3CIA A;  2BW3 A;  1QVU A;  3P7N A;  4E7L A;  2NOJ B;  3AG3 H;  2EZH A;  1Z77 A;  2EFO A;  3GBG A;  1WI3 A;  2W57 A;  2FXA A;  4HNT A;  1YYV A;  4BKX A;  5J8C A;  2HPO A;  3HKZ A;  1VQ9 I;  1OPC A;  5CJ9 A;  2EIJ H;  2PBI A;  3QPS A;  4OOE A;  1B72 A;  2R3S A;  2X51 A;  4GCV A;  3JRF A;  2K5C A;  2EV0 A;  1G3W A;  3B73 A;  1WKM A;  5EG0 A;  3BR6 A;  2DOD A;  1Z1D A;  2VT2 A;  4CXF A;  1A31 A;  4ZZD A;  3CZL A;  2BEO A;  3QQA A;  3VYS B;  1ACI A;  4UUT A;  1SEU A;  1TWG J;  5ED4 A;  3U9G A;  4L2L A;  1GVD A;  2X6Y A;  3A03 A;  4CYC A;  1WJB A;  2HTJ A;  2L02 A;  4I99 C;  3CZ6 A;  4EQQ A;  1IUY A;  4BGD A;  3NWT A;  2CW0 F;  1TTY A;  1HDD C;  4RM3 A;  1SQM A;  2GA2 A;  3SEQ A;  4A93 J;  4CH7 A;  4B47 A;  1MW3 A;  3AG1 H;  2L7Z A;  3SZG A;  4KN7 X;  4CZC A;  1G8X A;  4EGY A;  2E60 A;  2C6Y A;  2EPF A;  2WB1 N;  2ZC2 A;  5HLG A;  3L2R A;  4IVN A;  4XSZ F;  4E70 A;  1UCR A;  1OLT A;  1OJL A;  4ZW8 A;  2HVS A;  2BXZ A;  1BIB A;  1T38 A;  4JND A;  4XRF A;  3DLL F;  3SZT A;  4HNV A;  4I02 A;  3KZI C;  2ZXW H;  5BNG A;  2LYC A;  3K0L A;  1M1E B;  3ZQI A;  1YJ9 I;  4OMZ A;  3CLO A;  5K5R A;  4WX9 A;  3Q0U A;  3ABU A;  2JCV A;  2PG4 A;  2XGC A;  5K7H A;  1T2K A;  2KDZ A;  4FLO A;  4AVP A;  2FD5 A;  2KHM A;  4V2F A;  3C2B A;  1QPM A;  3FU3 A;  1F36 A;  1F9N A;  3VOE A;  1HSJ A;  1JUP A;  4U0Y A;  3O6B B;  3FX3 A;  1TBX A;  1G3Y A;  3MMY B;  1ZR2 A;  3AL0 B;  2QKM B;  2LRE A;  5TIS C;  1R1U A;  4ZDP A;  1IRF A;  3FUN A;  4ENN A;  1XGS A;  2XRL A;  2LSO A;  2MH9 A;  2PFB A;  3OIP A;  3CO6 C;  4ZW7 A;  2DMP A;  2GLO A;  2TCT A;  2OBP A;  3S15 J;  2VON A;  3H9Q A;  1U2W A;  4L5J A;  2Z3Y A;  3BR0 A;  1R1V A;  1JG9 A;  4E6K G;  3ROU A;  2YX4 A;  1W5S A;  3JRH A;  5ICE A;  3QAH A;  3I53 A;  1W7P B;  2F4M B;  1FWZ A;  3RQI A;  4P9U A;  1R0K A;  4AR1 A;  3I55 I;  2K4B A;  3OS0 A;  3HOX J;  1ZK8 A;  1MBF A;  4XN4 A;  5IT3 A;  3E5U A;  1H8A C;  4P9F A;  2PEX A;  2JD0 A;  1OCZ H;  1Y6I A;  2JCX A;  2PUS A;  2XQ0 A;  2Y9Y A;  2E1M C;  1J59 A;  4DOZ A;  1KQ8 A;  4QPO A;  5K1Y A;  1TLH B;  2GAU A;  1UHW A;  5K7Z A;  1QPI A;  2EGH A;  2PMH A;  3GZ6 A;  3CHQ A;  2IS2 A;  4KN4 X;  4V2G A;  1U5T B;  2A6E F;  3TMO A;  2DDB A;  4XMZ A;  2OC6 A;  4FHT A;  2F5F A;  2DQL A;  2XUB A;  3LFU A;  2IT0 A;  5LHG A;  3CD6 I;  2DDA A;  4AU7 A;  4N0B A;  3D1N I;  2RAE A;  1ITY A;  5D5U B;  2IGM A;  1G3T A;  2C82 A;  1R23 A;  2D2W A;  1SFO J;  3LSH A;  4IPA A;  4UVA A;  3OY9 A;  1U78 A;  4JYK A;  1WSU A;  2P5K A;  3K70 C;  3TOB A;  1KU7 A;  3PO2 J;  4A3D J;  1ZG5 A;  4H0E A;  2X85 A;  4ESF A;  2NRA C;  1S8N A;  2WWY A;  1TW3 A;  1VQ4 I;  2R93 J;  1UAA A;  2PLY A;  1T33 A;  3LAJ A;  1FEX A;  1G59 A;  5J8F A;  2F2E A;  5LHI A;  5D6E A;  2X6O A;  2XV4 S;  1DU0 A;  4LLG F;  3O8H A;  3T8T A;  3DEW A;  5FRM A;  3VSK A;  5LLQ A;  1Z05 A;  1D3Y A;  4ON0 A;  4P55 A;  2BHY A;  2XRO A;  3F8B A;  2RQQ A;  4ZQH A;  4CO8 A;  4BBS J;  3K4L A;  1WGX A;  2B61 A;  3ECO A;  5KAI C;  3G4S I;  4IXA A;  1R71 A;  2DK8 A;  2XPV A;  3OL3 A;  2BXY A;  1I3A A;  3K4C A;  3QOD A;  2V26 A;  3BLY A;  3CCS I;  5IT9 Z;  1RPW A;  2HKO A;  5AIQ A;  1J75 A;  1PP8 F;  4XRS G;  3MAJ A;  1BM9 A;  4AC0 A;  5EG0 B;  4FE7 A;  2PMZ N;  5GAH J;  5FFZ A;  1MW1 A;  2P7C B;  1O3S A;  4AR8 A;  1TWF J;  3RPU D;  3CC7 I;  5F27 A;  2LC2 A;  3GTP J;  1Z67 A;  2DA4 A;  1ZLJ A;  4BS9 A;  2WV0 A;  1EA3 A;  5D5X B;  2LRD A;  2UZK A;  1HC8 A;  5IYD J;  3A0H C;  5DS9 A;  2IS6 A;  3RDI A;  2O7G A;  4EJV A;  4BNC A;  2MC4 A;  3RKX A;  2ZB9 A;  3QJX A;  2ZXJ A;  2G7U A;  3S1Q J;  2QWW A;  2K9N A;  4HW0 A;  2DU9 A;  4BYY A;  4IRG A;  1SMT A;  2R7F A;  4RA2 A;  2KRH A;  3LSR A;  4M71 A;  3COA C;  1KU3 A;  1PYV A;  2BZT A;  1YTY A;  1IDY A;  3FZV A;  4XN7 A;  1R6R A;  1FTT A;  2WPG A;  2BGC A;  4LLL A;  2KFD A;  3GFL A;  3GFI A;  1AKH A;  2EB7 A;  3IRR A;  1BN5 A;  4QSH A;  4A3L J;  5JMW A;  5JI6 A;  2GOM A;  1Z21 A;  4B3X A;  3RAS A;  3ERM A;  3ZMS A;  3B34 A;  5IT9 K;  1MZB A;  4XOT A;  1GV5 A;  2RNJ A;  5F0C A;  2PGG A;  1XMK A;  2KJB A;  3CCR I;  2OF7 A;  4CHU A;  5CQE A;  2OTJ I;  1KGS A;  2ZJ2 A;  3ZHZ A;  2QA4 I;  3OWT A;  3CCV I;  2KIS A;  3H0D A;  2GXA A;  4IQJ A;  3M3Y J;  4XN0 A;  2KZV A;  2DA5 A;  1X3U A;  2Z2S B;  4R5X A;  4EM0 B;  3LMM A;  3W2V A;  2H1K A;  4QPQ A;  1GXQ A;  5DV5 A;  2JZY A;  5CVJ A;  3RIR A;  2KIF A;  3T8V A;  3GLX A;  2Q8K A;  2X1D A;  5ICF A;  3DBL B;  3PIO F;  4AIH A;  1OMI A;  1R5I D;  1BR2 A;  1FMV A;  2O61 A;  3JTH A;  5EZG A;  3M7G A;  4XNA A;  1J09 A;  1ON1 A;  3WHB A;  3MKW B;  2HPM A;  4FX0 A;  1LDD A;  3BQY A;  3OYC A;  1IN4 A;  2OQG A;  4RGR A;  2QBY A;  3OYJ A;  2K4J A;  2KIU A;  4CYD A;  1MBG A;  3B7R L;  1UMQ A;  1JHH A;  2EFQ A;  4HF1 A;  4A3J J;  5DUL A;  2DMN A;  2C5Z A;  2W25 A;  4F55 A;  5E3M A;  2EV5 A;  3L2V A;  1Z3X A;  4CDG A;  2R7T A;  2IA0 A;  2Z99 A;  2FFL A;  4GDF A;  5F04 A;  2HKX A;  3H5R A;  1ZH5 A;  3PUU A;  2FF4 A;  3DV8 A;  1ZYR F;  1H3L A;  3UCQ A;  2OQR A;  2RKH A;  3GTJ J;  1XSV A;  2L7F P;  3I64 A;  3A06 A;  5FO5 A;  1WPK A;  3MKL A;  2VKE A;  2JUC A;  1IRZ A;  4LGW A;  2Y9Z A;  1RRJ A;  4M6Y A;  3ANN A;  2KIM A;  1VQN I;  3G3Z A;  5D5V B;  4IHY A;  3N97 A;  2JRM A;  4G7Z F;  3RTR A;  1IG7 A;  4RB2 C;  3F8N A;  1RUN A;  3E7L A;  3KZY A;  1AOY A;  5KHD A;  3IHU A;  3HPG A;  2M0C A;  3OYD A;  2ADU A;  3X2Q H;  1HLV A;  3CES A;  3NAR A;  4ITV A;  1WJE A;  3J80 K;  1O3R A;  3ZP5 A;  4B8X A;  2OZ6 A;  3H9G A;  3OYI A;  2GZW A;  1HF0 A;  3FXR A;  3HRU A;  3SXY A;  2TDX A;  5D8L B;  2A3S A;  3K70 D;  1MMN A;  4HQM A;  3SQN A;  4RAF A;  3OSG A;  1GLN A;  5M3F J;  4Y67 A;  4ENM A;  2V6C A;  3E5Q A;  1G5A A;  2B9S A;  4EEF G;  3FU6 A;  3BC8 A;  4GAA A;  5BPP A;  3RCO A;  1G6N A;  1MMD A;  2YU3 A;  2OU2 A;  1JGI A;  5FLM J;  4LB5 A;  4QHP A;  2DJN A;  3BG9 A;  3OOP A;  4CCL A;  2DQM A;  2JTV A;  2A6T A;  1WJA A;  4CA0 A;  4KIG A;  2CUF A;  4NC8 A;  4XMU A;  1AKH B;  3HHG A;  3W6V A;  2Y1E A;  1T56 A;  3QP6 A;  4AYS A;  3RPQ A;  4IF4 A;  2RRE A;  2HQ5 A;  3OYM A;  1D0Z A;  3GLL A;  3VFZ A;  2WAQ A;  2FML A;  4A0Y A;  3LSI A;  1SD4 A;  2QGU A;  2M8E A;  3WQS B;  4RMN A;  3I4N J;  4PFO A;  1ZKG A;  5FWQ A;  3WU2 C;  5DM6 F;  3S2D J;  4ESJ A;  3G2B A;  3S32 A;  4XLP F;  2X48 A;  5B1B H;  4OOI A;  3DPU A;  1H0M A;  2B0L A;  4WCG A;  3HUG B;  4BE1 A;  2PJP A;  2IA1 A;  4I0A A;  4AIJ A;  5CVI A;  1ON2 A;  1OCT C;  2R7O A;  3KLO A;  1W36 D;  4UVB A;  3J81 K;  2COB A;  1WFX A;  3TL4 X;  4BQO A;  5EV7 A;  2JSC A;  2VAS A;  2IGN A;  3I58 A;  3GTQ J;  3KEQ A;  3E97 A;  4BHP A;  1OYY A;  1B59 A;  1BI3 A;  1BC8 C;  1XX5 A;  1NH3 A;  2WB1 A;  4D1Q A;  1YW8 A;  1IN5 A;  1YQA A;  1Z91 A;  2Y48 A;  1YIO A;  3MD2 A;  4PJN A;  3RYP A;  2HQR A;  4GFB A;  1T1R A;  4BXF A;  4BQQ A;  3E6B A;  5HLI A;  1UJ8 A;  2LH9 A;  1MNE A;  3G71 I;  2VBY A;  4UXN A;  5FKN A;  1BA5 A;  3IWZ A;  1WZ2 A;  2AQE A;  4XM3 A;  2AHQ A;  4GXO A;  1K5H A;  4K5N A;  2MYS A;  3R0A A;  2Z1D A;  2VT3 A;  3FBN B;  4ENJ A;  2VQL A;  1MNM C;  2EZL A;  4R5V A;  5FKL A;  4Q5S F;  2PI0 A;  2E36 A;  3H0G J;  3ZQC A;  3OSF A;  4S04 A;  3C2H A;  2WA0 A;  3FUL A;  2HPT A;  1WVR A;  3BQZ A;  3HZJ A;  4U7D A;  2E1O A;  4XN5 A;  2CH0 A;  4C2T A;  1P92 A;  4PGH A;  3BTC A;  4A5M A;  2FUG 2;  3CC4 I;  3PM1 A;  4QUO A;  5TGT A;  2FNP A;  3JRA A;  5DUI A;  4M9X A;  1P4A A;  2YUS A;  3BZK A;  1P4X A;  5E1W A;  2JPC A;  1R9T J;  2DQ6 A;  4IL6 C;  1HCR A;  2ISZ A;  3WGH A;  1R49 A;  2A05 A;  4IX7 A;  2OJE D;  4W1U A;  2XAF A;  4ESB A;  2JSP A;  1WJC A;  3CJN A;  4AIK A;  1JKR C;  3HSR A;  1ONO A;  3FUE A;  4D7N A;  3IIE A;  3K4K A;  5HVQ C;  1RET A;  2CYY A;  2EA2 A;  3O3K A;  1RR8 C;  2Q1Z B;  4HX7 A;  4XLC A;  4BJ6 C;  1Q0L A;  3GCM A;  3S3N A;  2EIL H;  1Y1W J;  4RB3 C;  1XSD A;  2COM A;  2KKO A;  4KIC A;  4K5O A;  4QME A;  2LF7 A;  2VQH A;  3OS1 A;  3NAU A;  5L3E A;  2HXO A;  4Y7N J;  1RIO H;  1Q1V A;  2GIZ A;  1R36 A;  1I6H J;  1T1S A;  1ZS2 A;  3FUF A;  2V1U A;  1T0F A;  5BPI A;  2CQX A;  4A3I J;  1XB4 A;  1F5T A;  2AS5 F;  1TWA J;  1W4M A;  2PJR A;  2BY3 A;  3BTI A;  1OKR A;  2EFW A;  2NOG A;  3EPZ A;  3K2Z A;  2ETH A;  1K4S A;  4M74 A;  1P7I A;  3CTA A;  3BG5 A;  1RKT A;  1MJA A;  4L9T A;  2Y31 A;  1MMS A;  1TQM A;  2Y0S N;  1U9N A;  1G4D A;  2VI6 A;  2CV1 A;  2DFF A;  3OYF A;  2KP6 A;  4QIW N;  1NG6 A;  5FKM A;  2RQP A;  1PP7 U;  1LKX A;  1S7E A;  2Y1D A;  4XK4 A;  2P5L C;  4KDP A;  2VL8 A;  3GME A;  5CLS A;  5B3S H;  4OIQ F;  3L00 A;  1LDK B;  4OIO F;  3FUJ A;  5ERI A;  3HM5 A;  5FRO A;  4ZQF A;  3SFI A;  1V4R A;  3BT9 A;  5M3M J;  2NVX J;  3C18 A;  1OYI A;  4J01 A;  4HBL A;  4A2U A;  4AM3 A;  5D4S A;  1SVM A;  2X1E A;  1S46 A;  4C2U A;  3CJT B;  3OYH A;  1AU7 A;  2QQA A;  4A6D A;  4HPQ A;  3MCZ A;  4LIU A;  5B5E C;  1S3J A;  1ZGW A;  1K7A A;  3GF2 A;  3JCU C;  2OCC H;  3FHZ A;  4UY8 I;  1R5G A;  3EYI A;  3A01 B;  2VQC A;  5JLW A;  3EBH A;  3SFZ A;  3A0B C;  1IXR C;  1MJ9 A;  3G1M A;  2Z5U A;  2DN0 A;  4LG3 A;  1ONN A;  4ZTF A;  4KP7 A;  4KMU X;  4DNC A;  2NXN B;  1OCR H;  1IC8 A;  2WC2 A;  2LK2 A;  3HC7 A;  5BOX A;  1T98 A;  1MSE C;  1QHG A;  1O7F A;  4MLO A;  3B2P A;  2K3F A;  2DBB A;  4WWC A;  2ECC A;  2ZXH A;  1U3E M;  3OMY A;  5D6F A;  1JTY A;  3E1S A;  1BOA A;  3GEZ A;  1RES A;  4IRH A;  1FSH A;  1HQC A;  1UHS A;  2NS8 A;  3MWM A;  2GQQ A;  4NC7 A;  3WGG A;  3B02 A;  1VQO I;  4ZJZ A;  1VTN C;  4V19 K;  4Q4E A;  2QQB A;  3F0C A;  4PCQ A;  3ZCO A;  1E3H A;  4I01 A;  1FOK A;  2QM3 A;  1WRJ A;  1FMW A;  1REP C;  1X4O A;  3CHP A;  2X9D A;  1MBE A;  3BR5 A;  2WZF A;  1I50 J;  3ZPL A;  4S0H B;  3FIW A;  1P2F A;  4B3A A;  2OUM A;  2R92 J;  2E7X A;  3W6K B;  2JA5 J;  4A12 A;  4JX6 A;  3ESW B;  2VBX A;  3B2X A;  2HGC A;  2LDU A;  1BBY A;  4B48 A;  3IH3 A;  4IRI A;  3FK6 A;  1HW2 A;  3PO3 J;  2XC7 A;  3P9I A;  1W5C C;  2KDO A;  1LE8 B;  2O8K A;  1SAX A;  4AID A;  4ARF A;  1ZGJ A;  2HOT A;  2CW8 A;  2JV7 A;  4G9Y A;  4BDY A;  2KZG A;  1FOY A;  1OCP A;  1TZL A;  3BTL A;  1KQ9 A;  2X4H A;  4PJJ A;  2Y0M A;  3DTE A;  5EEH A;  3K69 A;  4BE0 A;  2NVT J;  2M4G A;  1WCM J;  3IAM 2;  3ONQ A;  2P81 A;  2DPD A;  4XIC A;  1KQ0 A;  3FTU A;  2A07 F;  2HDD A;  3U9W A;  1D5Y A;  3HXL A;  4OU0 A;  2QVW A;  3JRE A;  1JE8 A;  2K3P A;  1Y8R B;  4HST A;  1JT0 A;  2LKS A;  2JRT A;  2MD5 A;  1FPQ A;  2OA4 A;  1GUU A;  5L3D A;  2QEN A;  1EJ9 A;  1MDM A;  5JC1 A;  4HX4 A;  3HKZ N;  4HF0 A;  2H6C A;  4R79 A;  1RI7 A;  3DTI A;  3K1M A;  2ELK A;  3FUM A;  5LRS A;  3FBI B;  2HU9 A;  3S93 A;  1ZG1 A;  2LY1 A;  4YIR X;  2XDV A;  1CQT A;  1FY7 A;  3HB9 A;  1EH8 A;  3A1Y A;  2Y2Z A;  2MAP A;  1XS9 A;  3HTU A;  1QZE A;  2VKV A;  5JR3 A;  3W6J B;  4L18 B;  1OR7 A;  1SFU A;  2NNY A;  3ZGK A;  4UB8 C;  2JT1 A;  4AVZ A;  3CCE I;  2DXI A;  2E19 A;  4EGZ A;  4YEJ A;  4A3M J;  5FRN A;  3VVL A;  4XLF A;  2QSG X;  2VE9 A;  4R1H A;  3KP5 A;  1ETY A;  1IN6 A;  5JVG F;  4QWQ A;  3TQN A;  2JA2 A;  3VWB A;  3FXQ A;  3A01 A;  1MSF C;  1ODD A;  3G1O A;  4WXD A;  2BY1 A;  5LD2 C;  3J7A Y;  5CVU A;  2YR2 A;  1T95 A;  2WAE A;  1H88 C;  1ETV A;  4P5O A;  3FTW A;  1MMA A;  1YJN I;  2MGQ A;  2F4O B;  2W24 A;  5M5Y J;  5FKK A;  5J4Y A;  1YFH A;  3DPT A;  1XMA A;  3DCF A;  2JQ7 A;  4RSY A;  4KNY A;  1BJA A;  1TNS A;  4LIT A;  1X1P A;  3KYC B;  3MFK A;  1N78 A;  4BH9 A;  2OD5 A;  3CP8 A;  1I5Z A;  2DA6 A;  4IO9 F;  1SFX A;  1X2N A;  3W3C A;  1YJW I;  2LY2 A;  2M7B A;  4XMY A;  1K79 A;  3EBG A;  5E3N A;  3P9C A;  2X1C A;  3BWG A;  4X2U A;  1P9Q C;  1UB9 A;  4ZW3 A;  3BG3 A;  2CJJ A;  3B7S A;  3S1N J;  3LSG A;  2BOL A;  3C2G A;  4X1E A;  2ACJ A;  1PVE A;  5HLT A;  1Z9C A;  2XKP A;  2DT6 A;  3WTT C;  5H6R A;  1LVA A;  2P7V B;  4MQV A;  4A69 C;  4EAT A;  5HOD A;  3CHO A;  4NUB A;  1ZRF A;  1L3L A;  1FTZ A;  4JBA A;  1N25 A;  3HOS A;  3CCU I;  3HSF A;  2L01 A;  4Y17 A;  1F4K A;  3FKJ A;  3CZE A;  5EF6 A;  2ZJQ F;  2HOA A;  2HS5 A;  4II3 A;  3ABL H;  5JFR A;  3RKY A;  3R0I A;  4G8X A;  2DOA A;  2ZBK A;  1VQ8 I;  3FXU A;  2IRF G;  3V7S A;  3IH2 A;  5A2Q K;  2JMW A;  5F0F A;  2STT A;  4NHJ A;  4XN1 A;  4U88 A;  1AHD P;  1E3O C;  4E7Z A;  5GTI C;  2IVM A;  1GV2 A;  1XG1 A;  1TT5 B;  3U1D A;  1JKP C;  1OYW A;  2XRN A;  1ZQ3 P;  1X1D A;  2CS3 A;  2BE5 F;  4QIR A;  4AR9 A;  4UUV A;  2LMD A;  4D0P A;  2A6H F;  3M07 A;  4Y6S A;  4MTE A;  4PJ0 C;  4Y33 A;  3ASO H;  1HDP A;  2YSR A;  3DF8 A;  3PQJ A;  5KCM A;  3FTV A;  3K10 A;  1D0Y A;  4Y3O A;  2XF7 A;  3LQQ A;  1FBS A;  3UR3 C;  1Z3Y A;  2CUJ A;  5CVR A;  4NQW B;  2R5Y B;  2I10 A;  3FMR A;  4GAE A;  4E7J A;  4L9V A;  2BVL A;  2VPR A;  2I8D A;  1RP3 A;  2FBH A;  3CUQ C;  4XLN F;  2VXD A;  2UUZ A;  3FK7 A;  1A6I A;  4PFP A;  4C9Y A;  5DM7 F;  2G0E A;  4FE4 A;  1SG7 A;  2CUE A;  2W4S A;  2RJI A;  1IDZ A;  1T0F C;  3SDG A;  4FLR A;  3DPL C;  5H2F C;  3R61 A;  3BR1 A;  4EJO A;  1AWC A;  2JD1 A;  1TNT A;  2Z16 A;  1S6L A;  3BZ6 A;  4HX8 A;  2A61 A;  1D1B A;  4DZP A;  5JMP A;  5GPA A;  3QWL A;  1ZAR A;  2EJR A;  2X6W A;  4XO5 A;  2LOO A;  3TP0 A;  3HGG A;  1ZTR A;  2IBD A;  4XKB A;  3AKZ A;  4Y6P A;  1WJ5 A;  3BJO A;  1TW2 A;  3BY6 A;  1K4T A;  4ZH4 F;  3BR3 A;  2W85 A;  2VJ8 A;  4YFX F;  1DP7 P;  1FP1 D;  4PJM A;  4ZQT A;  4UUS A;  1FC3 A;  2VN2 A;  4AIC A;  2L7K A;  2N8G A;  3UER A;  1HA8 A;  3HW2 A;  4M3B A;  5CKT A;  1NTC A;  1CGP A;  2V6E A;  3GTL J;  4LLN A;  1R0L A;  2HDW A;  5F08 A;  2IJL A;  1VI0 A;  3AFH A;  3OYL A;  5DYM A;  4DZJ A;  4U87 A;  2BY0 A;  2MA3 A;  3Q44 A;  2HNH A;  2ICW G;  4EVI A;  3IV5 A;  1ZAO A;  2QBY B;  5F1J A;  4BQN A;  1HXD A;  4ZYD A;  1JGS A;  2DFI A;  2EFN A;  3ZQ7 A;  3HRS A;  3V4G A;  5HDG A;  2R4G A;  2A5Y B;  2H09 A;  5JNL A;  1U8B A;  4ANJ A;  4MKT A;  4I0B A;  1DGR M;  4L9N A;  1KZH A;  1JUS A;  2R7D A;  1T6S A;  2XSD C;  2Z33 A;  4OOF A;  2ZXI A;  4IQ4 A;  4Z6Y A;  2E34 A;  5C4J J;  1JJ8 C;  5FD5 A;  5DEQ A;  1W0T A;  2XSJ C;  2XGE A;  4RGS A;  4M9S A;  2E71 A;  3NQO A;  2CSO A;  3CUO A;  3IWF A;  1K61 A;  3FXK A;  4IHT A;  3H3U A;  3HOW J;  4XKV A;  2L9R A;  3DKX A;  3ANM A;  3B7U X;  1UG2 A;  3KED A;  5DCF A;  5M5W J;  2A5W A;  2OZU A;  3HOY J;  3HSE A;  4KIS A;  5K7F A;  5FLX K;  1JI8 A;  1QO0 D;  1TQI A;  2LY9 A;  4N4N B;  1LUJ B;  4P1W A;  1W5T A;  6PAX A;  2DYR H;  3FM5 A;  4M73 A;  1EKE A;  4BY1 J;  2R7S A;  1IF1 A;  2L7M P;  4N9I A;  4ZQG A;  2M0M A;  3AG2 H;  3F8M A;  4ASN A;  3ANL A;  1YG2 A;  3RKW A;  5FJ8 J;  4HG2 A;  4ZQE A;  2VC1 A;  4MNU A;  4IHS A;  3FH7 A;  2PX9 A;  3PUB A;  1XGO A;  4M6X A;  2L9N A;  1B9N A;  3TGN A;  2HR3 A;  3CUQ A;  2FSW A;  4XMW A;  4KIB A;  1RC9 A;  5J1Y A;  4HLX A;  4XBF A;  1N75 A;  4Y52 J;  1V54 H;  2XF6 A;  3M1E A;  3FMQ A;  3B3B A;  1FIA A;  3FTZ A;  4RS8 A;  1HKT A;  2CO5 A;  3FTY A;  1RR7 A;  4E7K A;  3DBR B;  2RNG A;  1V5E A;  1R1T A;  3JRC A;  3C3W A;  1VQM I;  2VKD A;  2E5N A;  3ELK A;  3ZQF A;  4CIC A;  1DGW Y;  2DCE A;  2F6C A;  3CHS A;  5DD4 A;  4D5F A;  4XQF A;  4AWX B;  3F21 A;  2M9H A;  3IUO A;  4B09 A;  2HZT A;  3KP2 A;  4HLY A;  1SFK A;  4E7I A;  1R58 A;  4E4H A;  5HLH A;  2LNB A;  1O3Q A;  1SC5 A;  2CQ7 A;  1BI0 A;  3CMM A;  1KU9 A;  4RB0 A;  5IOY A;  3FDY A;  3AU9 A;  3REO A;  1DP3 A;  2K40 A;  2L3D A;  2DA1 A;  3D5L A;  3TDZ C;  3S1R J;  5E8I A;  1PUF A;  1D8K A;  1HW1 A;  2STW A;  1V5G A;  3JSO A;  2KT0 A;  1TQP A;  3H35 A;  3M4O J;  3TP3 A;  4DBQ A;  5LGN A;  3F23 A;  2DQR A;  1V55 H;  3DBH B;  3SHF A;  2QEX I;  4BAC A;  3P5J A;  2KL4 A;  1BOB A;  3D5S C;  4XKW A;  3HOV J;  2O7O A;  3IL2 A;  1ZRC A;  2JCY A;  4XNB A;  2OTL I;  3GXO A;  3V8J A;  3G6E I;  1FT9 A;  1Z7L A;  1B1B A;  2DFE A;  2CRG A;  5EEG A;  1DU6 A;  1K6Y A;  5EDN A;  2L2O A;  1I27 A;  5E8G A;  3B6A A;  5E18 F;  3DEE A;  2ME0 A;  5GAG J;  4Q4Z F;  4L9J A;  3Q9S A;  2W7N A;  1D1C A;  3KET A;  5B66 C;  1HST A;  2VB6 A;  1YRN A;  2XAU A;  4AYB A;  1A35 A;  1RUO A;  4O3M A;  2W82 A;  3OYE A;  2VPL A;  3V7C A;  2MSY A;  2ZME B;  1WH7 A;  4M3D A;  2DLL A;  2RN7 A;  4MEX F;  3FUK A;  5E20 A;  4OIN F;  1W7P D;  2JA8 J;  3LNQ A;  5LHH A;  3S17 J;  3ULQ B;  4IEJ A;  4KT6 A;  2XB0 X;  3H1C A;  4DPR A;  5FGM A;  1Q0Q A;  2HZD A;  3OOU A;  2M87 A;  2HDC A;  3TOA A;  3UKG A;  3L9F A;  3HUG A;  1IN8 A;  2CQK A;  1KYW A;  2E1M B;  4HV6 A;  3RZD J;  1J2X A;  3FHE A;  3ABK H;  1MND A;  3NRV A;  3SYT A;  1MKM A;  3K4M A;  4L0Z B;  3TO7 A;  2NVY J;  2X0L A;  1IGN A;  3S2W A;  2XF5 A;  1IJW C;  2XPU A;  2JD2 A;  3ZQL A;  5IP9 J;  3JRI A;  5LRR A;  2O8X A;  3JTG A;  2HOS A;  2D1H A;  2L9V A;  1BIA A;  3MZY A;  4ZYG A;  3RI4 A;  3WHC A;  4A3F J;  5J4V A;  4FQG A;  3Q0V A;  1F1Z A;  2EFP A;  1USS A;  2EH3 A;  3I56 I;  3WTX C;  3OIQ A;  3WG7 H;  4N4O B;  1AA7 A;  2GTQ A;  4HAM A;  4F91 B;  1Z0X A;  4WXH A;  1A04 A;  1X3W B;  2EIM H;  2EQR A;  2DTR A;  3H5N A;  2H6B A;  2NNN A;  3WE3 A;  4E7S A;  1NK3 P;  4LJZ F;  4PSW A;  5A2Q Z;  1TL8 A;  4F92 B;  4DGW B;  2VBZ A;  2K85 A;  5EGO B;  4BEH B;  4NDL A;  3HOU J;  4LK1 F;  2DYS H;  4HDV A;  1X3Z A;  1IXC A;  3T1B A;  4BBR J;  1BR1 A;  5E3L A;  3JRG A;  4KUM A;  2R7Z J;  4DBR A;  1JKQ C;  3JSZ A;  4C2M J;  2EZK A;  2AQF A;  4YEL A;  2OV7 A;  3LSK A;  3FKI J;  3QP5 A;  3MVP A;  4LIV A;  3TDU C;  3DKY A;  1VND A;  2DMQ A;  5F6F A;  4P96 A;  3BG6 A;  3CJQ B;  1OFC X;  2M5W A;  2Z9O A;  1UG0 A;  3CO7 C;  3Q0W A;  3L2C A;  4BHC A;  3F6V A;  2ISY A;  3EUH A;  2FOK A;  4Y6R A;  3HGY A;  5D4R A;  2RV8 A;  3DU5 A;  3KYD B;  1VQL I;  4XR6 A;  4BL0 B;  2ELJ A;  4GYI A;  5HS7 A;  3U21 A;  2F5D A;  3FXO A;  3HHH A;  3HBL A;  4PZJ A;  1X19 A;  4XSX F;  4CYC B;  1X1A A;  4JOM A;  3HDD A;  3J7A O;  3EQL F;  1L0O C;  1I1G A;  1YX5 A;  4B1R A;  2IGO A;  4I76 A;  4Q4I A;  5DD8 A;  1X2M A;  3AUA A;  2O3F A;  3OYK A;  4HEA 2;  4XL9 A;  3QYE A;  3RC8 A;  5IYB J;  1G3S A;  4ZTJ A;  1JTX A;  5D8K B;  4LK0 F;  3RPU A;  3V7R A;  4ZYE A;  3CME I;  5L3C A;  3KEY A;  2IS4 A;  2DO7 A;  2Y1C A;  2PL5 A;  4JX4 A;  3EUA A;  3HYI A;  2JWT A;  3K4N A;  4FTH A;  1O7L A;  3QU6 A;  2ESH A;  3T0Y A;  1FBQ A;  3KYL A;  3I9V 2;  2H8W A;  1ETW A;  3DTK A;  1UEL B;  3TO6 A;  2BBY A;  1ERD A;  2EIN H;  4BHB A;  1Y0N A;  3JT1 A;  3QPT A;  2V1X A;  5L3F A;  3GZ5 A;  1B8I B;  2QJ1 A;  2W48 A;  1YE9 A;  3O8G A;  1YRN B;  4LD5 A;  2LKP A;  4M6V A;  2HQN A;  1FOX A;  3FH5 A;  2R7Q A;  4XRM A;  3H5A A;  3CF5 F;  2AO9 A;  4NQW A;  1JXS A;  3ZI0 A;  1ETX A;  3IKV A;  3FXJ A;  2FE3 A;  3ASN H;  4ZN6 A;  1UZC A;  1GW6 A;  2G9W A;  2IEK A;  3D5R C;  2HQA A;  3FUI A;  1UHM A;  3F9K A;  3T5X A;  2V9V A;  3DKW A;  5E79 C;  4FX4 A;  2EA4 A;  3K4J A;  2QQ9 A;  3NWS A;  3AU8 A;  4ETS A;  2FA5 A;  2VLA A;  4A0X A;  1K78 B;  1JKO C;  2DT7 B;  4XN9 A;  3U2R A;  4ZX5 A;  1FP2 A;  5C44 J;  3PQK A;  1FYM A;  1V5F A;  2BY2 A;  3F6O A;  1YW9 A;  4FCA A;  5HNF A;  4PJL A;  2PQ8 A;  2R7R A;  2H8R A;  2K02 A;  3PIP F;  1VQK I;  2QSF X;  2MLG A;  1B72 B;  4B4C A;  5J40 A;  2ECB A;  2Y30 A;  2GA1 A;  4YRV A;  2W1O A;  4OAZ A;  5D5W B;  3SJM A;  3CCY A;  4HNU A;  2LLK A;  2OAZ A;  2CV0 A;  3HEF A;  2HYG D;  2PMZ A;  1ETK A;  5C3E J;  2VUM J;  3UEQ A;  2DT5 A;  3V42 A;  2FOW A;  2YX7 A;  3K9T A;  1IRG A;  1W1W E;  2E35 A;  2UXN A;  3RZO J;  5DLL A;  1TWC J;  3NEU A;  2R5Z A;  2CG4 A;  3DQV C;  3WE2 A;  4DYQ A;  2BYV E;  3RC3 A;  1VQ5 I;  4PVB A;  1YS7 A;  4U7B A;  5ILS A;  3OYA A;  1YO5 C;  2FMY A;  3R4K A;  4A6E A;  2DA2 A;  4MHG A;  1MW7 A;  4N9H A;  1U8R A;  2VC0 A;  1MH3 A;  1LB2 A;  4A3G J;  2Y0S A;  2QZ8 A;  4EMS A;  3FTX A;  2NAZ A;  1XC5 A;  1Z6T A;  1V3F A;  1B9M A;  2YU9 J;  2ZME C;  2WZG A;  2HYJ A;  5JO0 A;  5LGU A;  4FT8 A;  3OS2 A;  2WTE A;  3LSJ A;  2K7L A;  2W00 A;  2O0Y A;  4U0V A;  2CWE A;  3K1N A;  3CC2 I;  1A6Q A;  3S16 J;  3W2W A;  2FNA A;  4CZZ A;  3QOE A;  2MAO A;  4K5L A;  3U1K A;  4Y4R A;  2Y69 H;  3HPH A;  4MO7 A;  3FF5 A;  3FMS A;  2XKO A;  1Q0H A;  2CMP A;  3MN2 A;  3TO9 A;  2M2E A;  5E1Z B;  1J7K A;  4ZZL A;  3RSN A;  3EBI A;  3HOZ J;  3H3Z A;  1DDN A;  2Q2E A;  3G73 A;  1NK2 P;  1IRX A;  4GO1 A;  5F0H A;  3Q5F A;  4FAS D;  3FU0 A;  1IUF A;  2JN6 A;  3HJE A;  1SFE A;  2HVR A;  2V9K A;  2B63 J;  1PJR A;  4J00 A;  2ZNZ A;  2M7A A;  3LAP A;  2LG4 A;  1PUF B;  4B43 A;  1GXP A;  1S29 A;  2G7H A;  4Y15 A;  1VF9 A;  4X6A J;  1WWX A;  2IP2 A;  4XON A;  3RKQ A;  5LEK A;  3PFY A;  3CCL I;  1PUE E;  1MVY A;  3ZHY A;  1KYZ A;  2FEZ A;  1C0W A;  2LBF A;  2Y1F A;  2DTZ A;  1GDT A;  1B6A A;  1LDJ A;  1MBK A;  4Q47 A;  2AXL A;  1I3Q J;  1MIJ A;  3OYB A;  4HDU A;  2WAF A;  3DWL E;  3LA7 A;  1O57 A;  1DPU A;  3GFJ A;  3J80 Z;  3LSM A;  1ONP A;  5AEN A;  1KU2 A;  1QZZ A;  2ZSI B;  3CDH A;  3ISP A;  2FX0 A;  1R5H A;  4M3F A;  2ME6 A;  4MFE A;  1LNW A;  3LA3 A;  2QVO A;  1DQU A;  3WTW C;  3K2A A;  3BRO A;  3QYB A;  1FYK A;  1I6X A;  1XN7 A;  1LJ9 A;  2L4A A;  1QVT A;  3EET A;  2CGP A;  3M8E A;  1H89 C;  3B7T A;  1FBU A;  1WHU A;  2DAO A;  2MH2 A;  4JK1 X;  5FLX Z;  2EZI A;  2XB5 A;  4K5M A;  3VDX A;  2VOP A;  3J81 Z;  3F22 A;  4O5V A;  3OL4 A;  5ICG A;  4UNO A;  4FLS A;  4IKF A;  4A0Z A;  1FX7 A;  2GBY A;  1X1C A;  2CQQ A;  4AYB N;  2IAI A;  5E17 F;  5HS9 A;  1OQY A;  1FSE A;  2E2H J;  3H9J A;  2LTP A;  3PSI A;  3CZG A;  3OIO A;  1XGM A;  4CSW A;  4CCM A;  5JHU A;  1K83 J;  5EJC A;  2IW5 A;  3PSF A;  3ZRG A;  4DW6 A;  5J1R A;  2R5Y A;  3FH8 A;  1HOM A;  2R5Z B;  4OAY A;  3S14 J;  1STZ A;  3ZMV A;  2WY7 Q;  1YHQ I;  3CMY A;  2JVH A;  1IAW A;  2A69 F;  3RJP A;  3OYG A;  4PU2 A;  2HPI A;  3CXB A;  3BP8 A;  1SMY F;  3FM3 A;  2XPW A;  5J47 A;  5LGT A;  1MMG A;  3L2W A;  3EUH C;  4U0W A;  3R6S A;  5IOZ A;  4CCN A;  1J9I A;  1ENH A;  3E3V A;  3ML6 A;  3DXJ F;  4M3E A;  5CPR B;  4G12 A;  5IP7 J;  3GTG J;  1BI2 A;  3LOC A;  1H19 A;  1BI1 A;  4ENK A;  4J19 A;  2OPT A;  5TJJ A;  5J3L A;  2IPQ X;  1EH7 A;  4BQA A;  1POG A;  5C4X J;  3TKY A;  1O4X A;  4XKC A;  2VKH A;  2JUG A;  3L1P A;  4IHW A;  2MLK A;  3Q43 A;  2BV6 A;  2DFH A;  1QNT A;  3GWZ A;  4I98 B;  3ZN0 A;  4G6T B;  5DCM B;  1QBJ A;  1BW6 A;  3AAF A;  2E7W A;  1X3W A;  2CUZ A;  2XAJ A;  3TW7 A;  2K9Q A;  2P6T A;  4CCK A;  4L5E A;  1QU3 A;  2ZCW A;  2L4M A;  2LVS A;  4GGG A;  4MGR A;  4MQ9 F;  1Y56 A;  4II2 A;  4EM1 A;  3LL7 A;  3V8L A;  3CMA I;  3VVM A;  4EV0 A;  2D1V A;  5HS8 A;  4HOB A;  4LB6 B;  5JAZ A;  4L5I A;  3BCA A;  2LBF B;  2XAS A;  3LSP A;  5GPC A;  3CUQ B;  1S7O A;  2KRC A;  3E0J B;  4G6Q A;  2MC3 A;  1K6O A;  3KP4 A;  3FXM A;  1YI2 I;  2QLZ A;  4XOP A;  3GX4 X;  4HF2 A;  5EZH A;  3OR2 C;  4RAG A;  3E6D A;  1CF7 A;  2EWN A;  3FHN A;  2MBF A;  3KE2 A;  2Q0O A;  1R4N B;  3CDL A;  1XTA A;  4MS6 A;  2PJR B;  2RDP A;  3FIS A;  1TP4 A;  4BDZ A;  2VOD A;  1QZY A;  2CQN A;  5HOO A;  4IHV A;  3VSL A;  2J5P A;  1IN7 A;  4A3B J;  4QPE A;  2EBI A;  1HKQ A;  1KON A;  1MGT A;  3BJA A;  3FTS A;  1GVJ A;  3EYY A;  1BL0 A;  4HV5 A;  2EV6 A;  3BR2 A;  2CFX A;  3HIF A;  1CF7 B;  2WAD A;  2KRF A;  3HTS B;  4BY7 J;  3WU1 B;  3L2U A;  4XO4 A;  2F5V A;  4WK8 F;  1D0X A;  5HNH A;  4FCY A;  1JVS A;  2K86 A;  3M9A A;  5ILU A;  3TED A;  3DP7 A;  3GFM A;  3FUH A;  4BUP A;  2F48 A;  4YG2 F;  5AON A;  1QGP A;  1LQ1 A;  5CYV A;  4XND A;  4ZC3 A;  4HYE A;  1JHF A;  4RB1 A;  2RC4 A;  4KT5 C;  5K5Q A;  1GHC A;  4YFN F;  4K5P A;  1LFU P;  3P9K A;  1W7P A;  3ZQG A;  4I09 A;  1VQ6 I;  3C1D A;  3I4P A;  2CV2 A;  4RCV A;  4PDK A;  1QQI A;  1OCC H;  2M34 A;  2V79 A;  4NBQ A;  2FQ3 A;  2DOE A;  3CDI A;  1JJ6 C;  4EM2 A;  4X0G A;  2LR8 A;  1I1S A;  3S2H J;  4FET A;  4HSR A;  1X1B A;  2WV1 A;  3M1C A;  1E3P A;  3DEU A;  5BMZ A;  1IZ1 A;  2M3A A;  3ZOB A;  1GT0 C;  1UST A;  4HRI A;  4KMF A;  2XAG A;  3M8J A;  5EGO A;  3WQR A;  4M9Z A;  2IA2 A;  1XCV A;  3F3X A;  3CZK A;  4A3C J;  5BQT A;  2P8T A;  1LEA A;  2JPB A;  4F3Q A;  1H9G A;  3N05 A;  1IO2 A;  1SVL A;  2KQR A;  4MTD A;  4XN8 A;  2FQ4 A;  2ZME A;  4GYG A;  4MEY F;  5KVR A;  5LFA A;  4Q48 A;  1LFB A;  1FLI A;  5LEJ A;  4XOR A;  4RLQ A;  1R00 A;  2KIQ A;  2V4J C;  1T8I A;  2GWR A;  4NC6 A;  2XGD A;  3K1P A;  3IAS 2;  3KCC A;  3TBI A;  4YIF A;  5ILV A;  5IYC J;  2RGV A;  4S05 A;  3BJ6 A;  1IV6 A;  2IGK A;  3R60 A;  2E1C A;  5J1U A;  2M30 A;  3QOP A;  2EK5 A;  2QCO A;  1ZR4 A;  3K7A J;  1ETQ A;  2ZJP F;  1BW5 A;  1S5L C;  1SAN A;  3IKT A;  2K9M A;  2ZFW A;  1LFP A;  3A2K A;  5M5X J;  1ORK A;  3ERE D;  3WQQ A;  3BOQ A;  3JW4 A;  4XN3 A;  3PNY A;  2VIX A;  4A3K J;  3FWE A;  2M8G X;  1XD7 A;  2ID3 A;  2YPR A;  3LA2 A;  3I0T A;  3MEX A;  2GM4 A;  4OIP F;  3QRF F;  3S8P A;  3JRB A;  3ZMU A;  1DUX C;  4ZDL A;  1A5J A;  3I54 A;  5JHF A;  1B4A A;  3FUD A;  4XLE A;  4KYW A;  1QHH D;  3ZMT A;  4UV9 A;  4IHX A;  1O3T A;  2HXI A;  2RVC A;  1OIS A;  1Y39 A;  1JUM A;  3VYT B;  3WTS C;  2P0W A;  4PSX A;  3CCQ I;  1XGN A;  1E17 A;  1D1A A;  2NVU B;  2KMU A;  1OCO H;  1ETO A;  4PUS A;  3CLQ A;  4LMY A;  1A36 A;  1HS6 A;  5KK1 A;  2DMU A;  3WU0 A;  4PGG A;  3H3V K;  1HW5 A;  5DTD A;  1ZGA A;  1Y8Q B;  3C7J A;  3WOD F;  2R70 A;  4BU2 A;  1JT6 A;  5JBI A;  2ZNY A;  2QSH X;  4RLF A;  2VBW A;  3H36 A;  2P5V A;  2PMU A;  2DA7 A;  4HZF A;  5JLX A;  5IPA A;  3IC7 A;  4UV8 A;  4ZYA A;  2R7W A;  3D0S A;  2JVG A;  4Z2Y A;  2LP0 A;  1R7J A;  1RKW A;  1RNL A;  3ZMD A;  1N77 A;  4DIQ A;  4BE2 A;  1JGG A;  2MAB A;  2DI3 A;  4XRS A;  1E0E A;  1ZHF A;  3F8C A;  5KAF C;  5FFX A;  2A68 F;  4BAY A;  3CCM I;  1W0U A;  3F72 A;  3BZC A;  5BS6 A;  1E2X A;  3S1M J;  3PFI A;  1BC7 C;  4A03 A;  5DYF A;  4XMV A;  1ZG3 A;  2VE8 A;  5B1A H;  4RGX A;  1RZ4 A;  3IP4 B;  4F7Z A;  2R0Q C;  2XAQ A;  4OWR B;  1MJB A;  1XCB A;  4XID A;  1WH5 A;  2QQ8 A;  4PK4 A;  2QUF A;  4D7M A;  4XN2 A;  2GIV A;  4JX5 A;  2HTS A;  3M8F A;  2LF8 A;  1R22 A;  2HEO A;  1P6R A;  3GW2 A;  1EH6 A;  4XNF A;  4EJW A;  2DK5 A;  2NS7 A;  4PW4 A;  2DW4 A;  1WJF A;  2KLO A;  5TRD A;  1LVK A;  1LE8 A;  2R59 A;  1IV8 A;  1U5T A;  2UV1 A;  2DMT A;  2VQG A;  1YW7 A;  3ABT A;  3PL8 A;  4G7O F;  2ZO4 A;  4LG0 A;  3AG4 H;  1ULY A;  4C30 A;  2E1N A;  2WBM A;  1Q1H A;  1VFC A;  3KEO A;  3MZH A;  3ZQQ A;  2VXZ A;  1Z7U A;  3ZHX A;  2L9S A;  3SZP A;  3VYU B;  1EF4 A;  1I39 A;  3LWF A;  4I7H A;  4DJA A;  4CCJ A;  3WGI A;  3I4M J;  2WAQ N;  1SC7 A;  3PNT A;  1HKS A;  1SD6 A;  5H20 A;  5KNL A;  2WY8 Q;  4FLQ A;  4O6J A;  4OIR F;  4LOC A;  4KFC A;  4XLA A;  3CQZ J;  3MKZ A;  1MH4 A;  2B7E A;  3BCB A;  3QU3 A;  2VOO A;  4R8H A;  2D45 A;  1X4P A;  5F64 A;  4WXC A;  3PUF A;  4D9J A;  3L09 A;  3V8K A;  5GTH C;  3LQR A;  3EUK L;  2LD5 A;  4IOA F;  2LFB A;  4RAY A;  4J3B A;  1NG7 A;  4AUX A;  4BEH A;  4DQ2 A;  1T39 A;  2V1N A;  1D8J A;  3WTZ A;  2F5C A;  1Z6R A;  3DLA A;  3GUD A;  4AD9 A;  1Y0U A;  4QLC U;  2Y1G A;  3AL0 C;  4RBO A;  1ZRE A;  2BW3 B;  3VYR B;  2ZFU A;  1IW7 F;  3OV8 A;  3GTM J;  2DOF A;  3QPH A;  5GP9 A;  1ZN2 A;  2V1D A;  2K27 A;  3JAM K;  2MW8 A;  3CF2 A;  4CUG A;  1MBJ A;  4DYR A;  1MW2 A;  2I5U A;  2M1B A;  3BPV A;  4XMX A;  2CU7 A;  1Y1V J;  2MG4 A;  3OYN A;  2QF7 A;  1XPX A;  2IXS A;  4Y13 A;  2XHK A;  2PN6 A;  3KP6 A;  1SD5 A;  3KIO A;  4YFK F;  3B37 A;  5EYR A;  4KIT B;  2FJ1 A;  2HOE A;  4C3H J;  4IOC F;  3CJR B;  1P4W A;  2FBI A;  3ZN1 A;  4BXU A;  3HRM A;  1XDU A;  2P6S A;  1VQ7 I;  3DU6 A;  4RGU A;  2Q2E B;  4F93 B;  1APL C;  4R5T A;  4CCO A;  2Y75 A;  2HFH A;  5HDK A;  3WTV C;  3GYH X;  1VQP I;  2CFO A;  3KP7 A;  1YLF A;  4C3I J;  1PDN C;  2JA6 J;  5IP6 A;  5GAD J;  4HQE A;  3UNG C;  4B44 A;  4I6Z A;  2VJJ A;  3TW6 A;  4ZDO A;  3SEZ A;  4NB5 A;  2FU4 A;  2H1L A;  2NS0 A;  1WJD A;  3N4M A;  2AXT C;  4IJA A;  5AIP A;  1ZEL A;  3WTY C;  2O9L A;  4UVC A;  2EIK H;  4ZX4 A;  2XPY A;  5EEA A;  2FBK A;  1B8I A;  1NHA A;  3GTK J;  3T8R A;  2E2I J;  4YII A;  3MZ8 A;  2UXX A;  3HRT A;  2J5O A;  5L3G A;  2OCE A;  3Q9V A;  3ZXS A;  1DPR A;  1FOW A;  4A5N A;  2TRT A;  2ZKZ A;  2ZSH B;  1OR7 C;  2K9L A;  1D5V A;  4XMT A;  1J5Y A;  5LBQ A;  2VJ5 A;  3LST A;  4E7H A;  1LEB A;  2DA3 A;  3ZR8 X;  3S3M A;  2HYF A;  3GO5 A;  3RQ4 A;  1HBX G;  1UFM A;  5DDG A;  4M72 A;  3VPR A;  2MFZ A;  4R7L A;  2ZJR F;  3IRQ A;  3CCJ I;  4DYC A;  2QKL B;  3JSP A;  2KJC A;  1YIT I;  4M3G A;  1FYL A;  1SAU A;  3J7Y J;  1LPQ A;  1EV7 A;  4ZYH A;  2K9S A;  3H92 A;  2F5E A;  1J0R A;  1QRY A;  1YOV B;  4CGZ A;  2V7F A;  3VOD A;  1YS6 A;  5FLV A;  2W84 A;  5E1X A;  4G6D A;  3QYF A;  3BPX A;  2MD0 A;  3JR9 A;  2HI3 A;  2HVQ A;  2R7V A;  4W97 A;  3G1L A;  3CP2 A;  3RYR A;  1WQ2 A;  4HA8 A;  3LFK A;  1KA8 A;  3BTJ A;  3OR1 C;  2R7U A;  2L5Q A;  1ZRD A;  2V9P A;  3A14 A;  2HWV A;  9ANT A;  1G2H A;  1K78 A;  3I59 A;  5CVV A;  2FRH A;  1U6G A;  1MDM B;  3KX2 A;  4I2O A;  3E6M A;  2F4I A;  2XIG A;  1S72 I;  1QA6 A;  4L0Y B;  2JA7 J;  3I5U A;  4TV7 A;  3JAM Z;  5ICC A;  3L2Q A;  1FJL A;  1XMX A;  2ID6 A;  4WF2 A;  2X6X A;  4G7H F;  2R72 A;  2IS1 A;  3A02 A;  4UUS B;  3DFG A;  3I71 A;  5BPD A;  1ONV A;  2E5Z A;  3O2P E;  3BG7 A;  1TT0 A;  3Q3S A;  1U9O A;  1FNN A;  3BDD A;  1S7A A;  1SVO A;  4QTR A;  5H6Q A;  3KLN A;  5IY5 H;  4RAZ A;  1WI9 A;  4G94 A;  3KFW X;  4MFD A;  4XLH A;  2NVQ J;  3L7W A;  2XAH A;  3GTO J;  4BJT A;  3CHR A;  4LFU A;  4ZX3 A;  2P4W A;  3SDB A;  4KA4 A;  4ZW6 A;  1VZ0 A;  2H27 A;  3ECH A;  3EDP A;  3KPH A;  4UB6 C;  1YIJ I;  5FKO A;  4BXX J;  1IXS B;  1MW0 A;  5E3O A;  1FIP A;  2KPM A;  2GXG A;  4MIM A;  1MD0 A;  1XDS A;  5DCM A;  2YS9 A;  1H9T A;  2VJI A;  3FU5 A;  1FZP B;  2GOX B;  3WTU C;  2BHZ A;  2VJ4 A;  4A3E J;  1F43 A;  2NYX A;  1U0J A;  2O03 A;  4F52 A;  4LUP A;  3I3L A;  4KIF A;  2LKX A;  4BJ5 C;  1ZLK A;  2D5V A;  3VB2 A;  2XGX A;  1MBH A;  2E2J J;  2DPU A;  3PJR A;  3F8F A;  2XPZ A;  4FIS A;  1P7J A;  2ELH A;  2L0K A;  4C3J J;  5DUK A;  3J7Z I;  3HG9 A;  1TWH J;  3W2A A; 
#chains in the Genus database with same CATH homology
 3FH7 A;  3PUB A;  3Q43 A;  3C2H A;  2L9N A;  2WA0 A;  3FUL A;  2HPT A;  4G6T B;  4XN5 A;  2CH0 A;  4C2T A;  1X3W A;  2CUZ A;  1BR4 A;  2FUG 2;  4QUO A;  4XMW A;  4CCK A;  5TGT A;  1QU3 A;  1N75 A;  1Y56 A;  4II2 A;  2XF6 A;  3LL7 A;  3VVM A;  4IZZ A;  3K4B A;  4XO3 A;  4NNJ A;  2DQ6 A;  3B3B A;  2A7O A;  3MKY B;  3FTZ A;  3PNV A;  3K6G A;  5CQG A;  5JAZ A;  3FTY A;  4E7K A;  1W36 C;  3BCA A;  2LBF B;  2RNG A;  1V5E A;  2CW7 A;  4RM2 A;  4IX7 A;  2VKD A;  2E5N A;  2JSP A;  1WJC A;  2KRC A;  3HOT A;  2ZXG A;  3E0J B;  2DJI A;  2UWM A;  1ONO A;  3FUE A;  1DGW Y;  2DCE A;  2F6C A;  2M4K A;  2R7X A;  3K4K A;  3CHS A;  4XQF A;  4XOP A;  5HVQ C;  3IIE A;  3OR2 C;  2Q1Z B;  4XLC A;  1Q0L A;  2O5R A;  4BJ6 C;  3IUO A;  3FHN A;  3A4C A;  1S9H A;  4RVB A;  4ZW5 A;  4MS6 A;  2PJR B;  1SFK A;  3HL2 A;  4E7I A;  1YX3 A;  3S3N A;  4JQF A;  4E4H A;  4KJZ A;  4BDZ A;  5HOO A;  3VSL A;  1SC5 A;  4K5O A;  4QPE A;  4QME A;  4H4K C;  3CMM A;  3S3O A;  2VQH A;  1KON A;  3OS1 A;  3FDY A;  4GRI A;  3AU9 A;  4ZX6 A;  2BVM A;  3FTS A;  1DP3 A;  3CIA A;  2BW3 A;  3D5L A;  2WAD A;  1V5G A;  1T1S A;  1ZS2 A;  3H35 A;  4E7L A;  2NOJ B;  3L2U A;  3FUF A;  2F5V A;  4XO4 A;  1D0X A;  3GBG A;  5HNH A;  1JVS A;  4DBQ A;  4HNT A;  4BKX A;  3FUH A;  2HPO A;  3HKZ A;  4BUP A;  2PJR A;  4OOE A;  4BAC A;  4XND A;  4XKW A;  2KL4 A;  1BOB A;  2X51 A;  3D5S C;  4ZC3 A;  2JCY A;  4XMX A;  4XNB A;  2K5C A;  1Z7L A;  3EPZ A;  4K5P A;  4CXF A;  1K6Y A;  3CZL A;  2CV2 A;  4RCV A;  2L2O A;  3VYS B;  2CV1 A;  3OYF A;  2KP6 A;  3DEE A;  4L2L A;  4X0G A;  1NG6 A;  1D1C A;  2X6Y A;  2W7N A;  1WJB A;  1LKX A;  2VB6 A;  2XAU A;  4AYB A;  2Y1D A;  3CZ6 A;  2VL8 A;  4FET A;  4HSR A;  1LDK B;  4BGD A;  1X1B A;  2W82 A;  3NWT A;  3OYE A;  4RM3 A;  2VPL A;  3M1C A;  3FUJ A;  5FRO A;  1SQM A;  3SEQ A;  4ZQF A;  2M3A A;  4CH7 A;  3FUK A;  4B47 A;  4HRI A;  1MW3 A;  3M8J A;  3SZG A;  4CZC A;  1G8X A;  4KT6 A;  3WQR A;  4DPR A;  4J01 A;  2E60 A;  1Q0Q A;  2HZD A;  2X1E A;  3OOU A;  3L2R A;  4C2U A;  1S46 A;  3CZK A;  3OYH A;  1OLT A;  2E1M B;  4F3Q A;  4ZW8 A;  4HPQ A;  2HVS A;  3N05 A;  2KQR A;  4LIU A;  3FHE A;  4JND A;  4XN8 A;  1MND A;  3SYT A;  3K4M A;  5LFA A;  4XOR A;  4RLQ A;  2XF5 A;  2VQC A;  2LYC A;  2V4J C;  3EBH A;  2JD2 A;  4LG3 A;  1ONN A;  2JCV A;  3IAS 2;  4ZTF A;  4KP7 A;  4FLO A;  3TBI A;  2KHM A;  3FU3 A;  2IGK A;  3HC7 A;  3OIQ A;  1QHG A;  3MMY B;  1AA7 A;  4MLO A;  4N4O B;  2GTQ A;  3B2P A;  4F91 B;  3AL0 B;  4ZQE A;  2K9M A;  2QKM B;  1LFP A;  2LRE A;  2ZXH A;  3OMY A;  4ZDP A;  3A2K A;  3E1S A;  4E7S A;  3H5N A;  3WQQ A;  4NC7 A;  4XN3 A;  3PNY A;  2VIX A;  3FUN A;  4ZJZ A;  4Q4E A;  4PSW A;  3CHQ A;  3ZCO A;  4F92 B;  4DGW B;  3OIP A;  3S8P A;  4ZW7 A;  4BEH B;  1FMW A;  4ZDL A;  1X3Z A;  3H9Q A;  1X4O A;  5JHF A;  3CHP A;  1BR1 A;  3FUD A;  1JG9 A;  4E6K G;  3JSZ A;  4DBR A;  4XLE A;  2WZF A;  4YEL A;  2AQF A;  2OV7 A;  3LSK A;  1QHH D;  4LIV A;  3DKY A;  2OUM A;  3BG6 A;  3CJQ B;  3VYT B;  2P0W A;  4PSX A;  1R0K A;  4AR1 A;  1D1A A;  1UG0 A;  3OS0 A;  3B2X A;  4B48 A;  2KMU A;  4XN4 A;  4PUS A;  1HS6 A;  2XC7 A;  4Y6R A;  2KDO A;  3DU5 A;  1Y6I A;  2JD0 A;  4XR6 A;  2JCX A;  2PUS A;  4BL0 B;  2ELJ A;  2E1M C;  4BU2 A;  3U21 A;  4DOZ A;  2R70 A;  4QPO A;  2XQ0 A;  4AYS A;  1X19 A;  5JBI A;  1X1A A;  4JOM A;  4RLF A;  2EGH A;  4ARF A;  1YX5 A;  2CW8 A;  2JV7 A;  4BDY A;  2IGO A;  2IS2 A;  4Q4I A;  1TZL A;  4ZYA A;  3TMO A;  3AUA A;  3OYK A;  2OC6 A;  2R7W A;  4XMZ A;  3LFU A;  4HEA 2;  2JVG A;  4XL9 A;  4PJJ A;  1N77 A;  3QYE A;  3RC8 A;  3DTE A;  4AU7 A;  4DIQ A;  4BE2 A;  4ZTJ A;  2MAB A;  4BE0 A;  2M4G A;  1E0E A;  3IAM 2;  2IGM A;  3ONQ A;  3KEY A;  2IS4 A;  2Y1C A;  2PL5 A;  2C82 A;  3FTU A;  3U9W A;  3HXL A;  2QVW A;  3LSH A;  3OY9 A;  3EUA A;  3K4N A;  2K3P A;  3T0Y A;  4HST A;  3K70 C;  3KYL A;  5DYF A;  4A03 A;  3I9V 2;  4XMV A;  3DTK A;  2X85 A;  1UEL B;  1ERD A;  3IP4 B;  1UAA A;  1G59 A;  5JC1 A;  4OWR B;  3JT1 A;  4R79 A;  3DTI A;  3FUM A;  4PK4 A;  3VSK A;  5FRM A;  2QJ1 A;  1YE9 A;  3FBI B;  2HU9 A;  4XN2 A;  3S93 A;  4ZQH A;  2RQQ A;  3K4L A;  3FH5 A;  2LY1 A;  2XDV A;  2R7Q A;  2B61 A;  3H5A A;  4XNF A;  3A1Y A;  4NQW A;  2MAP A;  3ZI0 A;  4PW4 A;  3OL3 A;  3QOD A;  3K4C A;  2V26 A;  4ZN6 A;  3BLY A;  1GW6 A;  1WJF A;  2KLO A;  1OR7 A;  3D5R C;  1LVK A;  2HQA A;  2R59 A;  3FUI A;  3F9K A;  3ZGK A;  2UV1 A;  3K4J A;  2VQG A;  4AVZ A;  3PL8 A;  3NWS A;  2DXI A;  3AU8 A;  1MW1 A;  4YEJ A;  5FRN A;  3VVL A;  4XLF A;  4C30 A;  4AR8 A;  3RPU D;  2VLA A;  2WBM A;  2LC2 A;  2DT7 B;  4XN9 A;  4ZX5 A;  3ZQQ A;  2JA2 A;  1V5F A;  4BS9 A;  3VWB A;  1EA3 A;  4FCA A;  2VXZ A;  3J7A Y;  2LRD A;  5LD2 C;  2L9S A;  3ZHX A;  5HNF A;  4PJL A;  3VYU B;  2IS6 A;  2O7G A;  2R7R A;  1T95 A;  4DJA A;  2WAE A;  4CCJ A;  2MC4 A;  3QJX A;  4P5O A;  3FTW A;  3PNT A;  1MMA A;  5KNL A;  2WY8 Q;  4FLQ A;  3DPT A;  4RSY A;  4XLA A;  4YRV A;  2W1O A;  3BCB A;  4OAZ A;  3MKZ A;  4HNU A;  1X4P A;  2KRH A;  4LIT A;  2CV0 A;  4D9J A;  1N78 A;  2PMZ A;  1PYV A;  3CP8 A;  3UEQ A;  3EUK L;  3V42 A;  4XN7 A;  1R6R A;  3W3C A;  4J3B A;  2LY2 A;  1NG7 A;  4BEH A;  2WPG A;  2M7B A;  4XMY A;  2V1N A;  5DLL A;  3EBG A;  5JMW A;  3DLA A;  2GOM A;  1Z21 A;  2X1C A;  3DQV C;  1P9Q C;  4B3X A;  3AL0 C;  2Y1G A;  4X2U A;  3RAS A;  4ZW3 A;  2BW3 B;  3VYR B;  2ZFU A;  3B34 A;  3B7S A;  3RC3 A;  4XOT A;  3LSG A;  4PVB A;  2BOL A;  3C2G A;  4U7B A;  3OYA A;  2PGG A;  5HLT A;  3CF2 A;  4CUG A;  5CQE A;  1MW2 A;  1MW7 A;  2DT6 A;  3ZHZ A;  4EAT A;  3CHO A;  3OWT A;  4NUB A;  3H0D A;  3OYN A;  4IQJ A;  2IXS A;  4XN0 A;  2KZV A;  2Y0S A;  2Z2S B;  3HOS A;  3FTX A;  4R5X A;  3LMM A;  3W2V A;  4QPQ A;  3B37 A;  3FKJ A;  3CZE A;  4KIT B;  2WZG A;  5JO0 A;  3T8V A;  4II3 A;  3OS2 A;  2X1D A;  3CJR B;  3R0I A;  2W00 A;  2DOA A;  1BR2 A;  1FMV A;  4XNA A;  1J09 A;  3DU6 A;  2Q2E B;  3W2W A;  4F93 B;  4R5T A;  4CCO A;  3MKW B;  2HPM A;  3QOE A;  2MAO A;  4XN1 A;  3OYC A;  4K5L A;  4E7Z A;  2CFO A;  3OYJ A;  4Y4R A;  3HPH A;  1X1D A;  3B7R L;  2CS3 A;  3UNG C;  4B44 A;  5DUL A;  2VJJ A;  4ZDO A;  3SEZ A;  2C5Z A;  4QIR A;  4AR9 A;  4F55 A;  1WJD A;  4Y6S A;  3L2V A;  1Z3X A;  1ZEL A;  2R7T A;  4Y33 A;  1Q0H A;  2CMP A;  2FFL A;  5KCM A;  3FTV A;  3PUU A;  3H5R A;  2XPY A;  4ZX4 A;  3K10 A;  1D0Y A;  3RSN A;  4Y3O A;  1H3L A;  3EBI A;  3UCQ A;  2XF7 A;  3UR3 C;  1Z3Y A;  1IRX A;  2CUJ A;  4NQW B;  4FAS D;  3FU0 A;  3A06 A;  4GAE A;  4E7J A;  3ZXS A;  2BVL A;  2HVR A;  2I8D A;  1RP3 A;  2VXD A;  2V9K A;  2UUZ A;  4C9Y A;  4PFP A;  1PJR A;  3ANN A;  4J00 A;  2ZSH B;  1OR7 C;  2M7A A;  1SG7 A;  2K9L A;  2RJI A;  2W4S A;  4XMT A;  2LG4 A;  1T0F C;  4B43 A;  3RTR A;  4FLR A;  2VJ5 A;  4E7H A;  3DPL C;  3ZR8 X;  5KHD A;  3S3M A;  3HPG A;  3RQ4 A;  2JD1 A;  2Z16 A;  3OYD A;  4XON A;  3CES A;  2MFZ A;  4ITV A;  1D1B A;  1WJE A;  4R7L A;  3PFY A;  1MVY A;  5JMP A;  3H9G A;  3OYI A;  3ZHY A;  2QKL B;  2X6W A;  4XO5 A;  2LOO A;  2LBF A;  1SAU A;  2Y1F A;  3K70 D;  1MMN A;  4XKB A;  3AKZ A;  4Y6P A;  1GLN A;  2V7F A;  1WJ5 A;  4Y67 A;  3OYB A;  2WAF A;  3DWL E;  1G5A A;  3FU6 A;  3BC8 A;  4GAA A;  3LSM A;  5BPP A;  3RCO A;  1ONP A;  1MMD A;  2VJ8 A;  5AEN A;  2ZSI B;  3QYF A;  4PJM A;  4ZQT A;  2MD0 A;  1JGI A;  2HVQ A;  2R7V A;  4AIC A;  4QHP A;  2L7K A;  4CCL A;  3CP2 A;  2DQM A;  3UER A;  1HA8 A;  2A6T A;  1DQU A;  1WJA A;  4CA0 A;  5CKT A;  3OR1 C;  4NC8 A;  3QYB A;  4XMU A;  2V6E A;  2R7U A;  2L5Q A;  2Y1E A;  3A14 A;  1R0L A;  2HDW A;  2RRE A;  3OYM A;  3AFH A;  3OYL A;  4U87 A;  3B7T A;  1D0Z A;  3KX2 A;  3Q44 A;  2WAQ A;  2F4I A;  3LSI A;  4K5M A;  2HNH A;  3VDX A;  3L2Q A;  3WQS B;  4RMN A;  4BQN A;  2X6X A;  4PFO A;  2R72 A;  2IS1 A;  5FWQ A;  3G2B A;  3OL4 A;  3S32 A;  4FLS A;  3DPU A;  4IKF A;  2E5Z A;  2R4G A;  1X1C A;  3BG7 A;  5JNL A;  4ANJ A;  3HUG B;  1TT0 A;  4BE1 A;  1DGR M;  4MKT A;  4OOF A;  3H9J A;  2ZXI A;  4IQ4 A;  3PSI A;  3CZG A;  2R7O A;  1W36 D;  4CSW A;  1WFX A;  4CCM A;  3TL4 X;  4BQO A;  2XSJ C;  5EV7 A;  2VAS A;  2IGN A;  3PSF A;  4XLH A;  3ZRG A;  3FH8 A;  4BJT A;  3CHR A;  4ZX3 A;  2WB1 A;  4OAY A;  4D1Q A;  3SDB A;  4ZW6 A;  1VZ0 A;  2WY7 Q;  2JVH A;  4XKV A;  3DKX A;  3ANM A;  3B7U X;  4PU2 A;  3MD2 A;  3OYG A;  4PJN A;  1T1R A;  2HPI A;  1MW0 A;  4BXF A;  4BQQ A;  3KED A;  2A5W A;  2KPM A;  2LH9 A;  1MMG A;  1MNE A;  3L2W A;  3EUH C;  4KIS A;  1JI8 A;  2VJI A;  3FU5 A;  4CCN A;  2GOX B;  2VJ4 A;  4N4N B;  1U0J A;  2AQE A;  4XM3 A;  4P1W A;  4F52 A;  1K5H A;  5CPR B;  3I3L A;  4K5N A;  4LUP A;  2MYS A;  2Z1D A;  3FBN B;  1H19 A;  4BJ5 C;  2R7S A;  3PJR A;  4ZQG A;  2M0M A;  2VQL A;  4R5V A;  2XPZ A;  3ANL A;  4HG2 A;  2VKH A;  4XKC A;  2JUG A;  3HG9 A;  3W2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...