5HLTA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
278
structure length
278
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
total genus 94
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hltA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hltA02
5HNHA 2VLAA 5HNFA 5HLTA
chains in the Genus database with same CATH superfamily
2E1MB 3H1CA 4XRFA 1JUPA 2FNPA 3RPUD 2FA5A 2H94A 2LREA 1BOAA 1ACIA 5DV5A 3WHBA 1Z7LA 2IVMA 2ELJA 3FXLA 4PSWA 3UNGC 1TT0A 2A07F 1IXCA 1DP7P 2LKXA 2HYFA 4RLFA 4BJ6C 2EPFA 3LA3A 4QUOA 3WTTC 4B48A 1MW3A 4LUPA 4H4KC 1VF9A 4P55A 1KQ0A 4RB2C 3G1LA 4ZYGA 1W7PD 2GA1A 4Z6YA 1IDYA 1USTA 4FX4A 1RIOH 2Y2ZA 2O6GE 1W0TA 3TMOA 5HDKA 3ABMH 4CCLA 1T6SA 2BY2A 3AL0C 2XF6A 2KDZA 3WTZA 1VNDA 1VQ6I 2B9SA 2YU9J 2FUG2 1FOWA 1FP2A 3DU5A 3H36A 4P9FA 3RI4A 1JG9A 1YYVA 2F6CA 2PX9A 3WE3A 3LSHA 3FU3A 1GXPA 2D2WA 4HQMA 4XSZF 2DMTA 1XGOA 2BE5F 3CCSI 2K3PA 1IG7A 3B7TA 4OOEA 2EZHA 2RQPA 3DCFA 3CZLA 2XAJA 3C7JA 5GPCA 4CHUA 2CW0F 1BC7C 3K4LA 1K78A 3ZRGA 1MMAA 1SD4A 2UWMA 4UUSA 1SFXA 1H0MA 2H8WA 3H9QA 4M73A 2VOOA 5F1JA 5D5WB 1FBQA 2DT6A 3S3OA 1DGRM 3BJ6A 2R7RA 3LNQA 3P9CA 2KQRA 4FCAA 2HDWA 3FM3A 2IS6A 3B2PA 3QU6A 1WJBA 3FUNA 4MFDA 1JT0A 2XDVA 1W5TA 2DYRH 2MAOA 4E6KG 5F27A 3BTIA 3FXJA 3PNYA 1G5AA 1G8XA 2M9HA 2X48A 1I1SA 1BIBA 4D0PA 3GFLA 4P96A 2CQXA 4YG2F 5DUIA 1VQNI 3AU9A 1W5CC 1YTYA 1WRJA 3K1NA 1HKSA 2O61A 5F0CA 4RB1A 3F8BA 2H27A 1QO0D 2EIMH 3FMSA 3QYEA 1H19A 3HTUA 3IL2A 4BQAA 2VASA 3Q44A 2E1NA 4IKFA 1ITYA 1ON2A 3GW2A 4XN0A 3FUHA 2CWEA 2QVOA 2V7FA 3FTWA 3HL2A 4CCKA 2L3DA 1I6HJ 2ID6A 2JQ7A 2VXDA 2EFQA 5IT9K 4GDFA 4I0AA 2VE9A 1J2XA 4XN7A 4BJ5C 4KMUX 2RAEA 2CW8A 1WJDA 2K85A 4IOCF 1OCTC 2K7LA 1JGIA 1SVOA 1HC8A 3FTXA 2QQBA 4AR8A 4Q4ZF 1A6IA 2E1OA 5FKOA 3H3UA 3FHEA 2EIJH 5JC1A 5HLGA 4I2OA 2VUMJ 2EFNA 1TQMA 5L3BA 1BIAA 2XGCA 3BWGA 3KX2A 2FQ4A 5HODA 1YIJI 3S1NJ 9ANTA 2DBBA 2HQAA 5DCMA 5FB2A 4UXNA 4GAAA 4LB5A 3LQQA 3BR1A 2VQCA 3TOBA 4R5VA 1G3SA 1VQ4I 5HDNA 4BYYA 2NXNB 3R61A 3ZHZA 3ECOA 3CJTB 4LB6B 2HKXA 5IYBJ 2GOMA 2VJ4A 4IJAA 2R7TA 4JOMA 3DLAA 2GIZA 2M30A 2DFEA 4N9HA 2HQRA 1V55H 1BL0A 4ZYDA 3PSIA 4B1RA 3AG4H 1WWXA 3IH3A 1MGTA 4MEXF 4C2MJ 2WPGA 2NOJB 4AC0A 2LH9A 4XNAA 4MS6A 4XONA 1K83J 2UUZA 1NG6A 2EQRA 2L4AA 2W1OA 3BOQA 1X58A 3EUHC 3T8TA 1TWHJ 2MSYA 4MFEA 5E18F 3QODA 2XPZA 4BHPA 2DU9A 1R23A 3GTKJ 2K9LA 2E7XA 4JX4A 5EF6A 4U7DA 1V54H 2L9VA 4F91B 3DEEA 1U8RA 3J7AO 3KLOA 4I6ZA 1MW7A 3DEUA 1TL8A 5H6RA 4LLLA 5DS9A 3HTSB 4FHTA 1VQ8I 4L18B 1EH8A 2VI6A 3U9WA 3TO6A 4PVBA 1HSJA 3VWBA 4LOCA 1FWZA 4L0YB 3ECHA 3CHQA 2XROA 1ULYA 1Z9CA 2CYYA 2WZFA 1X19A 1Z0XA 3FU6A 5IT3A 3T1BA 1A04A 1XTAA 1NK3P 4V19K 1C0WA 3CF2A 1E17A 1R22A 2DA6A 3G6EI 5FWQA 4UVAA 1AWCA 4KDPA 1KU2A 2OZ6A 1B6AA 4IX7A 3D1NI 2HOSA 1MMGA 3LMMA 4A5MA 2E7WA 2KFDA 2DMPA 2X4HA 4HOBA 4ZZDA 5ICGA 3WQQA 1HDDC 3WTVC 5LGTA 3E6DA 1DPUA 2FE3A 3BG7A 4QIWN 2OU2A 3SEZA 2P6TA 2H6CA 5DYMA 5DM6F 2G0EA 3SDGA 4TV7A 1J75A 5F6FA 4GFBA 4ZQFA 4MGRA 1H9GA 4NHJA 4XO5A 2ICWG 2L9NA 2JZYA 4KICA 2E2HJ 1ZR4A 2EZLA 1JKRC 5BMZA 4U0WA 1FP1D 1LE8A 1JKPC 2HTJA 4IHXA 3GTOJ 1ZGAA 3E1SA 3HZJA 1HW1A 2CJJA 2JVGA 2K3FA 2KRFA 3BY6A 3L9FA 4U87A 4ZTFA 4Y33A 4YRVA 2L54A 1UFMA 2JPCA 4H0EA 2DQ6A 1KQ9A 4OU0A 4FLOA 2XF5A 2UXXA 3KEQA 5HS8A 5DULA 3L09A 4M6YA 4BS9A 1XB4A 2D45A 4A0ZA 3OOPA 1U5TA 4HX8A 1UHWA 3A0HC 4OIOF 4G6DA 3CCVI 3HOUJ 2M2EA 3ERED 3HSRA 3JRFA 2A5YB 2H6BA 4NNJA 4G6TB 2BV6A 3VYRB 1E0EA 5LEJA 3WGIA 4M9SA 4F52A 2FXAA 3Q9VA 1QGPA 4QLCU 5JHUA 5AIQA 5CVUA 4ZX5A 3GYHX 4PW4A 2X1DA 1E3PA 2QQ9A 3ZQCA 1R5GA 3VVMA 4AIKA 2ID3A 4ZN6A 1XN7A 4XLCA 3P7NA 4ZH4F 2LRDA 1SQMA 2RNGA 2VC0A 5EZGA 2CV1A 5GADJ 3OYFA 2TDXA 4A0YA 1VQLI 3QPTA 3M7GA 5E1XA 3RSNA 1W36D 1SC5A 5D5XB 4BQOA 4IXAA 3ZR8X 1MBKA 4XLAA 3TEDA 4HW0A 1QPIA 3CO6C 2HDDA 2EV5A 2M87A 1XSDA 3BQYA 4HYEA 1XCVA 4AD9A 3Q0WA 3Q0VA 3S15J 2OQRA 2W7NA 1TLHB 4JK1X 3FDYA 4DYQA 4AICA 3D5LA 2R7DA 2VBZA 1OYIA 1XGNA 1BA5A 4GYIA 2VJ8A 3RZDJ 4O6JA 2CUZA 2X85A 4XOTA 2EJRA 3E5XA 1SVLA 4IPAA 1W4MA 1TW2A 2LSOA 4CXFA 3OR2C 1DU0A 2IAIA 1X4OA 5TISC 4MHGA 3COAC 3REOA 4K5NA 4WCGA 5IP6A 1Y6IA 2M3AA 3I53A 4D7NA 1I1GA 2XF7A 1UB9A 3WTYC 5K7FA 1SD7A 4BL0B 2JCYA 4HNTA 2FMYA 2KJBA 1T1SA 2HS5A 2JV7A 4IF4A 2ZSHB 2GXAA 2ZXIA 3WTSC 5EZHA 3BP8A 1QPMA 2B7EA 3F9KA 2P6SA 3OYHA 2JD1A 3GFMA 2LBFB 3OS1A 2ISZA 5FLXZ 2HGCA 4DIQA 1UJ8A 4MLOA 2RGVA 1D0XA 1LVKA 4M9XA 2ZXWH 5K1YA 3J80K 3HOSA 1CF7A 4CYCB 3FBNB 4E7HA 2KRCA 3HSFA 5KK1A 4DQ2A 4E70A 4EJVA 2OJED 3VSLA 1IGNA 1MDMB 3ABLH 2WAQN 5B66C 4XN5A 4Y17A 3VPRA 3ZQ7A 4A3LJ 2ZMEA 2NNYA 1YQAA 3LSGA 3K2ZA 2NVXJ 4OIPF 5KAFC 2DYSH 1JHHA 2C6YA 2DLLA 1X2NA 1EH7A 4FETA 4XM3A 5IOYA 3HOWJ 3KYDB 3KEDA 4ZQHA 3KP3A 4AM3A 1DU6A 4II2A 1IRFA 2BW3B 4YFXF 1Q1HA 2LG4A 2M45A 2I10A 1RP3A 5J4VA 4V2FA 1ZARA 4EATA 1I50J 3N97A 2O8KA 2JCVA 1XGSA 1KU7A 2VC1A 3E6BA 3CCEI 1JVSA 4E7ZA 3ZMTA 2E5ZA 3JTGA 3DLLF 3HW2A 1O4XA 3TW7A 4K5OA 3SDBA 4CCNA 4GGGA 2AQFA 2ZB9A 3IWFA 4XLFA 2QQAA 4L9JA 1A35A 3WG9A 3HB9A 2CH0A 1K78B 3T8VA 4MNUA 2IW5A 2OBPA 1NH3A 2HPIA 3CZ6A 3HJEA 2V1NA 2ZNZA 3FMRA 1KU9A 2Q8KA 1SMYF 2EA2A 1OCCH 1ZLKA 2VL8A 3S1MJ 3DTIA 4AYSA 2YU3A 1GT0C 4M6VA 4IRIA 3OWTA 1QQIA 4XLHA 4AIDA 3HOTA 5JVTA 3F21A 2P4WA 3AKZA 5J1RA 4RBOA 3CDIA 2YSRA 2ZXJA 1JI8A 2FF4A 5H20A 1R6RA 4KIBA 4ENNA 1IF1A 2LKPA 2XVCA 2R5YA 2IA0A 1FTZA 4PJJA 4BAYA 3M07A 5L3FA 3K0LA 5FKNA 1BR2A 3K4NA 3ZQGA 5GAHJ 3HSEA 2BXZA 2UZKA 1K7AA 4E7IA 4OWRB 2L01A 3DU6A 3JAMK 2HPOA 4X1EA 1HXDA 2NNNA 2XSJC 4XQFA 2FQ3A 1D1CA 3L7WA 1V5GA 3H9JA 3ANMA 2W4SA 2R7QA 2XGEA 3OYKA 4KA4A 3HRTA 4LFUA 3FBIB 5EEHA 2I8DA 3K4CA 4RGUA 4Y3OA 2MC3A 3M9AA 2NS7A 3OL4A 5M5YJ 2NVQJ 1UG2A 2ME0A 1XGMA 1PP8F 2GWRA 4KP7A 4NC8A 2ECBA 3IKTA 1JE8A 3SHFA 4XMXA 4ZX4A 2XV4S 2ZKZA 1S3JA 2MA3A 4BDZA 5FKKA 3HOYJ 2X6YA 2BW3A 1E3HA 4WXCA 3L2UA 1STZA 3DPUA 1Z3YA 2KP6A 3JSZA 4RLQA 3J81Z 1MW1A 1BW5A 1T0FA 2JK3A 5LBQA 1DGWY 2AO9A 5E1ZB 2IA1A 4MIMA 5HS9A 2R0QC 2A7OA 1TQIA 1H88C 3A03A 4E4HA 2JRTA 4DNCA 4XMUA 1GLNA 3ELKA 1MDMA 3DBLB 1KYWA 4DBRA 3FH5A 1U78A 2JA8J 3LSPA 1LEBA 4XR6A 1QZEA 3OYLA 2LP0A 4W1UA 1RI7A 4CYCA 3OIQA 1EH6A 2ISYA 2QKMB 3CLQA 2WV0A 1LJ9A 4IHSA 2DTRA 1ZQ3P 2LOOA 1I39A 4IQ4A 3PJRA 1O3SA 1X1AA 3BR3A 2Y9YA 1FJLA 4QSHA 2Y69H 1O3TA 3GX4X 3ZGKA 1MMDA 1OQYA 1DUXC 1BJAA 3CC4I 2IXSA 1ZRDA 3FXUA 5HNHA 1GVDA 2Y1GA 3WGGA 2FEZA 2Y0SA 3EPZA 1IN7A 4OAZA 2R7UA 3LOCA 4UHTA 4XLPF 2FX0A 1V3FA 3ULQB 1MIJA 3SEQA 3HYIA 2XIGA 3GLXA 4XO4A 3PFIA 4AVZA 2XPUA 2KZVA 1LDDA 3VYSB 2DODA 4F55A 3HOXJ 3NEUA 4ZX3A 1RUOA 3LA7A 2GLOA 1TNTA 5JI6A 2OZUA 1YW9A 2VQGA 1MD0A 2MBFA 3HBLA 4PFPA 4BH9A 1ZREA 5C4JJ 5K5RA 3MEXA 2FNAA 2X9DA 4HF2A 3R0JA 1IRGA 2Z3YA 4EGZA 2E71A 3K4JA 4EQQA 4RSYA 1LFPA 3BQZA 5CQGA 1D5VA 4IO9F 4RA2A 3ZP5A 3UEQA 1YG2A 3UCQA 3WQSB 2JUCA 3MKYB 3FTUA 3GFJA 1TW3A 5CVVA 3C2GA 4ZW5A 1MBEA 1S7OA 3I4PA 1FY7A 2DQRA 3K1MA 3QQAA 3JTHA 1CGPA 3ONQA 1JXSA 2VE8A 3AG2H 1MMNA 3MZYA 2CFOA 1ONPA 2CQQA 1ZG1A 4A6DA 2AXTC 1ZN2A 3UKGA 3P5JA 4ZDLA 1KQ8A 4WF2A 4HG2A 3I4NJ 3E5UA 1ONNA 4R5TA 2Q0OA 4QIRA 4ZW8A 4OINF 3L1PA 1YX5A 1HCRA 1DQUA 3F6VA 1MVYA 3L2WA 3VSKA 2ZFUA 2L4MA 3H5NA 1BI3A 1ODDA 4BU2A 4LK0F 5HS7A 5E1WA 2PG4A 2STTA 2RNJA 4XSXF 3HPHA 1SC7A 5HVQC 1B9MA 4HX4A 3CHPA 2M1BA 4J00A 1IJWC 3VEPA 1MSFC 3F23A 1HF0A 1EKEA 1X3WA 1U9NA 3ZMUA 2R72A 4ZW3A 2MD0A 4A3IJ 1TQPA 5LD2C 3S32A 2M8EA 2IEKA 2HKOA 4HZFA 1Z1DA 2BBYA 1APLC 1S7EA 1OCPA 2VBYA 2QUFA 4ZZLA 1QVUA 4XMVA 1KYZA 3OYGA 3BLYA 2LYCA 2KRHA 4QPEA 4C30A 3I56I 3QOEA 4L5JA 3LWFA 4BE2A 2CU7A 1Y1WJ 2HZDA 3K4KA 1SEUA 3DXJF 2EZIA 3J7ZI 4ESJA 4M3BA 4XMYA 3WODF 3C18A 5E17F 4S0HB 5E3LA 4A3JJ 1R00A 4M3FA 3O2PE 2DN0A 2LFBA 5BQTA 3FUKA 4ZW6A 4BEHB 1D0YA 4FE7A 3TL4X 2HYJA 4FE4A 4A3FJ 3TQNA 1SFEA 3OOUA 1Z77A 4UVBA 5D6FA 4GYGA 4NQWB 5AIPA 4OMZA 1WGXA 4A0XA 4KN7X 4ZJZA 4ZYAA 3MN2A 3ANLA 4BEHA 1USSA 1IRXA 1Z21A 4AWXB 2BVMA 2A6TA 5EV7A 2NVTJ 3H3ZA 2DDAA 2DOFA 1DP3A 2O8XA 3FK6A 1JHFA 1WPKA 3H3VK 2HOAA 5CVRA 2ZJQF 4XMTA 5B5EC 3FISA 1FOKA 1Q1VA 2KIUA 4RAZA 2X1EA 5FD6A 2H8RA 1GHCA 1MBJA 1WVRA 4YIRX 2QWWA 3MKLA 2OAZA 1T95A 2HI3A 1QVTA 2KL4A 3H35A 2GOXB 2L2OA 4F93B 3JRDA 3SFZA 4UUTA 4CCMA 4G6QA 4BUPA 3MKZA 2R59A 1XSVA 3QYBA 5EJCA 1IXSB 1IRZA 1U5TC 2FRHA 1Y39A 3EBIA 3Q0UA 2RVCA 4UUVA 3R4KA 2J5OA 3EETA 4YEJA 2XB5A 5HDGA 1ZAOA 1S29A 3NARA 3FUIA 2ACJA 3VYTB 2COBA 2CRGA 3K4MA 3W6VA 4S05A 1AU7A 4K5LA 4IHTA 1K79A 4G7HF 3QPHA 2KIQA 4NBQA 1X2MA 3LAPA 3G2BA 5LFAA 5FLXK 1ZELA 3M8EA 4F3QA 2LK2A 1D1AA 4I98B 1MBGA 2Y1CA 3BCAA 3BG3A 2STWA 3DTEA 3EDPA 4OIRF 4IEJA 4FTHA 2Y1FA 1FYLA 3BR0A 1R4MB 5FD5A 3A14A 4CYDA 1QZZA 2HVRA 2O3FA 3RKQA 3K9TA 5IYDJ 2PMHA 5AENA 1H3LA 2ELKA 4UV9A 4XIDA 4A3EJ 3CHSA 2F4MB 4MKTA 3BROA 1MJ9A 1W1WE 2G9WA 2HQ5A 2DMUA 2DMNA 4R8HA 4KIGA 5JBIA 3A2KA 2KZGA 3ZQFA 3RQIA 1S6LA 1Y8RB 3EUKL 4HA8A 1X1DA 2NOGA 2DPDA 2L7KA 5FKMA 2DXIA 3AUAA 3P9IA 1UCRA 5LHIA 2XAGA 2YS9A 3SYTA 1PUEE 4R5XA 1OYYA 2XRNA 2Y30A 3FTZA 2XC7A 1IUFA 1I6XA 2VODA 1YS7A 2EA4A 3KE2A 1WQ2A 2PI0A 1Z3XA 3V7SA 2NAZA 2QBYB 2MW8A 5DD8A 2VJ5A 4PJ0C 1TTYA 2P81A 3ABKH 4YELA 3A0BC 4ZYEA 1M1EB 2MLGA 2P0WA 4KT6A 2X6WA 3B73A 4PJNA 3TDUC 2VKHA 4ENKA 3QRFF 4RCVA 3U21A 1X4PA 1R5HA 2PEXA 3FTYA 3G73A 2IT0A 4YIFA 4A3BJ 2Q1ZB 4ITVA 1ZS2A 3U1DA 1Z91A 2M8GX 3ZN1A 3DBHB 2YUSA 3G71I 1HA8A 1YRNB 2WV1A 1BBYA 3EBGA 3FF5A 1OR7A 4ANJA 2VT3A 1UAAA 1MW2A 1X1PA 2GQQA 1PJRA 1R0LA 2KMUA 2EFWA 1E2XA 1VQOI 4N9IA 2CQKA 2P5KA 3M1EA 5B1AH 3GWZA 2DDBA 5K5QA 1AHDP 3PO2J 3LSRA 4A12A 1MJAA 4XBFA 3CD6I 4YFKF 3DPLC 4FQGA 4IVNA 2R7VA 2Y48A 1N78A 1IZ1A 2CUJA 3BJOA 3ZCOA 1ETXA 1IN6A 3CZEA 1JUMA 3CTAA 1G59A 1GDTA 4XN4A 1FOXA 1YJNI 4EVIA 2BHYA 2HOTA 1ETVA 2LTPA 4ZDPA 2BGCA 2YX4A 4M3GA 2HFHA 2N8GA 4PZJA 2KIFA 1H8AC 5HLTA 1AA7A 1Z05A 2W48A 4IHVA 3I9V2 3MQ0A 1I3QJ 4JX5A 4D7MA 1RR8C 1VQ9I 3RZOJ 2R7SA 3DKYA 5B1BH 1RPWA 1I27A 2HQNA 4BNCA 1QRYA 1FYMA 3HUGB 1I3AA 3IAS2 5GP9A 4U7BA 3KZIC 3PIOF 5EG0B 3J80Z 2EK5A 1JUSA 1R49A 5LRRA 4EMSA 4M74A 1XDUA 2OPTA 1CF7B 2ELHA 3JRGA 3CHRA 4NC6A 3Q43A 2L7ZA 3CMEI 3QOPA 2W57A 1BJZA 3SZGA 3I0TA 2QZ8A 1MJBA 2VN2A 1KU3A 4A3CJ 4A3KJ 3HKZA 1O57A 5J47A 1HQCA 2K9QA 3E7LA 2WB1A 3PUBA 1RKTA 2QKLB 4PK4A 2O0YA 4XL9A 3AG1H 2HPTA 4FASD 1R1TA 2R4GA 2P5LC 2EINH 4XO3A 3CF5F 1U6GA 2ADUA 2EV6A 3LSKA 2K86A 5ILVA 3EYIA 3LSMA 2A61A 4DPRA 4B44A 2EB7A 1J9IA 5AONA 3KYLA 5IT9Z 1A5JA 1F4KA 4Y7NJ 2V4JC 1J09A 4Y6PA 3KP4A 3K6GA 4ZW7A 4BE1A 1SAXA 1YE9A 4EJOA 1A6QA 3ROUA 4Y6SA 2F5VA 3E0JB 2EBIA 3LSIA 1FBUA 5KVRA 3DP7A 4XKCA 2MAPA 5BOXA 3B02A 1JT6A 3W3CA 4DW6A 5CLSA 2R7XA 1BC8C 4UY8I 3E6MA 1R71A 5LGNA 1JJ8C 2W24A 2JSPA 5DCMB 1WJEA 5ICEA 3CC7I 1FMWA 1HW5A 4RGRA 3TO9A 2OTLI 3QP5A 3D0SA 4BXFA 1R0KA 2V26A 2Z2SB 3J7AY 5D6EA 1P2FA 2CQNA 4Q4EA 3U2RA 3ZQQA 4FX0A 3CIAA 2KHMA 3CO7C 2QLZA 2WB1N 2A05A 5GPAA 3LA2A 1RESA 1FOYA 3TKYA 2FFLA 1QA6A 1T0FC 4ABZA 1FBSA 4PJLA 4BDYA 4U0YA 5E3NA 3ZPLA 1Z7UA 1LFUP 5EYRA 1P4WA 1XSXA 1S8NA 4NDLA 3RKXA 4E7LA 4KFCA 5L3EA 2X0LA 2ZMEB 1L0OC 3I59A 2H1KA 1VQ7I 1FT9A 5IP7J 3CJNA 2LY9A 4LJZF 4ZQEA 2EGHA 3DPTA 4ZQTA 2NS0A 5J40A 2IGOA 3DV8A 3LFUA 1R36A 2P8TA 1I5ZA 4ZX6A 1ZGJA 1LQ1A 1SFKA 3RYPA 3FIWA 4UB8C 4XKWA 4EJTA 2NYXA 3V8LA 2BYVE 4AR9A 2QENA 4EEFG 5F0FA 2M7AA 4EM0B 2VPLA 3BR6A 1GXQA 1U5TB 1Y8QB 3RJPA 3OL3A 5JLXA 3JT1A 2CGPA 3FUJA 2L9RA 3PSFA 3H0DA 3FTVA 3QU3A 2O5RA 2JPBA 2JWTA 3OR1C 1TNSA 4LG0A 4ON0A 3FHNA 3IWZA 1D8JA 3CMMA 1LPQA 2WTEA 3GBGA 4LITA 3LQRA 3DQVC 2PL5A 2IGNA 5JNLA 1WJAA 2JN6A 4KJZA 2EIKH 2G7HA 1CQTA 1GV5A 3SZPA 5KCMA 3F3XA 1EF4A 1WI9A 2BHZA 2F5DA 3ZHYA 1OFCX 3GTMJ 4C3JJ 4JYKA 4R7LA 1ONOA 5A2QZ 3WE2A 2Z1DA 1V5FA 2GZWA 4ASNA 1YOVB 2WAQA 4A03A 1JGGA 2F2EA 1HW2A 4WWCA 4AYBA 3SXYA 4D5CA 5E8GA 3W6JB 2XPYA 5JLWA 5LRSA 1U2WA 3RKWA 1MMSA 3OYMA 2RREA 2LY1A 4CUGA 2DFHA 2WY8Q 2BY3A 2K27A 2ZMEC 3FXMA 5J8CA 4E7JA 3WGHA 4X6AJ 1U9OA 2EWNA 2ESNA 5CPRB 2OCEA 2ESHA 5BPIA 2Z5UA 2WA0A 1RC9A 3EUHA 4U0VA 3CDLA 5FRMA 3CZKA 3F72A 2IP2A 2XB0X 3WHCA 4GO1A 3PQKA 4GAEA 4G94A 1XS9A 3MZ8A 4DYCA 2B63J 2M0MA 5ILSA 2KJCA 3F8CA 3KETA 2HTSA 1XC5A 4QWQA 4U88A 5FFZA 2NVYJ 3R60A 5CVJA 3JAMZ 4XNDA 1XPXA 2PLYA 1X3WB 1GVJA 3R0IA 1FYKA 3CMAI 1JJ6C 1UZCA 3FZVA 1WH5A 5JMPA 4ZQGA 4XN1A 1U8BA 1X1BA 1B8IA 2LR8A 1R1VA 3IH2A 2WADA 3J7YJ 4ZDOA 3CUOA 4Q4IA 1D0ZA 1Q0HA 4PGGA 4LIVA 2JA7J 2PJPA 4OOIA 1SVMA 2WAFA 2GM4A 4RAGA 1P92A 2ZJ2A 1K4TA 2DJNA 1S46A 4M72A 3MKWB 1Y56A 3AAFA 5EGOB 3B2XA 2E5NA 3RKYA 1U0JA 4HV6A 1LFBA 3M1CA 4XLEA 5D8KB 2KT0A 3JRCA 1RETA 4ETSA 3CCJI 2FJ1A 3V4GA 2JUGA 1N75A 2XAQA 3TBIA 5F08A 5J6XA 3WQRA 3CDHA 4LLNA 3OYDA 2VB6A 4XICA 4K5MA 1G3TA 4OAYA 2IS4A 4NC7A 4AVPA 1P9QC 3OY9A 4JNDA 3B6AA 2PN6A 4PGHA 2CSOA 1FSEA 3DEWA 3HRSA 1VZ0A 3PIPF 2LF8A 4CICA 4D5FA 2J5PA 3CJRB 4HAMA 4S04A 1YRNA 4M6XA 3BCBA 3IH4A 1W7PA 5EEGA 2ZBKA 2C5ZA 3OYIA 2X51A 3OYJA 4MEYF 2HU9A 3VODA 4CSWA 3JRIA 3PFYA 2V1DA 5J4YA 3PNVA 1J0RA 4KNYA 3EQLF 4G12A 5CYVA 4C2UA 3GTQJ 3ZMVA 2D5VA 3TP0A 1RZ4A 2K9MA 1D5YA 3W2AA 3H9GA 4ESFA 5FJ8J 5L3GA 3IC7A 1VTNC 5ED4A 5CQEA 3B7UX 2P7CB 3I71A 3FM5A 4CDGA 1LDJA 5D5VB 3S93A 1LEAA 4IHYA 5GAEJ 3ZQIA 1O3QA 4OOFA 3GTLJ 1RUNA 3I59B 2DOEA 4BJTA 1IO2A 4QPOA 2F5EA 1WJFA 1IN4A 2QJ1A 2W82A 3MAJA 4A3MJ 1IV8A 2PQ8A 4KN4X 4B3AA 2XAFA 3B7RL 3W2VA 3D5SC 1ERDA 4GCVA 3TDZC 3OIOA 2OA4A 1AKHA 3H5AA 1RKWA 1PP7U 2HR3A 4GRIA 4ZYHA 4XLNF 5E8IA 3B3BA 3L2VA 4PJMA 3QWLA 2ETHA 1YW7A 2CUFA 2C82A 3KZYA 2DK5A 2W84A 1ONVA 1W5SA 2VOPA 2DW4A 2OF7A 3FKJA 2R3SA 2KKOA 2OQGA 4Y13A 2ECCA 4RB0A 2L7MP 4Q47A 3I5UA 1K4SA 3E5QA 1TC3C 2JSCA 1JTXA 3W2WA 3ZMDA 1YHQI 4XN9A 2DK8A 3BTJA 3OMYA 4B43A 4L0ZB 1FSHA 4AUXA 3CUQC 2V9KA 2WBMA 2E2IJ 3G3ZA 3FK7A 3CHOA 3ZHXA 2F4OB 3JSPA 1TWGJ 2WY7Q 2MH2A 1YLFA 4II3A 1OCZH 1Y0UA 3E3VA 4N4NB 1FC3A 2ZSIB 2PJRA 2R7ZJ 2IBDA 5CVIA 3DKWA 3K70C 1IUYA 5LGUA 3CCUI 1L3LA 1AKHB 1QU3A 2V6EA 1O7FA 2M4KA 3VB2A 3WU2C 2QSGX 2IS2A 3FTSA 3BG5A 3DFGA 2VKVA 1VQKI 4PDKA 3Q9SA 2GIVA 2UV1A 4I99C 1JKQC 3B7SA 3F8NA 1EV7A 1P7IA 3H92A 1GUUA 2XPVA 3KFWX 4HLYA 2HYGD 5J1UA 5CKTA 4EGYA 1UG0A 2FOWA 5F04A 2VJJA 2F5CA 1MNDA 3WU1B 3BZ6A 1ETQA 2WC2A 3IAM2 5EG0A 3OSGA 3BJAA 1GV2A 2PUSA 1UHSA 2GBYA 3OYNA 4FLQA 4P1WA 1N77A 2QYOA 5JR3A 4HV5A 4MQ9F 1ZRFA 2DT5A 3ZOBA 3LSTA 1YJWI 2DPUA 2XAHA 4HSRA 3MVPA 3FUMA 5FFXA 5GTHC 2XSDC 1MW0A 5FROA 1H89C 3GLLA 5M5XJ 4WXHA 5HNFA 2QA4I 3TOAA 3QYFA 5F64A 2A6EF 1FTTA 4L9VA 2VIXA 3I54A 5BNGA 1LE8B 5E20A 4HNUA 3HG9A 3KP7A 4KMFA 1ZTRA 2RN7A 4XNBA 3JRHA 4UUSB 3NRVA 3B34A 4HF0A 3H0GJ 2OTJI 5BS6A 2HEOA 5BPPA 3C2BA 3OYCA 1YO5C 1E3OC 5J8FA 2M4GA 1J59A 2RDPA 3R6SA 3IUOA 1ZLJA 3GXOA 1BW6A 1ETWA 3JSOA 1ETYA 3LL7A 3I55I 2QVWA 3EUAA 4QHPA 1F43A 4HDVA 5H2FC 5DLLA 4HRIA 4RGXA 4KITB 3FMQA 2DA4A 2R5YB 2E34A 4HLXA 4RAYA 2JA5J 2P7VB 1P7JA 1MNMC 3SFIA 3M8FA 1WHUA 1JKOC 1RNLA 4O5VA 3NQOA 4C2TA 1ZR2A 1ZRCA 3CCLI 4IQJA 1K5HA 4L5EA 2DQMA 5JAZA 1BM9A 1BI2A 1ETKA 2FOKA 4ZTJA 1W36C 4DZPA 4ENMA 4RGSA 2MLKA 3FKIJ 2R7OA 1G2HA 3KLNA 4JX6A 3RYRA 4I76A 4I7HA 2CG4A 4W97A 2V1XA 2RQQA 1YX3A 4G9YA 5KHDA 2PMZN 2LBFA 2MD5A 2RKHA 3FUEA 4B3XA 3FXQA 2M5WA 1SFOJ 2PGGA 2L7FP 4I01A 2Z16A 2KDOA 3DKXA 4HEA2 1ENHA 2R5ZA 2K5CA 2LF7A 2VT2A 3FXKA 4JP0A 3IIEA 3C1DA 3PM1A 3SJMA 1XD7A 4KISA 3O3KA 5IOZA 1DDNA 3ASNH 3O8GA 3L2RA 4Q48A 2IPQX 4HF1A 2HXIA 3OSFA 3PO3J 5TGTA 4QPQA 1LB2A 1P4XA 3S3MA 2XGDA 1V4RA 3WTXC 2LC2A 3F22A 2V1UA 2M34A 3H5RA 2MH9A 3WTUC 3TGNA 3ZN0A 1XX5A 4YIIA 1B72B 2JA2A 3HKZN 1PDNC 4WXDA 2GXGA 3IHUA 1EJ9A 2TCTA 3CCYA 5DEQA 5C4XJ 3WU0A 3BTLA 3UERA 1XMXA 5DTDA 2ZXGA 5D8LB 2NS8A 3IKVA 4DOZA 1QZYA 3CLOA 1IV6A 4O3MA 2MYSA 5LHGA 3HRMA 3PUFA 3ML6A 1OKRA 1BR1A 1POGA 2W85A 3AFHA 3RC8A 5JMWA 3MFKA 1PYVA 2JRMA 5M5WJ 4XMWA 2CQ7A 2ME6A 3ZQHA 4OIQF 5HLIA 4A6EA 3F6OA 4IRHA 4Q5SF 3HIFA 5GAGJ 2NRAC 1T1RA 3K10A 3U1KA 3HC7A 4LMYA 4M3EA 3OS0A 3HDDA 1HDPA 3ANNA 3Q5FA 3I64A 3S2WA 4M9ZA 3PUUA 3RTRA 4CO8A 3U9GA 1HS6A 2DTZA 5D4RA 3BR5A 3W6KB 5CJ9A 2IJLA 4UNOA 5HOOA 3QPSA 5KAIC 2BEOA 2QBYA 1WJ5A 4N4OB 1Y0NA 3VOEA 1R1UA 3JRBA 2QEXI 3HOVJ 4BQQA 4FT8A 1RR7A 4HDUA 3GTGJ 2HZTA 1HOMA 3T0YA 2PBIA 1QHGA 3GZNB 1YJ9I 3QAHA 4L5IA 2OUMA 3JR9A 4Y15A 1T56A 4WK8F 3SZTA 1TWAJ 1IXRC 3GVAA 1SAUA 2K4JA 1FLIA 2FU4A 2A68F 3BPVA 2JJ7A 2Y1EA 2R5ZB 2V6CA 2R92J 4XN3A 2X6OA 1Q0LA 5L3DA 4KUMA 1WKMA 2E35A 2M0CA 4RVBA 2K40A 3F0CA 4ENJA 1S72I 4FLSA 1XCBA 3TW6A 1LKXA 1G6NA 4XOPA 2LDUA 4JQFA 2OCCH 3MCZA 1T39A 3C3WA 3T8RA 1ETOA 3PQJA 4AIHA 2OV7A 2AS5F 2UXNA 5IYCJ 2PMZA 2BOLA 4EM2A 4XORA 3JW4A 5ILUA 1D1BA 1JTYA 2K4BA 1NG7A 3BZCA 4R1HA 5C3EJ 2DFIA 3ASOH 1SANA 3GF2A 4L9TA 3RPQA 1B4AA 3I4MJ 2LNBA 1WH7A 3BPXA 3V7CA 3CUQA 1R7JA 2R70A 3CCQI 3N4MA 2R93J 1T33A 5JVGF 4A3GJ 2W00A 3QP6A 3FULA 1BR4A 1OYWA 2VBXA 2L0KA 3HHHA 4J19A 3K4BA 4K2EA 1ZH5A 1IDZA 3S1RJ 4A69C 1MH3A 4AR1A 3VVLA 1J7KA 4KYWA 4A93J 4F92B 3T5XA 3KIOA 1BOBA 1KONA 1ZYRF 1BN5A 2VBWA 4PUSA 4Y52J 4XKBA 4E7KA 3ABTA 4MTDA 2DFFA 2PMUA 3K1PA 3BTCA 3GEZA 4AYBN 5EEAA 3N05A 3I3LA 1YW8A 1TT5B 2BXYA 4CCOA 3S16J 4OMYA 1ZK8A 1REPC 5FO5A 2HXOA 2QSFX 3HHGA 2IGKA 2DMQA 2DA7A 1LDKB 2QSHX 2WZGA 2XAUA 1RRJA 3CXBA 4DYRA 5TJJA 1YITI 1X3ZA 5DCFA 4RS8A 1Y1VJ 3CP2A 2W25A 3P9KA 5FRNA 4DJAA 2CV0A 5D4SA 5DUKA 2JVHA 3G4SI 2XQ0A 5GTIC 1VQPI 2ZXHA 3O6BB 3K70D 3JCUC 1NTCA 5ICCA 1QNTA 3G1MA 5DM7F 1D3YA 1G3WA 1B1BA 2XPWA 1F36A 4YFNF 3MD2A 5ERIA 2MG4A 3S8PA 1ON1A 2XHKA 6PAXA 5LEKA 3QPLA 2JD0A 3GTJJ 2V9VA 3BG6A 3KPHA 4X0GA 3FXOA 3KEYA 3CQZJ 3V8KA 3A02A 5BPDA 3E97A 1HBXG 1PUFA 2VQLA 3QJXA 2G7UA 4I02A 1PUFB 4D9JA 2XGXA 1VFCA 2V9PA 2DA1A 4M3DA 3OYAA 2MFZA 4BE0A 2RJIA 1XG1A 4BY1J 2DI3A 1BI1A 4RDUA 3X2QH 3HRUA 1A31A 2WWYA 3CCRI 2F48A 1KZHA 3DBRB 3CJQB 2OC6A 5E3OA 1TP4A 1D8KA 2XUBA 4DGWB 1W0UA 3ZI0A 3S2HJ 1IN5A 1KGSA 3KYCB 2IA2A 5HLHA 2CV2A 3FUDA 3K2AA 1AOYA 2HWVA 2XRLA 2AHQA 2PFBA 1IC8A 2CFXA 3DF8A 3I58A 2ZJPF 2VQHA 2FBHA 4BQNA 3ESWB 3TO7A 1TWFJ 1T2KA 1TBXA 3HPGA 2BVLA 3CZGA 3Q3SA 3GFIA 4G8XA 3GMEA 3A01A 2CS3A 3ISPA 4MQVA 3V42A 2FSWA 2V79A 3LFKA 3A1YA 3L2QA 3FHZA 3JRAA 3CCMI 3BR2A 1G3YA 1WJCA 4FCYA 3PNTA 1IW7F 1W7PB 5JFRA 4BXXJ 4PU2A 1V5EA 2EZKA 1H9TA 1DPRA 3LSJA 4M71A 4IZZA 4MO7A 3BC8A 4HSTA 3M4OJ 5IY5H 2DQLA 4E7SA 2COMA 3FU5A 3HXLA 5TRDA 2VXZA 2IRFG 3DTKA 3IP4B 1LNWA 3A01B 4Y6RA 2JCXA 2LY2A 3VDXA 3UR3C 1T8IA 1G4DA 5FLVA 4ZC3A 1R9TJ 1UMQA 3C2HA 3OIPA 4A5NA 3E6CC 4LIUA 4G7OF 4EV0A 4KT5C 1FIPA 2FD5A 1HKTA 1OPCA 4R79A 1R4NB 1SD6A 4I0BA 1P6RA 5DD4A 1MBFA 2QF7A 5J3LA 3CUQB 5D5UB 4XRMA 2Y75A 1T08B 3NWSA 1FEXA 1TZLA 2EV0A 4XNFA 2D1HA 1F1ZA 2R7WA 4BBSJ 2EFOA 1SG7A 2D1VA 3K7AJ 4RM2A 3HOZJ 4WX9A 2Y1DA 4UB6C 5IP9J 1LUJB 4B47A 2RC4A 1MZBA 2LKSA 4AIJA 4RM3A 3B6CA 2I5UA 4BHBA 2A5WA 5B3SH 3FX3A 3FH8A 3L00A 5DDGA 4A2UA 4QTRA 2Y31A 2O03A 2JT1A 2MC4A 3FH7A 2JA6J 1EA3A 1OISA 2DA2A 1R58A 2DT7B 1HKQA 2L5QA 4P9UA 3S2DJ 5J1YA 4IHWA 3ZXSA 5ICFA 4IL6C 1FNNA 4LG3A 3RIRA 3HEFA 2NVUB 3VFZA 4NB5A 3PL8A 3CC2I 4G7ZF 2K9SA 2Y9ZA 3MMYB 3RC3A 3LAJA 4J01A 3GTPJ 2QGUA 4ESBA 1FPQA 2XASA 5EGOA 4DZJA 1UHMA 2EH3A 3TP3A 2O9LA 3G1OA 3CMYA 2ZC2A 1WCMJ 2VPRA 2YR2A 2VKEA 2ZJRF 4HNVA 4CGZA 1UELB 3IRRA 3BG9A 2JTVA 4BXUA 3OYBA 1MSEC 4N0BA 1N25A 1Z6RA 4BBRJ 5DYFA 5H6QA 1B8IB 3V8JA 2EFPA 2HDCA 5E79C 1JGSA 4P5OA 1XDSA 3V7RA 2CW7A 4LGWA 3OS2A 3ZQLA 1S5LC 3K69A 4LLGF 3GO5A 2A69F 1ZKGA 1TWCJ 4QMEA 3O8HA 2Y0MA 1LVAA 3OV8A 5K5OA 2HVSA 1F9NA 3KEOA 3J81K 1O3RA 2R7FA 3OYEA 1K6YA 1U3EM 2P5VA 2E60A 1YFHA 2ZO4A 2X6XA 1YI2I 3AU8A 4B8XA 3GZ6A 4XK4A 4LG0B 1MNEA 2DJIA 3GCMA 2Z9OA 4KIFA 2RV8A 1VQ5I 3KP5A 2PJRB 1IAWA 3KCCA 4NUBA 4XRSG 4C3HJ 1MBHA 4HBLA 2Y0SN 1WSUA 2MABA 3SQNA 1X3UA 2DCEA 5LHHA 4XRSA 2Q2EB 4C3IJ 2A3SA 1ZGWA 4PFOA 4XN2A 4X2UA 4CCJA 2QCOA 1BI0A 1OCRH 3AL0B 4BACA 1QHHD 2KISA 2ZFWA 5FGMA 3EBHA 5C44J 1FIAA 2GTQA 3VYUB 5LLQA 5KNLA 3HM5A 5K7ZA 1FZPB 4PSXA 2K9NA 1S7AA 4FISA 2Z99A 3ABUA 3M8JA 2IS1A 2YX7A 3HGGA 2CMPA 2KIMA 1KA8A 1ZG5A 4C9YA 1K61A 2JD2A 4CZZA 2HOEA 3S14J 1HLVA 1F5TA 2BZTA 3ZMZA 4Z2YA 2QQ8A 4UVCA 3F8FA 3MWMA 3MZHA 2VLAA 3L2CA 5E3MA 2E1MC 5FLMJ 4B09A 1YIOA 2O7OA 2L9SA 1SD5A 3A4CA 2BY0A 3NWTA 4JBAA 2OD5A 4HQEA 2AXLA 1OMIA 2EILH 4EJUA 3R0AA 4LK1F 2CUEA 2E19A 2M7BA 4V2GA 1B59A 2XKOA 4RAFA 4CZCA 1ZHFA 3S17J 3RCOA 5F0HA 1MH4A 4BGDA 2DO7A 4LD5A 3RDIA 2HPMA 4Y67A 2HNHA 2DA3A 3D5RC 2E36A 4BHCA 2KLOA 2LD5A 3S3NA 2E1CA 2YPRA 4UV8A 1WZ2A 4BY7J 1Q0QA 1WI3A 5M3FJ 3RQ4A 2CO5A 4D1QA 2VONA 1S9HA 3GZ5A 2VJIA 2K02A 3HGYA 4FLRA 4CA0A 2LMDA 1X1CA 2Q2EA 1QBJA 4EM1A 3JREA 3F8MA 4XKVA 2DAOA 2B0LA 2MGQA 2H1LA 2JMWA 4DBQA 4IOAF 2GXBA 2X1CA 2LLKA 1OR7C 4B4CA 3M3YJ 4L2LA 4XN8A 1B9NA 1NK2P 3RASA 5K7HA 1R5ID 2TRTA 4MTEA 4ARFA 5FKLA 1ZG3A 2QM3A 3S1QJ 1T38A 4AU7A 2GAUA 3FWEA 1XMAA 3IV5A 4CH7A 4RB3C 3CP8A 3BDDA 3B37A 2H09A 3FU0A 3AG3H 5JHFA 2F5FA 4XMZA 4J3BA 3KZZA 5IPAA 3IRQA 5L3CA 1MKMA 1FX7A 2HVQA 2FBKA 1VI0A 5JO0A 1OLTA 1ORKA 3GUDA 4PCQA 4L9NA 3RPUA 5M3MJ 1B72A 3KP2A 5F1RA 2Z33A 2ZNYA 2LVSA 3HUGA 3WG7H 4BKXA 4HPQA 1K6OA 2WAEA 1YS6A 4I09A 2A6HF 4F7ZA 3WTWC 1SFUA 3FUFA 4K5PA 2DOAA 1VQMI 4A3DJ 4EJWA 2GA2A 1Z6TA 3DWLE 3BT9A 2VKDA 4NQWA 4IRGA 1XMKA 2XKPA 3ERMA 2BY1A 4RMNA 2O7GA 1X3ZB 2AQEA 1FMVA 2FBIA 3FXRA 2L02A 1A36A 3CESA 3KP6A 2E2JJ 3ZMSA 2B61A 1OJLA 1T98A 4GXOA 1P4AA 4HX7A 2IGMA 4Y4RA 5EDNA 1SMTA 1Z67A 1GW6A 3A06A 1WFXA 1O7LA 1J5YA 1NHAA 2KPMA 1HSTA 3EYYA 1PVEA 1OCOH 2DA5A 3BZKA 5A2QK 1IN8A 2FMLA 2ZCWA 2F4IA 3NAUA
chains in the Genus database with same CATH topology
2BW3A 2E1MB 1SAUA 4ZQEA 2EGHA 3L2UA 2Y1EA 3RPUD 3DPTA 4ZQTA 3DPUA 1Z3YA 2KP6A 3JSZA 2IGOA 2LREA 3LFUA 4RLQA 4XN3A 1Q0LA 1Z7LA 1MW1A 4ZX6A 2ELJA 3UNGC 4PSWA 1DGWY 1SFKA 1TT0A 4XKWA 2A7OA 4RVBA 4XMUA 4E4HA 4RLFA 1GLNA 4BJ6C 4FLSA 4AR9A 4QUOA 2M7AA 1LKXA 4XOPA 4B48A 2VPLA 1MW3A 4JQFA 4H4KC 4LUPA 3OL3A 3JT1A 4DBRA 3FH5A 3FUJA 4XR6A 3OYLA 3PSFA 3H0DA 3FTVA 3TMOA 2O5RA 3OR1C 2OV7A 3OIQA 4CCLA 3FHNA 3AL0C 2XF6A 2PMZA 3CMMA 2QKMB 2BOLA 3GBGA 4LITA 4XORA 2FUG2 3DQVC 1D1BA 3DU5A 1JG9A 2IGNA 2LOOA 2PL5A 5JNLA 1WJAA 4IQ4A 3PJRA 2F6CA 1X1AA 3FU3A 1NG7A 3LSHA 4KJZA 5KCMA 2K3PA 3ZGKA 1MMDA 3B7TA 4OOEA 3CZLA 3ZHYA 4R7LA 2IXSA 1ONOA 3K4LA 5HNHA 3ZRGA 1MMAA 2R70A 2Y1GA 2Z1DA 2UWMA 2Y0SA 1V5FA 4A03A 2WAQA 3EPZA 4OAZA 2R7UA 3H9QA 2W00A 2DT6A 3S3OA 3FULA 1BR4A 1DGRM 4AYBA 2R7RA 3K4BA 3SEQA 4FCAA 2KQRA 2HDWA 2XPYA 2IS6A 3B2PA 4XO4A 4AR1A 1WJBA 4AVZA 3VVLA 3FUNA 2KZVA 3VYSB 4F92B 4F55A 3OYMA 2RREA 1BOBA 2XDVA 2MAOA 2LY1A 4E6KG 4CUGA 4ZX3A 1KONA 3PNYA 1G5AA 1G8XA 2VQGA 4PUSA 2WY8Q 4PFPA 4XKBA 4E7KA 3AU9A 4E7JA 3K4JA 3N05A 3I3LA 4CCOA 4RSYA 5CPRB 1LFPA 5CQGA 3QYEA 2WA0A 1H19A 2VASA 5FRMA 2IGKA 4IKFA 3CZKA 3Q44A 3UCQA 3UEQA 3WQSB 3MKYB 1LDKB 2WZGA 3FTUA 2XAUA 4XN0A 3FUHA 4GAEA 2M0MA 2V7FA 1X3ZA 3HL2A 3FTWA 4CCKA 3CP2A 3C2GA 4ZW5A 5FRNA 2VXDA 4DJAA 2CV0A 4XNDA 3R0IA 4XN7A 3ONQA 1MMNA 4BJ5C 2JVHA 2XQ0A 5JMPA 2CW8A 1WJDA 2CFOA 4XN1A 4ZQGA 1ONPA 1X1BA 1JGIA 2WADA 2ZXHA 3FTXA 4ZDOA 4Q4IA 3K70D 4AR8A 1D0ZA 4ZDLA 1Q0HA 3FHEA 4LIVA 5JC1A 4HG2A 2WAFA 1ONNA 4R5TA 4QIRA 4ZW8A 3MD2A 1S46A 1YX5A 3S8PA 1Y56A 3MKWB 1DQUA 3KX2A 2JD0A 3B2XA 2E5NA 1MVYA 1U0JA 3BG6A 3VSKA 4X0GA 3L2WA 2ZFUA 3M1CA 3KEYA 4XLEA 3H5NA 2HQAA 4BU2A 4GAAA 2VQLA 2VQCA 3QJXA 2JUGA 1N75A 3HPHA 3TBIA 5HVQC 4R5VA 4D9JA 3WQRA 3CHPA 4J00A 3ZHZA 3OYAA 2MFZA 2VB6A 3OYDA 4BE0A 2RJIA 2GOMA 2VJ4A 2R7TA 4K5MA 4OAYA 4JOMA 2IS4A 4NC7A 3DLAA 1P9QC 3OY9A 4JNDA 1X3WA 3PSIA 2R72A 4ZW3A 2MD0A 3CJQB 2OC6A 1VZ0A 5LD2C 3S32A 4DGWB 3ZI0A 3CJRB 3BCBA 2WPGA 2NOJB 3FUDA 2CV2A 4XMVA 2LH9A 2C5ZA 3OYIA 4XNAA 2X51A 3OYJA 3OYGA 2HU9A 3BLYA 2LYCA 2KRHA 4XONA 4C30A 4CSWA 3PFYA 3QOEA 2UUZA 1NG6A 4BE2A 3PNVA 2VQHA 2HZDA 3K4KA 2W1OA 4C2UA 4BQNA 3EUHC 4XMYA 2K9MA 3W2AA 3HPGA 2BVLA 3CZGA 3H9GA 4QPEA 3QODA 2XPZA 2CS3A 2K9LA 5CQEA 3V42A 3B7UX 3FUKA 4ZW6A 3A1YA 4F91B 3DEEA 4BEHB 1D0YA 3TL4X 3L2QA 1MW7A 3S93A 1WJCA 3PNTA 4OOFA 3U9WA 4PU2A 4PVBA 3OOUA 1V5EA 3VWBA 4NQWB 4BJTA 4IZZA 4QPOA 3BC8A 4HSTA 3CHQA 4ZJZA 4ZYAA 1WJFA 2QJ1A 3ANLA 2W82A 4E7SA 4BEHA 3FU5A 3HXLA 1IRXA 2WZFA 2VXZA 3DTKA 1X19A 1Z21A 3B7RL 3FU6A 2BVMA 2A6TA 3D5SC 3IP4B 3W2VA 1ERDA 4Y6RA 5EV7A 2JCXA 1DP3A 2LY2A 3CF2A 3VDXA 5FWQA 3UR3C 3H5AA 4XMTA 4ZC3A 3C2HA 3OIPA 4GRIA 4LIUA 4IX7A 2X1EA 3B3BA 1MMGA 3LMMA 3L2VA 4PJMA 4R79A 1T95A 2KL4A 3H35A 2C82A 2GOXB 2L2OA 4F93B 3WQQA 4CCMA 3BG7A 4BUPA 3SEZA 3MKZA 2R59A 3QYBA 3FKJA 3NWSA 1TZLA 3EBIA 4ZQFA 4XNFA 4XO5A 2L9NA 2R7WA 1SG7A 4YEJA 4RM2A 2Y1DA 3W2WA 4B47A 4XN9A 4RM3A 3FUIA 2A5WA 3OMYA 4B43A 3VYTB 3FH8A 2V9KA 2WBMA 3K4MA 3E1SA 2JVGA 4U87A 3CHOA 4ZTFA 4K5LA 3ZHXA 2MC4A 4Y33A 3FH7A 4YRVA 2DQ6A 4FLOA 2WY7Q 2XF5A 3G2BA 5LFAA 1EA3A 1ZELA 4II3A 4BS9A 4F3QA 5DULA 2DT7B 1D1AA 4N4NB 2ZSIB 2PJRA 2Y1CA 2L5QA 3BCAA 3DTEA 3ZXSA 4LG3A 3K70C 2Y1FA 3PL8A 1QU3A 2V6EA 3A14A 2M4KA 2HVRA 2IS2A 3FTSA 3MMYB 4NNJA 3RC3A 4J01A 4G6TB 3VYRB 1E0EA 5AENA 1H3LA 4F52A 3CHSA 4MKTA 2UV1A 3B7SA 4ZX5A 5JBIA 5CKTA 3A2KA 1UG0A 4PW4A 1UELB 2VJJA 2X1DA 1MNDA 3EUKL 3OYBA 1X1DA 5DYFA 3VVMA 3IAM2 2L7KA 2DXIA 3AUAA 4ZN6A 4P5OA 3SYTA 4XLCA 2CW7A 3OS2A 2LRDA 1SQMA 2RNGA 3OYNA 2PUSA 4P1WA 3FTZA 4FLQA 4R5XA 2XC7A 1N77A 2CV1A 3OYFA 4QMEA 1Z3XA 3RSNA 1W36D 2HVSA 4HSRA 1SC5A 3FUMA 4BQOA 3ZR8X 1MW0A 2VJ5A 5FROA 4XLAA 3OYEA 1K6YA 4YELA 5HNFA 4KT6A 2P0WA 2E60A 3QYFA 2X6WA 2X6XA 4PJNA 3AU8A 2VIXA 4RCVA 2VKHA 2W7NA 3U21A 1X4PA 3FTYA 4HNUA 3FDYA 1MNEA 2DJIA 3HG9A 4AICA 4XNBA 3D5LA 3B34A 2Q1ZB 4ITVA 2PJRB 1ZS2A 2VJ8A 2CUZA 2X85A 4NUBA 5BPPA 4XOTA 3OYCA 2M4GA 1HA8A 2MABA 3EBGA 3IUOA 4CXFA 1OR7A 3OR2C 4ANJA 2DCEA 1UAAA 1MW2A 2Q2EB 1R0LA 1PJRA 4QHPA 2KMUA 3LL7A 1X4OA 3EUAA 2QVWA 4K5NA 4PFOA 4XN2A 1Y6IA 2M3AA 4X2UA 5DLLA 4HRIA 4CCJA 4KITB 2XF7A 3AL0B 4BACA 1QHHD 4BL0B 2JCYA 4HNTA 3EBHA 3DPLC 1T1SA 2R7VA 2GTQA 2JV7A 3VYUB 5KNLA 2ZSHB 1N78A 2ZXIA 2CUJA 4PSXA 3ZCOA 3F9KA 4C2TA 3CZEA 3M8JA 3OYHA 2IS1A 2JD1A 2LBFB 3OS1A 1G59A 4IQJA 1K5HA 2CMPA 4XN4A 2DQMA 5JAZA 4DIQA 4C9YA 2JD2A 4MLOA 1D0XA 1LVKA 4ZDPA 3HOSA 4ZTJA 1W36C 2VLAA 3FBNB 4E7HA 2KRCA 1AA7A 2R7OA 2E1MC 5HLTA 3I9V2 2L9SA 3A4CA 3NWTA 2R7SA 3DKYA 3VSLA 2RQQA 1YX3A 5KHDA 4XN5A 2M7BA 3HUGB 2LBFA 3IAS2 3LSGA 4CZCA 4U7BA 3FUEA 4B3XA 2PGGA 3RCOA 2Z16A 2KDOA 4FETA 4XM3A 4BGDA 3DKXA 3KEDA 4ZQHA 2HPMA 4HEA2 4Y67A 2HNHA 2K5CA 4II2A 3CHRA 3D5RC 3S3NA 2BW3B 2KLOA 3IIEA 2LG4A 3Q43A 4KISA 1RP3A 1Q0QA 3RQ4A 4D1QA 4EATA 1S9HA 3L2RA 3SZGA 2VJIA 2JCVA 4FLRA 1JVSA 4E7ZA 5TGTA 4CA0A 1X1CA 2E5ZA 4QPQA 3HKZA 4K5OA 3S3MA 4XKVA 2LC2A 3SDBA 2WB1A 3PUBA 4CCNA 2QKLB 3H5RA 2AQFA 4DBQA 4XLFA 2X1CA 4PK4A 1OR7C 4XL9A 4L2LA 4XN8A 2HPTA 4FASD 2R4GA 2CH0A 3T8VA 4XO3A 2JA2A 3LSKA 3RASA 2HPIA 3CZ6A 2V1NA 3LSMA 4DPRA 4B44A 3UERA 2VL8A 4ARFA 2ZXGA 3KYLA 4DOZA 4AU7A 2V4JC 2MYSA 3DTIA 4AYSA 1J09A 3B37A 4CH7A 4Y6PA 3CP8A 1BR1A 3K6GA 3FU0A 3OWTA 4ZW7A 4XLHA 5JHFA 4XMZA 3HOTA 4BE1A 4J3BA 1YE9A 4Y6SA 3AFHA 2F5VA 3RC8A 3E0JB 3LSIA 5JMWA 3AKZA 2HVQA 1PYVA 4XKCA 4XMWA 2MAPA 1JI8A 5JO0A 1OLTA 3W3CA 2R7XA 1R6RA 2JSPA 1WJEA 1T1RA 1FMWA 3K10A 4PJJA 4BXFA 1R0KA 2V26A 2Z2SB 3HC7A 3J7AY 4Q4EA 3OS0A 1BR2A 3K4NA 3ZQQA 3ANNA 4BKXA 4HPQA 2WAEA 4E7IA 4OWRB 3FUFA 3CIAA 3DU6A 4K5PA 2DOAA 2HPOA 4MS6A 3PUUA 2XSJC 2KHMA 3RTRA 3DWLE 4XQFA 2VKDA 4NQWA 1D1CA 1HS6A 1V5GA 3H9JA 4RMNA 2O7GA 3ANMA 2AQEA 2W4SA 1FMVA 2R7QA 3OYKA 2FFLA 1T0FC 5HOOA 3CESA 4PJLA 4BDYA 3FBIB 2I8DA 3K4CA 4Y3OA 2B61A 1WJ5A 4N4OB 3OL4A 2IGMA 4Y4RA 4BQQA 4KP7A 1GW6A 3A06A 1WFXA 4NC8A 4E7LA 3T0YA 2KPMA 1QHGA 4XMXA 4ZX4A 2OUMA 4BDZA 2F4IA 2X6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  2VLA A;  5HNF A;  5HLT A; 
#chains in the Genus database with same CATH topology
 2E1M B;  3H1C A;  4XRF A;  1JUP A;  2FNP A;  3RPU D;  2FA5 A;  2H94 A;  2LRE A;  1BOA A;  1ACI A;  5DV5 A;  3WHB A;  1Z7L A;  2IVM A;  2ELJ A;  3FXL A;  4PSW A;  3UNG C;  1TT0 A;  2A07 F;  1IXC A;  1DP7 P;  2LKX A;  2HYF A;  4RLF A;  4BJ6 C;  2EPF A;  3LA3 A;  4QUO A;  3WTT C;  4B48 A;  1MW3 A;  4LUP A;  4H4K C;  1VF9 A;  4P55 A;  1KQ0 A;  4RB2 C;  3G1L A;  4ZYG A;  1W7P D;  2GA1 A;  4Z6Y A;  1IDY A;  1UST A;  4FX4 A;  1RIO H;  2Y2Z A;  2O6G E;  1W0T A;  3TMO A;  5HDK A;  3ABM H;  4CCL A;  1T6S A;  2BY2 A;  3AL0 C;  2XF6 A;  2KDZ A;  3WTZ A;  1VND A;  1VQ6 I;  2B9S A;  2YU9 J;  2FUG 2;  1FOW A;  1FP2 A;  3DU5 A;  3H36 A;  4P9F A;  3RI4 A;  1JG9 A;  1YYV A;  2F6C A;  2PX9 A;  3WE3 A;  3LSH A;  3FU3 A;  1GXP A;  2D2W A;  4HQM A;  4XSZ F;  2DMT A;  1XGO A;  2BE5 F;  3CCS I;  2K3P A;  1IG7 A;  3B7T A;  4OOE A;  2EZH A;  2RQP A;  3DCF A;  3CZL A;  2XAJ A;  3C7J A;  5GPC A;  4CHU A;  2CW0 F;  1BC7 C;  3K4L A;  1K78 A;  3ZRG A;  1MMA A;  1SD4 A;  2UWM A;  4UUS A;  1SFX A;  1H0M A;  2H8W A;  3H9Q A;  4M73 A;  2VOO A;  5F1J A;  5D5W B;  1FBQ A;  2DT6 A;  3S3O A;  1DGR M;  3BJ6 A;  2R7R A;  3LNQ A;  3P9C A;  2KQR A;  4FCA A;  2HDW A;  3FM3 A;  2IS6 A;  3B2P A;  3QU6 A;  1WJB A;  3FUN A;  4MFD A;  1JT0 A;  2XDV A;  1W5T A;  2DYR H;  2MAO A;  4E6K G;  5F27 A;  3BTI A;  3FXJ A;  3PNY A;  1G5A A;  1G8X A;  2M9H A;  2X48 A;  1I1S A;  1BIB A;  4D0P A;  3GFL A;  4P96 A;  2CQX A;  4YG2 F;  5DUI A;  1VQN I;  3AU9 A;  1W5C C;  1YTY A;  1WRJ A;  3K1N A;  1HKS A;  2O61 A;  5F0C A;  4RB1 A;  3F8B A;  2H27 A;  1QO0 D;  2EIM H;  3FMS A;  3QYE A;  1H19 A;  3HTU A;  3IL2 A;  4BQA A;  2VAS A;  3Q44 A;  2E1N A;  4IKF A;  1ITY A;  1ON2 A;  3GW2 A;  4XN0 A;  3FUH A;  2CWE A;  2QVO A;  2V7F A;  3FTW A;  3HL2 A;  4CCK A;  2L3D A;  1I6H J;  2ID6 A;  2JQ7 A;  2VXD A;  2EFQ A;  5IT9 K;  4GDF A;  4I0A A;  2VE9 A;  1J2X A;  4XN7 A;  4BJ5 C;  4KMU X;  2RAE A;  2CW8 A;  1WJD A;  2K85 A;  4IOC F;  1OCT C;  2K7L A;  1JGI A;  1SVO A;  1HC8 A;  3FTX A;  2QQB A;  4AR8 A;  4Q4Z F;  1A6I A;  2E1O A;  5FKO A;  3H3U A;  3FHE A;  2EIJ H;  5JC1 A;  5HLG A;  4I2O A;  2VUM J;  2EFN A;  1TQM A;  5L3B A;  1BIA A;  2XGC A;  3BWG A;  3KX2 A;  2FQ4 A;  5HOD A;  1YIJ I;  3S1N J;  9ANT A;  2DBB A;  2HQA A;  5DCM A;  5FB2 A;  4UXN A;  4GAA A;  4LB5 A;  3LQQ A;  3BR1 A;  2VQC A;  3TOB A;  4R5V A;  1G3S A;  1VQ4 I;  5HDN A;  4BYY A;  2NXN B;  3R61 A;  3ZHZ A;  3ECO A;  3CJT B;  4LB6 B;  2HKX A;  5IYB J;  2GOM A;  2VJ4 A;  4IJA A;  2R7T A;  4JOM A;  3DLA A;  2GIZ A;  2M30 A;  2DFE A;  4N9H A;  2HQR A;  1V55 H;  1BL0 A;  4ZYD A;  3PSI A;  4B1R A;  3AG4 H;  1WWX A;  3IH3 A;  1MGT A;  4MEX F;  4C2M J;  2WPG A;  2NOJ B;  4AC0 A;  2LH9 A;  4XNA A;  4MS6 A;  4XON A;  1K83 J;  2UUZ A;  1NG6 A;  2EQR A;  2L4A A;  2W1O A;  3BOQ A;  1X58 A;  3EUH C;  3T8T A;  1TWH J;  2MSY A;  4MFE A;  5E18 F;  3QOD A;  2XPZ A;  4BHP A;  2DU9 A;  1R23 A;  3GTK J;  2K9L A;  2E7X A;  4JX4 A;  5EF6 A;  4U7D A;  1V54 H;  2L9V A;  4F91 B;  3DEE A;  1U8R A;  3J7A O;  3KLO A;  4I6Z A;  1MW7 A;  3DEU A;  1TL8 A;  5H6R A;  4LLL A;  5DS9 A;  3HTS B;  4FHT A;  1VQ8 I;  4L18 B;  1EH8 A;  2VI6 A;  3U9W A;  3TO6 A;  4PVB A;  1HSJ A;  3VWB A;  4LOC A;  1FWZ A;  4L0Y B;  3ECH A;  3CHQ A;  2XRO A;  1ULY A;  1Z9C A;  2CYY A;  2WZF A;  1X19 A;  1Z0X A;  3FU6 A;  5IT3 A;  3T1B A;  1A04 A;  1XTA A;  1NK3 P;  4V19 K;  1C0W A;  3CF2 A;  1E17 A;  1R22 A;  2DA6 A;  3G6E I;  5FWQ A;  4UVA A;  1AWC A;  4KDP A;  1KU2 A;  2OZ6 A;  1B6A A;  4IX7 A;  3D1N I;  2HOS A;  1MMG A;  3LMM A;  4A5M A;  2E7W A;  2KFD A;  2DMP A;  2X4H A;  4HOB A;  4ZZD A;  5ICG A;  3WQQ A;  1HDD C;  3WTV C;  5LGT A;  3E6D A;  1DPU A;  2FE3 A;  3BG7 A;  4QIW N;  2OU2 A;  3SEZ A;  2P6T A;  2H6C A;  5DYM A;  5DM6 F;  2G0E A;  3SDG A;  4TV7 A;  1J75 A;  5F6F A;  4GFB A;  4ZQF A;  4MGR A;  1H9G A;  4NHJ A;  4XO5 A;  2ICW G;  2L9N A;  2JZY A;  4KIC A;  2E2H J;  1ZR4 A;  2EZL A;  1JKR C;  5BMZ A;  4U0W A;  1FP1 D;  1LE8 A;  1JKP C;  2HTJ A;  4IHX A;  3GTO J;  1ZGA A;  3E1S A;  3HZJ A;  1HW1 A;  2CJJ A;  2JVG A;  2K3F A;  2KRF A;  3BY6 A;  3L9F A;  4U87 A;  4ZTF A;  4Y33 A;  4YRV A;  2L54 A;  1UFM A;  2JPC A;  4H0E A;  2DQ6 A;  1KQ9 A;  4OU0 A;  4FLO A;  2XF5 A;  2UXX A;  3KEQ A;  5HS8 A;  5DUL A;  3L09 A;  4M6Y A;  4BS9 A;  1XB4 A;  2D45 A;  4A0Z A;  3OOP A;  1U5T A;  4HX8 A;  1UHW A;  3A0H C;  4OIO F;  4G6D A;  3CCV I;  3HOU J;  2M2E A;  3ERE D;  3HSR A;  3JRF A;  2A5Y B;  2H6B A;  4NNJ A;  4G6T B;  2BV6 A;  3VYR B;  1E0E A;  5LEJ A;  3WGI A;  4M9S A;  4F52 A;  2FXA A;  3Q9V A;  1QGP A;  4QLC U;  5JHU A;  5AIQ A;  5CVU A;  4ZX5 A;  3GYH X;  4PW4 A;  2X1D A;  1E3P A;  2QQ9 A;  3ZQC A;  1R5G A;  3VVM A;  4AIK A;  2ID3 A;  4ZN6 A;  1XN7 A;  4XLC A;  3P7N A;  4ZH4 F;  2LRD A;  1SQM A;  2RNG A;  2VC0 A;  5EZG A;  2CV1 A;  5GAD J;  3OYF A;  2TDX A;  4A0Y A;  1VQL I;  3QPT A;  3M7G A;  5E1X A;  3RSN A;  1W36 D;  1SC5 A;  5D5X B;  4BQO A;  4IXA A;  3ZR8 X;  1MBK A;  4XLA A;  3TED A;  4HW0 A;  1QPI A;  3CO6 C;  2HDD A;  2EV5 A;  2M87 A;  1XSD A;  3BQY A;  4HYE A;  1XCV A;  4AD9 A;  3Q0W A;  3Q0V A;  3S15 J;  2OQR A;  2W7N A;  1TLH B;  4JK1 X;  3FDY A;  4DYQ A;  4AIC A;  3D5L A;  2R7D A;  2VBZ A;  1OYI A;  1XGN A;  1BA5 A;  4GYI A;  2VJ8 A;  3RZD J;  4O6J A;  2CUZ A;  2X85 A;  4XOT A;  2EJR A;  3E5X A;  1SVL A;  4IPA A;  1W4M A;  1TW2 A;  2LSO A;  4CXF A;  3OR2 C;  1DU0 A;  2IAI A;  1X4O A;  5TIS C;  4MHG A;  3COA C;  3REO A;  4K5N A;  4WCG A;  5IP6 A;  1Y6I A;  2M3A A;  3I53 A;  4D7N A;  1I1G A;  2XF7 A;  1UB9 A;  3WTY C;  5K7F A;  1SD7 A;  4BL0 B;  2JCY A;  4HNT A;  2FMY A;  2KJB A;  1T1S A;  2HS5 A;  2JV7 A;  4IF4 A;  2ZSH B;  2GXA A;  2ZXI A;  3WTS C;  5EZH A;  3BP8 A;  1QPM A;  2B7E A;  3F9K A;  2P6S A;  3OYH A;  2JD1 A;  3GFM A;  2LBF B;  3OS1 A;  2ISZ A;  5FLX Z;  2HGC A;  4DIQ A;  1UJ8 A;  4MLO A;  2RGV A;  1D0X A;  1LVK A;  4M9X A;  2ZXW H;  5K1Y A;  3J80 K;  3HOS A;  1CF7 A;  4CYC B;  3FBN B;  4E7H A;  2KRC A;  3HSF A;  5KK1 A;  4DQ2 A;  4E70 A;  4EJV A;  2OJE D;  3VSL A;  1IGN A;  1MDM B;  3ABL H;  2WAQ N;  5B66 C;  4XN5 A;  4Y17 A;  3VPR A;  3ZQ7 A;  4A3L J;  2ZME A;  2NNY A;  1YQA A;  3LSG A;  3K2Z A;  2NVX J;  4OIP F;  5KAF C;  2DYS H;  1JHH A;  2C6Y A;  2DLL A;  1X2N A;  1EH7 A;  4FET A;  4XM3 A;  5IOY A;  3HOW J;  3KYD B;  3KED A;  4ZQH A;  3KP3 A;  4AM3 A;  1DU6 A;  4II2 A;  1IRF A;  2BW3 B;  4YFX F;  1Q1H A;  2LG4 A;  2M45 A;  2I10 A;  1RP3 A;  5J4V A;  4V2F A;  1ZAR A;  4EAT A;  1I50 J;  3N97 A;  2O8K A;  2JCV A;  1XGS A;  1KU7 A;  2VC1 A;  3E6B A;  3CCE I;  1JVS A;  4E7Z A;  3ZMT A;  2E5Z A;  3JTG A;  3DLL F;  3HW2 A;  1O4X A;  3TW7 A;  4K5O A;  3SDB A;  4CCN A;  4GGG A;  2AQF A;  2ZB9 A;  3IWF A;  4XLF A;  2QQA A;  4L9J A;  1A35 A;  3WG9 A;  3HB9 A;  2CH0 A;  1K78 B;  3T8V A;  4MNU A;  2IW5 A;  2OBP A;  1NH3 A;  2HPI A;  3CZ6 A;  3HJE A;  2V1N A;  2ZNZ A;  3FMR A;  1KU9 A;  2Q8K A;  1SMY F;  2EA2 A;  1OCC H;  1ZLK A;  2VL8 A;  3S1M J;  3DTI A;  4AYS A;  2YU3 A;  1GT0 C;  4M6V A;  4IRI A;  3OWT A;  1QQI A;  4XLH A;  4AID A;  3HOT A;  5JVT A;  3F21 A;  2P4W A;  3AKZ A;  5J1R A;  4RBO A;  3CDI A;  2YSR A;  2ZXJ A;  1JI8 A;  2FF4 A;  5H20 A;  1R6R A;  4KIB A;  4ENN A;  1IF1 A;  2LKP A;  2XVC A;  2R5Y A;  2IA0 A;  1FTZ A;  4PJJ A;  4BAY A;  3M07 A;  5L3F A;  3K0L A;  5FKN A;  1BR2 A;  3K4N A;  3ZQG A;  5GAH J;  3HSE A;  2BXZ A;  2UZK A;  1K7A A;  4E7I A;  4OWR B;  2L01 A;  3DU6 A;  3JAM K;  2HPO A;  4X1E A;  1HXD A;  2NNN A;  2XSJ C;  4XQF A;  2FQ3 A;  1D1C A;  3L7W A;  1V5G A;  3H9J A;  3ANM A;  2W4S A;  2R7Q A;  2XGE A;  3OYK A;  4KA4 A;  3HRT A;  4LFU A;  3FBI B;  5EEH A;  2I8D A;  3K4C A;  4RGU A;  4Y3O A;  2MC3 A;  3M9A A;  2NS7 A;  3OL4 A;  5M5Y J;  2NVQ J;  1UG2 A;  2ME0 A;  1XGM A;  1PP8 F;  2GWR A;  4KP7 A;  4NC8 A;  2ECB A;  3IKT A;  1JE8 A;  3SHF A;  4XMX A;  4ZX4 A;  2XV4 S;  2ZKZ A;  1S3J A;  2MA3 A;  4BDZ A;  5FKK A;  3HOY J;  2X6Y A;  2BW3 A;  1E3H A;  4WXC A;  3L2U A;  1STZ A;  3DPU A;  1Z3Y A;  2KP6 A;  3JSZ A;  4RLQ A;  3J81 Z;  1MW1 A;  1BW5 A;  1T0F A;  2JK3 A;  5LBQ A;  1DGW Y;  2AO9 A;  5E1Z B;  2IA1 A;  4MIM A;  5HS9 A;  2R0Q C;  2A7O A;  1TQI A;  1H88 C;  3A03 A;  4E4H A;  2JRT A;  4DNC A;  4XMU A;  1GLN A;  3ELK A;  1MDM A;  3DBL B;  1KYW A;  4DBR A;  3FH5 A;  1U78 A;  2JA8 J;  3LSP A;  1LEB A;  4XR6 A;  1QZE A;  3OYL A;  2LP0 A;  4W1U A;  1RI7 A;  4CYC A;  3OIQ A;  1EH6 A;  2ISY A;  2QKM B;  3CLQ A;  2WV0 A;  1LJ9 A;  4IHS A;  2DTR A;  1ZQ3 P;  2LOO A;  1I39 A;  4IQ4 A;  3PJR A;  1O3S A;  1X1A A;  3BR3 A;  2Y9Y A;  1FJL A;  4QSH A;  2Y69 H;  1O3T A;  3GX4 X;  3ZGK A;  1MMD A;  1OQY A;  1DUX C;  1BJA A;  3CC4 I;  2IXS A;  1ZRD A;  3FXU A;  5HNH A;  1GVD A;  2Y1G A;  3WGG A;  2FEZ A;  2Y0S A;  3EPZ A;  1IN7 A;  4OAZ A;  2R7U A;  3LOC A;  4UHT A;  4XLP F;  2FX0 A;  1V3F A;  3ULQ B;  1MIJ A;  3SEQ A;  3HYI A;  2XIG A;  3GLX A;  4XO4 A;  3PFI A;  4AVZ A;  2XPU A;  2KZV A;  1LDD A;  3VYS B;  2DOD A;  4F55 A;  3HOX J;  3NEU A;  4ZX3 A;  1RUO A;  3LA7 A;  2GLO A;  1TNT A;  5JI6 A;  2OZU A;  1YW9 A;  2VQG A;  1MD0 A;  2MBF A;  3HBL A;  4PFP A;  4BH9 A;  1ZRE A;  5C4J J;  5K5R A;  3MEX A;  2FNA A;  2X9D A;  4HF2 A;  3R0J A;  1IRG A;  2Z3Y A;  4EGZ A;  2E71 A;  3K4J A;  4EQQ A;  4RSY A;  1LFP A;  3BQZ A;  5CQG A;  1D5V A;  4IO9 F;  4RA2 A;  3ZP5 A;  3UEQ A;  1YG2 A;  3UCQ A;  3WQS B;  2JUC A;  3MKY B;  3FTU A;  3GFJ A;  1TW3 A;  5CVV A;  3C2G A;  4ZW5 A;  1MBE A;  1S7O A;  3I4P A;  1FY7 A;  2DQR A;  3K1M A;  3QQA A;  3JTH A;  1CGP A;  3ONQ A;  1JXS A;  2VE8 A;  3AG2 H;  1MMN A;  3MZY A;  2CFO A;  1ONP A;  2CQQ A;  1ZG1 A;  4A6D A;  2AXT C;  1ZN2 A;  3UKG A;  3P5J A;  4ZDL A;  1KQ8 A;  4WF2 A;  4HG2 A;  3I4N J;  3E5U A;  1ONN A;  4R5T A;  2Q0O A;  4QIR A;  4ZW8 A;  4OIN F;  3L1P A;  1YX5 A;  1HCR A;  1DQU A;  3F6V A;  1MVY A;  3L2W A;  3VSK A;  2ZFU A;  2L4M A;  3H5N A;  1BI3 A;  1ODD A;  4BU2 A;  4LK0 F;  5HS7 A;  5E1W A;  2PG4 A;  2STT A;  2RNJ A;  4XSX F;  3HPH A;  1SC7 A;  5HVQ C;  1B9M A;  4HX4 A;  3CHP A;  2M1B A;  4J00 A;  1IJW C;  3VEP A;  1MSF C;  3F23 A;  1HF0 A;  1EKE A;  1X3W A;  1U9N A;  3ZMU A;  2R72 A;  4ZW3 A;  2MD0 A;  4A3I J;  1TQP A;  5LD2 C;  3S32 A;  2M8E A;  2IEK A;  2HKO A;  4HZF A;  1Z1D A;  2BBY A;  1APL C;  1S7E A;  1OCP A;  2VBY A;  2QUF A;  4ZZL A;  1QVU A;  4XMV A;  1KYZ A;  3OYG A;  3BLY A;  2LYC A;  2KRH A;  4QPE A;  4C30 A;  3I56 I;  3QOE A;  4L5J A;  3LWF A;  4BE2 A;  2CU7 A;  1Y1W J;  2HZD A;  3K4K A;  1SEU A;  3DXJ F;  2EZI A;  3J7Z I;  4ESJ A;  4M3B A;  4XMY A;  3WOD F;  3C18 A;  5E17 F;  4S0H B;  5E3L A;  4A3J J;  1R00 A;  4M3F A;  3O2P E;  2DN0 A;  2LFB A;  5BQT A;  3FUK A;  4ZW6 A;  4BEH B;  1D0Y A;  4FE7 A;  3TL4 X;  2HYJ A;  4FE4 A;  4A3F J;  3TQN A;  1SFE A;  3OOU A;  1Z77 A;  4UVB A;  5D6F A;  4GYG A;  4NQW B;  5AIP A;  4OMZ A;  1WGX A;  4A0X A;  4KN7 X;  4ZJZ A;  4ZYA A;  3MN2 A;  3ANL A;  4BEH A;  1USS A;  1IRX A;  1Z21 A;  4AWX B;  2BVM A;  2A6T A;  5EV7 A;  2NVT J;  3H3Z A;  2DDA A;  2DOF A;  1DP3 A;  2O8X A;  3FK6 A;  1JHF A;  1WPK A;  3H3V K;  2HOA A;  5CVR A;  2ZJQ F;  4XMT A;  5B5E C;  3FIS A;  1FOK A;  1Q1V A;  2KIU A;  4RAZ A;  2X1E A;  5FD6 A;  2H8R A;  1GHC A;  1MBJ A;  1WVR A;  4YIR X;  2QWW A;  3MKL A;  2OAZ A;  1T95 A;  2HI3 A;  1QVT A;  2KL4 A;  3H35 A;  2GOX B;  2L2O A;  4F93 B;  3JRD A;  3SFZ A;  4UUT A;  4CCM A;  4G6Q A;  4BUP A;  3MKZ A;  2R59 A;  1XSV A;  3QYB A;  5EJC A;  1IXS B;  1IRZ A;  1U5T C;  2FRH A;  1Y39 A;  3EBI A;  3Q0U A;  2RVC A;  4UUV A;  3R4K A;  2J5O A;  3EET A;  4YEJ A;  2XB5 A;  5HDG A;  1ZAO A;  1S29 A;  3NAR A;  3FUI A;  2ACJ A;  3VYT B;  2COB A;  2CRG A;  3K4M A;  3W6V A;  4S05 A;  1AU7 A;  4K5L A;  4IHT A;  1K79 A;  4G7H F;  3QPH A;  2KIQ A;  4NBQ A;  1X2M A;  3LAP A;  3G2B A;  5LFA A;  5FLX K;  1ZEL A;  3M8E A;  4F3Q A;  2LK2 A;  1D1A A;  4I98 B;  1MBG A;  2Y1C A;  3BCA A;  3BG3 A;  2STW A;  3DTE A;  3EDP A;  4OIR F;  4IEJ A;  4FTH A;  2Y1F A;  1FYL A;  3BR0 A;  1R4M B;  5FD5 A;  3A14 A;  4CYD A;  1QZZ A;  2HVR A;  2O3F A;  3RKQ A;  3K9T A;  5IYD J;  2PMH A;  5AEN A;  1H3L A;  2ELK A;  4UV9 A;  4XID A;  4A3E J;  3CHS A;  2F4M B;  4MKT A;  3BRO A;  1MJ9 A;  1W1W E;  2G9W A;  2HQ5 A;  2DMU A;  2DMN A;  4R8H A;  4KIG A;  5JBI A;  3A2K A;  2KZG A;  3ZQF A;  3RQI A;  1S6L A;  1Y8R B;  3EUK L;  4HA8 A;  1X1D A;  2NOG A;  2DPD A;  2L7K A;  5FKM A;  2DXI A;  3AUA A;  3P9I A;  1UCR A;  5LHI A;  2XAG A;  2YS9 A;  3SYT A;  1PUE E;  4R5X A;  1OYY A;  2XRN A;  2Y30 A;  3FTZ A;  2XC7 A;  1IUF A;  1I6X A;  2VOD A;  1YS7 A;  2EA4 A;  3KE2 A;  1WQ2 A;  2PI0 A;  1Z3X A;  3V7S A;  2NAZ A;  2QBY B;  2MW8 A;  5DD8 A;  2VJ5 A;  4PJ0 C;  1TTY A;  2P81 A;  3ABK H;  4YEL A;  3A0B C;  4ZYE A;  1M1E B;  2MLG A;  2P0W A;  4KT6 A;  2X6W A;  3B73 A;  4PJN A;  3TDU C;  2VKH A;  4ENK A;  3QRF F;  4RCV A;  3U21 A;  1X4P A;  1R5H A;  2PEX A;  3FTY A;  3G73 A;  2IT0 A;  4YIF A;  4A3B J;  2Q1Z B;  4ITV A;  1ZS2 A;  3U1D A;  1Z91 A;  2M8G X;  3ZN1 A;  3DBH B;  2YUS A;  3G71 I;  1HA8 A;  1YRN B;  2WV1 A;  1BBY A;  3EBG A;  3FF5 A;  1OR7 A;  4ANJ A;  2VT3 A;  1UAA A;  1MW2 A;  1X1P A;  2GQQ A;  1PJR A;  1R0L A;  2KMU A;  2EFW A;  1E2X A;  1VQO I;  4N9I A;  2CQK A;  2P5K A;  3M1E A;  5B1A H;  3GWZ A;  2DDB A;  5K5Q A;  1AHD P;  3PO2 J;  3LSR A;  4A12 A;  1MJA A;  4XBF A;  3CD6 I;  4YFK F;  3DPL C;  4FQG A;  4IVN A;  2R7V A;  2Y48 A;  1N78 A;  1IZ1 A;  2CUJ A;  3BJO A;  3ZCO A;  1ETX A;  1IN6 A;  3CZE A;  1JUM A;  3CTA A;  1G59 A;  1GDT A;  4XN4 A;  1FOX A;  1YJN I;  4EVI A;  2BHY A;  2HOT A;  1ETV A;  2LTP A;  4ZDP A;  2BGC A;  2YX4 A;  4M3G A;  2HFH A;  2N8G A;  4PZJ A;  2KIF A;  1H8A C;  5HLT A;  1AA7 A;  1Z05 A;  2W48 A;  4IHV A;  3I9V 2;  3MQ0 A;  1I3Q J;  4JX5 A;  4D7M A;  1RR8 C;  1VQ9 I;  3RZO J;  2R7S A;  3DKY A;  5B1B H;  1RPW A;  1I27 A;  2HQN A;  4BNC A;  1QRY A;  1FYM A;  3HUG B;  1I3A A;  3IAS 2;  5GP9 A;  4U7B A;  3KZI C;  3PIO F;  5EG0 B;  3J80 Z;  2EK5 A;  1JUS A;  1R49 A;  5LRR A;  4EMS A;  4M74 A;  1XDU A;  2OPT A;  1CF7 B;  2ELH A;  3JRG A;  3CHR A;  4NC6 A;  3Q43 A;  2L7Z A;  3CME I;  3QOP A;  2W57 A;  1BJZ A;  3SZG A;  3I0T A;  2QZ8 A;  1MJB A;  2VN2 A;  1KU3 A;  4A3C J;  4A3K J;  3HKZ A;  1O57 A;  5J47 A;  1HQC A;  2K9Q A;  3E7L A;  2WB1 A;  3PUB A;  1RKT A;  2QKL B;  4PK4 A;  2O0Y A;  4XL9 A;  3AG1 H;  2HPT A;  4FAS D;  1R1T A;  2R4G A;  2P5L C;  2EIN H;  4XO3 A;  3CF5 F;  1U6G A;  2ADU A;  2EV6 A;  3LSK A;  2K86 A;  5ILV A;  3EYI A;  3LSM A;  2A61 A;  4DPR A;  4B44 A;  2EB7 A;  1J9I A;  5AON A;  3KYL A;  5IT9 Z;  1A5J A;  1F4K A;  4Y7N J;  2V4J C;  1J09 A;  4Y6P A;  3KP4 A;  3K6G A;  4ZW7 A;  4BE1 A;  1SAX A;  1YE9 A;  4EJO A;  1A6Q A;  3ROU A;  4Y6S A;  2F5V A;  3E0J B;  2EBI A;  3LSI A;  1FBU A;  5KVR A;  3DP7 A;  4XKC A;  2MAP A;  5BOX A;  3B02 A;  1JT6 A;  3W3C A;  4DW6 A;  5CLS A;  2R7X A;  1BC8 C;  4UY8 I;  3E6M A;  1R71 A;  5LGN A;  1JJ8 C;  2W24 A;  2JSP A;  5DCM B;  1WJE A;  5ICE A;  3CC7 I;  1FMW A;  1HW5 A;  4RGR A;  3TO9 A;  2OTL I;  3QP5 A;  3D0S A;  4BXF A;  1R0K A;  2V26 A;  2Z2S B;  3J7A Y;  5D6E A;  1P2F A;  2CQN A;  4Q4E A;  3U2R A;  3ZQQ A;  4FX0 A;  3CIA A;  2KHM A;  3CO7 C;  2QLZ A;  2WB1 N;  2A05 A;  5GPA A;  3LA2 A;  1RES A;  1FOY A;  3TKY A;  2FFL A;  1QA6 A;  1T0F C;  4ABZ A;  1FBS A;  4PJL A;  4BDY A;  4U0Y A;  5E3N A;  3ZPL A;  1Z7U A;  1LFU P;  5EYR A;  1P4W A;  1XSX A;  1S8N A;  4NDL A;  3RKX A;  4E7L A;  4KFC A;  5L3E A;  2X0L A;  2ZME B;  1L0O C;  3I59 A;  2H1K A;  1VQ7 I;  1FT9 A;  5IP7 J;  3CJN A;  2LY9 A;  4LJZ F;  4ZQE A;  2EGH A;  3DPT A;  4ZQT A;  2NS0 A;  5J40 A;  2IGO A;  3DV8 A;  3LFU A;  1R36 A;  2P8T A;  1I5Z A;  4ZX6 A;  1ZGJ A;  1LQ1 A;  1SFK A;  3RYP A;  3FIW A;  4UB8 C;  4XKW A;  4EJT A;  2NYX A;  3V8L A;  2BYV E;  4AR9 A;  2QEN A;  4EEF G;  5F0F A;  2M7A A;  4EM0 B;  2VPL A;  3BR6 A;  1GXQ A;  1U5T B;  1Y8Q B;  3RJP A;  3OL3 A;  5JLX A;  3JT1 A;  2CGP A;  3FUJ A;  2L9R A;  3PSF A;  3H0D A;  3FTV A;  3QU3 A;  2O5R A;  2JPB A;  2JWT A;  3OR1 C;  1TNS A;  4LG0 A;  4ON0 A;  3FHN A;  3IWZ A;  1D8J A;  3CMM A;  1LPQ A;  2WTE A;  3GBG A;  4LIT A;  3LQR A;  3DQV C;  2PL5 A;  2IGN A;  5JNL A;  1WJA A;  2JN6 A;  4KJZ A;  2EIK H;  2G7H A;  1CQT A;  1GV5 A;  3SZP A;  5KCM A;  3F3X A;  1EF4 A;  1WI9 A;  2BHZ A;  2F5D A;  3ZHY A;  1OFC X;  3GTM J;  4C3J J;  4JYK A;  4R7L A;  1ONO A;  5A2Q Z;  3WE2 A;  2Z1D A;  1V5F A;  2GZW A;  4ASN A;  1YOV B;  2WAQ A;  4A03 A;  1JGG A;  2F2E A;  1HW2 A;  4WWC A;  4AYB A;  3SXY A;  4D5C A;  5E8G A;  3W6J B;  2XPY A;  5JLW A;  5LRS A;  1U2W A;  3RKW A;  1MMS A;  3OYM A;  2RRE A;  2LY1 A;  4CUG A;  2DFH A;  2WY8 Q;  2BY3 A;  2K27 A;  2ZME C;  3FXM A;  5J8C A;  4E7J A;  3WGH A;  4X6A J;  1U9O A;  2EWN A;  2ESN A;  5CPR B;  2OCE A;  2ESH A;  5BPI A;  2Z5U A;  2WA0 A;  1RC9 A;  3EUH A;  4U0V A;  3CDL A;  5FRM A;  3CZK A;  3F72 A;  2IP2 A;  2XB0 X;  3WHC A;  4GO1 A;  3PQK A;  4GAE A;  4G94 A;  1XS9 A;  3MZ8 A;  4DYC A;  2B63 J;  2M0M A;  5ILS A;  2KJC A;  3F8C A;  3KET A;  2HTS A;  1XC5 A;  4QWQ A;  4U88 A;  5FFZ A;  2NVY J;  3R60 A;  5CVJ A;  3JAM Z;  4XND A;  1XPX A;  2PLY A;  1X3W B;  1GVJ A;  3R0I A;  1FYK A;  3CMA I;  1JJ6 C;  1UZC A;  3FZV A;  1WH5 A;  5JMP A;  4ZQG A;  4XN1 A;  1U8B A;  1X1B A;  1B8I A;  2LR8 A;  1R1V A;  3IH2 A;  2WAD A;  3J7Y J;  4ZDO A;  3CUO A;  4Q4I A;  1D0Z A;  1Q0H A;  4PGG A;  4LIV A;  2JA7 J;  2PJP A;  4OOI A;  1SVM A;  2WAF A;  2GM4 A;  4RAG A;  1P92 A;  2ZJ2 A;  1K4T A;  2DJN A;  1S46 A;  4M72 A;  3MKW B;  1Y56 A;  3AAF A;  5EGO B;  3B2X A;  2E5N A;  3RKY A;  1U0J A;  4HV6 A;  1LFB A;  3M1C A;  4XLE A;  5D8K B;  2KT0 A;  3JRC A;  1RET A;  4ETS A;  3CCJ I;  2FJ1 A;  3V4G A;  2JUG A;  1N75 A;  2XAQ A;  3TBI A;  5F08 A;  5J6X A;  3WQR A;  3CDH A;  4LLN A;  3OYD A;  2VB6 A;  4XIC A;  4K5M A;  1G3T A;  4OAY A;  2IS4 A;  4NC7 A;  4AVP A;  1P9Q C;  3OY9 A;  4JND A;  3B6A A;  2PN6 A;  4PGH A;  2CSO A;  1FSE A;  3DEW A;  3HRS A;  1VZ0 A;  3PIP F;  2LF8 A;  4CIC A;  4D5F A;  2J5P A;  3CJR B;  4HAM A;  4S04 A;  1YRN A;  4M6X A;  3BCB A;  3IH4 A;  1W7P A;  5EEG A;  2ZBK A;  2C5Z A;  3OYI A;  2X51 A;  3OYJ A;  4MEY F;  2HU9 A;  3VOD A;  4CSW A;  3JRI A;  3PFY A;  2V1D A;  5J4Y A;  3PNV A;  1J0R A;  4KNY A;  3EQL F;  4G12 A;  5CYV A;  4C2U A;  3GTQ J;  3ZMV A;  2D5V A;  3TP0 A;  1RZ4 A;  2K9M A;  1D5Y A;  3W2A A;  3H9G A;  4ESF A;  5FJ8 J;  5L3G A;  3IC7 A;  1VTN C;  5ED4 A;  5CQE A;  3B7U X;  2P7C B;  3I71 A;  3FM5 A;  4CDG A;  1LDJ A;  5D5V B;  3S93 A;  1LEA A;  4IHY A;  5GAE J;  3ZQI A;  1O3Q A;  4OOF A;  3GTL J;  1RUN A;  3I59 B;  2DOE A;  4BJT A;  1IO2 A;  4QPO A;  2F5E A;  1WJF A;  1IN4 A;  2QJ1 A;  2W82 A;  3MAJ A;  4A3M J;  1IV8 A;  2PQ8 A;  4KN4 X;  4B3A A;  2XAF A;  3B7R L;  3W2V A;  3D5S C;  1ERD A;  4GCV A;  3TDZ C;  3OIO A;  2OA4 A;  1AKH A;  3H5A A;  1RKW A;  1PP7 U;  2HR3 A;  4GRI A;  4ZYH A;  4XLN F;  5E8I A;  3B3B A;  3L2V A;  4PJM A;  3QWL A;  2ETH A;  1YW7 A;  2CUF A;  2C82 A;  3KZY A;  2DK5 A;  2W84 A;  1ONV A;  1W5S A;  2VOP A;  2DW4 A;  2OF7 A;  3FKJ A;  2R3S A;  2KKO A;  2OQG A;  4Y13 A;  2ECC A;  4RB0 A;  2L7M P;  4Q47 A;  3I5U A;  1K4S A;  3E5Q A;  1TC3 C;  2JSC A;  1JTX A;  3W2W A;  3ZMD A;  1YHQ I;  4XN9 A;  2DK8 A;  3BTJ A;  3OMY A;  4B43 A;  4L0Z B;  1FSH A;  4AUX A;  3CUQ C;  2V9K A;  2WBM A;  2E2I J;  3G3Z A;  3FK7 A;  3CHO A;  3ZHX A;  2F4O B;  3JSP A;  1TWG J;  2WY7 Q;  2MH2 A;  1YLF A;  4II3 A;  1OCZ H;  1Y0U A;  3E3V A;  4N4N B;  1FC3 A;  2ZSI B;  2PJR A;  2R7Z J;  2IBD A;  5CVI A;  3DKW A;  3K70 C;  1IUY A;  5LGU A;  3CCU I;  1L3L A;  1AKH B;  1QU3 A;  2V6E A;  1O7F A;  2M4K A;  3VB2 A;  3WU2 C;  2QSG X;  2IS2 A;  3FTS A;  3BG5 A;  3DFG A;  2VKV A;  1VQK I;  4PDK A;  3Q9S A;  2GIV A;  2UV1 A;  4I99 C;  1JKQ C;  3B7S A;  3F8N A;  1EV7 A;  1P7I A;  3H92 A;  1GUU A;  2XPV A;  3KFW X;  4HLY A;  2HYG D;  5J1U A;  5CKT A;  4EGY A;  1UG0 A;  2FOW A;  5F04 A;  2VJJ A;  2F5C A;  1MND A;  3WU1 B;  3BZ6 A;  1ETQ A;  2WC2 A;  3IAM 2;  5EG0 A;  3OSG A;  3BJA A;  1GV2 A;  2PUS A;  1UHS A;  2GBY A;  3OYN A;  4FLQ A;  4P1W A;  1N77 A;  2QYO A;  5JR3 A;  4HV5 A;  4MQ9 F;  1ZRF A;  2DT5 A;  3ZOB A;  3LST A;  1YJW I;  2DPU A;  2XAH A;  4HSR A;  3MVP A;  3FUM A;  5FFX A;  5GTH C;  2XSD C;  1MW0 A;  5FRO A;  1H89 C;  3GLL A;  5M5X J;  4WXH A;  5HNF A;  2QA4 I;  3TOA A;  3QYF A;  5F64 A;  2A6E F;  1FTT A;  4L9V A;  2VIX A;  3I54 A;  5BNG A;  1LE8 B;  5E20 A;  4HNU A;  3HG9 A;  3KP7 A;  4KMF A;  1ZTR A;  2RN7 A;  4XNB A;  3JRH A;  4UUS B;  3NRV A;  3B34 A;  4HF0 A;  3H0G J;  2OTJ I;  5BS6 A;  2HEO A;  5BPP A;  3C2B A;  3OYC A;  1YO5 C;  1E3O C;  5J8F A;  2M4G A;  1J59 A;  2RDP A;  3R6S A;  3IUO A;  1ZLJ A;  3GXO A;  1BW6 A;  1ETW A;  3JSO A;  1ETY A;  3LL7 A;  3I55 I;  2QVW A;  3EUA A;  4QHP A;  1F43 A;  4HDV A;  5H2F C;  5DLL A;  4HRI A;  4RGX A;  4KIT B;  3FMQ A;  2DA4 A;  2R5Y B;  2E34 A;  4HLX A;  4RAY A;  2JA5 J;  2P7V B;  1P7J A;  1MNM C;  3SFI A;  3M8F A;  1WHU A;  1JKO C;  1RNL A;  4O5V A;  3NQO A;  4C2T A;  1ZR2 A;  1ZRC A;  3CCL I;  4IQJ A;  1K5H A;  4L5E A;  2DQM A;  5JAZ A;  1BM9 A;  1BI2 A;  1ETK A;  2FOK A;  4ZTJ A;  1W36 C;  4DZP A;  4ENM A;  4RGS A;  2MLK A;  3FKI J;  2R7O A;  1G2H A;  3KLN A;  4JX6 A;  3RYR A;  4I76 A;  4I7H A;  2CG4 A;  4W97 A;  2V1X A;  2RQQ A;  1YX3 A;  4G9Y A;  5KHD A;  2PMZ N;  2LBF A;  2MD5 A;  2RKH A;  3FUE A;  4B3X A;  3FXQ A;  2M5W A;  1SFO J;  2PGG A;  2L7F P;  4I01 A;  2Z16 A;  2KDO A;  3DKX A;  4HEA 2;  1ENH A;  2R5Z A;  2K5C A;  2LF7 A;  2VT2 A;  3FXK A;  4JP0 A;  3IIE A;  3C1D A;  3PM1 A;  3SJM A;  1XD7 A;  4KIS A;  3O3K A;  5IOZ A;  1DDN A;  3ASN H;  3O8G A;  3L2R A;  4Q48 A;  2IPQ X;  4HF1 A;  2HXI A;  3OSF A;  3PO3 J;  5TGT A;  4QPQ A;  1LB2 A;  1P4X A;  3S3M A;  2XGD A;  1V4R A;  3WTX C;  2LC2 A;  3F22 A;  2V1U A;  2M34 A;  3H5R A;  2MH9 A;  3WTU C;  3TGN A;  3ZN0 A;  1XX5 A;  4YII A;  1B72 B;  2JA2 A;  3HKZ N;  1PDN C;  4WXD A;  2GXG A;  3IHU A;  1EJ9 A;  2TCT A;  3CCY A;  5DEQ A;  5C4X J;  3WU0 A;  3BTL A;  3UER A;  1XMX A;  5DTD A;  2ZXG A;  5D8L B;  2NS8 A;  3IKV A;  4DOZ A;  1QZY A;  3CLO A;  1IV6 A;  4O3M A;  2MYS A;  5LHG A;  3HRM A;  3PUF A;  3ML6 A;  1OKR A;  1BR1 A;  1POG A;  2W85 A;  3AFH A;  3RC8 A;  5JMW A;  3MFK A;  1PYV A;  2JRM A;  5M5W J;  4XMW A;  2CQ7 A;  2ME6 A;  3ZQH A;  4OIQ F;  5HLI A;  4A6E A;  3F6O A;  4IRH A;  4Q5S F;  3HIF A;  5GAG J;  2NRA C;  1T1R A;  3K10 A;  3U1K A;  3HC7 A;  4LMY A;  4M3E A;  3OS0 A;  3HDD A;  1HDP A;  3ANN A;  3Q5F A;  3I64 A;  3S2W A;  4M9Z A;  3PUU A;  3RTR A;  4CO8 A;  3U9G A;  1HS6 A;  2DTZ A;  5D4R A;  3BR5 A;  3W6K B;  5CJ9 A;  2IJL A;  4UNO A;  5HOO A;  3QPS A;  5KAI C;  2BEO A;  2QBY A;  1WJ5 A;  4N4O B;  1Y0N A;  3VOE A;  1R1U A;  3JRB A;  2QEX I;  3HOV J;  4BQQ A;  4FT8 A;  1RR7 A;  4HDU A;  3GTG J;  2HZT A;  1HOM A;  3T0Y A;  2PBI A;  1QHG A;  3GZN B;  1YJ9 I;  3QAH A;  4L5I A;  2OUM A;  3JR9 A;  4Y15 A;  1T56 A;  4WK8 F;  3SZT A;  1TWA J;  1IXR C;  3GVA A;  1SAU A;  2K4J A;  1FLI A;  2FU4 A;  2A68 F;  3BPV A;  2JJ7 A;  2Y1E A;  2R5Z B;  2V6C A;  2R92 J;  4XN3 A;  2X6O A;  1Q0L A;  5L3D A;  4KUM A;  1WKM A;  2E35 A;  2M0C A;  4RVB A;  2K40 A;  3F0C A;  4ENJ A;  1S72 I;  4FLS A;  1XCB A;  3TW6 A;  1LKX A;  1G6N A;  4XOP A;  2LDU A;  4JQF A;  2OCC H;  3MCZ A;  1T39 A;  3C3W A;  3T8R A;  1ETO A;  3PQJ A;  4AIH A;  2OV7 A;  2AS5 F;  2UXN A;  5IYC J;  2PMZ A;  2BOL A;  4EM2 A;  4XOR A;  3JW4 A;  5ILU A;  1D1B A;  1JTY A;  2K4B A;  1NG7 A;  3BZC A;  4R1H A;  5C3E J;  2DFI A;  3ASO H;  1SAN A;  3GF2 A;  4L9T A;  3RPQ A;  1B4A A;  3I4M J;  2LNB A;  1WH7 A;  3BPX A;  3V7C A;  3CUQ A;  1R7J A;  2R70 A;  3CCQ I;  3N4M A;  2R93 J;  1T33 A;  5JVG F;  4A3G J;  2W00 A;  3QP6 A;  3FUL A;  1BR4 A;  1OYW A;  2VBX A;  2L0K A;  3HHH A;  4J19 A;  3K4B A;  4K2E A;  1ZH5 A;  1IDZ A;  3S1R J;  4A69 C;  1MH3 A;  4AR1 A;  3VVL A;  1J7K A;  4KYW A;  4A93 J;  4F92 B;  3T5X A;  3KIO A;  1BOB A;  1KON A;  1ZYR F;  1BN5 A;  2VBW A;  4PUS A;  4Y52 J;  4XKB A;  4E7K A;  3ABT A;  4MTD A;  2DFF A;  2PMU A;  3K1P A;  3BTC A;  3GEZ A;  4AYB N;  5EEA A;  3N05 A;  3I3L A;  1YW8 A;  1TT5 B;  2BXY A;  4CCO A;  3S16 J;  4OMY A;  1ZK8 A;  1REP C;  5FO5 A;  2HXO A;  2QSF X;  3HHG A;  2IGK A;  2DMQ A;  2DA7 A;  1LDK B;  2QSH X;  2WZG A;  2XAU A;  1RRJ A;  3CXB A;  4DYR A;  5TJJ A;  1YIT I;  1X3Z A;  5DCF A;  4RS8 A;  1Y1V J;  3CP2 A;  2W25 A;  3P9K A;  5FRN A;  4DJA A;  2CV0 A;  5D4S A;  5DUK A;  2JVH A;  3G4S I;  2XQ0 A;  5GTI C;  1VQP I;  2ZXH A;  3O6B B;  3K70 D;  3JCU C;  1NTC A;  5ICC A;  1QNT A;  3G1M A;  5DM7 F;  1D3Y A;  1G3W A;  1B1B A;  2XPW A;  1F36 A;  4YFN F;  3MD2 A;  5ERI A;  2MG4 A;  3S8P A;  1ON1 A;  2XHK A;  6PAX A;  5LEK A;  3QPL A;  2JD0 A;  3GTJ J;  2V9V A;  3BG6 A;  3KPH A;  4X0G A;  3FXO A;  3KEY A;  3CQZ J;  3V8K A;  3A02 A;  5BPD A;  3E97 A;  1HBX G;  1PUF A;  2VQL A;  3QJX A;  2G7U A;  4I02 A;  1PUF B;  4D9J A;  2XGX A;  1VFC A;  2V9P A;  2DA1 A;  4M3D A;  3OYA A;  2MFZ A;  4BE0 A;  2RJI A;  1XG1 A;  4BY1 J;  2DI3 A;  1BI1 A;  4RDU A;  3X2Q H;  3HRU A;  1A31 A;  2WWY A;  3CCR I;  2F48 A;  1KZH A;  3DBR B;  3CJQ B;  2OC6 A;  5E3O A;  1TP4 A;  1D8K A;  2XUB A;  4DGW B;  1W0U A;  3ZI0 A;  3S2H J;  1IN5 A;  1KGS A;  3KYC B;  2IA2 A;  5HLH A;  2CV2 A;  3FUD A;  3K2A A;  1AOY A;  2HWV A;  2XRL A;  2AHQ A;  2PFB A;  1IC8 A;  2CFX A;  3DF8 A;  3I58 A;  2ZJP F;  2VQH A;  2FBH A;  4BQN A;  3ESW B;  3TO7 A;  1TWF J;  1T2K A;  1TBX A;  3HPG A;  2BVL A;  3CZG A;  3Q3S A;  3GFI A;  4G8X A;  3GME A;  3A01 A;  2CS3 A;  3ISP A;  4MQV A;  3V42 A;  2FSW A;  2V79 A;  3LFK A;  3A1Y A;  3L2Q A;  3FHZ A;  3JRA A;  3CCM I;  3BR2 A;  1G3Y A;  1WJC A;  4FCY A;  3PNT A;  1IW7 F;  1W7P B;  5JFR A;  4BXX J;  4PU2 A;  1V5E A;  2EZK A;  1H9T A;  1DPR A;  3LSJ A;  4M71 A;  4IZZ A;  4MO7 A;  3BC8 A;  4HST A;  3M4O J;  5IY5 H;  2DQL A;  4E7S A;  2COM A;  3FU5 A;  3HXL A;  5TRD A;  2VXZ A;  2IRF G;  3DTK A;  3IP4 B;  1LNW A;  3A01 B;  4Y6R A;  2JCX A;  2LY2 A;  3VDX A;  3UR3 C;  1T8I A;  1G4D A;  5FLV A;  4ZC3 A;  1R9T J;  1UMQ A;  3C2H A;  3OIP A;  4A5N A;  3E6C C;  4LIU A;  4G7O F;  4EV0 A;  4KT5 C;  1FIP A;  2FD5 A;  1HKT A;  1OPC A;  4R79 A;  1R4N B;  1SD6 A;  4I0B A;  1P6R A;  5DD4 A;  1MBF A;  2QF7 A;  5J3L A;  3CUQ B;  5D5U B;  4XRM A;  2Y75 A;  1T08 B;  3NWS A;  1FEX A;  1TZL A;  2EV0 A;  4XNF A;  2D1H A;  1F1Z A;  2R7W A;  4BBS J;  2EFO A;  1SG7 A;  2D1V A;  3K7A J;  4RM2 A;  3HOZ J;  4WX9 A;  2Y1D A;  4UB6 C;  5IP9 J;  1LUJ B;  4B47 A;  2RC4 A;  1MZB A;  2LKS A;  4AIJ A;  4RM3 A;  3B6C A;  2I5U A;  4BHB A;  2A5W A;  5B3S H;  3FX3 A;  3FH8 A;  3L00 A;  5DDG A;  4A2U A;  4QTR A;  2Y31 A;  2O03 A;  2JT1 A;  2MC4 A;  3FH7 A;  2JA6 J;  1EA3 A;  1OIS A;  2DA2 A;  1R58 A;  2DT7 B;  1HKQ A;  2L5Q A;  4P9U A;  3S2D J;  5J1Y A;  4IHW A;  3ZXS A;  5ICF A;  4IL6 C;  1FNN A;  4LG3 A;  3RIR A;  3HEF A;  2NVU B;  3VFZ A;  4NB5 A;  3PL8 A;  3CC2 I;  4G7Z F;  2K9S A;  2Y9Z A;  3MMY B;  3RC3 A;  3LAJ A;  4J01 A;  3GTP J;  2QGU A;  4ESB A;  1FPQ A;  2XAS A;  5EGO A;  4DZJ A;  1UHM A;  2EH3 A;  3TP3 A;  2O9L A;  3G1O A;  3CMY A;  2ZC2 A;  1WCM J;  2VPR A;  2YR2 A;  2VKE A;  2ZJR F;  4HNV A;  4CGZ A;  1UEL B;  3IRR A;  3BG9 A;  2JTV A;  4BXU A;  3OYB A;  1MSE C;  4N0B A;  1N25 A;  1Z6R A;  4BBR J;  5DYF A;  5H6Q A;  1B8I B;  3V8J A;  2EFP A;  2HDC A;  5E79 C;  1JGS A;  4P5O A;  1XDS A;  3V7R A;  2CW7 A;  4LGW A;  3OS2 A;  3ZQL A;  1S5L C;  3K69 A;  4LLG F;  3GO5 A;  2A69 F;  1ZKG A;  1TWC J;  4QME A;  3O8H A;  2Y0M A;  1LVA A;  3OV8 A;  5K5O A;  2HVS A;  1F9N A;  3KEO A;  3J81 K;  1O3R A;  2R7F A;  3OYE A;  1K6Y A;  1U3E M;  2P5V A;  2E60 A;  1YFH A;  2ZO4 A;  2X6X A;  1YI2 I;  3AU8 A;  4B8X A;  3GZ6 A;  4XK4 A;  4LG0 B;  1MNE A;  2DJI A;  3GCM A;  2Z9O A;  4KIF A;  2RV8 A;  1VQ5 I;  3KP5 A;  2PJR B;  1IAW A;  3KCC A;  4NUB A;  4XRS G;  4C3H J;  1MBH A;  4HBL A;  2Y0S N;  1WSU A;  2MAB A;  3SQN A;  1X3U A;  2DCE A;  5LHH A;  4XRS A;  2Q2E B;  4C3I J;  2A3S A;  1ZGW A;  4PFO A;  4XN2 A;  4X2U A;  4CCJ A;  2QCO A;  1BI0 A;  1OCR H;  3AL0 B;  4BAC A;  1QHH D;  2KIS A;  2ZFW A;  5FGM A;  3EBH A;  5C44 J;  1FIA A;  2GTQ A;  3VYU B;  5LLQ A;  5KNL A;  3HM5 A;  5K7Z A;  1FZP B;  4PSX A;  2K9N A;  1S7A A;  4FIS A;  2Z99 A;  3ABU A;  3M8J A;  2IS1 A;  2YX7 A;  3HGG A;  2CMP A;  2KIM A;  1KA8 A;  1ZG5 A;  4C9Y A;  1K61 A;  2JD2 A;  4CZZ A;  2HOE A;  3S14 J;  1HLV A;  1F5T A;  2BZT A;  3ZMZ A;  4Z2Y A;  2QQ8 A;  4UVC A;  3F8F A;  3MWM A;  3MZH A;  2VLA A;  3L2C A;  5E3M A;  2E1M C;  5FLM J;  4B09 A;  1YIO A;  2O7O A;  2L9S A;  1SD5 A;  3A4C A;  2BY0 A;  3NWT A;  4JBA A;  2OD5 A;  4HQE A;  2AXL A;  1OMI A;  2EIL H;  4EJU A;  3R0A A;  4LK1 F;  2CUE A;  2E19 A;  2M7B A;  4V2G A;  1B59 A;  2XKO A;  4RAF A;  4CZC A;  1ZHF A;  3S17 J;  3RCO A;  5F0H A;  1MH4 A;  4BGD A;  2DO7 A;  4LD5 A;  3RDI A;  2HPM A;  4Y67 A;  2HNH A;  2DA3 A;  3D5R C;  2E36 A;  4BHC A;  2KLO A;  2LD5 A;  3S3N A;  2E1C A;  2YPR A;  4UV8 A;  1WZ2 A;  4BY7 J;  1Q0Q A;  1WI3 A;  5M3F J;  3RQ4 A;  2CO5 A;  4D1Q A;  2VON A;  1S9H A;  3GZ5 A;  2VJI A;  2K02 A;  3HGY A;  4FLR A;  4CA0 A;  2LMD A;  1X1C A;  2Q2E A;  1QBJ A;  4EM1 A;  3JRE A;  3F8M A;  4XKV A;  2DAO A;  2B0L A;  2MGQ A;  2H1L A;  2JMW A;  4DBQ A;  4IOA F;  2GXB A;  2X1C A;  2LLK A;  1OR7 C;  4B4C A;  3M3Y J;  4L2L A;  4XN8 A;  1B9N A;  1NK2 P;  3RAS A;  5K7H A;  1R5I D;  2TRT A;  4MTE A;  4ARF A;  5FKL A;  1ZG3 A;  2QM3 A;  3S1Q J;  1T38 A;  4AU7 A;  2GAU A;  3FWE A;  1XMA A;  3IV5 A;  4CH7 A;  4RB3 C;  3CP8 A;  3BDD A;  3B37 A;  2H09 A;  3FU0 A;  3AG3 H;  5JHF A;  2F5F A;  4XMZ A;  4J3B A;  3KZZ A;  5IPA A;  3IRQ A;  5L3C A;  1MKM A;  1FX7 A;  2HVQ A;  2FBK A;  1VI0 A;  5JO0 A;  1OLT A;  1ORK A;  3GUD A;  4PCQ A;  4L9N A;  3RPU A;  5M3M J;  1B72 A;  3KP2 A;  5F1R A;  2Z33 A;  2ZNY A;  2LVS A;  3HUG A;  3WG7 H;  4BKX A;  4HPQ A;  1K6O A;  2WAE A;  1YS6 A;  4I09 A;  2A6H F;  4F7Z A;  3WTW C;  1SFU A;  3FUF A;  4K5P A;  2DOA A;  1VQM I;  4A3D J;  4EJW A;  2GA2 A;  1Z6T A;  3DWL E;  3BT9 A;  2VKD A;  4NQW A;  4IRG A;  1XMK A;  2XKP A;  3ERM A;  2BY1 A;  4RMN A;  2O7G A;  1X3Z B;  2AQE A;  1FMV A;  2FBI A;  3FXR A;  2L02 A;  1A36 A;  3CES A;  3KP6 A;  2E2J J;  3ZMS A;  2B61 A;  1OJL A;  1T98 A;  4GXO A;  1P4A A;  4HX7 A;  2IGM A;  4Y4R A;  5EDN A;  1SMT A;  1Z67 A;  1GW6 A;  3A06 A;  1WFX A;  1O7L A;  1J5Y A;  1NHA A;  2KPM A;  1HST A;  3EYY A;  1PVE A;  1OCO H;  2DA5 A;  3BZK A;  5A2Q K;  1IN8 A;  2FML A;  2ZCW A;  2F4I A;  3NAU A; 
#chains in the Genus database with same CATH homology
 2BW3 A;  2E1M B;  1SAU A;  4ZQE A;  2EGH A;  3L2U A;  2Y1E A;  3RPU D;  3DPT A;  4ZQT A;  3DPU A;  1Z3Y A;  2KP6 A;  3JSZ A;  2IGO A;  2LRE A;  3LFU A;  4RLQ A;  4XN3 A;  1Q0L A;  1Z7L A;  1MW1 A;  4ZX6 A;  2ELJ A;  3UNG C;  4PSW A;  1DGW Y;  1SFK A;  1TT0 A;  4XKW A;  2A7O A;  4RVB A;  4XMU A;  4E4H A;  4RLF A;  1GLN A;  4BJ6 C;  4FLS A;  4AR9 A;  4QUO A;  2M7A A;  1LKX A;  4XOP A;  4B48 A;  2VPL A;  1MW3 A;  4JQF A;  4H4K C;  4LUP A;  3OL3 A;  3JT1 A;  4DBR A;  3FH5 A;  3FUJ A;  4XR6 A;  3OYL A;  3PSF A;  3H0D A;  3FTV A;  3TMO A;  2O5R A;  3OR1 C;  2OV7 A;  3OIQ A;  4CCL A;  3FHN A;  3AL0 C;  2XF6 A;  2PMZ A;  3CMM A;  2QKM B;  2BOL A;  3GBG A;  4LIT A;  4XOR A;  2FUG 2;  3DQV C;  1D1B A;  3DU5 A;  1JG9 A;  2IGN A;  2LOO A;  2PL5 A;  5JNL A;  1WJA A;  4IQ4 A;  3PJR A;  2F6C A;  1X1A A;  3FU3 A;  1NG7 A;  3LSH A;  4KJZ A;  5KCM A;  2K3P A;  3ZGK A;  1MMD A;  3B7T A;  4OOE A;  3CZL A;  3ZHY A;  4R7L A;  2IXS A;  1ONO A;  3K4L A;  5HNH A;  3ZRG A;  1MMA A;  2R70 A;  2Y1G A;  2Z1D A;  2UWM A;  2Y0S A;  1V5F A;  4A03 A;  2WAQ A;  3EPZ A;  4OAZ A;  2R7U A;  3H9Q A;  2W00 A;  2DT6 A;  3S3O A;  3FUL A;  1BR4 A;  1DGR M;  4AYB A;  2R7R A;  3K4B A;  3SEQ A;  4FCA A;  2KQR A;  2HDW A;  2XPY A;  2IS6 A;  3B2P A;  4XO4 A;  4AR1 A;  1WJB A;  4AVZ A;  3VVL A;  3FUN A;  2KZV A;  3VYS B;  4F92 B;  4F55 A;  3OYM A;  2RRE A;  1BOB A;  2XDV A;  2MAO A;  2LY1 A;  4E6K G;  4CUG A;  4ZX3 A;  1KON A;  3PNY A;  1G5A A;  1G8X A;  2VQG A;  4PUS A;  2WY8 Q;  4PFP A;  4XKB A;  4E7K A;  3AU9 A;  4E7J A;  3K4J A;  3N05 A;  3I3L A;  4CCO A;  4RSY A;  5CPR B;  1LFP A;  5CQG A;  3QYE A;  2WA0 A;  1H19 A;  2VAS A;  5FRM A;  2IGK A;  4IKF A;  3CZK A;  3Q44 A;  3UCQ A;  3UEQ A;  3WQS B;  3MKY B;  1LDK B;  2WZG A;  3FTU A;  2XAU A;  4XN0 A;  3FUH A;  4GAE A;  2M0M A;  2V7F A;  1X3Z A;  3HL2 A;  3FTW A;  4CCK A;  3CP2 A;  3C2G A;  4ZW5 A;  5FRN A;  2VXD A;  4DJA A;  2CV0 A;  4XND A;  3R0I A;  4XN7 A;  3ONQ A;  1MMN A;  4BJ5 C;  2JVH A;  2XQ0 A;  5JMP A;  2CW8 A;  1WJD A;  2CFO A;  4XN1 A;  4ZQG A;  1ONP A;  1X1B A;  1JGI A;  2WAD A;  2ZXH A;  3FTX A;  4ZDO A;  4Q4I A;  3K70 D;  4AR8 A;  1D0Z A;  4ZDL A;  1Q0H A;  3FHE A;  4LIV A;  5JC1 A;  4HG2 A;  2WAF A;  1ONN A;  4R5T A;  4QIR A;  4ZW8 A;  3MD2 A;  1S46 A;  1YX5 A;  3S8P A;  1Y56 A;  3MKW B;  1DQU A;  3KX2 A;  2JD0 A;  3B2X A;  2E5N A;  1MVY A;  1U0J A;  3BG6 A;  3VSK A;  4X0G A;  3L2W A;  2ZFU A;  3M1C A;  3KEY A;  4XLE A;  3H5N A;  2HQA A;  4BU2 A;  4GAA A;  2VQL A;  2VQC A;  3QJX A;  2JUG A;  1N75 A;  3HPH A;  3TBI A;  5HVQ C;  4R5V A;  4D9J A;  3WQR A;  3CHP A;  4J00 A;  3ZHZ A;  3OYA A;  2MFZ A;  2VB6 A;  3OYD A;  4BE0 A;  2RJI A;  2GOM A;  2VJ4 A;  2R7T A;  4K5M A;  4OAY A;  4JOM A;  2IS4 A;  4NC7 A;  3DLA A;  1P9Q C;  3OY9 A;  4JND A;  1X3W A;  3PSI A;  2R72 A;  4ZW3 A;  2MD0 A;  3CJQ B;  2OC6 A;  1VZ0 A;  5LD2 C;  3S32 A;  4DGW B;  3ZI0 A;  3CJR B;  3BCB A;  2WPG A;  2NOJ B;  3FUD A;  2CV2 A;  4XMV A;  2LH9 A;  2C5Z A;  3OYI A;  4XNA A;  2X51 A;  3OYJ A;  3OYG A;  2HU9 A;  3BLY A;  2LYC A;  2KRH A;  4XON A;  4C30 A;  4CSW A;  3PFY A;  3QOE A;  2UUZ A;  1NG6 A;  4BE2 A;  3PNV A;  2VQH A;  2HZD A;  3K4K A;  2W1O A;  4C2U A;  4BQN A;  3EUH C;  4XMY A;  2K9M A;  3W2A A;  3HPG A;  2BVL A;  3CZG A;  3H9G A;  4QPE A;  3QOD A;  2XPZ A;  2CS3 A;  2K9L A;  5CQE A;  3V42 A;  3B7U X;  3FUK A;  4ZW6 A;  3A1Y A;  4F91 B;  3DEE A;  4BEH B;  1D0Y A;  3TL4 X;  3L2Q A;  1MW7 A;  3S93 A;  1WJC A;  3PNT A;  4OOF A;  3U9W A;  4PU2 A;  4PVB A;  3OOU A;  1V5E A;  3VWB A;  4NQW B;  4BJT A;  4IZZ A;  4QPO A;  3BC8 A;  4HST A;  3CHQ A;  4ZJZ A;  4ZYA A;  1WJF A;  2QJ1 A;  3ANL A;  2W82 A;  4E7S A;  4BEH A;  3FU5 A;  3HXL A;  1IRX A;  2WZF A;  2VXZ A;  3DTK A;  1X19 A;  1Z21 A;  3B7R L;  3FU6 A;  2BVM A;  2A6T A;  3D5S C;  3IP4 B;  3W2V A;  1ERD A;  4Y6R A;  5EV7 A;  2JCX A;  1DP3 A;  2LY2 A;  3CF2 A;  3VDX A;  5FWQ A;  3UR3 C;  3H5A A;  4XMT A;  4ZC3 A;  3C2H A;  3OIP A;  4GRI A;  4LIU A;  4IX7 A;  2X1E A;  3B3B A;  1MMG A;  3LMM A;  3L2V A;  4PJM A;  4R79 A;  1T95 A;  2KL4 A;  3H35 A;  2C82 A;  2GOX B;  2L2O A;  4F93 B;  3WQQ A;  4CCM A;  3BG7 A;  4BUP A;  3SEZ A;  3MKZ A;  2R59 A;  3QYB A;  3FKJ A;  3NWS A;  1TZL A;  3EBI A;  4ZQF A;  4XNF A;  4XO5 A;  2L9N A;  2R7W A;  1SG7 A;  4YEJ A;  4RM2 A;  2Y1D A;  3W2W A;  4B47 A;  4XN9 A;  4RM3 A;  3FUI A;  2A5W A;  3OMY A;  4B43 A;  3VYT B;  3FH8 A;  2V9K A;  2WBM A;  3K4M A;  3E1S A;  2JVG A;  4U87 A;  3CHO A;  4ZTF A;  4K5L A;  3ZHX A;  2MC4 A;  4Y33 A;  3FH7 A;  4YRV A;  2DQ6 A;  4FLO A;  2WY7 Q;  2XF5 A;  3G2B A;  5LFA A;  1EA3 A;  1ZEL A;  4II3 A;  4BS9 A;  4F3Q A;  5DUL A;  2DT7 B;  1D1A A;  4N4N B;  2ZSI B;  2PJR A;  2Y1C A;  2L5Q A;  3BCA A;  3DTE A;  3ZXS A;  4LG3 A;  3K70 C;  2Y1F A;  3PL8 A;  1QU3 A;  2V6E A;  3A14 A;  2M4K A;  2HVR A;  2IS2 A;  3FTS A;  3MMY B;  4NNJ A;  3RC3 A;  4J01 A;  4G6T B;  3VYR B;  1E0E A;  5AEN A;  1H3L A;  4F52 A;  3CHS A;  4MKT A;  2UV1 A;  3B7S A;  4ZX5 A;  5JBI A;  5CKT A;  3A2K A;  1UG0 A;  4PW4 A;  1UEL B;  2VJJ A;  2X1D A;  1MND A;  3EUK L;  3OYB A;  1X1D A;  5DYF A;  3VVM A;  3IAM 2;  2L7K A;  2DXI A;  3AUA A;  4ZN6 A;  4P5O A;  3SYT A;  4XLC A;  2CW7 A;  3OS2 A;  2LRD A;  1SQM A;  2RNG A;  3OYN A;  2PUS A;  4P1W A;  3FTZ A;  4FLQ A;  4R5X A;  2XC7 A;  1N77 A;  2CV1 A;  3OYF A;  4QME A;  1Z3X A;  3RSN A;  1W36 D;  2HVS A;  4HSR A;  1SC5 A;  3FUM A;  4BQO A;  3ZR8 X;  1MW0 A;  2VJ5 A;  5FRO A;  4XLA A;  3OYE A;  1K6Y A;  4YEL A;  5HNF A;  4KT6 A;  2P0W A;  2E60 A;  3QYF A;  2X6W A;  2X6X A;  4PJN A;  3AU8 A;  2VIX A;  4RCV A;  2VKH A;  2W7N A;  3U21 A;  1X4P A;  3FTY A;  4HNU A;  3FDY A;  1MNE A;  2DJI A;  3HG9 A;  4AIC A;  4XNB A;  3D5L A;  3B34 A;  2Q1Z B;  4ITV A;  2PJR B;  1ZS2 A;  2VJ8 A;  2CUZ A;  2X85 A;  4NUB A;  5BPP A;  4XOT A;  3OYC A;  2M4G A;  1HA8 A;  2MAB A;  3EBG A;  3IUO A;  4CXF A;  1OR7 A;  3OR2 C;  4ANJ A;  2DCE A;  1UAA A;  1MW2 A;  2Q2E B;  1R0L A;  1PJR A;  4QHP A;  2KMU A;  3LL7 A;  1X4O A;  3EUA A;  2QVW A;  4K5N A;  4PFO A;  4XN2 A;  1Y6I A;  2M3A A;  4X2U A;  5DLL A;  4HRI A;  4CCJ A;  4KIT B;  2XF7 A;  3AL0 B;  4BAC A;  1QHH D;  4BL0 B;  2JCY A;  4HNT A;  3EBH A;  3DPL C;  1T1S A;  2R7V A;  2GTQ A;  2JV7 A;  3VYU B;  5KNL A;  2ZSH B;  1N78 A;  2ZXI A;  2CUJ A;  4PSX A;  3ZCO A;  3F9K A;  4C2T A;  3CZE A;  3M8J A;  3OYH A;  2IS1 A;  2JD1 A;  2LBF B;  3OS1 A;  1G59 A;  4IQJ A;  1K5H A;  2CMP A;  4XN4 A;  2DQM A;  5JAZ A;  4DIQ A;  4C9Y A;  2JD2 A;  4MLO A;  1D0X A;  1LVK A;  4ZDP A;  3HOS A;  4ZTJ A;  1W36 C;  2VLA A;  3FBN B;  4E7H A;  2KRC A;  1AA7 A;  2R7O A;  2E1M C;  5HLT A;  3I9V 2;  2L9S A;  3A4C A;  3NWT A;  2R7S A;  3DKY A;  3VSL A;  2RQQ A;  1YX3 A;  5KHD A;  4XN5 A;  2M7B A;  3HUG B;  2LBF A;  3IAS 2;  3LSG A;  4CZC A;  4U7B A;  3FUE A;  4B3X A;  2PGG A;  3RCO A;  2Z16 A;  2KDO A;  4FET A;  4XM3 A;  4BGD A;  3DKX A;  3KED A;  4ZQH A;  2HPM A;  4HEA 2;  4Y67 A;  2HNH A;  2K5C A;  4II2 A;  3CHR A;  3D5R C;  3S3N A;  2BW3 B;  2KLO A;  3IIE A;  2LG4 A;  3Q43 A;  4KIS A;  1RP3 A;  1Q0Q A;  3RQ4 A;  4D1Q A;  4EAT A;  1S9H A;  3L2R A;  3SZG A;  2VJI A;  2JCV A;  4FLR A;  1JVS A;  4E7Z A;  5TGT A;  4CA0 A;  1X1C A;  2E5Z A;  4QPQ A;  3HKZ A;  4K5O A;  3S3M A;  4XKV A;  2LC2 A;  3SDB A;  2WB1 A;  3PUB A;  4CCN A;  2QKL B;  3H5R A;  2AQF A;  4DBQ A;  4XLF A;  2X1C A;  4PK4 A;  1OR7 C;  4XL9 A;  4L2L A;  4XN8 A;  2HPT A;  4FAS D;  2R4G A;  2CH0 A;  3T8V A;  4XO3 A;  2JA2 A;  3LSK A;  3RAS A;  2HPI A;  3CZ6 A;  2V1N A;  3LSM A;  4DPR A;  4B44 A;  3UER A;  2VL8 A;  4ARF A;  2ZXG A;  3KYL A;  4DOZ A;  4AU7 A;  2V4J C;  2MYS A;  3DTI A;  4AYS A;  1J09 A;  3B37 A;  4CH7 A;  4Y6P A;  3CP8 A;  1BR1 A;  3K6G A;  3FU0 A;  3OWT A;  4ZW7 A;  4XLH A;  5JHF A;  4XMZ A;  3HOT A;  4BE1 A;  4J3B A;  1YE9 A;  4Y6S A;  3AFH A;  2F5V A;  3RC8 A;  3E0J B;  3LSI A;  5JMW A;  3AKZ A;  2HVQ A;  1PYV A;  4XKC A;  4XMW A;  2MAP A;  1JI8 A;  5JO0 A;  1OLT A;  3W3C A;  2R7X A;  1R6R A;  2JSP A;  1WJE A;  1T1R A;  1FMW A;  3K10 A;  4PJJ A;  4BXF A;  1R0K A;  2V26 A;  2Z2S B;  3HC7 A;  3J7A Y;  4Q4E A;  3OS0 A;  1BR2 A;  3K4N A;  3ZQQ A;  3ANN A;  4BKX A;  4HPQ A;  2WAE A;  4E7I A;  4OWR B;  3FUF A;  3CIA A;  3DU6 A;  4K5P A;  2DOA A;  2HPO A;  4MS6 A;  3PUU A;  2XSJ C;  2KHM A;  3RTR A;  3DWL E;  4XQF A;  2VKD A;  4NQW A;  1D1C A;  1HS6 A;  1V5G A;  3H9J A;  4RMN A;  2O7G A;  3ANM A;  2AQE A;  2W4S A;  1FMV A;  2R7Q A;  3OYK A;  2FFL A;  1T0F C;  5HOO A;  3CES A;  4PJL A;  4BDY A;  3FBI B;  2I8D A;  3K4C A;  4Y3O A;  2B61 A;  1WJ5 A;  4N4O B;  3OL4 A;  2IGM A;  4Y4R A;  4BQQ A;  4KP7 A;  1GW6 A;  3A06 A;  1WFX A;  4NC8 A;  4E7L A;  3T0Y A;  2KPM A;  1QHG A;  4XMX A;  4ZX4 A;  2OUM A;  4BDZ A;  2F4I A;  2X6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...