2O7GA

Crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
TASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Probable RNA polymerase sigma-C factor
publication title Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 36
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2o7gA00
2EGHA 1SC5A 3T0YA 4RCVA 3A06A 3CZGA 1Q0QA 1OR7A 2MAPA 2Y1FA 3ANNA 3CZEA 3RASA 3AU8A 3WQQA 1H3LA 1MW1A 1JGIA 4OOFA 4ZQFA 3CZLA 4FLQA 1ONNA 3UCQA 3ZHXA 5JNLA 2JCYA 2MAOA 4LUPA 3AU9A 3WQRA 1Q0HA 4ZQGA 1Q0LA 4ZQEA 1JG9A 4FLSA 1MW2A 2JCXA 1JVSA 1T1RA 4GAEA 4AICA 3UERA 5DULA 4ZQHA 2WPGA 2Y1CA 3A14A 3UEQA 2Y1EA 2Y1GA 1S46A 1MW0A 1RP3A 4FLRA 2JCVA 2O7GA 3R0IA 5JMWA 4AYSA 3IIEA 3ZI0A 1MW3A 4OOEA 4CXFA 4Y6SA 1MVYA 3AUAA 5JO0A 1ZS2A 3CZKA 4FLOA 3WQSB 5JAZA 3ANLA 1ONOA 1ONPA 2Y1DA 1R0LA 2C82A 2JD0A 4Y6RA 3ZHZA 5JMPA 3ZHYA 5JBIA 5JC1A 4KP7A 4Y67A 3ANMA 4NQWA 1K5HA 1R0KA 1T1SA 2JD2A 1G5AA 4A03A 2JD1A 4Y6PA 4ZN6A
chains in the Genus database with same CATH superfamily
2EGHA 3EBHA 1SC5A 3B2XA 4XN8A 3T0YA 4RCVA 4ARFA 3FULA 4XN7A 4XNBA 2GTQA 3B2PA 3A06A 3CZGA 3FU6A 3HW2A 1SG7A 2B61A 4ZQTA 3RC8A 1Q0QA 3FU3A 4XN5A 1OR7A 4AR9A 2Y1FA 3ANNA 2MAPA 3CZEA 1GW6A 3RASA 4FCAA 4ZX3A 3CHSA 4L2LA 3AU8A 3WQQA 4QHPA 4J3BA 3FUIA 4R5TA 1H3LA 1HS6A 1MW1A 4QMEA 1JGIA 3FTYA 3FTUA 4QIRA 3B37A 4OOFA 3CHPA 2VJ8A 4ZQFA 3KEDA 4AR1A 3CZLA 3FUFA 3VVLA 4FLQA 5BPPA 4Q4EA 4XN1A 4XNDA 1ONNA 3UCQA 4XMZA 4X2UA 3ZHXA 1X3ZA 3B7RL 3B7TA 4XN9A 5JNLA 2JCYA 2MAOA 4XN2A 3CHQA 4LUPA 2PL5A 3AU9A 2ZXGA 4XMTA 4K5PA 3FH5A 3JT1A 4MS6A 3WQRA 1Q0HA 4ZQGA 4ZX4A 3EBGA 1Q0LA 3CHRA 4XO3A 4XMWA 2WZFA 4R5VA 4R7LA 3FUJA 4ZQEA 4ZW7A 4DPRA 3FUMA 1JG9A 4FLSA 1MW2A 3B3BA 4XO4A 5DYFA 2JCXA 4Q4IA 1JVSA 1T1RA 4K5MA 4GAEA 4AICA 3B34A 2QJ1A 3FTWA 3UERA 3CHOA 5DULA 4AR8A 4ZQHA 3RC3A 2PGGA 2PUSA 4XMVA 2WPGA 2Y1CA 4ZX5A 2R72A 3A14A 4K5OA 3UEQA 3FTVA 5HLTA 4R5XA 3CIAA 1SQMA 2Y1EA 3PUUA 4PU2A 4XMXA 3FUKA 4RVBA 2Y1GA 2C5ZA 1S46A 2WZGA 1MW0A 1RP3A 2DQ6A 2JCVA 4FLRA 2O7GA 4ZW5A 2XPZA 4ZW3A 5HNFA 3R0IA 4PVBA 3FU5A 5JMWA 4AYSA 3IIEA 3ZI0A 2HPOA 2XPYA 1MW3A 4OOEA 4CXFA 2R59A 4XNAA 3B7UX 4Y6SA 3FH8A 1MVYA 3FTXA 3AUAA 4K5NA 2HPTA 3U9WA 5JO0A 2VLAA 3FHEA 1ZS2A 4ZW8A 4ZX6A 3CZKA 1H19A 2QVWA 3FTZA 4RSYA 5HNHA 4FLOA 3WQSB 3VVMA 3FUNA 5AENA 3QJXA 5JAZA 3ANLA 4BKXA 1ONOA 1ONPA 4XO5A 2Y1DA 1R0LA 3T8VA 2C82A 2FFLA 2JD0A 4MKTA 3FUDA 3FUEA 4Y6RA 2DQMA 5JMPA 3ZHYA 3ZHZA 2RJIA 3FH7A 5JBIA 3FTSA 4XMUA 5JC1A 2A7OA 4KP7A 4GAAA 1X3WA 4Y67A 3FU0A 3ANMA 4K5LA 4NQWA 4PW4A 5EV7A 5DLLA 1K5HA 1R0KA 5FWQA 1T1SA 2R70A 2JV7A 4ZW6A 2JD2A 3B7SA 4QUOA 1G5AA 4A03A 2XQ0A 2JD1A 3EBIA 4Y6PA 4JNDA 4XN4A 3CXBA 3JSZA 4ZN6A 3Q43A 3Q44A 4QPEA 3FUHA
chains in the Genus database with same CATH topology
2EGHA 3EBHA 1SC5A 3B2XA 4XN8A 3T0YA 4RCVA 4ARFA 3FULA 4XN7A 4XNBA 2GTQA 3B2PA 3A06A 3CZGA 3FU6A 1SG7A 2B61A 4ZQTA 3RC8A 1Q0QA 3FU3A 4XN5A 1OR7A 4AR9A 2Y1FA 3ANNA 2MAPA 3CZEA 1GW6A 3RASA 4FCAA 4ZX3A 3CHSA 4L2LA 3AU8A 3WQQA 4QHPA 4J3BA 3FUIA 4R5TA 1H3LA 1HS6A 1MW1A 4QMEA 1JGIA 3FTYA 3FTUA 4QIRA 3B37A 4OOFA 3CHPA 2VJ8A 4ZQFA 3KEDA 4AR1A 3CZLA 3FUFA 3VVLA 4FLQA 5BPPA 4Q4EA 4XN1A 4XNDA 1ONNA 3UCQA 4XMZA 4X2UA 3ZHXA 1X3ZA 3B7RL 3B7TA 4XN9A 5JNLA 2JCYA 2MAOA 4XN2A 3CHQA 4LUPA 2PL5A 3AU9A 2ZXGA 4XMTA 4K5PA 3FH5A 3JT1A 4MS6A 3WQRA 1Q0HA 4ZQGA 4ZX4A 3EBGA 1Q0LA 3CHRA 4XO3A 4XMWA 2WZFA 4R5VA 4R7LA 3FUJA 4ZQEA 4ZW7A 4DPRA 3FUMA 1JG9A 4FLSA 1MW2A 3B3BA 4XO4A 5DYFA 2JCXA 4Q4IA 1JVSA 1T1RA 4K5MA 4GAEA 4AICA 3B34A 2QJ1A 3FTWA 3UERA 3CHOA 5DULA 4AR8A 4ZQHA 3RC3A 2PGGA 2PUSA 4XMVA 2WPGA 2Y1CA 4ZX5A 2R72A 3A14A 4K5OA 3UEQA 3FTVA 5HLTA 4R5XA 3CIAA 1SQMA 2Y1EA 3PUUA 4PU2A 4XMXA 3FUKA 4RVBA 2Y1GA 2C5ZA 1S46A 2WZGA 1MW0A 1RP3A 2DQ6A 2JCVA 4FLRA 2O7GA 4ZW5A 2XPZA 4ZW3A 5HNFA 3R0IA 4PVBA 3FU5A 5JMWA 4AYSA 3IIEA 3ZI0A 2HPOA 2XPYA 1MW3A 4OOEA 4CXFA 2R59A 4XNAA 3B7UX 4Y6SA 3FH8A 1MVYA 3FTXA 3AUAA 4K5NA 2HPTA 3U9WA 5JO0A 2VLAA 3FHEA 1ZS2A 4ZW8A 4ZX6A 3CZKA 1H19A 2QVWA 3FTZA 4RSYA 5HNHA 4FLOA 3WQSB 3VVMA 3FUNA 5AENA 3QJXA 5JAZA 3ANLA 4BKXA 1ONOA 1ONPA 4XO5A 2Y1DA 1R0LA 3T8VA 2C82A 2FFLA 2JD0A 4MKTA 3FUDA 3FUEA 4Y6RA 2DQMA 5JMPA 3ZHYA 3ZHZA 2RJIA 3FH7A 5JBIA 3FTSA 4XMUA 5JC1A 2A7OA 4KP7A 4GAAA 1X3WA 4Y67A 3FU0A 3ANMA 4K5LA 4NQWA 4PW4A 5EV7A 5DLLA 1K5HA 1R0KA 5FWQA 1T1SA 2R70A 2JV7A 4ZW6A 2JD2A 3B7SA 4QUOA 1G5AA 4A03A 2XQ0A 2JD1A 3EBIA 4Y6PA 4JNDA 4XN4A 3JSZA 4ZN6A 3Q43A 3Q44A 4QPEA 3FUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGH A;  1SC5 A;  3T0Y A;  4RCV A;  3A06 A;  3CZG A;  1Q0Q A;  1OR7 A;  2MAP A;  2Y1F A;  3ANN A;  3CZE A;  3RAS A;  3AU8 A;  3WQQ A;  1H3L A;  1MW1 A;  1JGI A;  4OOF A;  4ZQF A;  3CZL A;  4FLQ A;  1ONN A;  3UCQ A;  3ZHX A;  5JNL A;  2JCY A;  2MAO A;  4LUP A;  3AU9 A;  3WQR A;  1Q0H A;  4ZQG A;  1Q0L A;  4ZQE A;  1JG9 A;  4FLS A;  1MW2 A;  2JCX A;  1JVS A;  1T1R A;  4GAE A;  4AIC A;  3UER A;  5DUL A;  4ZQH A;  2WPG A;  2Y1C A;  3A14 A;  3UEQ A;  2Y1E A;  2Y1G A;  1S46 A;  1MW0 A;  1RP3 A;  4FLR A;  2JCV A;  2O7G A;  3R0I A;  5JMW A;  4AYS A;  3IIE A;  3ZI0 A;  1MW3 A;  4OOE A;  4CXF A;  4Y6S A;  1MVY A;  3AUA A;  5JO0 A;  1ZS2 A;  3CZK A;  4FLO A;  3WQS B;  5JAZ A;  3ANL A;  1ONO A;  1ONP A;  2Y1D A;  1R0L A;  2C82 A;  2JD0 A;  4Y6R A;  3ZHZ A;  5JMP A;  3ZHY A;  5JBI A;  5JC1 A;  4KP7 A;  4Y67 A;  3ANM A;  4NQW A;  1K5H A;  1R0K A;  1T1S A;  2JD2 A;  1G5A A;  4A03 A;  2JD1 A;  4Y6P A;  4ZN6 A; 
#chains in the Genus database with same CATH topology
 2EGH A;  3EBH A;  1SC5 A;  3B2X A;  4XN8 A;  3T0Y A;  4RCV A;  4ARF A;  3FUL A;  4XN7 A;  4XNB A;  2GTQ A;  3B2P A;  3A06 A;  3CZG A;  3FU6 A;  3HW2 A;  1SG7 A;  2B61 A;  4ZQT A;  3RC8 A;  1Q0Q A;  3FU3 A;  4XN5 A;  1OR7 A;  4AR9 A;  2Y1F A;  3ANN A;  2MAP A;  3CZE A;  1GW6 A;  3RAS A;  4FCA A;  4ZX3 A;  3CHS A;  4L2L A;  3AU8 A;  3WQQ A;  4QHP A;  4J3B A;  3FUI A;  4R5T A;  1H3L A;  1HS6 A;  1MW1 A;  4QME A;  1JGI A;  3FTY A;  3FTU A;  4QIR A;  3B37 A;  4OOF A;  3CHP A;  2VJ8 A;  4ZQF A;  3KED A;  4AR1 A;  3CZL A;  3FUF A;  3VVL A;  4FLQ A;  5BPP A;  4Q4E A;  4XN1 A;  4XND A;  1ONN A;  3UCQ A;  4XMZ A;  4X2U A;  3ZHX A;  1X3Z A;  3B7R L;  3B7T A;  4XN9 A;  5JNL A;  2JCY A;  2MAO A;  4XN2 A;  3CHQ A;  4LUP A;  2PL5 A;  3AU9 A;  2ZXG A;  4XMT A;  4K5P A;  3FH5 A;  3JT1 A;  4MS6 A;  3WQR A;  1Q0H A;  4ZQG A;  4ZX4 A;  3EBG A;  1Q0L A;  3CHR A;  4XO3 A;  4XMW A;  2WZF A;  4R5V A;  4R7L A;  3FUJ A;  4ZQE A;  4ZW7 A;  4DPR A;  3FUM A;  1JG9 A;  4FLS A;  1MW2 A;  3B3B A;  4XO4 A;  5DYF A;  2JCX A;  4Q4I A;  1JVS A;  1T1R A;  4K5M A;  4GAE A;  4AIC A;  3B34 A;  2QJ1 A;  3FTW A;  3UER A;  3CHO A;  5DUL A;  4AR8 A;  4ZQH A;  3RC3 A;  2PGG A;  2PUS A;  4XMV A;  2WPG A;  2Y1C A;  4ZX5 A;  2R72 A;  3A14 A;  4K5O A;  3UEQ A;  3FTV A;  5HLT A;  4R5X A;  3CIA A;  1SQM A;  2Y1E A;  3PUU A;  4PU2 A;  4XMX A;  3FUK A;  4RVB A;  2Y1G A;  2C5Z A;  1S46 A;  2WZG A;  1MW0 A;  1RP3 A;  2DQ6 A;  2JCV A;  4FLR A;  2O7G A;  4ZW5 A;  2XPZ A;  4ZW3 A;  5HNF A;  3R0I A;  4PVB A;  3FU5 A;  5JMW A;  4AYS A;  3IIE A;  3ZI0 A;  2HPO A;  2XPY A;  1MW3 A;  4OOE A;  4CXF A;  2R59 A;  4XNA A;  3B7U X;  4Y6S A;  3FH8 A;  1MVY A;  3FTX A;  3AUA A;  4K5N A;  2HPT A;  3U9W A;  5JO0 A;  2VLA A;  3FHE A;  1ZS2 A;  4ZW8 A;  4ZX6 A;  3CZK A;  1H19 A;  2QVW A;  3FTZ A;  4RSY A;  5HNH A;  4FLO A;  3WQS B;  3VVM A;  3FUN A;  5AEN A;  3QJX A;  5JAZ A;  3ANL A;  4BKX A;  1ONO A;  1ONP A;  4XO5 A;  2Y1D A;  1R0L A;  3T8V A;  2C82 A;  2FFL A;  2JD0 A;  4MKT A;  3FUD A;  3FUE A;  4Y6R A;  2DQM A;  5JMP A;  3ZHY A;  3ZHZ A;  2RJI A;  3FH7 A;  5JBI A;  3FTS A;  4XMU A;  5JC1 A;  2A7O A;  4KP7 A;  4GAA A;  1X3W A;  4Y67 A;  3FU0 A;  3ANM A;  4K5L A;  4NQW A;  4PW4 A;  5EV7 A;  5DLL A;  1K5H A;  1R0K A;  5FWQ A;  1T1S A;  2R70 A;  2JV7 A;  4ZW6 A;  2JD2 A;  3B7S A;  4QUO A;  1G5A A;  4A03 A;  2XQ0 A;  2JD1 A;  3EBI A;  4Y6P A;  4JND A;  4XN4 A;  3CXB A;  3JSZ A;  4ZN6 A;  3Q43 A;  3Q44 A;  4QPE A;  3FUH A; 
#chains in the Genus database with same CATH homology
 2EGH A;  3EBH A;  1SC5 A;  3B2X A;  4XN8 A;  3T0Y A;  4RCV A;  4ARF A;  3FUL A;  4XN7 A;  4XNB A;  2GTQ A;  3B2P A;  3A06 A;  3CZG A;  3FU6 A;  1SG7 A;  2B61 A;  4ZQT A;  3RC8 A;  1Q0Q A;  3FU3 A;  4XN5 A;  1OR7 A;  4AR9 A;  2Y1F A;  3ANN A;  2MAP A;  3CZE A;  1GW6 A;  3RAS A;  4FCA A;  4ZX3 A;  3CHS A;  4L2L A;  3AU8 A;  3WQQ A;  4QHP A;  4J3B A;  3FUI A;  4R5T A;  1H3L A;  1HS6 A;  1MW1 A;  4QME A;  1JGI A;  3FTY A;  3FTU A;  4QIR A;  3B37 A;  4OOF A;  3CHP A;  2VJ8 A;  4ZQF A;  3KED A;  4AR1 A;  3CZL A;  3FUF A;  3VVL A;  4FLQ A;  5BPP A;  4Q4E A;  4XN1 A;  4XND A;  1ONN A;  3UCQ A;  4XMZ A;  4X2U A;  3ZHX A;  1X3Z A;  3B7R L;  3B7T A;  4XN9 A;  5JNL A;  2JCY A;  2MAO A;  4XN2 A;  3CHQ A;  4LUP A;  2PL5 A;  3AU9 A;  2ZXG A;  4XMT A;  4K5P A;  3FH5 A;  3JT1 A;  4MS6 A;  3WQR A;  1Q0H A;  4ZQG A;  4ZX4 A;  3EBG A;  1Q0L A;  3CHR A;  4XO3 A;  4XMW A;  2WZF A;  4R5V A;  4R7L A;  3FUJ A;  4ZQE A;  4ZW7 A;  4DPR A;  3FUM A;  1JG9 A;  4FLS A;  1MW2 A;  3B3B A;  4XO4 A;  5DYF A;  2JCX A;  4Q4I A;  1JVS A;  1T1R A;  4K5M A;  4GAE A;  4AIC A;  3B34 A;  2QJ1 A;  3FTW A;  3UER A;  3CHO A;  5DUL A;  4AR8 A;  4ZQH A;  3RC3 A;  2PGG A;  2PUS A;  4XMV A;  2WPG A;  2Y1C A;  4ZX5 A;  2R72 A;  3A14 A;  4K5O A;  3UEQ A;  3FTV A;  5HLT A;  4R5X A;  3CIA A;  1SQM A;  2Y1E A;  3PUU A;  4PU2 A;  4XMX A;  3FUK A;  4RVB A;  2Y1G A;  2C5Z A;  1S46 A;  2WZG A;  1MW0 A;  1RP3 A;  2DQ6 A;  2JCV A;  4FLR A;  2O7G A;  4ZW5 A;  2XPZ A;  4ZW3 A;  5HNF A;  3R0I A;  4PVB A;  3FU5 A;  5JMW A;  4AYS A;  3IIE A;  3ZI0 A;  2HPO A;  2XPY A;  1MW3 A;  4OOE A;  4CXF A;  2R59 A;  4XNA A;  3B7U X;  4Y6S A;  3FH8 A;  1MVY A;  3FTX A;  3AUA A;  4K5N A;  2HPT A;  3U9W A;  5JO0 A;  2VLA A;  3FHE A;  1ZS2 A;  4ZW8 A;  4ZX6 A;  3CZK A;  1H19 A;  2QVW A;  3FTZ A;  4RSY A;  5HNH A;  4FLO A;  3WQS B;  3VVM A;  3FUN A;  5AEN A;  3QJX A;  5JAZ A;  3ANL A;  4BKX A;  1ONO A;  1ONP A;  4XO5 A;  2Y1D A;  1R0L A;  3T8V A;  2C82 A;  2FFL A;  2JD0 A;  4MKT A;  3FUD A;  3FUE A;  4Y6R A;  2DQM A;  5JMP A;  3ZHY A;  3ZHZ A;  2RJI A;  3FH7 A;  5JBI A;  3FTS A;  4XMU A;  5JC1 A;  2A7O A;  4KP7 A;  4GAA A;  1X3W A;  4Y67 A;  3FU0 A;  3ANM A;  4K5L A;  4NQW A;  4PW4 A;  5EV7 A;  5DLL A;  1K5H A;  1R0K A;  5FWQ A;  1T1S A;  2R70 A;  2JV7 A;  4ZW6 A;  2JD2 A;  3B7S A;  4QUO A;  1G5A A;  4A03 A;  2XQ0 A;  2JD1 A;  3EBI A;  4Y6P A;  4JND A;  4XN4 A;  3JSZ A;  4ZN6 A;  3Q43 A;  3Q44 A;  4QPE A;  3FUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...