2O7GA

Crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
TASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable RNA polymerase sigma-C factor
total genus 36
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2o7gA00
2JD2A 5DULA 4ZQEA 1RP3A 5JBIA 4KP7A 1H3LA 2JCYA 1R0LA 1JGIA 3UEQA 1MVYA 2EGHA 1JG9A 3ZHXA 3ANMA 3A06A 3CZLA 1G5AA 4LUPA 4GAEA 2O7GA 1ONPA 3UCQA 1Q0QA 1JVSA 1SC5A 1S46A 4ZQHA 1ONNA 2Y1CA 4FLOA 4FLRA 3ANNA 3IIEA 2MAOA 4Y6SA 1T1RA 4A03A 3UERA 2JCXA 1T1SA 5JO0A 2Y1GA 4Y67A 4ZN6A 3ZI0A 3CZEA 1MW0A 3WQRA 4AICA 3A14A 2Y1FA 4ZQFA 3T0YA 4OOFA 5JC1A 3CZGA 2WPGA 1K5HA 3R0IA 2Y1DA 2MAPA 2JCVA 4CXFA 3WQSB 4NQWA 5JNLA 1ZS2A 1MW3A 4OOEA 2JD1A 1MW2A 1Q0LA 4FLQA 5JMWA 4Y6RA 1OR7A 4Y6PA 2C82A 3ANLA 1Q0HA 5JAZA 3AUAA 3AU9A 2Y1EA 4FLSA 3WQQA 4AYSA 3AU8A 3CZKA 1MW1A 2JD0A 3ZHZA 1ONOA 3ZHYA 1R0KA 5JMPA 3RASA 4ZQGA 4RCVA
chains in the Genus database with same CATH superfamily
3JT1A 4XMVA 4AR9A 4ZW5A 2JD2A 2XPZA 4K5LA 5DULA 2WZGA 4PVBA 4ZQEA 1RP3A 5JBIA 3Q44A 2R59A 3B7SA 4KP7A 1H3LA 2JCYA 3FUIA 1R0LA 1JGIA 3FTZA 1MVYA 4XN4A 3UEQA 4ZW3A 4DPRA 3B34A 3FUMA 2EGHA 3B2PA 4FCAA 1JG9A 3ZHXA 4XN5A 3FUFA 3FUHA 3ANMA 4K5PA 4XO3A 3FH5A 4PU2A 2QJ1A 3CHRA 3VVMA 5HNFA 2GTQA 5HNHA 3FU0A 4XN8A 1H19A 3A06A 3CZLA 1G5AA 1SG7A 4XO5A 4XNDA 4LUPA 4GAEA 2O7GA 1ONPA 2WZFA 1GW6A 4R5XA 3UCQA 1Q0QA 1JVSA 1SC5A 4XMUA 1S46A 4XN2A 4ZQHA 3FTWA 1ONNA 3EBIA 2HPOA 3FTXA 2VJ8A 4QMEA 2Y1CA 4FLOA 4XN1A 4FLRA 3ANNA 4XNBA 4BKXA 3IIEA 4QPEA 3B7TA 4ZW8A 2MAOA 2A7OA 4L2LA 3B37A 3B7UX 5BPPA 3FTVA 4Y6SA 4ZW6A 4PW4A 1T1RA 4A03A 4XMTA 5DYFA 4ZX3A 4XMZA 2B61A 4R5TA 3UERA 2JCXA 2HPTA 3FU6A 4QHPA 1T1SA 3U9WA 5JO0A 4XN9A 3CHQA 3FTYA 2QVWA 3RC3A 4ARFA 2Y1GA 2PUSA 3VVLA 3PUUA 2DQMA 4Y67A 4ZN6A 4JNDA 3FH7A 4ZQTA 3ZI0A 4XMWA 3CZEA 2C5ZA 1MW0A 3FHEA 4MS6A 4R5VA 3FU3A 3WQRA 4AICA 3A14A 3EBHA 2Y1FA 4XNAA 4ZQFA 3T0YA 4OOFA 2PL5A 5JC1A 3CZGA 3HW2A 2WPGA 3CHOA 1K5HA 3R0IA 4AR1A 3CHPA 4J3BA 3FUJA 2Y1DA 2DQ6A 4RSYA 3RC8A 4Q4EA 3CHSA 2R70A 2MAPA 4ZW7A 2JCVA 3FULA 5DLLA 4CXFA 3WQSB 3CXBA 4NQWA 5JNLA 4ZX6A 1ZS2A 4MKTA 3QJXA 1HS6A 3FTSA 5EV7A 4K5NA 4AR8A 1MW3A 4OOEA 4R7LA 2JD1A 1MW2A 1X3ZA 2VLAA 3B3BA 4GAAA 1Q0LA 3EBGA 3FTUA 3FU5A 4FLQA 5JMWA 4X2UA 4Y6RA 1OR7A 2ZXGA 3B7RL 3FH8A 4Y6PA 4K5MA 5AENA 2XQ0A 3KEDA 2C82A 3ANLA 1Q0HA 5JAZA 3AUAA 3AU9A 3FUNA 4XN7A 2PGGA 2Y1EA 4FLSA 3WQQA 2FFLA 3AU8A 3FUDA 4QUOA 4AYSA 3CZKA 2XPYA 4XO4A 4ZX4A 1MW1A 3Q43A 2JD0A 2RJIA 2R72A 3ZHZA 3FUKA 1ONOA 1X3WA 3FUEA 3T8VA 3ZHYA 1R0KA 5JMPA 3B2XA 5FWQA 4QIRA 4RVBA 4XMXA 3CIAA 3RASA 4ZQGA 5HLTA 4ZX5A 4Q4IA 2JV7A 1SQMA 4K5OA 3JSZA 4RCVA
chains in the Genus database with same CATH topology
3JT1A 4XMVA 4AR9A 4ZW5A 2JD2A 2XPZA 4K5LA 5DULA 2WZGA 4PVBA 4ZQEA 1RP3A 5JBIA 3Q44A 2R59A 3B7SA 4KP7A 1H3LA 2JCYA 3FUIA 1R0LA 1JGIA 3FTZA 1MVYA 4XN4A 3UEQA 4ZW3A 4DPRA 3B34A 3FUMA 2EGHA 3B2PA 4FCAA 1JG9A 3ZHXA 4XN5A 3FUFA 3FUHA 3ANMA 4K5PA 4XO3A 3FH5A 4PU2A 2QJ1A 3CHRA 3VVMA 5HNFA 2GTQA 5HNHA 3FU0A 4XN8A 1H19A 3A06A 3CZLA 1G5AA 1SG7A 4XO5A 4XNDA 4LUPA 4GAEA 2O7GA 1ONPA 2WZFA 1GW6A 4R5XA 3UCQA 1Q0QA 1JVSA 1SC5A 4XMUA 1S46A 4XN2A 4ZQHA 3FTWA 1ONNA 3EBIA 2HPOA 3FTXA 2VJ8A 4QMEA 2Y1CA 4FLOA 4XN1A 4FLRA 3ANNA 4XNBA 4BKXA 3IIEA 4QPEA 3B7TA 4ZW8A 2MAOA 2A7OA 4L2LA 3B37A 3B7UX 5BPPA 3FTVA 4Y6SA 4ZW6A 4PW4A 1T1RA 4A03A 4XMTA 5DYFA 4ZX3A 4XMZA 2B61A 4R5TA 3UERA 2JCXA 2HPTA 3FU6A 4QHPA 1T1SA 3U9WA 5JO0A 4XN9A 3CHQA 3FTYA 2QVWA 3RC3A 4ARFA 2Y1GA 2PUSA 3VVLA 3PUUA 2DQMA 4Y67A 4ZN6A 4JNDA 3FH7A 4ZQTA 3ZI0A 4XMWA 3CZEA 2C5ZA 1MW0A 3FHEA 4MS6A 4R5VA 3FU3A 3WQRA 4AICA 3A14A 3EBHA 2Y1FA 4XNAA 4ZQFA 3T0YA 4OOFA 2PL5A 5JC1A 3CZGA 2WPGA 3CHOA 1K5HA 3R0IA 4AR1A 3CHPA 4J3BA 3FUJA 2Y1DA 2DQ6A 4RSYA 3RC8A 4Q4EA 3CHSA 2R70A 2MAPA 4ZW7A 2JCVA 3FULA 5DLLA 4CXFA 3WQSB 4NQWA 5JNLA 4ZX6A 1ZS2A 4MKTA 3QJXA 1HS6A 3FTSA 5EV7A 4K5NA 4AR8A 1MW3A 4OOEA 4R7LA 2JD1A 1MW2A 1X3ZA 2VLAA 3B3BA 4GAAA 1Q0LA 3EBGA 3FTUA 3FU5A 4FLQA 5JMWA 4X2UA 4Y6RA 1OR7A 2ZXGA 3B7RL 3FH8A 4Y6PA 4K5MA 5AENA 2XQ0A 3KEDA 2C82A 3ANLA 1Q0HA 5JAZA 3AUAA 3AU9A 3FUNA 4XN7A 2PGGA 2Y1EA 4FLSA 3WQQA 2FFLA 3AU8A 3FUDA 4QUOA 4AYSA 3CZKA 2XPYA 4XO4A 4ZX4A 1MW1A 3Q43A 2JD0A 2RJIA 2R72A 3ZHZA 3FUKA 1ONOA 1X3WA 3FUEA 3T8VA 3ZHYA 1R0KA 5JMPA 3B2XA 5FWQA 4QIRA 4RVBA 4XMXA 3CIAA 3RASA 4ZQGA 5HLTA 4ZX5A 4Q4IA 2JV7A 1SQMA 4K5OA 3JSZA 4RCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD2 A;  5DUL A;  4ZQE A;  1RP3 A;  5JBI A;  4KP7 A;  1H3L A;  2JCY A;  1R0L A;  1JGI A;  3UEQ A;  1MVY A;  2EGH A;  1JG9 A;  3ZHX A;  3ANM A;  3A06 A;  3CZL A;  1G5A A;  4LUP A;  4GAE A;  2O7G A;  1ONP A;  3UCQ A;  1Q0Q A;  1JVS A;  1SC5 A;  1S46 A;  4ZQH A;  1ONN A;  2Y1C A;  4FLO A;  4FLR A;  3ANN A;  3IIE A;  2MAO A;  4Y6S A;  1T1R A;  4A03 A;  3UER A;  2JCX A;  1T1S A;  5JO0 A;  2Y1G A;  4Y67 A;  4ZN6 A;  3ZI0 A;  3CZE A;  1MW0 A;  3WQR A;  4AIC A;  3A14 A;  2Y1F A;  4ZQF A;  3T0Y A;  4OOF A;  5JC1 A;  3CZG A;  2WPG A;  1K5H A;  3R0I A;  2Y1D A;  2MAP A;  2JCV A;  4CXF A;  3WQS B;  4NQW A;  5JNL A;  1ZS2 A;  1MW3 A;  4OOE A;  2JD1 A;  1MW2 A;  1Q0L A;  4FLQ A;  5JMW A;  4Y6R A;  1OR7 A;  4Y6P A;  2C82 A;  3ANL A;  1Q0H A;  5JAZ A;  3AUA A;  3AU9 A;  2Y1E A;  4FLS A;  3WQQ A;  4AYS A;  3AU8 A;  3CZK A;  1MW1 A;  2JD0 A;  3ZHZ A;  1ONO A;  3ZHY A;  1R0K A;  5JMP A;  3RAS A;  4ZQG A;  4RCV A; 
#chains in the Genus database with same CATH topology
 3JT1 A;  4XMV A;  4AR9 A;  4ZW5 A;  2JD2 A;  2XPZ A;  4K5L A;  5DUL A;  2WZG A;  4PVB A;  4ZQE A;  1RP3 A;  5JBI A;  3Q44 A;  2R59 A;  3B7S A;  4KP7 A;  1H3L A;  2JCY A;  3FUI A;  1R0L A;  1JGI A;  3FTZ A;  1MVY A;  4XN4 A;  3UEQ A;  4ZW3 A;  4DPR A;  3B34 A;  3FUM A;  2EGH A;  3B2P A;  4FCA A;  1JG9 A;  3ZHX A;  4XN5 A;  3FUF A;  3FUH A;  3ANM A;  4K5P A;  4XO3 A;  3FH5 A;  4PU2 A;  2QJ1 A;  3CHR A;  3VVM A;  5HNF A;  2GTQ A;  5HNH A;  3FU0 A;  4XN8 A;  1H19 A;  3A06 A;  3CZL A;  1G5A A;  1SG7 A;  4XO5 A;  4XND A;  4LUP A;  4GAE A;  2O7G A;  1ONP A;  2WZF A;  1GW6 A;  4R5X A;  3UCQ A;  1Q0Q A;  1JVS A;  1SC5 A;  4XMU A;  1S46 A;  4XN2 A;  4ZQH A;  3FTW A;  1ONN A;  3EBI A;  2HPO A;  3FTX A;  2VJ8 A;  4QME A;  2Y1C A;  4FLO A;  4XN1 A;  4FLR A;  3ANN A;  4XNB A;  4BKX A;  3IIE A;  4QPE A;  3B7T A;  4ZW8 A;  2MAO A;  2A7O A;  4L2L A;  3B37 A;  3B7U X;  5BPP A;  3FTV A;  4Y6S A;  4ZW6 A;  4PW4 A;  1T1R A;  4A03 A;  4XMT A;  5DYF A;  4ZX3 A;  4XMZ A;  2B61 A;  4R5T A;  3UER A;  2JCX A;  2HPT A;  3FU6 A;  4QHP A;  1T1S A;  3U9W A;  5JO0 A;  4XN9 A;  3CHQ A;  3FTY A;  2QVW A;  3RC3 A;  4ARF A;  2Y1G A;  2PUS A;  3VVL A;  3PUU A;  2DQM A;  4Y67 A;  4ZN6 A;  4JND A;  3FH7 A;  4ZQT A;  3ZI0 A;  4XMW A;  3CZE A;  2C5Z A;  1MW0 A;  3FHE A;  4MS6 A;  4R5V A;  3FU3 A;  3WQR A;  4AIC A;  3A14 A;  3EBH A;  2Y1F A;  4XNA A;  4ZQF A;  3T0Y A;  4OOF A;  2PL5 A;  5JC1 A;  3CZG A;  3HW2 A;  2WPG A;  3CHO A;  1K5H A;  3R0I A;  4AR1 A;  3CHP A;  4J3B A;  3FUJ A;  2Y1D A;  2DQ6 A;  4RSY A;  3RC8 A;  4Q4E A;  3CHS A;  2R70 A;  2MAP A;  4ZW7 A;  2JCV A;  3FUL A;  5DLL A;  4CXF A;  3WQS B;  3CXB A;  4NQW A;  5JNL A;  4ZX6 A;  1ZS2 A;  4MKT A;  3QJX A;  1HS6 A;  3FTS A;  5EV7 A;  4K5N A;  4AR8 A;  1MW3 A;  4OOE A;  4R7L A;  2JD1 A;  1MW2 A;  1X3Z A;  2VLA A;  3B3B A;  4GAA A;  1Q0L A;  3EBG A;  3FTU A;  3FU5 A;  4FLQ A;  5JMW A;  4X2U A;  4Y6R A;  1OR7 A;  2ZXG A;  3B7R L;  3FH8 A;  4Y6P A;  4K5M A;  5AEN A;  2XQ0 A;  3KED A;  2C82 A;  3ANL A;  1Q0H A;  5JAZ A;  3AUA A;  3AU9 A;  3FUN A;  4XN7 A;  2PGG A;  2Y1E A;  4FLS A;  3WQQ A;  2FFL A;  3AU8 A;  3FUD A;  4QUO A;  4AYS A;  3CZK A;  2XPY A;  4XO4 A;  4ZX4 A;  1MW1 A;  3Q43 A;  2JD0 A;  2RJI A;  2R72 A;  3ZHZ A;  3FUK A;  1ONO A;  1X3W A;  3FUE A;  3T8V A;  3ZHY A;  1R0K A;  5JMP A;  3B2X A;  5FWQ A;  4QIR A;  4RVB A;  4XMX A;  3CIA A;  3RAS A;  4ZQG A;  5HLT A;  4ZX5 A;  4Q4I A;  2JV7 A;  1SQM A;  4K5O A;  3JSZ A;  4RCV A; 
#chains in the Genus database with same CATH homology
 3JT1 A;  4XMV A;  4AR9 A;  4ZW5 A;  2JD2 A;  2XPZ A;  4K5L A;  5DUL A;  2WZG A;  4PVB A;  4ZQE A;  1RP3 A;  5JBI A;  3Q44 A;  2R59 A;  3B7S A;  4KP7 A;  1H3L A;  2JCY A;  3FUI A;  1R0L A;  1JGI A;  3FTZ A;  1MVY A;  4XN4 A;  3UEQ A;  4ZW3 A;  4DPR A;  3B34 A;  3FUM A;  2EGH A;  3B2P A;  4FCA A;  1JG9 A;  3ZHX A;  4XN5 A;  3FUF A;  3FUH A;  3ANM A;  4K5P A;  4XO3 A;  3FH5 A;  4PU2 A;  2QJ1 A;  3CHR A;  3VVM A;  5HNF A;  2GTQ A;  5HNH A;  3FU0 A;  4XN8 A;  1H19 A;  3A06 A;  3CZL A;  1G5A A;  1SG7 A;  4XO5 A;  4XND A;  4LUP A;  4GAE A;  2O7G A;  1ONP A;  2WZF A;  1GW6 A;  4R5X A;  3UCQ A;  1Q0Q A;  1JVS A;  1SC5 A;  4XMU A;  1S46 A;  4XN2 A;  4ZQH A;  3FTW A;  1ONN A;  3EBI A;  2HPO A;  3FTX A;  2VJ8 A;  4QME A;  2Y1C A;  4FLO A;  4XN1 A;  4FLR A;  3ANN A;  4XNB A;  4BKX A;  3IIE A;  4QPE A;  3B7T A;  4ZW8 A;  2MAO A;  2A7O A;  4L2L A;  3B37 A;  3B7U X;  5BPP A;  3FTV A;  4Y6S A;  4ZW6 A;  4PW4 A;  1T1R A;  4A03 A;  4XMT A;  5DYF A;  4ZX3 A;  4XMZ A;  2B61 A;  4R5T A;  3UER A;  2JCX A;  2HPT A;  3FU6 A;  4QHP A;  1T1S A;  3U9W A;  5JO0 A;  4XN9 A;  3CHQ A;  3FTY A;  2QVW A;  3RC3 A;  4ARF A;  2Y1G A;  2PUS A;  3VVL A;  3PUU A;  2DQM A;  4Y67 A;  4ZN6 A;  4JND A;  3FH7 A;  4ZQT A;  3ZI0 A;  4XMW A;  3CZE A;  2C5Z A;  1MW0 A;  3FHE A;  4MS6 A;  4R5V A;  3FU3 A;  3WQR A;  4AIC A;  3A14 A;  3EBH A;  2Y1F A;  4XNA A;  4ZQF A;  3T0Y A;  4OOF A;  2PL5 A;  5JC1 A;  3CZG A;  2WPG A;  3CHO A;  1K5H A;  3R0I A;  4AR1 A;  3CHP A;  4J3B A;  3FUJ A;  2Y1D A;  2DQ6 A;  4RSY A;  3RC8 A;  4Q4E A;  3CHS A;  2R70 A;  2MAP A;  4ZW7 A;  2JCV A;  3FUL A;  5DLL A;  4CXF A;  3WQS B;  4NQW A;  5JNL A;  4ZX6 A;  1ZS2 A;  4MKT A;  3QJX A;  1HS6 A;  3FTS A;  5EV7 A;  4K5N A;  4AR8 A;  1MW3 A;  4OOE A;  4R7L A;  2JD1 A;  1MW2 A;  1X3Z A;  2VLA A;  3B3B A;  4GAA A;  1Q0L A;  3EBG A;  3FTU A;  3FU5 A;  4FLQ A;  5JMW A;  4X2U A;  4Y6R A;  1OR7 A;  2ZXG A;  3B7R L;  3FH8 A;  4Y6P A;  4K5M A;  5AEN A;  2XQ0 A;  3KED A;  2C82 A;  3ANL A;  1Q0H A;  5JAZ A;  3AUA A;  3AU9 A;  3FUN A;  4XN7 A;  2PGG A;  2Y1E A;  4FLS A;  3WQQ A;  2FFL A;  3AU8 A;  3FUD A;  4QUO A;  4AYS A;  3CZK A;  2XPY A;  4XO4 A;  4ZX4 A;  1MW1 A;  3Q43 A;  2JD0 A;  2RJI A;  2R72 A;  3ZHZ A;  3FUK A;  1ONO A;  1X3W A;  3FUE A;  3T8V A;  3ZHY A;  1R0K A;  5JMP A;  3B2X A;  5FWQ A;  4QIR A;  4RVB A;  4XMX A;  3CIA A;  3RAS A;  4ZQG A;  5HLT A;  4ZX5 A;  4Q4I A;  2JV7 A;  1SQM A;  4K5O A;  3JSZ A;  4RCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...