2O7GA

Crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
TASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA polymerase sigma-C factor
publication title Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 36
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2o7gA00
5JAZA 2Y1FA 1JVSA 1MW2A 2JD2A 3AU9A 3T0YA 1H3LA 3ZHYA 3CZEA 2JD0A 2O7GA 4FLOA 1JG9A 2JCYA 4ZQEA 5JMPA 3UERA 4ZQGA 4AYSA 3UEQA 4OOEA 3A06A 4Y6SA 4Y6PA 3ANMA 5JMWA 1Q0LA 2C82A 4OOFA 3R0IA 3ZI0A 2Y1DA 1ZS2A 1JGIA 1Q0HA 2WPGA 3ZHXA 4Y67A 4FLQA 4Y6RA 4GAEA 4NQWA 4KP7A 1R0LA 2MAOA 5JNLA 1R0KA 2MAPA 1ONNA 2JCVA 1Q0QA 3A14A 3IIEA 3WQRA 1ONOA 1MW0A 4ZQFA 1T1RA 5DULA 4AICA 4RCVA 5JO0A 1MW3A 2JD1A 4A03A 4FLSA 1S46A 1RP3A 3AU8A 4CXFA 3WQQA 1MVYA 2Y1GA 4ZN6A 1K5HA 1ONPA 5JBIA 4FLRA 3ZHZA 4ZQHA 1T1SA 3UCQA 4LUPA 2Y1EA 2EGHA 3ANLA 3AUAA 3CZKA 3ANNA 2JCXA 1SC5A 3WQSB 1OR7A 1MW1A 1G5AA 2Y1CA 5JC1A 3CZGA 3RASA 3CZLA
chains in the Genus database with same CATH superfamily
5JAZA 2Y1FA 1JVSA 4XMXA 3FTWA 1MW2A 3FU5A 2JD2A 1HS6A 3AU9A 3T0YA 4L2LA 3FH7A 3RC8A 1H3LA 3ZHYA 5EV7A 3CZEA 2JD0A 4Q4IA 4PW4A 2C5ZA 2O7GA 1GW6A 4FLOA 1JG9A 2JCYA 4XMZA 3FUNA 4QMEA 4QUOA 2XQ0A 4JNDA 4ZQEA 5JMPA 3UERA 4ZQGA 4DPRA 4K5NA 3Q44A 4AYSA 2DQMA 3UEQA 5DYFA 2JV7A 3A06A 4OOEA 4PU2A 4J3BA 3RC3A 3B7RL 4Y6SA 1SG7A 3QJXA 4AR9A 4Y6PA 3ANMA 2PL5A 4XNDA 5JMWA 1Q0LA 2C82A 2QVWA 2ZXGA 4ZW5A 3FUKA 3R0IA 4OOFA 2B61A 3JSZA 3T8VA 3FTVA 3JT1A 4RVBA 4R5TA 3B2XA 4XMWA 4XMVA 4RSYA 3VVMA 3ZI0A 3U9WA 2Y1DA 1ZS2A 2FFLA 2A7OA 4ZX4A 4ZW6A 1JGIA 4K5OA 1SQMA 4XN1A 4Q4EA 4X2UA 4XO4A 1Q0HA 5DLLA 2WPGA 4QIRA 2WZFA 4XN8A 3ZHXA 4XMUA 4Y67A 4FLQA 3FUIA 4Y6RA 5FWQA 4GAEA 4NQWA 2HPOA 3FH5A 3CIAA 2GTQA 4ZW7A 4KP7A 5JO0A 1R0LA 2MAOA 2VJ8A 4ZX5A 5JNLA 1R0KA 2MAPA 1ONNA 2JCVA 1Q0QA 3VVLA 2WZGA 2R59A 4ZQTA 3A14A 4MKTA 3IIEA 4XNAA 3WQRA 4XN4A 4R7LA 5AENA 4ZW3A 3Q43A 1ONOA 4QPEA 2PUSA 3B7TA 2XPYA 3FULA 4ARFA 4MS6A 1MW0A 3B7SA 4XNBA 4ZW8A 3FU6A 1T1RA 4ZQFA 5DULA 4AICA 3EBGA 3FTSA 2XPZA 4RCVA 1MW3A 2JD1A 2R70A 3FUDA 3FUFA 4K5LA 4A03A 4XMTA 3FU0A 4FLSA 1S46A 2QJ1A 4K5PA 1RP3A 3AU8A 2VLAA 3B7UX 4CXFA 3B34A 3FUMA 3FUEA 3KEDA 2HPTA 3WQQA 1MVYA 4K5MA 2Y1GA 4ZN6A 1K5HA 1ONPA 1X3WA 4XN2A 5JBIA 3FHEA 4FLRA 5HLTA 2PGGA 4XO3A 3ZHZA 5HNHA 4ZQHA 4R5XA 3HW2A 3FH8A 1T1SA 3UCQA 4XN7A 4LUPA 3B2PA 3FUHA 2Y1EA 4GAAA 4R5VA 2EGHA 4QHPA 4XN5A 4XN9A 3CHRA 4ZX3A 2R72A 3ANLA 3AUAA 3CHPA 3FTUA 1X3ZA 3CZKA 3FTYA 4FCAA 3CHOA 4ZX6A 3FU3A 3ANNA 2JCXA 1SC5A 3CXBA 3EBHA 4BKXA 3WQSB 1OR7A 3FTZA 1MW1A 4AR1A 1G5AA 4XO5A 3EBIA 2Y1CA 1H19A 3CHQA 4PVBA 5JC1A 2DQ6A 4AR8A 3B37A 3CZGA 3B3BA 3FTXA 3FUJA 3PUUA 2RJIA 3RASA 5BPPA 3CZLA 5HNFA 3CHSA
chains in the Genus database with same CATH topology
5JAZA 2Y1FA 1JVSA 4XMXA 3FTWA 1MW2A 3FU5A 2JD2A 1HS6A 3AU9A 3T0YA 4L2LA 3FH7A 3RC8A 1H3LA 3ZHYA 5EV7A 3CZEA 2JD0A 4Q4IA 4PW4A 2C5ZA 2O7GA 1GW6A 4FLOA 1JG9A 2JCYA 4XMZA 3FUNA 4QMEA 4QUOA 2XQ0A 4JNDA 4ZQEA 5JMPA 3UERA 4ZQGA 4DPRA 4K5NA 3Q44A 4AYSA 2DQMA 3UEQA 5DYFA 2JV7A 3A06A 4OOEA 4PU2A 4J3BA 3RC3A 3B7RL 4Y6SA 1SG7A 3QJXA 4AR9A 4Y6PA 3ANMA 2PL5A 4XNDA 5JMWA 1Q0LA 2C82A 2QVWA 2ZXGA 4ZW5A 3FUKA 3R0IA 4OOFA 2B61A 3JSZA 3T8VA 3FTVA 3JT1A 4RVBA 4R5TA 3B2XA 4XMWA 4XMVA 4RSYA 3VVMA 3ZI0A 3U9WA 2Y1DA 1ZS2A 2FFLA 2A7OA 4ZX4A 4ZW6A 1JGIA 4K5OA 1SQMA 4XN1A 4Q4EA 4X2UA 4XO4A 1Q0HA 5DLLA 2WPGA 4QIRA 2WZFA 4XN8A 3ZHXA 4XMUA 4Y67A 4FLQA 3FUIA 4Y6RA 5FWQA 4GAEA 4NQWA 2HPOA 3FH5A 3CIAA 2GTQA 4ZW7A 4KP7A 5JO0A 1R0LA 2MAOA 2VJ8A 4ZX5A 5JNLA 1R0KA 2MAPA 1ONNA 2JCVA 1Q0QA 3VVLA 2WZGA 2R59A 4ZQTA 3A14A 4MKTA 3IIEA 4XNAA 3WQRA 4XN4A 4R7LA 5AENA 4ZW3A 3Q43A 1ONOA 4QPEA 2PUSA 3B7TA 2XPYA 3FULA 4ARFA 4MS6A 1MW0A 3B7SA 4XNBA 4ZW8A 3FU6A 1T1RA 4ZQFA 5DULA 4AICA 3EBGA 3FTSA 2XPZA 4RCVA 1MW3A 2JD1A 2R70A 3FUDA 3FUFA 4K5LA 4A03A 4XMTA 3FU0A 4FLSA 1S46A 2QJ1A 4K5PA 1RP3A 3AU8A 2VLAA 3B7UX 4CXFA 3B34A 3FUMA 3FUEA 3KEDA 2HPTA 3WQQA 1MVYA 4K5MA 2Y1GA 4ZN6A 1K5HA 1ONPA 1X3WA 4XN2A 5JBIA 3FHEA 4FLRA 5HLTA 2PGGA 4XO3A 3ZHZA 5HNHA 4ZQHA 4R5XA 3FH8A 1T1SA 3UCQA 4XN7A 4LUPA 3B2PA 3FUHA 2Y1EA 4GAAA 4R5VA 2EGHA 4QHPA 4XN5A 4XN9A 3CHRA 4ZX3A 2R72A 3ANLA 3AUAA 3CHPA 3FTUA 1X3ZA 3CZKA 3FTYA 4FCAA 3CHOA 4ZX6A 3FU3A 3ANNA 2JCXA 1SC5A 4BKXA 3EBHA 3WQSB 1OR7A 3FTZA 1MW1A 4AR1A 1G5AA 4XO5A 3EBIA 2Y1CA 1H19A 3CHQA 4PVBA 5JC1A 2DQ6A 4AR8A 3B37A 3CZGA 3B3BA 3FTXA 3FUJA 3PUUA 2RJIA 3RASA 5BPPA 3CZLA 5HNFA 3CHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JAZ A;  2Y1F A;  1JVS A;  1MW2 A;  2JD2 A;  3AU9 A;  3T0Y A;  1H3L A;  3ZHY A;  3CZE A;  2JD0 A;  2O7G A;  4FLO A;  1JG9 A;  2JCY A;  4ZQE A;  5JMP A;  3UER A;  4ZQG A;  4AYS A;  3UEQ A;  4OOE A;  3A06 A;  4Y6S A;  4Y6P A;  3ANM A;  5JMW A;  1Q0L A;  2C82 A;  4OOF A;  3R0I A;  3ZI0 A;  2Y1D A;  1ZS2 A;  1JGI A;  1Q0H A;  2WPG A;  3ZHX A;  4Y67 A;  4FLQ A;  4Y6R A;  4GAE A;  4NQW A;  4KP7 A;  1R0L A;  2MAO A;  5JNL A;  1R0K A;  2MAP A;  1ONN A;  2JCV A;  1Q0Q A;  3A14 A;  3IIE A;  3WQR A;  1ONO A;  1MW0 A;  4ZQF A;  1T1R A;  5DUL A;  4AIC A;  4RCV A;  5JO0 A;  1MW3 A;  2JD1 A;  4A03 A;  4FLS A;  1S46 A;  1RP3 A;  3AU8 A;  4CXF A;  3WQQ A;  1MVY A;  2Y1G A;  4ZN6 A;  1K5H A;  1ONP A;  5JBI A;  4FLR A;  3ZHZ A;  4ZQH A;  1T1S A;  3UCQ A;  4LUP A;  2Y1E A;  2EGH A;  3ANL A;  3AUA A;  3CZK A;  3ANN A;  2JCX A;  1SC5 A;  3WQS B;  1OR7 A;  1MW1 A;  1G5A A;  2Y1C A;  5JC1 A;  3CZG A;  3RAS A;  3CZL A; 
#chains in the Genus database with same CATH topology
 5JAZ A;  2Y1F A;  1JVS A;  4XMX A;  3FTW A;  1MW2 A;  3FU5 A;  2JD2 A;  1HS6 A;  3AU9 A;  3T0Y A;  4L2L A;  3FH7 A;  3RC8 A;  1H3L A;  3ZHY A;  5EV7 A;  3CZE A;  2JD0 A;  4Q4I A;  4PW4 A;  2C5Z A;  2O7G A;  1GW6 A;  4FLO A;  1JG9 A;  2JCY A;  4XMZ A;  3FUN A;  4QME A;  4QUO A;  2XQ0 A;  4JND A;  4ZQE A;  5JMP A;  3UER A;  4ZQG A;  4DPR A;  4K5N A;  3Q44 A;  4AYS A;  2DQM A;  3UEQ A;  5DYF A;  2JV7 A;  3A06 A;  4OOE A;  4PU2 A;  4J3B A;  3RC3 A;  3B7R L;  4Y6S A;  1SG7 A;  3QJX A;  4AR9 A;  4Y6P A;  3ANM A;  2PL5 A;  4XND A;  5JMW A;  1Q0L A;  2C82 A;  2QVW A;  2ZXG A;  4ZW5 A;  3FUK A;  3R0I A;  4OOF A;  2B61 A;  3JSZ A;  3T8V A;  3FTV A;  3JT1 A;  4RVB A;  4R5T A;  3B2X A;  4XMW A;  4XMV A;  4RSY A;  3VVM A;  3ZI0 A;  3U9W A;  2Y1D A;  1ZS2 A;  2FFL A;  2A7O A;  4ZX4 A;  4ZW6 A;  1JGI A;  4K5O A;  1SQM A;  4XN1 A;  4Q4E A;  4X2U A;  4XO4 A;  1Q0H A;  5DLL A;  2WPG A;  4QIR A;  2WZF A;  4XN8 A;  3ZHX A;  4XMU A;  4Y67 A;  4FLQ A;  3FUI A;  4Y6R A;  5FWQ A;  4GAE A;  4NQW A;  2HPO A;  3FH5 A;  3CIA A;  2GTQ A;  4ZW7 A;  4KP7 A;  5JO0 A;  1R0L A;  2MAO A;  2VJ8 A;  4ZX5 A;  5JNL A;  1R0K A;  2MAP A;  1ONN A;  2JCV A;  1Q0Q A;  3VVL A;  2WZG A;  2R59 A;  4ZQT A;  3A14 A;  4MKT A;  3IIE A;  4XNA A;  3WQR A;  4XN4 A;  4R7L A;  5AEN A;  4ZW3 A;  3Q43 A;  1ONO A;  4QPE A;  2PUS A;  3B7T A;  2XPY A;  3FUL A;  4ARF A;  4MS6 A;  1MW0 A;  3B7S A;  4XNB A;  4ZW8 A;  3FU6 A;  1T1R A;  4ZQF A;  5DUL A;  4AIC A;  3EBG A;  3FTS A;  2XPZ A;  4RCV A;  1MW3 A;  2JD1 A;  2R70 A;  3FUD A;  3FUF A;  4K5L A;  4A03 A;  4XMT A;  3FU0 A;  4FLS A;  1S46 A;  2QJ1 A;  4K5P A;  1RP3 A;  3AU8 A;  2VLA A;  3B7U X;  4CXF A;  3B34 A;  3FUM A;  3FUE A;  3KED A;  2HPT A;  3WQQ A;  1MVY A;  4K5M A;  2Y1G A;  4ZN6 A;  1K5H A;  1ONP A;  1X3W A;  4XN2 A;  5JBI A;  3FHE A;  4FLR A;  5HLT A;  2PGG A;  4XO3 A;  3ZHZ A;  5HNH A;  4ZQH A;  4R5X A;  3HW2 A;  3FH8 A;  1T1S A;  3UCQ A;  4XN7 A;  4LUP A;  3B2P A;  3FUH A;  2Y1E A;  4GAA A;  4R5V A;  2EGH A;  4QHP A;  4XN5 A;  4XN9 A;  3CHR A;  4ZX3 A;  2R72 A;  3ANL A;  3AUA A;  3CHP A;  3FTU A;  1X3Z A;  3CZK A;  3FTY A;  4FCA A;  3CHO A;  4ZX6 A;  3FU3 A;  3ANN A;  2JCX A;  1SC5 A;  3CXB A;  3EBH A;  4BKX A;  3WQS B;  1OR7 A;  3FTZ A;  1MW1 A;  4AR1 A;  1G5A A;  4XO5 A;  3EBI A;  2Y1C A;  1H19 A;  3CHQ A;  4PVB A;  5JC1 A;  2DQ6 A;  4AR8 A;  3B37 A;  3CZG A;  3B3B A;  3FTX A;  3FUJ A;  3PUU A;  2RJI A;  3RAS A;  5BPP A;  3CZL A;  5HNF A;  3CHS A; 
#chains in the Genus database with same CATH homology
 5JAZ A;  2Y1F A;  1JVS A;  4XMX A;  3FTW A;  1MW2 A;  3FU5 A;  2JD2 A;  1HS6 A;  3AU9 A;  3T0Y A;  4L2L A;  3FH7 A;  3RC8 A;  1H3L A;  3ZHY A;  5EV7 A;  3CZE A;  2JD0 A;  4Q4I A;  4PW4 A;  2C5Z A;  2O7G A;  1GW6 A;  4FLO A;  1JG9 A;  2JCY A;  4XMZ A;  3FUN A;  4QME A;  4QUO A;  2XQ0 A;  4JND A;  4ZQE A;  5JMP A;  3UER A;  4ZQG A;  4DPR A;  4K5N A;  3Q44 A;  4AYS A;  2DQM A;  3UEQ A;  5DYF A;  2JV7 A;  3A06 A;  4OOE A;  4PU2 A;  4J3B A;  3RC3 A;  3B7R L;  4Y6S A;  1SG7 A;  3QJX A;  4AR9 A;  4Y6P A;  3ANM A;  2PL5 A;  4XND A;  5JMW A;  1Q0L A;  2C82 A;  2QVW A;  2ZXG A;  4ZW5 A;  3FUK A;  3R0I A;  4OOF A;  2B61 A;  3JSZ A;  3T8V A;  3FTV A;  3JT1 A;  4RVB A;  4R5T A;  3B2X A;  4XMW A;  4XMV A;  4RSY A;  3VVM A;  3ZI0 A;  3U9W A;  2Y1D A;  1ZS2 A;  2FFL A;  2A7O A;  4ZX4 A;  4ZW6 A;  1JGI A;  4K5O A;  1SQM A;  4XN1 A;  4Q4E A;  4X2U A;  4XO4 A;  1Q0H A;  5DLL A;  2WPG A;  4QIR A;  2WZF A;  4XN8 A;  3ZHX A;  4XMU A;  4Y67 A;  4FLQ A;  3FUI A;  4Y6R A;  5FWQ A;  4GAE A;  4NQW A;  2HPO A;  3FH5 A;  3CIA A;  2GTQ A;  4ZW7 A;  4KP7 A;  5JO0 A;  1R0L A;  2MAO A;  2VJ8 A;  4ZX5 A;  5JNL A;  1R0K A;  2MAP A;  1ONN A;  2JCV A;  1Q0Q A;  3VVL A;  2WZG A;  2R59 A;  4ZQT A;  3A14 A;  4MKT A;  3IIE A;  4XNA A;  3WQR A;  4XN4 A;  4R7L A;  5AEN A;  4ZW3 A;  3Q43 A;  1ONO A;  4QPE A;  2PUS A;  3B7T A;  2XPY A;  3FUL A;  4ARF A;  4MS6 A;  1MW0 A;  3B7S A;  4XNB A;  4ZW8 A;  3FU6 A;  1T1R A;  4ZQF A;  5DUL A;  4AIC A;  3EBG A;  3FTS A;  2XPZ A;  4RCV A;  1MW3 A;  2JD1 A;  2R70 A;  3FUD A;  3FUF A;  4K5L A;  4A03 A;  4XMT A;  3FU0 A;  4FLS A;  1S46 A;  2QJ1 A;  4K5P A;  1RP3 A;  3AU8 A;  2VLA A;  3B7U X;  4CXF A;  3B34 A;  3FUM A;  3FUE A;  3KED A;  2HPT A;  3WQQ A;  1MVY A;  4K5M A;  2Y1G A;  4ZN6 A;  1K5H A;  1ONP A;  1X3W A;  4XN2 A;  5JBI A;  3FHE A;  4FLR A;  5HLT A;  2PGG A;  4XO3 A;  3ZHZ A;  5HNH A;  4ZQH A;  4R5X A;  3FH8 A;  1T1S A;  3UCQ A;  4XN7 A;  4LUP A;  3B2P A;  3FUH A;  2Y1E A;  4GAA A;  4R5V A;  2EGH A;  4QHP A;  4XN5 A;  4XN9 A;  3CHR A;  4ZX3 A;  2R72 A;  3ANL A;  3AUA A;  3CHP A;  3FTU A;  1X3Z A;  3CZK A;  3FTY A;  4FCA A;  3CHO A;  4ZX6 A;  3FU3 A;  3ANN A;  2JCX A;  1SC5 A;  4BKX A;  3EBH A;  3WQS B;  1OR7 A;  3FTZ A;  1MW1 A;  4AR1 A;  1G5A A;  4XO5 A;  3EBI A;  2Y1C A;  1H19 A;  3CHQ A;  4PVB A;  5JC1 A;  2DQ6 A;  4AR8 A;  3B37 A;  3CZG A;  3B3B A;  3FTX A;  3FUJ A;  3PUU A;  2RJI A;  3RAS A;  5BPP A;  3CZL A;  5HNF A;  3CHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...