2O7GA

Crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
TASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA polymerase sigma-C factor
publication title Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 36
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2o7gA00
4LUPA 1SC5A 2Y1DA 5JMWA 4A03A 4NQWA 3ZHZA 3ZHXA 2JCXA 4ZN6A 1H3LA 1ZS2A 3UEQA 5JC1A 4CXFA 3UCQA 4ZQGA 2O7GA 1T1RA 3ZI0A 4FLOA 1JGIA 1JG9A 3RASA 2WPGA 1OR7A 2JD2A 3AU8A 1R0KA 4FLSA 4ZQHA 4OOFA 1ONOA 2JD0A 1G5AA 3IIEA 3CZGA 3T0YA 2Y1EA 3AU9A 1MW2A 1T1SA 1S46A 4Y67A 1ONNA 3CZKA 3CZLA 3AUAA 3ANLA 2C82A 3CZEA 5DULA 4OOEA 3WQQA 4RCVA 5JBIA 2Y1CA 4GAEA 1R0LA 4AYSA 5JMPA 2MAPA 4Y6SA 5JAZA 1Q0LA 1MW1A 3UERA 5JNLA 1K5HA 3R0IA 4KP7A 1MW3A 2JCYA 2EGHA 3A14A 4FLQA 2Y1FA 2JD1A 1MW0A 3WQRA 1ONPA 1Q0HA 4ZQEA 3ANNA 3A06A 2MAOA 1MVYA 4ZQFA 2Y1GA 4FLRA 3WQSB 1Q0QA 3ZHYA 1RP3A 4AICA 2JCVA 3ANMA 4Y6PA 1JVSA 5JO0A 4Y6RA
chains in the Genus database with same CATH superfamily
4LUPA 1SC5A 2Y1DA 2DQMA 5JMWA 4A03A 4MS6A 4NQWA 3ZHZA 3B3BA 2C5ZA 4R5XA 4R5TA 4X2UA 3ZHXA 5BPPA 2JCXA 4XN1A 4XO3A 4ZN6A 3FU5A 1H3LA 1GW6A 3B7UX 4ZQTA 5FWQA 4QHPA 1ZS2A 3FUJA 3FTSA 3UEQA 5JC1A 3RC8A 4XMTA 4XN5A 1SG7A 4XNBA 4CXFA 3FUIA 4AR9A 3UCQA 3FUMA 4JNDA 4XMWA 2O7GA 4ZQGA 4ZW7A 4AR8A 1T1RA 3ZI0A 2VLAA 2FFLA 2VJ8A 4FLOA 4XN8A 4PVBA 4Q4EA 3FTUA 3FU3A 1JGIA 3FUFA 4QIRA 1JG9A 4XMXA 3FU6A 1X3WA 3PUUA 2HPTA 3FUEA 2PL5A 3CHQA 4QMEA 3RASA 2JV7A 2WPGA 2R72A 4RVBA 1OR7A 3FH8A 4ZX3A 2JD2A 3AU8A 3VVLA 3FH5A 2R70A 3CHSA 4FCAA 5HNHA 1R0KA 4FLSA 4ZQHA 4ZW3A 4OOFA 1ONOA 3CXBA 2WZFA 3CHOA 2JD0A 1G5AA 3FTVA 3IIEA 4GAAA 4L2LA 3CZGA 3T0YA 2Y1EA 5AENA 4DPRA 3FTXA 3FHEA 3FTZA 3AU9A 3B7TA 5DYFA 2QVWA 1MW2A 3FULA 1T1SA 2WZGA 3KEDA 1S46A 4K5OA 2HPOA 1ONNA 4Y67A 2A7OA 4XN9A 3B34A 4ZW6A 3CZKA 3CZLA 3AUAA 4ZX6A 3ANLA 4XO5A 2C82A 3B2XA 3FUDA 3JSZA 4XMZA 3CZEA 5DULA 3U9WA 2GTQA 3CHPA 5EV7A 4OOEA 4AR1A 3CIAA 3FUNA 2PGGA 1H19A 3FTYA 4BKXA 4K5MA 3WQQA 4RCVA 4Q4IA 4PW4A 2PUSA 4MKTA 5JBIA 1HS6A 2Y1CA 4GAEA 3B7RL 4ZW5A 3FTWA 2R59A 4J3BA 1R0LA 1X3ZA 4AYSA 3RC3A 5JMPA 2MAPA 4Y6SA 5JAZA 1Q0LA 3B2PA 1MW1A 4XO4A 2DQ6A 3HW2A 3UERA 3EBHA 4ARFA 4XNDA 4K5NA 3FUHA 5JNLA 1K5HA 4PU2A 3FUKA 3R0IA 4KP7A 3JT1A 4RSYA 3B37A 1SQMA 1MW3A 2JCYA 2EGHA 3A14A 4FLQA 4XMVA 2Y1FA 3EBIA 2JD1A 4K5PA 2QJ1A 4XN4A 1MW0A 2ZXGA 1ONPA 1Q0HA 4XN7A 3ANNA 4ZQEA 3WQRA 2XPYA 2MAOA 1MVYA 3A06A 3Q43A 4ZQFA 2Y1GA 4FLRA 2RJIA 4ZW8A 4XNAA 3WQSB 4K5LA 1Q0QA 4XMUA 5HNFA 3CHRA 4R5VA 4XN2A 3Q44A 4ZX5A 3QJXA 2XPZA 3ZHYA 2XQ0A 5DLLA 3FU0A 4QUOA 1RP3A 3T8VA 4AICA 5HLTA 2JCVA 3VVMA 3B7SA 3ANMA 3FH7A 2B61A 4ZX4A 4Y6PA 1JVSA 5JO0A 4QPEA 4R7LA 3EBGA 4Y6RA
chains in the Genus database with same CATH topology
4LUPA 1SC5A 2Y1DA 2DQMA 5JMWA 4A03A 4MS6A 4NQWA 3ZHZA 3B3BA 2C5ZA 4R5XA 4R5TA 4X2UA 3ZHXA 5BPPA 2JCXA 4XN1A 4XO3A 4ZN6A 3FU5A 1H3LA 1GW6A 3B7UX 4ZQTA 5FWQA 4QHPA 1ZS2A 3FUJA 3FTSA 3UEQA 5JC1A 3RC8A 4XMTA 4XN5A 1SG7A 4XNBA 4CXFA 3FUIA 4AR9A 3UCQA 3FUMA 4JNDA 4XMWA 2O7GA 4ZQGA 4ZW7A 4AR8A 1T1RA 3ZI0A 2VLAA 2FFLA 2VJ8A 4FLOA 4XN8A 4PVBA 4Q4EA 3FTUA 3FU3A 1JGIA 3FUFA 4QIRA 1JG9A 4XMXA 3FU6A 1X3WA 3PUUA 2HPTA 3FUEA 2PL5A 3CHQA 4QMEA 3RASA 2JV7A 2WPGA 2R72A 4RVBA 1OR7A 3FH8A 4ZX3A 2JD2A 3AU8A 3VVLA 3FH5A 2R70A 3CHSA 4FCAA 5HNHA 1R0KA 4FLSA 4ZQHA 4ZW3A 4OOFA 1ONOA 3FTVA 2WZFA 3CHOA 2JD0A 1G5AA 3IIEA 4GAAA 4L2LA 3CZGA 3T0YA 2Y1EA 5AENA 4DPRA 3FTXA 3FHEA 3FTZA 3AU9A 3B7TA 5DYFA 2QVWA 1MW2A 3FULA 1T1SA 2WZGA 3KEDA 1S46A 4K5OA 2HPOA 1ONNA 4Y67A 2A7OA 4XN9A 3B34A 4ZW6A 3CZKA 3CZLA 3AUAA 4ZX6A 3ANLA 4XO5A 2C82A 3B2XA 3FUDA 3JSZA 4XMZA 3CZEA 5DULA 3U9WA 2GTQA 3CHPA 5EV7A 4OOEA 4AR1A 3CIAA 3FUNA 2PGGA 1H19A 3FTYA 4BKXA 4K5MA 3WQQA 4RCVA 4Q4IA 4PW4A 2PUSA 4MKTA 5JBIA 1HS6A 2Y1CA 4GAEA 3B7RL 4ZW5A 3FTWA 2R59A 4J3BA 1R0LA 1X3ZA 4AYSA 3RC3A 5JMPA 2MAPA 4Y6SA 5JAZA 1Q0LA 3B2PA 1MW1A 4XO4A 2DQ6A 3UERA 5JNLA 3EBHA 4ARFA 4XNDA 4K5NA 3FUHA 1K5HA 4PU2A 3FUKA 3R0IA 4KP7A 3JT1A 4RSYA 3B37A 1SQMA 1MW3A 2JCYA 2EGHA 3A14A 4FLQA 4XMVA 2Y1FA 3EBIA 2JD1A 4K5PA 2QJ1A 4XN4A 1MW0A 2ZXGA 1ONPA 1Q0HA 4XN7A 3ANNA 4ZQEA 3WQRA 2XPYA 2MAOA 1MVYA 3A06A 3Q43A 4ZQFA 2Y1GA 4FLRA 2RJIA 4ZW8A 4XNAA 3WQSB 4K5LA 1Q0QA 4XMUA 5HNFA 3CHRA 4R5VA 4XN2A 3Q44A 4ZX5A 3QJXA 2XPZA 3ZHYA 2XQ0A 5DLLA 3FU0A 4QUOA 1RP3A 3T8VA 4AICA 5HLTA 2JCVA 3VVMA 3B7SA 3ANMA 3FH7A 2B61A 4ZX4A 4Y6PA 1JVSA 5JO0A 4QPEA 4R7LA 3EBGA 4Y6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUP A;  1SC5 A;  2Y1D A;  5JMW A;  4A03 A;  4NQW A;  3ZHZ A;  3ZHX A;  2JCX A;  4ZN6 A;  1H3L A;  1ZS2 A;  3UEQ A;  5JC1 A;  4CXF A;  3UCQ A;  4ZQG A;  2O7G A;  1T1R A;  3ZI0 A;  4FLO A;  1JGI A;  1JG9 A;  3RAS A;  2WPG A;  1OR7 A;  2JD2 A;  3AU8 A;  1R0K A;  4FLS A;  4ZQH A;  4OOF A;  1ONO A;  2JD0 A;  1G5A A;  3IIE A;  3CZG A;  3T0Y A;  2Y1E A;  3AU9 A;  1MW2 A;  1T1S A;  1S46 A;  4Y67 A;  1ONN A;  3CZK A;  3CZL A;  3AUA A;  3ANL A;  2C82 A;  3CZE A;  5DUL A;  4OOE A;  3WQQ A;  4RCV A;  5JBI A;  2Y1C A;  4GAE A;  1R0L A;  4AYS A;  5JMP A;  2MAP A;  4Y6S A;  5JAZ A;  1Q0L A;  1MW1 A;  3UER A;  5JNL A;  1K5H A;  3R0I A;  4KP7 A;  1MW3 A;  2JCY A;  2EGH A;  3A14 A;  4FLQ A;  2Y1F A;  2JD1 A;  1MW0 A;  3WQR A;  1ONP A;  1Q0H A;  4ZQE A;  3ANN A;  3A06 A;  2MAO A;  1MVY A;  4ZQF A;  2Y1G A;  4FLR A;  3WQS B;  1Q0Q A;  3ZHY A;  1RP3 A;  4AIC A;  2JCV A;  3ANM A;  4Y6P A;  1JVS A;  5JO0 A;  4Y6R A; 
#chains in the Genus database with same CATH topology
 4LUP A;  1SC5 A;  2Y1D A;  2DQM A;  5JMW A;  4A03 A;  4MS6 A;  4NQW A;  3ZHZ A;  3B3B A;  2C5Z A;  4R5X A;  4R5T A;  4X2U A;  3ZHX A;  5BPP A;  2JCX A;  4XN1 A;  4XO3 A;  4ZN6 A;  3FU5 A;  1H3L A;  1GW6 A;  3B7U X;  4ZQT A;  5FWQ A;  4QHP A;  1ZS2 A;  3FUJ A;  3FTS A;  3UEQ A;  5JC1 A;  3RC8 A;  4XMT A;  4XN5 A;  1SG7 A;  4XNB A;  4CXF A;  3FUI A;  4AR9 A;  3UCQ A;  3FUM A;  4JND A;  4XMW A;  2O7G A;  4ZQG A;  4ZW7 A;  4AR8 A;  1T1R A;  3ZI0 A;  2VLA A;  2FFL A;  2VJ8 A;  4FLO A;  4XN8 A;  4PVB A;  4Q4E A;  3FTU A;  3FU3 A;  1JGI A;  3FUF A;  4QIR A;  1JG9 A;  4XMX A;  3FU6 A;  1X3W A;  3PUU A;  2HPT A;  3FUE A;  2PL5 A;  3CHQ A;  4QME A;  3RAS A;  2JV7 A;  2WPG A;  2R72 A;  4RVB A;  1OR7 A;  3FH8 A;  4ZX3 A;  2JD2 A;  3AU8 A;  3VVL A;  3FH5 A;  2R70 A;  3CHS A;  4FCA A;  5HNH A;  1R0K A;  4FLS A;  4ZQH A;  4ZW3 A;  4OOF A;  1ONO A;  3CXB A;  2WZF A;  3CHO A;  2JD0 A;  1G5A A;  3FTV A;  3IIE A;  4GAA A;  4L2L A;  3CZG A;  3T0Y A;  2Y1E A;  5AEN A;  4DPR A;  3FTX A;  3FHE A;  3FTZ A;  3AU9 A;  3B7T A;  5DYF A;  2QVW A;  1MW2 A;  3FUL A;  1T1S A;  2WZG A;  3KED A;  1S46 A;  4K5O A;  2HPO A;  1ONN A;  4Y67 A;  2A7O A;  4XN9 A;  3B34 A;  4ZW6 A;  3CZK A;  3CZL A;  3AUA A;  4ZX6 A;  3ANL A;  4XO5 A;  2C82 A;  3B2X A;  3FUD A;  3JSZ A;  4XMZ A;  3CZE A;  5DUL A;  3U9W A;  2GTQ A;  3CHP A;  5EV7 A;  4OOE A;  4AR1 A;  3CIA A;  3FUN A;  2PGG A;  1H19 A;  3FTY A;  4BKX A;  4K5M A;  3WQQ A;  4RCV A;  4Q4I A;  4PW4 A;  2PUS A;  4MKT A;  5JBI A;  1HS6 A;  2Y1C A;  4GAE A;  3B7R L;  4ZW5 A;  3FTW A;  2R59 A;  4J3B A;  1R0L A;  1X3Z A;  4AYS A;  3RC3 A;  5JMP A;  2MAP A;  4Y6S A;  5JAZ A;  1Q0L A;  3B2P A;  1MW1 A;  4XO4 A;  2DQ6 A;  3HW2 A;  3UER A;  3EBH A;  4ARF A;  4XND A;  4K5N A;  3FUH A;  5JNL A;  1K5H A;  4PU2 A;  3FUK A;  3R0I A;  4KP7 A;  3JT1 A;  4RSY A;  3B37 A;  1SQM A;  1MW3 A;  2JCY A;  2EGH A;  3A14 A;  4FLQ A;  4XMV A;  2Y1F A;  3EBI A;  2JD1 A;  4K5P A;  2QJ1 A;  4XN4 A;  1MW0 A;  2ZXG A;  1ONP A;  1Q0H A;  4XN7 A;  3ANN A;  4ZQE A;  3WQR A;  2XPY A;  2MAO A;  1MVY A;  3A06 A;  3Q43 A;  4ZQF A;  2Y1G A;  4FLR A;  2RJI A;  4ZW8 A;  4XNA A;  3WQS B;  4K5L A;  1Q0Q A;  4XMU A;  5HNF A;  3CHR A;  4R5V A;  4XN2 A;  3Q44 A;  4ZX5 A;  3QJX A;  2XPZ A;  3ZHY A;  2XQ0 A;  5DLL A;  3FU0 A;  4QUO A;  1RP3 A;  3T8V A;  4AIC A;  5HLT A;  2JCV A;  3VVM A;  3B7S A;  3ANM A;  3FH7 A;  2B61 A;  4ZX4 A;  4Y6P A;  1JVS A;  5JO0 A;  4QPE A;  4R7L A;  3EBG A;  4Y6R A; 
#chains in the Genus database with same CATH homology
 4LUP A;  1SC5 A;  2Y1D A;  2DQM A;  5JMW A;  4A03 A;  4MS6 A;  4NQW A;  3ZHZ A;  3B3B A;  2C5Z A;  4R5X A;  4R5T A;  4X2U A;  3ZHX A;  5BPP A;  2JCX A;  4XN1 A;  4XO3 A;  4ZN6 A;  3FU5 A;  1H3L A;  1GW6 A;  3B7U X;  4ZQT A;  5FWQ A;  4QHP A;  1ZS2 A;  3FUJ A;  3FTS A;  3UEQ A;  5JC1 A;  3RC8 A;  4XMT A;  4XN5 A;  1SG7 A;  4XNB A;  4CXF A;  3FUI A;  4AR9 A;  3UCQ A;  3FUM A;  4JND A;  4XMW A;  2O7G A;  4ZQG A;  4ZW7 A;  4AR8 A;  1T1R A;  3ZI0 A;  2VLA A;  2FFL A;  2VJ8 A;  4FLO A;  4XN8 A;  4PVB A;  4Q4E A;  3FTU A;  3FU3 A;  1JGI A;  3FUF A;  4QIR A;  1JG9 A;  4XMX A;  3FU6 A;  1X3W A;  3PUU A;  2HPT A;  3FUE A;  2PL5 A;  3CHQ A;  4QME A;  3RAS A;  2JV7 A;  2WPG A;  2R72 A;  4RVB A;  1OR7 A;  3FH8 A;  4ZX3 A;  2JD2 A;  3AU8 A;  3VVL A;  3FH5 A;  2R70 A;  3CHS A;  4FCA A;  5HNH A;  1R0K A;  4FLS A;  4ZQH A;  4ZW3 A;  4OOF A;  1ONO A;  3FTV A;  2WZF A;  3CHO A;  2JD0 A;  1G5A A;  3IIE A;  4GAA A;  4L2L A;  3CZG A;  3T0Y A;  2Y1E A;  5AEN A;  4DPR A;  3FTX A;  3FHE A;  3FTZ A;  3AU9 A;  3B7T A;  5DYF A;  2QVW A;  1MW2 A;  3FUL A;  1T1S A;  2WZG A;  3KED A;  1S46 A;  4K5O A;  2HPO A;  1ONN A;  4Y67 A;  2A7O A;  4XN9 A;  3B34 A;  4ZW6 A;  3CZK A;  3CZL A;  3AUA A;  4ZX6 A;  3ANL A;  4XO5 A;  2C82 A;  3B2X A;  3FUD A;  3JSZ A;  4XMZ A;  3CZE A;  5DUL A;  3U9W A;  2GTQ A;  3CHP A;  5EV7 A;  4OOE A;  4AR1 A;  3CIA A;  3FUN A;  2PGG A;  1H19 A;  3FTY A;  4BKX A;  4K5M A;  3WQQ A;  4RCV A;  4Q4I A;  4PW4 A;  2PUS A;  4MKT A;  5JBI A;  1HS6 A;  2Y1C A;  4GAE A;  3B7R L;  4ZW5 A;  3FTW A;  2R59 A;  4J3B A;  1R0L A;  1X3Z A;  4AYS A;  3RC3 A;  5JMP A;  2MAP A;  4Y6S A;  5JAZ A;  1Q0L A;  3B2P A;  1MW1 A;  4XO4 A;  2DQ6 A;  3UER A;  5JNL A;  3EBH A;  4ARF A;  4XND A;  4K5N A;  3FUH A;  1K5H A;  4PU2 A;  3FUK A;  3R0I A;  4KP7 A;  3JT1 A;  4RSY A;  3B37 A;  1SQM A;  1MW3 A;  2JCY A;  2EGH A;  3A14 A;  4FLQ A;  4XMV A;  2Y1F A;  3EBI A;  2JD1 A;  4K5P A;  2QJ1 A;  4XN4 A;  1MW0 A;  2ZXG A;  1ONP A;  1Q0H A;  4XN7 A;  3ANN A;  4ZQE A;  3WQR A;  2XPY A;  2MAO A;  1MVY A;  3A06 A;  3Q43 A;  4ZQF A;  2Y1G A;  4FLR A;  2RJI A;  4ZW8 A;  4XNA A;  3WQS B;  4K5L A;  1Q0Q A;  4XMU A;  5HNF A;  3CHR A;  4R5V A;  4XN2 A;  3Q44 A;  4ZX5 A;  3QJX A;  2XPZ A;  3ZHY A;  2XQ0 A;  5DLL A;  3FU0 A;  4QUO A;  1RP3 A;  3T8V A;  4AIC A;  5HLT A;  2JCV A;  3VVM A;  3B7S A;  3ANM A;  3FH7 A;  2B61 A;  4ZX4 A;  4Y6P A;  1JVS A;  5JO0 A;  4QPE A;  4R7L A;  3EBG A;  4Y6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...