2O7GA

Crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
TASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable RNA polymerase sigma-C factor
total genus 36
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2o7gA00
1ONNA 3R0IA 3UCQA 3ZHXA 2C82A 4LUPA 4AICA 5JNLA 1JVSA 3CZKA 1Q0QA 4Y6PA 2O7GA 3WQRA 4Y6RA 5DULA 1T1RA 1S46A 4RCVA 3WQQA 2MAPA 4FLOA 1H3LA 1R0LA 1Q0LA 2WPGA 5JAZA 1OR7A 1MW0A 4ZQEA 1K5HA 4FLSA 3CZLA 2EGHA 2Y1DA 5JMPA 3ANMA 3ANNA 4CXFA 1Q0HA 3ZHZA 2JD2A 3T0YA 4ZQFA 4Y6SA 1RP3A 1R0KA 3WQSB 5JO0A 1ZS2A 5JBIA 3A06A 4ZQHA 4OOFA 3ZHYA 2JCXA 1ONOA 2JCVA 2Y1CA 3AU8A 3CZGA 1JG9A 3ANLA 1T1SA 5JMWA 3RASA 2Y1FA 1ONPA 5JC1A 4ZQGA 3CZEA 4GAEA 4OOEA 3AU9A 1JGIA 3UERA 1SC5A 4KP7A 1MW3A 4FLRA 3IIEA 2MAOA 4A03A 1MW2A 4ZN6A 3AUAA 1G5AA 1MW1A 2JCYA 1MVYA 3UEQA 2Y1GA 3A14A 4AYSA 4Y67A 4FLQA 2Y1EA 3ZI0A 2JD0A 2JD1A 4NQWA
chains in the Genus database with same CATH superfamily
1ONNA 3FU0A 3B7UX 3R0IA 2C82A 4K5LA 3UCQA 3FTZA 3ZHXA 2XPYA 4QIRA 4AICA 5JNLA 4LUPA 1JVSA 4XO3A 3CZKA 1Q0QA 3B7RL 4R5XA 4Y6PA 4DPRA 2O7GA 2QVWA 3WQRA 4Y6RA 5DULA 1T1RA 2VLAA 1X3ZA 5AENA 3FU3A 1S46A 4RCVA 4X2UA 4K5PA 3WQQA 4RSYA 3VVMA 2MAPA 4FLOA 4K5NA 4JNDA 4L2LA 1H3LA 4MKTA 1R0LA 3FTXA 3FUMA 4XNDA 1HS6A 1Q0LA 4ZX3A 4QUOA 5DLLA 1GW6A 2WPGA 5JAZA 4QMEA 2RJIA 4XMTA 3CHSA 3FTVA 4R5VA 1OR7A 1MW0A 2PL5A 4ZQEA 1K5HA 2HPOA 2VJ8A 4FLSA 3CZLA 3T8VA 4AR1A 3CHPA 3FUJA 4ARFA 2EGHA 2Y1DA 4ZW7A 3FUHA 5JMPA 4ZX4A 3ANMA 4XMXA 2ZXGA 3FTYA 4Q4EA 3CHOA 3EBIA 3ANNA 3FUEA 4CXFA 4QPEA 4AR8A 3JSZA 3KEDA 1Q0HA 3ZHZA 2JD2A 2JV7A 3FTSA 4XMZA 4ZW5A 3T0YA 3FTWA 4FCAA 4ZW6A 4J3BA 3RC3A 3FU6A 4ZQFA 1SG7A 5HNHA 4R5TA 4Y6SA 1RP3A 1R0KA 3QJXA 3WQSB 3B3BA 4Q4IA 3FUKA 3CXBA 2C5ZA 4XMVA 4ZX6A 2GTQA 3EBHA 5JO0A 3PUUA 1ZS2A 5JBIA 5HLTA 3FUNA 4AR9A 3A06A 4XMWA 3CHQA 4ZQHA 2PUSA 4ZX5A 3EBGA 4XO4A 4XN7A 3FH8A 3CIAA 3FUFA 3U9WA 4OOFA 4XO5A 3ZHYA 2JCXA 1ONOA 3RC8A 2JCVA 2Y1CA 3AU8A 3CZGA 2XPZA 3B2XA 1JG9A 2QJ1A 4XNBA 3ANLA 1T1SA 5JMWA 2R72A 3B37A 3B7SA 4XNAA 1SQMA 3RASA 3FH5A 2Y1FA 1ONPA 4XN8A 2R59A 4PVBA 5JC1A 2FFLA 3CZEA 4GAEA 4OOEA 4ZQGA 3AU9A 4K5MA 5FWQA 3VVLA 4PW4A 2WZFA 4XN4A 4XMUA 4BKXA 4XN5A 3B2PA 1JGIA 4QHPA 3FU5A 3Q44A 2DQ6A 3UERA 1SC5A 4KP7A 2R70A 1H19A 1MW3A 4FLRA 4XN9A 3IIEA 2MAOA 3Q43A 4XN2A 4A03A 1MW2A 4MS6A 2DQMA 4ZN6A 5BPPA 3JT1A 3AUAA 1G5AA 1MW1A 3FH7A 4ZQTA 2JCYA 2WZGA 4PU2A 5HNFA 1MVYA 1X3WA 3B7TA 3HW2A 3CHRA 4GAAA 5DYFA 3UEQA 2Y1GA 3A14A 4AYSA 4ZW3A 2XQ0A 3B34A 4Y67A 4FLQA 2Y1EA 4R7LA 2PGGA 4K5OA 3ZI0A 4ZW8A 4RVBA 3FULA 3FUDA 3FTUA 2A7OA 2JD0A 5EV7A 4XN1A 2JD1A 4NQWA 2HPTA 2B61A 3FUIA 3FHEA
chains in the Genus database with same CATH topology
1ONNA 3FU0A 3B7UX 3R0IA 2C82A 4K5LA 3UCQA 3FTZA 3ZHXA 2XPYA 4QIRA 4AICA 5JNLA 4LUPA 1JVSA 4XO3A 3CZKA 1Q0QA 3B7RL 4R5XA 4Y6PA 4DPRA 2O7GA 2QVWA 3WQRA 4Y6RA 5DULA 1T1RA 2VLAA 1X3ZA 5AENA 3FU3A 1S46A 4RCVA 4X2UA 4K5PA 3WQQA 4RSYA 3VVMA 2MAPA 4FLOA 4K5NA 4JNDA 4L2LA 1H3LA 4MKTA 1R0LA 3FTXA 3FUMA 4XNDA 1HS6A 1Q0LA 4ZX3A 4QUOA 5DLLA 1GW6A 2WPGA 5JAZA 4QMEA 2RJIA 4XMTA 3CHSA 3FTVA 4R5VA 1OR7A 1MW0A 2PL5A 4ZQEA 1K5HA 2HPOA 2VJ8A 4FLSA 3CZLA 3T8VA 4AR1A 3CHPA 3FUJA 4ARFA 2EGHA 2Y1DA 4ZW7A 3FUHA 5JMPA 4ZX4A 3ANMA 4XMXA 2ZXGA 3FTYA 4Q4EA 3CHOA 3EBIA 3ANNA 3FUEA 4CXFA 4QPEA 4AR8A 3JSZA 3KEDA 1Q0HA 3ZHZA 2JD2A 2JV7A 3FTSA 4XMZA 4ZW5A 3T0YA 3FTWA 4FCAA 4ZW6A 4J3BA 3RC3A 3FU6A 4ZQFA 1SG7A 5HNHA 4R5TA 4Y6SA 1RP3A 1R0KA 3QJXA 3WQSB 3B3BA 4Q4IA 3FUKA 2C5ZA 4XMVA 4ZX6A 2GTQA 3EBHA 5JO0A 3PUUA 1ZS2A 5JBIA 5HLTA 3FUNA 4AR9A 3A06A 4XMWA 3CHQA 4ZQHA 2PUSA 4ZX5A 3EBGA 4XO4A 4XN7A 3FH8A 3CIAA 3FUFA 3U9WA 4OOFA 4XO5A 3ZHYA 2JCXA 1ONOA 3RC8A 2JCVA 2Y1CA 3AU8A 3CZGA 2XPZA 3B2XA 1JG9A 2QJ1A 4XNBA 3ANLA 1T1SA 5JMWA 2R72A 3B37A 3B7SA 4XNAA 1SQMA 3RASA 3FH5A 2Y1FA 1ONPA 4XN8A 2R59A 4PVBA 5JC1A 2FFLA 3CZEA 4GAEA 4OOEA 4ZQGA 3AU9A 4K5MA 5FWQA 3VVLA 4PW4A 2WZFA 4XN4A 4XMUA 4BKXA 4XN5A 3B2PA 1JGIA 4QHPA 3FU5A 3Q44A 2DQ6A 3UERA 1SC5A 4KP7A 2R70A 1H19A 1MW3A 4FLRA 4XN9A 3IIEA 2MAOA 3Q43A 4XN2A 4A03A 1MW2A 4MS6A 2DQMA 4ZN6A 5BPPA 3JT1A 3AUAA 1G5AA 1MW1A 3FH7A 4ZQTA 2JCYA 2WZGA 4PU2A 5HNFA 1MVYA 1X3WA 3B7TA 4GAAA 3CHRA 5DYFA 3UEQA 2Y1GA 3A14A 4AYSA 4ZW3A 2XQ0A 3B34A 4Y67A 4FLQA 2Y1EA 4R7LA 2PGGA 4K5OA 3ZI0A 4ZW8A 4RVBA 3FULA 3FUDA 3FTUA 2A7OA 2JD0A 5EV7A 4XN1A 2JD1A 4NQWA 2HPTA 2B61A 3FUIA 3FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONN A;  3R0I A;  3UCQ A;  3ZHX A;  2C82 A;  4LUP A;  4AIC A;  5JNL A;  1JVS A;  3CZK A;  1Q0Q A;  4Y6P A;  2O7G A;  3WQR A;  4Y6R A;  5DUL A;  1T1R A;  1S46 A;  4RCV A;  3WQQ A;  2MAP A;  4FLO A;  1H3L A;  1R0L A;  1Q0L A;  2WPG A;  5JAZ A;  1OR7 A;  1MW0 A;  4ZQE A;  1K5H A;  4FLS A;  3CZL A;  2EGH A;  2Y1D A;  5JMP A;  3ANM A;  3ANN A;  4CXF A;  1Q0H A;  3ZHZ A;  2JD2 A;  3T0Y A;  4ZQF A;  4Y6S A;  1RP3 A;  1R0K A;  3WQS B;  5JO0 A;  1ZS2 A;  5JBI A;  3A06 A;  4ZQH A;  4OOF A;  3ZHY A;  2JCX A;  1ONO A;  2JCV A;  2Y1C A;  3AU8 A;  3CZG A;  1JG9 A;  3ANL A;  1T1S A;  5JMW A;  3RAS A;  2Y1F A;  1ONP A;  5JC1 A;  4ZQG A;  3CZE A;  4GAE A;  4OOE A;  3AU9 A;  1JGI A;  3UER A;  1SC5 A;  4KP7 A;  1MW3 A;  4FLR A;  3IIE A;  2MAO A;  4A03 A;  1MW2 A;  4ZN6 A;  3AUA A;  1G5A A;  1MW1 A;  2JCY A;  1MVY A;  3UEQ A;  2Y1G A;  3A14 A;  4AYS A;  4Y67 A;  4FLQ A;  2Y1E A;  3ZI0 A;  2JD0 A;  2JD1 A;  4NQW A; 
#chains in the Genus database with same CATH topology
 1ONN A;  3FU0 A;  3B7U X;  3R0I A;  2C82 A;  4K5L A;  3UCQ A;  3FTZ A;  3ZHX A;  2XPY A;  4QIR A;  4AIC A;  5JNL A;  4LUP A;  1JVS A;  4XO3 A;  3CZK A;  1Q0Q A;  3B7R L;  4R5X A;  4Y6P A;  4DPR A;  2O7G A;  2QVW A;  3WQR A;  4Y6R A;  5DUL A;  1T1R A;  2VLA A;  1X3Z A;  5AEN A;  3FU3 A;  1S46 A;  4RCV A;  4X2U A;  4K5P A;  3WQQ A;  4RSY A;  3VVM A;  2MAP A;  4FLO A;  4K5N A;  4JND A;  4L2L A;  1H3L A;  4MKT A;  1R0L A;  3FTX A;  3FUM A;  4XND A;  1HS6 A;  1Q0L A;  4ZX3 A;  4QUO A;  5DLL A;  1GW6 A;  2WPG A;  5JAZ A;  4QME A;  2RJI A;  4XMT A;  3CHS A;  3FTV A;  4R5V A;  1OR7 A;  1MW0 A;  2PL5 A;  4ZQE A;  1K5H A;  2HPO A;  2VJ8 A;  4FLS A;  3CZL A;  3T8V A;  4AR1 A;  3CHP A;  3FUJ A;  4ARF A;  2EGH A;  2Y1D A;  4ZW7 A;  3FUH A;  5JMP A;  4ZX4 A;  3ANM A;  4XMX A;  2ZXG A;  3FTY A;  4Q4E A;  3CHO A;  3EBI A;  3ANN A;  3FUE A;  4CXF A;  4QPE A;  4AR8 A;  3JSZ A;  3KED A;  1Q0H A;  3ZHZ A;  2JD2 A;  2JV7 A;  3FTS A;  4XMZ A;  4ZW5 A;  3T0Y A;  3FTW A;  4FCA A;  4ZW6 A;  4J3B A;  3RC3 A;  3FU6 A;  4ZQF A;  1SG7 A;  5HNH A;  4R5T A;  4Y6S A;  1RP3 A;  1R0K A;  3QJX A;  3WQS B;  3B3B A;  4Q4I A;  3FUK A;  3CXB A;  2C5Z A;  4XMV A;  4ZX6 A;  2GTQ A;  3EBH A;  5JO0 A;  3PUU A;  1ZS2 A;  5JBI A;  5HLT A;  3FUN A;  4AR9 A;  3A06 A;  4XMW A;  3CHQ A;  4ZQH A;  2PUS A;  4ZX5 A;  3EBG A;  4XO4 A;  4XN7 A;  3FH8 A;  3CIA A;  3FUF A;  3U9W A;  4OOF A;  4XO5 A;  3ZHY A;  2JCX A;  1ONO A;  3RC8 A;  2JCV A;  2Y1C A;  3AU8 A;  3CZG A;  2XPZ A;  3B2X A;  1JG9 A;  2QJ1 A;  4XNB A;  3ANL A;  1T1S A;  5JMW A;  2R72 A;  3B37 A;  3B7S A;  4XNA A;  1SQM A;  3RAS A;  3FH5 A;  2Y1F A;  1ONP A;  4XN8 A;  2R59 A;  4PVB A;  5JC1 A;  2FFL A;  3CZE A;  4GAE A;  4OOE A;  4ZQG A;  3AU9 A;  4K5M A;  5FWQ A;  3VVL A;  4PW4 A;  2WZF A;  4XN4 A;  4XMU A;  4BKX A;  4XN5 A;  3B2P A;  1JGI A;  4QHP A;  3FU5 A;  3Q44 A;  2DQ6 A;  3UER A;  1SC5 A;  4KP7 A;  2R70 A;  1H19 A;  1MW3 A;  4FLR A;  4XN9 A;  3IIE A;  2MAO A;  3Q43 A;  4XN2 A;  4A03 A;  1MW2 A;  4MS6 A;  2DQM A;  4ZN6 A;  5BPP A;  3JT1 A;  3AUA A;  1G5A A;  1MW1 A;  3FH7 A;  4ZQT A;  2JCY A;  2WZG A;  4PU2 A;  5HNF A;  1MVY A;  1X3W A;  3B7T A;  3HW2 A;  3CHR A;  4GAA A;  5DYF A;  3UEQ A;  2Y1G A;  3A14 A;  4AYS A;  4ZW3 A;  2XQ0 A;  3B34 A;  4Y67 A;  4FLQ A;  2Y1E A;  4R7L A;  2PGG A;  4K5O A;  3ZI0 A;  4ZW8 A;  4RVB A;  3FUL A;  3FUD A;  3FTU A;  2A7O A;  2JD0 A;  5EV7 A;  4XN1 A;  2JD1 A;  4NQW A;  2HPT A;  2B61 A;  3FUI A;  3FHE A; 
#chains in the Genus database with same CATH homology
 1ONN A;  3FU0 A;  3B7U X;  3R0I A;  2C82 A;  4K5L A;  3UCQ A;  3FTZ A;  3ZHX A;  2XPY A;  4QIR A;  4AIC A;  5JNL A;  4LUP A;  1JVS A;  4XO3 A;  3CZK A;  1Q0Q A;  3B7R L;  4R5X A;  4Y6P A;  4DPR A;  2O7G A;  2QVW A;  3WQR A;  4Y6R A;  5DUL A;  1T1R A;  2VLA A;  1X3Z A;  5AEN A;  3FU3 A;  1S46 A;  4RCV A;  4X2U A;  4K5P A;  3WQQ A;  4RSY A;  3VVM A;  2MAP A;  4FLO A;  4K5N A;  4JND A;  4L2L A;  1H3L A;  4MKT A;  1R0L A;  3FTX A;  3FUM A;  4XND A;  1HS6 A;  1Q0L A;  4ZX3 A;  4QUO A;  5DLL A;  1GW6 A;  2WPG A;  5JAZ A;  4QME A;  2RJI A;  4XMT A;  3CHS A;  3FTV A;  4R5V A;  1OR7 A;  1MW0 A;  2PL5 A;  4ZQE A;  1K5H A;  2HPO A;  2VJ8 A;  4FLS A;  3CZL A;  3T8V A;  4AR1 A;  3CHP A;  3FUJ A;  4ARF A;  2EGH A;  2Y1D A;  4ZW7 A;  3FUH A;  5JMP A;  4ZX4 A;  3ANM A;  4XMX A;  2ZXG A;  3FTY A;  4Q4E A;  3CHO A;  3EBI A;  3ANN A;  3FUE A;  4CXF A;  4QPE A;  4AR8 A;  3JSZ A;  3KED A;  1Q0H A;  3ZHZ A;  2JD2 A;  2JV7 A;  3FTS A;  4XMZ A;  4ZW5 A;  3T0Y A;  3FTW A;  4FCA A;  4ZW6 A;  4J3B A;  3RC3 A;  3FU6 A;  4ZQF A;  1SG7 A;  5HNH A;  4R5T A;  4Y6S A;  1RP3 A;  1R0K A;  3QJX A;  3WQS B;  3B3B A;  4Q4I A;  3FUK A;  2C5Z A;  4XMV A;  4ZX6 A;  2GTQ A;  3EBH A;  5JO0 A;  3PUU A;  1ZS2 A;  5JBI A;  5HLT A;  3FUN A;  4AR9 A;  3A06 A;  4XMW A;  3CHQ A;  4ZQH A;  2PUS A;  4ZX5 A;  3EBG A;  4XO4 A;  4XN7 A;  3FH8 A;  3CIA A;  3FUF A;  3U9W A;  4OOF A;  4XO5 A;  3ZHY A;  2JCX A;  1ONO A;  3RC8 A;  2JCV A;  2Y1C A;  3AU8 A;  3CZG A;  2XPZ A;  3B2X A;  1JG9 A;  2QJ1 A;  4XNB A;  3ANL A;  1T1S A;  5JMW A;  2R72 A;  3B37 A;  3B7S A;  4XNA A;  1SQM A;  3RAS A;  3FH5 A;  2Y1F A;  1ONP A;  4XN8 A;  2R59 A;  4PVB A;  5JC1 A;  2FFL A;  3CZE A;  4GAE A;  4OOE A;  4ZQG A;  3AU9 A;  4K5M A;  5FWQ A;  3VVL A;  4PW4 A;  2WZF A;  4XN4 A;  4XMU A;  4BKX A;  4XN5 A;  3B2P A;  1JGI A;  4QHP A;  3FU5 A;  3Q44 A;  2DQ6 A;  3UER A;  1SC5 A;  4KP7 A;  2R70 A;  1H19 A;  1MW3 A;  4FLR A;  4XN9 A;  3IIE A;  2MAO A;  3Q43 A;  4XN2 A;  4A03 A;  1MW2 A;  4MS6 A;  2DQM A;  4ZN6 A;  5BPP A;  3JT1 A;  3AUA A;  1G5A A;  1MW1 A;  3FH7 A;  4ZQT A;  2JCY A;  2WZG A;  4PU2 A;  5HNF A;  1MVY A;  1X3W A;  3B7T A;  4GAA A;  3CHR A;  5DYF A;  3UEQ A;  2Y1G A;  3A14 A;  4AYS A;  4ZW3 A;  2XQ0 A;  3B34 A;  4Y67 A;  4FLQ A;  2Y1E A;  4R7L A;  2PGG A;  4K5O A;  3ZI0 A;  4ZW8 A;  4RVB A;  3FUL A;  3FUD A;  3FTU A;  2A7O A;  2JD0 A;  5EV7 A;  4XN1 A;  2JD1 A;  4NQW A;  2HPT A;  2B61 A;  3FUI A;  3FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...