4ZN6A

X-ray crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase (ispc) from acinetobacter baumannii
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
397
structure length
392
Chain Sequence
TQSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARDHQALLLPVDSEHNAIFQSLPHNYLQADRTGQPQLGVSKILLTASGGPFLNHSLEQLVHVTPQQACKMGQKISVDSATLMNKGLELIEACHLFSISEHFVTVVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLFEYSQLNFQAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVVEHTLEKLENAAAESIECILDKDKVARSVAQQYISSIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title X-ray Crystal Structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase (IspC) from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii (strain ab307-0294)
total genus 129
structure length 392
sequence length 397
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4zn6A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zn6A01
3QVOA 3E1KA 1EVJA 1B14A 1HWYA 1KVQA 2Q49A 3T7CA 3WNVA 4UVDA 3OHSX 3RKRA 3JYOA 5HA5A 3PP8A 2X0IA 3X2EA 2XPCA 2VUUA 4RDHA 1D4FA 1UXHA 2QYTA 3K9QO 3KZVA 3LU1A 2Y0EA 2D59A 1D1TA 3A4VA 2LDBA 3FNHA 2Q2QA 4BKRA 4TMFA 1ZCJA 2O3UA 3HN7A 3W6ZA 1DAOA 3WX0A 3CEAA 3VZPA 2Y67A 1MG0A 1B8PA 4FS3A 4PGFA 5JYEA 1T4BA 1UP7A 3DZJA 4YRDA 1U9JA 1V35A 2FR0A 3MZ0A 4I8XA 4N7RA 3HSKA 4BMNA 3LF1A 1UP6A 4J0EA 1DC6A 4XDZA 4CV0A 1O89A 3IS3A 3JD2A 4J4TA 4AVYA 1R4MB 1ZMTA 4TQGA 1K89A 4BO9A 4FFMA 4QFDA 2CUKA 1EVIA 5IDQA 1U5AA 1E5QA 3H8VA 5DZSA 2I67A 4GLOA 3RC2A 3MTGA 2FWMX 3JYNA 5CP8A 2Q50A 4OL9A 5CPFA 2IRWA 3GF4A 3U5TA 1PGNA 2AA3A 3NEPX 3RUEA 2PGLA 1U8XX 2J3KA 3PHLA 1G0NA 1ARZA 3JQAD 4YRAA 2BFPA 4A10A 4FLRA 2X23A 3ADOA 4ND2A 2GN4A 2PZLA 3R6DA 2OHXA 5TJHA 2UDPA 4F45A 1XR3A 4S3MA 5TQVA 3GOHA 2I66A 3OJ0A 5EERA 5JPIA 4GSLA 1XKQA 2Y0DA 3JYQA 5KVQA 1SOWA 3UH1A 4GBJA 3BMOB 1ZS2A 1HL3A 1KY5A 2NTJA 3A28A 3K2BA 4AJNA 4IDGA 2HMSA 2OZPA 5CHEA 4Y8VA 3RVDA 3PIIA 3RU7A 3FTPA 4OOEA 2JAHA 3F47A 3JYLA 4BKQA 3GRKA 2CF6A 1UAYA 3WR5A 4NK5A 4LMRA 4HFNA 4CLXA 4RLSA 3H7AA 4TRJA 1X0XA 1UUFA 1G5AA 1C0KA 1C1XB 1WP4A 5HWSA 3IIEA 1RM5A 3Q9UA 4W82A 3BMQB 4TRRA 1XIVA 3WIEA 4CR8A 3ICPA 1WDKA 4P38A 5JY1A 3OQ1A 4KZPA 5IZCA 3GH3A 4II2A 4XYMA 3L4SO 4F3YA 4RPHA 3GNQA 2O2YA 4HFJA 4RORA 2NQTA 2C2XA 4OM8A 1PQUA 3ZU3A 1Y6JA 1KEUA 2DQ4A 2D2IA 5BNTA 1JN0A 5HRUA 4Z3DA 2GNAA 3ONEA 3AY7A 1QORA 4RV9A 3B1KA 1A27A 2GCGA 1D3AA 1V3TA 5HS6A 4D3SA 5JCJD 3F46A 2PR2A 2Q99A 2B5WA 4AJEA 5I7EA 1PX0A 3EZLA 2VTDA 3FPLA 5G0TA 3DMYA 4DRYA 2HMVA 2Z1MA 1ZH8A 4CUJA 3OICA 1MB4A 2C20A 2X9NA 3UCFA 1UXGA 3DOJA 4BNUA 1RWBA 4PRLA 1E1NA 3DOOA 1E7QA 3ON5A 4XYGA 1NASA 2DTEA 4DL9A 1ZXBA 1Y7TA 1P44A 2ZTLA 3H9QA 1DFGA 2NVBA 5A1TA 1S6YA 2BRUA 3UCEA 3CSDA 3F9IA 1DIGA 1DRVA 2NU6A 3PQDA 5CDSA 4H7PA 3OSUA 1R6DA 2GPTA 2NTVA 2OOSA 1JAYA 1NPYA 3B1JA 1QV7A 4Y98A 4IXWA 3GVIA 3WSWA 5A9RA 5ILOA 3Q2IA 5DP1A 1H93A 1XQ6A 5COQA 1JA9A 3O8QA 3LT4A 3DXFA 1HE3A 1N9GA 4WLEA 1D7OA 3JD1A 3QQPA 1GUYA 1T1SA 2O7QA 3ULKA 3M2TA 1W6UA 2Y68A 2PH5A 1Q7CA 3WGGA 1ZW1A 2EHDA 3FD8A 4UAGA 5GMOA 3ZH2A 3TOZA 3VPXA 5F1OA 5JAIA 1W8DA 3D3WA 3MTJA 4OXYA 2J3JA 1BW9B 4IBOA 4CODB 1DFIA 4CXFA 4IGFA 3PTZA 4DPKA 1DHRA 1SEPA 4IM7A 4XR4A 3EW7A 5DNAA 1PGQA 4JGBA 5JC8A 3GPIA 1E3SA 1EEHA 1X7DA 1YBMA 2OBNA 2ZYGA 3D4OA 4B3JA 3VC7A 3NV9A 4E5PA 1ISFA 3L77A 3INRA 4ID9A 4LUPA 3RROA 2PD6A 1GAEO 1K6JA 4GX5A 1QP8A 4UEJA 4BNYA 4RVSA 4ZQBA 4D7AA 2UUPA 4ND3A 3QA9A 4CLHA 1PS9A 5DN9A 1LRLA 1NHGA 1LEHA 1U4SA 4KWHA 2H1SA 4Z0HO 4DTIA 1VL0A 3A06A 3QW2A 2WDZA 3DBRA 2PWZA 3E5MA 1I2ZA 2WYWA 5TLSA 2TMDA 2DUUA 1HE2A 4JJFA 4R16A 3WMWA 4BMSA 3ABIA 4BNXA 4D46A 4YACA 1JW9B 2GN6A 3ZHZA 3C7AA 3RFVA 4IUYA 4W9NC 4IIUA 1PL6A 4NJOA 3V2UA 2JFFA 4IQ0A 3ZNOA 3I4FA 4IDDA 4AG3A 3K96A 4GGPA 4DYDA 5KWEA 4MKRA 4DUPA 4FCCA 4DXHA 1HETA 5F21A 1YJ8A 4DPMA 4JJIA 4WCFC 4DIFA 2HQ1A 4LMPA 3PZRA 1E7YA 3VPFA 3EK2A 4NR0A 1Z45A 2HAEA 2QRJA 2Y0CA 3FHLA 3OFSA 4IQGA 3VTZA 4DMLA 4J9UE 4R1TA 4MVJE 1UDBA 4MP8A 4N5LA 1X1EA 2PD4A 4F6CA 4HUJA 3GMSA 1LTHR 4I5GA 3NDJA 1IB6A 5THQA 3QSGA 4CMAA 5JLAA 3D1LA 1F0YA 1TT5A 1IUKA 3FBGA 1I0ZA 4N5NA 3UEQA 4BKUA 2GYYA 3I4CA 3U0BA 3A1NA 4Y67A 1OOEA 3BHMA 5C7LO 5IXSA 2OL4A 4NJMA 4W6ZA 4J4HA 4PZCA 3PWSA 4PLZA 2AEJA 3GDOA 2GRAA 3OA2A 1OFGA 1BGVA 3EGOA 3UUWA 2J8ZA 2PFGA 4R41A 3U4IA 1B0AA 1N1EA 5AYVA 3ZW8A 2PD3A 2SCUA 3IQDB 1OR7A 1QYVA 3LLSA 3LYLA 5T64A 3JQAA 3ENNA 3GZNB 4J9VA 1ONOA 4FFLA 3INGA 5G2OA 4YQYA 3ZWYA 4BO2A 4R3NA 4BNJA 1KY4A 4UUNA 3L4BC 4HBGA 2CZCA 2PKQO 3E9NA 4FR5A 1MW1A 2ZTMA 4K9DA 2QQ5A 8ADHA 4LCJA 1K2WA 2J5RA 2GSDA 3ZWMA 3IUPA 3PRJA 1I3KA 4RDIA 1LQTA 4FFRA 1LDMA 2VYVD 5L4LA 5L53A 1NFRA 2BHLA 3W4JA 3UOGA 4JJGA 4MO2A 4Z0TA 1KVTA 1KYQA 1I10A 3RWBA 2UAGA 4HADA 2P4QA 3CPSA 4L9RA 1UZMA 1LRJA 4Y6RA 4BVAA 5JBIA 2WE8A 2PGJA 3D5QA 1DIHA 2PKRA 3CZLA 2A94A 2BGLA 2Y1OA 1T2DA 1NM5A 4GMFA 1BHSA 5JDIC 2DM6A 4OYRA 1KS9A 2JCVA 2I5PO 4O1MA 4TVBA 5EQDA 3BYZA 3OIDA 3ANNA 2NTNA 4K26A 4DLAA 9LDTA 3DR3A 3WLFA 1LSJA 1VLLA 2CD9A 3BMQA 4TZKA 4WUVA 4YPOA 2AQHA 1WXDA 4BV8A 2H9IA 1EVYA 1KVSA 4E5YA 4J2OA 4FLOA 1J0XO 2Z95A 3VZRA 5KJFA 1R4NB 3BTSA 3BMNA 1CQIA 1GV0A 5T5QA 2JCYA 2BH9A 3BA1A 2WYVA 4XWYA 1SB8A 1LLUA 2HK7A 4B4VA 3TZCA 2I6TA 1I8TA 2JHFA 3DL2A 2XXBA 2X22A 2VUTA 4G65A 2EV9A 2PTGA 4TKMA 2EGGA 3WJ7A 3JQ8A 4DLLA 2X6TA 4FPXA 4XQ9A 1P9LA 2QRLA 1Y1PA 4CL8A 1H9BA 3HFGA 5TRTA 3KHUA 3I6QA 4Q39A 3KYBA 4DQUA 4OGWA 1PWXA 5BQFA 1W4ZA 3ICCA 2WEKA 3M1LA 4WK6A 1HDOA 5FI3A 4FJ0A 1V3VA 3BHIA 1FMCA 2Q2VA 3QHAA 4BNZA 3JCZA 3BZUA 1C1DA 3NT2A 4QT0A 4BNKA 3H65A 3ONFA 3NRCA 1DXYA 1YQDA 4BNTA 4U6QA 2O2SA 5A3JA 1LSSA 4J90A 4ZN6A 3MJ4A 2DTDA 3ZW9A 3DZGA 3DHYA 4NNJA 1U28A 5C3MA 4P4LA 1JG9A 4F46A 3S8MA 2QX7A 3GR6A 2NADA 1IPFA 3FNGA 4XB1A 1L7EA 1DHTA 1Z7BA 2Q1UA 1Z6ZA 3JSAA 5A05A 4YAGA 5LDGA 1GPDG 4WNCA 4OXKA 4INAA 3EDMA 3DZBA 2OXIA 4AJ2A 2BFAA 1P1KA 2WMDA 4QEDA 4RPGA 1PJBA 2VNAA 3HADA 3L9XA 3HB4X 1B8VA 4FGWA 1MUUA 5HM8A 1BW9A 3DONA 2GZ2A 4EBFA 3PQFA 4IMPA 4MVJG 1CERA 4GVLA 4BNVA 4M55A 2B5VA 2AEMA 2GO1A 3GQVA 4UUPA 2G1UA 1BG6A 1LQUA 3VTFA 4NG5A 4EEXA 3R1IA 5L45A 3KYCB 3IDSA 1YONA 3E9QA 3HQ4O 3UAGA 3P2YA 3ZWBA 3UERA 1SO8A 1ZSNA 3WJAA 2GUGA 5H83A 4PLPA 2VCYA 3BXXA 1YL5A 2G0TA 3GFBA 2AE2A 3CH6A 1ZK2A 3ETEA 1HDZA 3PVZA 3VH4A 4A03A 3JTMA 4CR6A 4PG8A 1RYDA 1T2EA 4U0JA 4J1TA 1YB1A 3HUDA 3JQ9C 5L51A 5B37A 5CEJA 4KDFA 1EUDA 1KC1A 3ZGYA 3Q6IA 4LRTB 5DDIP 1RM3A 3FF4A 1DIRA 4FDAA 2NUAA 1LLDA 4DQXA 5IFLA 3VPGA 5BNIA 3GDGA 3JV7A 3TZ6A 1XU9A 1ZEMA 2P5YA 4Z3KA 3HDHA 4R5MA 1GEEA 2PZMA 1UXJA 1JLLA 4FOSA 4DYVA 1AXGA 3KSUA 2CVOA 1PJSA 2V6GA 4UVHA 3WLEA 3RBXA 1F12A 4M8SA 1P31A 1BMDA 1LBEA 3PDJA 1AXEA 3D7LA 1GFSA 3CZEA 2DUWA 4RVDA 2WD8A 4QSMA 4Y6PA 1YQXA 1E1LA 3OMLA 5KJ1A 1EZ4A 4NU5A 1FDWA 3N74A 4OXNA 5DCWA 3UW3A 4L0QA 3RUFA 4BO4A 5A3VA 5I7FA 4AJLA 5L95A 1HSZA 5TC4A 3AY3A 4KWIA 1HRDA 3AI2A 3U62A 1U3TA 1XSEA 2R6JA 2YV2A 3WGIA 2DBZA 1NQOA 4Z9YA 2BELA 1K6XA 4OQZA 5DBFA 1P77A 1LNQA 3EUWA 3GZ4A 4MP3A 2MAPA 4EUEA 4YQZA 5K6AC 3LC2O 3ZHXA 1YJQA 2W98A 4GSKA 4LVUA 5TNXA 3AU8A 1H9AA 3BTVA 3O38A 3VH1A 4WOJA 1HDGO 4PZDA 3GZNA 4MOWA 3I6IA 4RCVA 1LC0A 3ZHYA 1B3RA 3EVNA 3GFGA 1BWSA 1SZJG 5JDCA 4UUOA 1ZVMA 3FCOA 1VE9A 1QRRA 2YUTA 4C4OA 2EKQA 2B35A 4DGSA 1TB4A 4XGKA 2HRBA 2AMFA 3RU9A 3TFQA 2B4QA 3PZBA 2VYVA 2I3AA 1ZEJA 3OBBA 3GG2A 4BUCA 1I33A 2NU9A 1WDLA 5FF9A 5JYDA 5ER6A 1EBFA 1XA0A 3VZSA 3RSHA 1EK5A 3DBLA 3KLMX 2HCTA 3O8QB 1CEQA 1I5RA 1N9GB 2FP4A 1EK6A 2FOIA 2W2KA 2W90A 3ZV6A 2PNFA 1YDEA 5A5EA 1LSUA 1PZGA 3I9NA 4ZJUA 2O50A 3D3WB 1GTMA 1CYDA 4GMGA 5BSFA 2DVMA 1ENYA 1NHWA 2D0IA 1M75A 1R4NA 4RZHA 4XCVA 1SOVA 1U3WA 4HKTA 2VHWA 3QY9A 2QW8A 4YWJA 1E3WA 5JNLA 3Q2KA 3E6AA 4J2HA 1DB3A 3UFXA 3RQSA 1Y9AA 4BO7A 3PHHA 1JQBA 1F17A 1NVGA 2P68A 3CE6A 2DBQA 1E7RA 1YO6A 2GF2A 4NFHA 3TZHA 3GDFA 4ZQHA 2OP1A 1I3LA 1VKNA 3M6IA 4EJMA 3F5QA 4M89A 4B3HA 1GYRA 1V9LA 3P5SA 3DBRB 3DDNA 3ROQA 4BKPA 1Z73A 4MJLA 4IDEA 4RF3A 2FR8A 4CMGA 4XGIA 5B4VA 3LF2A 3AOEC 2Y1DA 4PLYA 3I9JA 2GASA 4AICA 1TA4A 4KTVE 3BAZA 1C0PA 1H94A 2JD1A 1NNUA 2HRZA 1PR9A 3MJSA 2G17A 3RASA 1MC5A 3U4HA 4PG4A 3RCBA 3RJ5A 1R0LA 2EERA 5JE8A 1R0SA 1P1FA 5I8ZA 1E3LA 3VKUA 1H6AA 4ZGWA 3F4LA 1UJMA 1NR1A 4B4WA 4NBRA 3L6EA 3AM5A 4EITA 4P22A 3S2EA 1TT5B 4UUMA 2PK3A 3H3FA 5L40A 5KJCA 3OIGA 2ZQYA 5EESA 4PG5A 5JSFA 4JLWA 2C59A 2CY0A 4NJMB 4HY3A 1JAXA 2X5KO 3PGJA 3ZWPA 2D5AA 3TL3A 4IINA 5EN4A 4D41A 1VL6A 4OHUA 4S1VA 1H2HA 1GZ4A 1AUPA 1KIFA 1KEPA 2VHXA 3M1AA 3MOIA 4FC7A 4DC1A 5IJZA 3KYCA 4QECA 4G5HA 4BB5A 3VVCA 3JQAB 4E13A 2C07A 3QIVA 4KP7A 1ENPA 2IYPA 4A2CA 4GI2A 4HXYA 1D8AA 1M67A 4DBZA 3DFZA 4YR9A 4Y6SA 1E3JA 3CIFA 1DAPA 1M2WA 4XRGA 3AJRA 1J4AA 2I3GA 4E12A 4PLGA 4RLHA 1UAGA 3EHEA 3IKVA 4ZQEA 3FN4A 4W7IA 3TF5A 1U7HA 4N54A 5ITWA 1N2SA 5C7IO 2FN7A 3HZZA 4QO7A 2V65A 2PLAA 4TSKA 4XQEA 2ZTVA 4R51A 1N8KA 1BSVA 3HN2A 1LDEA 3FBTA 4L76A 1A7KA 4QTZA 3GA0A 3GGGA 4JP3A 2NM0A 1LI4A 1QYDA 4WLFA 4CV3A 4GKVA 3B20A 3H9GA 4MIEA 3PLNA 1J49A 3GGPA 1HZJA 1YS4A 2O3QA 3H5NA 5IDXA 3E03A 1MXHA 3K6JA 4BO5A 4E4YA 4FOOA 3KUXA 3I9MA 2TMGA 1HDRA 2BFMA 2FY8A 1E6EA 5AXBA 5TGDA 2D3TA 1HLDA 2AQIA 2JJYA 3EC7A 1U3VA 3BMNB 5KVSA 2IE0A 1MVYA 2WJPA 3DHEA 3CZMA 4IJUA 2VZ0A 1PL8A 2XAAA 1O8CA 5AQ1A 5JS6A 1R16A 3IP1A 1VJ1A 4A27A 3MJEA 4CM4A 5T8KC 4R68A 1ZJYA 2O7GA 3ZN2A 3LLVA 5JO0A 1HDCA 1WZEA 5GZ3A 4JP2A 4QO8A 1PJLA 3F3SA 4YA6A 1A4IA 3JQ8B 2IYOA 1B3BA 3DEYX 1Y8QB 3SXPA 1BXZA 4D44A 2CNBA 3ITKA 3DBHA 1IULA 1EMDA 3G1UA 3TDKA 3AUUA 3IAHA 4QFCA 1ADBA 2O48X 1HT0A 1PJTA 1ENOA 4BO0A 1I32A 4L4SA 2X7HA 4L75A 1MW2A 1TI7A 4CM5A 3FI9A 1B8UA 4UREA 5DOVA 1LC3A 1E7WA 4II3A 1C1DB 1BDBA 4UVIA 1ISGA 4ZICA 4FN4A 3AFNA 2A92A 3OIFA 4IZHA 3CKYA 4ZHSA 3AY6A 2X0JA 4YJDA 2NVWA 3ZV3A 4BQRA 3PK0A 5K9ZA 1ZMOA 4U6SA 4H16A 3KLPX 4I5EA 3R0IA 1A72A 2EF1A 2VYND 4H3VA 4NBVA 3QVWA 2V7PA 4CM9D 1MP0A 2P9GA 2NLOA 2CFCA 4CM3A 1O0SA 1EFLA 2YJZA 3H2SA 1MXFA 1NX6A 4RVFA 3MJCA 1IE3A 5ILGA 4J0FA 4K6CA 4CMEC 1XDWA 3KSZO 4YT5A 5KTKA 1HTBA 5BR7A 3C1OA 4CM6A 2ZCUA 1VM6A 4XJTA 1MGOA 3WFIA 3IL2A 5ENVA 4TZTA 4YB8A 1B15A 1BXGA 1PR3A 2YHIA 4WECA 8LDHA 1NFFA 3KYDA 3DB2A 4M49A 3QE3A 5IDYA 5H82A 4I9HA 3CZGA 1AE1A 3GNSA 4IPTA 1O94A 5BSEA 4U7WA 4BGEA 2POQX 3U09A 3ZNPA 1SBYA 3O4RA 4HWKA 1T2CA 4MINA 1KEVA 4IZIA 5KVCA 1LRKA 2V6BA 1K0UA 3MWEB 4WEQA 2GN8A 4XYEA 4WLUA 3WB9A 2EXXA 2QZZA 3RKUA 5DBGA 3L07A 2AE1A 3DZHA 2RBEA 1T2AA 3KBOA 3G49A 4KTTE 1HDYA 2BMAA 1EFKA 4YJFB 3QP9A 3PPIA 3RC9A 1ZIDA 3PXXA 1HDXA 3PDUA 3WYCA 5DOZA 1QYWA 4Z0PA 4XA8A 1HYEA 2X1HA 2ZB3A 3L6OO 2Y93A 1ZK3A 1R12A 2Q1TA 4UEOA 3WMXA 3I23A 4IDFA 1NXQA 1VSUA 4RJTA 1BVRA 4ND5A 2IDZA 5DF1A 4EJ6A 3WGHA 5AXAA 1ULSA 4PN3A 2B0JA 4ND4A 5C37A 4ALNA 5IN5A 1H0KA 1GCUA 3KRTA 1EE2A 1Y5MA 2EP7A 1VJ0A 4CUZA 1NWCA 5L4SA 4U8GA 2F1KA 1A71A 4XR9A 5F5NA 1PZEA 4PLWA 2Q2WA 2JCXA 2GLXA 3JQFC 4HFMA 3SEFA 4B4OA 3ZNNA 3E9MA 4I1IA 4GX1A 4BHTA 4A7PA 4BOYA 3NTRA 3W8DA 4KUEA 1XU7A 2OO5A 5CPBA 1FXSA 2JHGA 3WGOA 4JBHA 1YOVA 3C24A 3GAFA 4B4UA 3QVXA 3IOYA 5FFFA 3FR8A 4OO3A 2E49A 2FSSA 2JD0A 3GHHA 4MVJF 5G4LA 3DMTA 3OA0A 4MVJH 5IXYA 3W4KA 4W4TA 5L7WA 5F5LA 4PG6A 3ANMA 3Q11A 1WWKA 4CMJA 5A02A 1V8BA 5THKA 3CTMA 1ML3A 1Y5RA 2Z1NA 3ROMA 4FLSA 1UDCA 1SEVA 1ZUD1 2NU7A 3DC2A 1X13A 4WJZA 2W8ZA 3UVEA 3QRWA 4RF4A 3W6UA 1KC3A 3IUSA 2HDHA 3W8EA 4PLTA 2I65A 1GR0A 2P9EA 3G0OA 3H9JA 3HHPA 5GY7A 5I9LA 3NYWA 3WOHA 1KEWA 2DBVO 2R00A 1LDYA 4E2YA 5ITVA 1E3EA 5DBIA 3DBLB 4J49A 1X7HA 4R1SA 3OF2A 3OQBA 1EE9A 3DAPA 3W1VA 2A35A 4LSWA 1D1SA 3AI3A 5FEUA 2W2KB 3D64A 5ENDA 1I24A 2PY6A 2HK9A 3GUYA 4I9UA 2B4RO 3RC1A 5EJ2A 1Q2XA 4ALJA 4Q3NA 1DEHA 3I52A 1JVSA 5CAEA 1OBFO 1PTJA 4B3IA 4XYLA 1DIBA 3WGZA 3LT2A 1PZFA 3JQCA 3LC1O 3SJ7A 4ZA2A 3VOSA 4E2XA 4L4XA 4CM7A 6LDHA 1QSGA 3NUGA 3GVHA 3QWIA 2Q45A 5JAZA 1HYGA 4OIMA 2JKVA 1H2BA 3UXYA 3NX4A 1SMKA 2BGKA 2XF8A 1UZNA 2G5CA 1E3WB 4IIVA 4XZ3A 2D5CA 5DP2A 4BMVA 2VUSA 5FWNA 1U5CA 3TJRA 4Q3AA 4J7XA 2E37A 5BSGA 5KNLA 5JCJA 1P74A 1PS8A 4CLEA 1E92A 2VWPA 4PVCA 1Y8QA 5EL0A 5KJ6A 3U9LA 2AEFA 4R01A 1WZIA 5L7YA 4D3DA 4MVJI 4P4GA 1GD1O 4YJHB 3PHJA 1N92A 4NIMA 1I2BA 1KBZA 1RYEA 3KVOA 5F1PA 3PLRA 4GAEA 4JNKA 4YT8A 2HU2A 5H81A 4DLBA 1XYGA 2YY7A 2W2LD 3DQPA 4EGFA 1QLHA 3OJFA 4BL5A 4YAKA 1DPGA 2VTEA 3MOGA 2E48A 4AJKA 4D42A 4DIOA 3C7DB 1PJQA 2PA3A 3WNQA 2EKLA 4ZVVA 4D0RA 1S46A 3S55A 5TT0A 1UXKA 2VYNA 1U8FO 5HS4A 2BI7A 2NV6A 1OAAA 4PLVA 4OAQA 3AW9A 1N7GA 3ZWXA 4JK3A 4CQLB 1CF2O 2VHVA 4QQRA 2Y1CA 3AOGA 1JVBA 4D0SA 4E6PA 4AJOA 4BO6A 3K30A 1JKIA 4YVFA 3ASUA 3FTNA 3RUIA 1GUZA 2RCYA 3HDYA 2UV8A 3WBBA 4PLCA 3DTTA 4ILKA 1YWGO 1TXGA 1IZ9A 3QWFA 4GL4A 4O59O 2DC1A 1YB4A 5KVVA 5F3RA 4R3WA 3N7UA 3V1TC 1NFQA 1P0FA 1GV1A 3N58A 2QZ9A 4X54A 3L9WA 4FBGA 2Y66A 1NWHA 3KXDA 1GCOA 1XHLA 3O26A 2FPIA 3GLQA 3QJ5A 3VH2A 3HWRA 2O7SA 4Q3EA 1Q0LA 5CG1A 1R15A 3IC5A 3PJFA 1BTOA 1PJ3A 2NACA 4UVGA 5A9SA 5BNFA 4IJVA 3WYBA 1IYZA 1Z82A 1LLQA 5T6BA 4RF5A 2ZQZA 3P19A 2HJSA 4YJFA 1MX3A 2C54A 5TT1A 2VQ3A 3OJEA 5CEFA 2YQ4A 1GYQA 3TNLA 1DSSG 2VWGA 4B7UA 5IAAA 3ZWCA 3SLGA 1R37A 3Q9NA 3KTDA 4BO8A 1EDOA 3VZQA 4IDBA 4BNIA 4CLDA 2EGHA 5LCXA 4W7HA 4TROA 3EYWA 3KEOA 1ONNA 3OH8A 1C0IA 1JTVA 1YE3A 1F8GA 1RM0A 3RUCA 4R54A 1JWAB 2AXQA 4JX8A 2IXBA 1B16A 1H6DA 1NPDA 1NQAO 3GPDG 9LDBA 3SLKA 5AXCA 3TSCA 3TZKA 3JQGA 1BDMA 2XXJA 4AJ4A 4OH1A 4BGVA 1ZZEA 2EW8A 5A4DA 3DAGA 5COBA 1BXKA 3H3JA 1G0OA 3KV3O 1MW3A 1PU2A 3AU9A 4URFA 3ADPA 3HDJA 4ALLA 4F6LA 3WGTA 4WOKA 4AJPA 1CWUA 5KKAA 3ORFA 3LZ6A 1X0VA 3IP3A 3RJ9A 4R9SA 1ZKMA 3ZU2A 4YRBA 3ZWNA 4WLOA 1I3NA 5LC1A 4E31A 4U0KA 5F1KA 3OEWA 4CM4B 1ZK0A 2I99A 5AOVA 3DHNA 5AXDA 4D45A 2YDXA 5EQFA 3UICA 1X14A 2I76A 5TJ9A 4MIOA 3S2FA 3QVSA 5L7TA 4M87A 3DBHB 4A0SA 2HSDA 3NDIA 3C7CB 2H63A 3QWHA 3ZV5A 4A26A 3GC6A 5COAA 4CLRA 4L4RA 5U1PA 4Q3DA 4OKIA 3DFUA 1JU9A 4D3FA 4P4NA 3WQRA 1OC4A 1U2DA 4XGNA 4R5HA 2HJRA 1PS0A 3K8ZA 4OSOA 3RUDA 1DIAA 1LLCA 1PGOA 4GX2A 1C0LA 4RQTA 4E0BA 3ZV4A 3VVBA 4AL4A 1T24A 4O63O 5KKCA 3WQQA 3GNTA 1K6IA 2DFDA 4J7CA 1TT7A 4W9NA 3JQDA 3GEGA 4GX0A 3I5MA 2DU8A 2PH3A 4RZIA 4XKJA 2C5EA 4IY1A 3DZKA 4BNHA 1YXMA 1BXGB 2VZ8A 3WGQA 4WCDA 4R69A 2YHIB 3SVTA 3KO8A 3I1JA 3UCXA 3WICA 4BNNA 4E32A 3P2OA 1WLYA 3KYDB 1I36A 5DCYA 2Y05A 1I2CA 3K2EA 1Z75A 3ASVA 4WCFA 1E1MA 3A14A 1HE5A 2YQ5A 3ETGA 4H15A 2NSDA 2OGUA 1EQ2A 4G81A 2VWQA 3BIOA 2UYYA 5L4NA 2QRKA 4J1QA 2X86A 1O5IA 4EUHA 1UH5A 4HP8A 3GMDA 4IDAA 1WMBA 2OMEA 2PGDA 2G82A 3PWZA 3WTBA 3G3EA 1QYCA 3GN1A 1DJQA 1N5DA 4Z9FA 1DO8A 1TVEA 1WMAA 4YT2A 4CMKA 5HTOA 4CM1A 1EUCA 3K31A 1V3UA 1X15A 1NAHA 1AHHA 4NPCA 3VH3A 1DLJA 1GYPA 2HUNA 3LT0A 4BGIA 2WSBA 1GZ6A 3MCVA 1ORRA 3EVTA 4E5MA 2AW5A 1P0CA 1ZXLA 3RUAA 1VI2A 2YHUA 4HNHA 2WD7A 3L4BA 4PFJA 4CM8A 4XQCA 4FC6A 4P8RA 5IZ4A 2HMWA 3T4XA 3O9ZA 1H5QA 2QYSA 1ZJZA 5TSDA 3WFJA 2VWHA 4DPLA 5CDUA 2UUOA 1QXSA 1QG6A 4KUGA 3D0OA 1E6UA 4LGVA 5ER9A 4E5NA 1E6WA 3R3JA 3I9LA 1VSVA 1DRUA 4WKGA 1MC4A 5CFZA 3BHJA 4W99A 4CLOB 4CQMD 4GWKA 3UHAA 4DVJA 4RVGA 2QIOA 4CQLA 4LCEA 5TIIA 2BGMA 2P4HX 3PYMA 4E2ZA 3RI3A 3ST7A 1LDNA 4WNIA 1LX6A 2X5OA 1N7HA 4MVJD 1MW0A 5U4QA 4OMUA 2FPPA 2EW2A 4O6VA 3OQ6A 5JDIA 5A03A 1Y8RB 3VKVA 2FZEA 2WPGA 2OBYA 4WPGA 3PJDA 1V6AA 1O6ZA 3ZWOA 3H5RA 4RF2A 3R3SA 4IXTA 4BIIA 4NFSA 4C7KA 4XD2A 1MFZA 1YOVB 3AWDA 3BMCA 7MDHA 4NH4A 1P1JA 2WTBA 2ET6A 4EEZA 1LXCA 3RAJA 5ICSA 3V1YA 2NVUB 4K28A 4LRSB 1E7MA 4ZQFA 1A9YA 3AK4A 3D4PA 5T67A 3WWYA 1ZO8A 3W8FA 2HO5A 4YDRA 3WXBA 5GZ6A 2C0CA 1E77A 1IPEA 1E0DA 4U5QA 4UULA 3RC7A 1OZAA 1MV8A 3BTOA 2NNLD 1WNTA 2C7GA 4FSHA 3C8MA 1GDHA 5JO9A 1DFHA 1VJTA 4PLFA 4YBZA 4HFRA 5JCXA 3DZFA 4XDYA 1PQWA 2F00A 2WE7A 5CDTA 2X58A 3PHIA 2Y99A 3F6YA 4RPKA 7ADHA 4CUKA 5MDHA 1SAYA 4FFOA 4FB5A 5B4TA 2H6EA 1KVUA 1Q1NA 1WDMA 3I9OA 3VPHA 1Y81A 2ZIZA 4O5OA 4DA9A 4RL6A 1WPQA 2D1YA 2DPGA 4XIJA 2GERA 1FDVA 2GDZA 4NBTA 1M6WA 1RP3A 1TEHA 2FHSA 3QWBA 3G1TA 3E5RA 3KEQA 2X4GA 3LK7A 3M2PA 3TFOA 2UVDA 1H3LA 5IN4A 3LQFA 2X0NA 2OUIA 1DLIA 2DAPA 3TRIA 4NHEA 1IHXA 4WLNA 4E33A 3KETA 3KSDO 4E30A 2ZYDA 5BSHA 6ADHA 1IOLA 2CF5A 2GD1O 5HBRA 2Y1GA 4TRNA 5EINA 1JWBB 3GRPA 4NMHA 4RQUA 5EMHA 2C2YA 5JAMA 3GG9A 4AJHA 1SCUA 4CV1A 3B70A 4OQYA 2V6FA 4EW6A 1TLTA 4GGOA 4MIYA 1QR6A 4MDHA 4MKZA 3NKLA 3JQ7B 5BT9A 4J91A 1SB9A 1A4UA 2VRBA 4MP6A 4ALIA 4J4BA 5IDWA 4IS2A 4E3ZA 3T4EA 2PKQP 1E3IA 4R1UA 5DCUA 2PV7A 2FZWA 1ONPA 3QV1A 2C5AA 3G17A 1HEUA 3ZHBA 1YDWA 4I08A 1J6UA 4BQPA 4IDCA 4Z9XA 4D43A 3JQ9A 4KQXA 2RAFA 3CMCO 1JGIA 4NQZA 2E82A 1Q7BA 2BLLA 2O4CA 3E82A 3PQEA 4FFPA 4AJIA 3H9EO 1JKFA 1P45A 3OECA 4NBWA 1FK8A 1ZSVA 3V2HA 1WVGA 2NWQA 3I3OA 1EDZA 4NFYA 2Q1SA 1NTOA 2Q4BA 2YFHA 3GN2A 1SC5A 1GZ3A 3WQSB 2IZZA 4QUKA 1YQGA 3V8BA 1M76A 4LVCA 3FNEA 2P5UA 1YVEI 3FWNA 3LSYA 3VAZA 2D8AA 2AHRA 4IJWA 4AJ1A 3ANLA 3DBVO 4AFNA 2X5JO 1QKIA 1ZK4A 4ZRNA 1NVTA 1FJHA 1UDAA 3CUKA 3S1LA 3MEQA 3DTYA 1YBAA 1CRWG 1DDOA 3PJGA 3TL2A 4LW8A 2EP5A 5IG2A 2GN9A 1T4DA 1EVZA 1HE4A 4WE3A 3TN7A 3GT0A 1F8FA 1OI7A 4MPDA 2EIHA 2IODA 2RHRA 4BNWA 1R66A 4PLHA 5EPOA 4LSMA 3TZQA 2DKNA 1AHIA 5FYDA 4C7JA 3RIHA 5CDGA 1YL7A 1V0JA 1MA0A 3DAFA 2ZB7A 3EZYA 3JQBC 4NU6A 2CVZA 5A9SB 2WM3A 2PZJA 3W4IA 1PL7A 5K6AA 5FI5A 5JMWA 4HNGA 3RUHA 1T1RA 2FMUA 1F14A 4ESOA 3GEDA 2YW9A 1VKOA 4RPLA 3COSA 3BTUA 3GK3A 2J3HA 4RO0A 1VL8A 3P7MA 4YYZA 3L0DA 1GQ2A 3K92A 2AQ8A 4KOAA 4I5DA 4CJXA 1H6CA 1HF3A 2Q4EA 5A9TA 3S2IA 4YJGA 2IZ1A 3FPCA 4YCAA 5G0VA 2Y1EA 5JDCC 3ZWWA 1YBVA 1GU7A 3X2FA 2QG4A 4B8WA 3SBOA 1XELA 4XX0A 1HKUA 4CMIA 1RJWA 1ZK1A 3I83A 1HXHA 4OSPA 1RPNA 3RFXA 2H5LA 3WBFA 1ADCA 3AM4A 3NT5A 1GQYA 4TKLA 1CIVA 3OP4A 3HFSA 3B1FA 4Z6KA 2HLPA 3ITDA 4NK4A 4CLOA 4CQMA 3JQGB 4YAIA 3C1TA 3WGYA 1UZLA 2YZ7A 1A5ZA 1FF9A 1QYXA 2NQ8A 3FWZA 3HNPA 3WG9A 1U4OA 4BGUA 1Z74A 4WGGA 4AYSA 4YJHA 2DFVA 5I9MA 4MVJA 1K5HA 4ZD6A 3WDSA 1Q0HA 1LDBA 4EDFA 2C7VA 4BB6A 2O3JA 2B37A 1Y8RA 4PG7A 3NT4A 4E5KA 2VOEA 5G4KB 1KETA 1CETA 2JFHA 4IMRA 4HX5A 3F5SA 5B1YA 2EEZA 1UXIA 4GWGA 5T57A 4HV4A 2NVUA 1G1AA 1XQ1A 1PZHA 1DC5A 1DC4A 1E7SA 4R1NA 1UP4A 4OKNA 1UR5A 1E1KA 1P1IA 2IEDA 3PIDA 4BV9A 3ZNQA 2Q46A 4YTEA 3HB5X 3WTCA 2AG5A 3GUCA 3UN1A 3Q3CA 1R4MA 2JFGA 5ADHA 2A9FA 1Q7GA 1KOLA 1IL0A 3CMMA 1ISHA 2IEBA 4R4JA 1U2GA 2CVQA 4CLRB 1B26A 1ISJA 3WWZA 1YL6A 1ZSYA 4O0LA 3MJTA 2O4UX 2ZJ0A 1PGJA 4KDEA 5MGBA 4KQWA 4XIYA 1OC2A 2C29D 2VT2A 5KJEA 4GKBA 3U49A 3IJPA 5JMPA 5TX7A 1ZNQO 3TWOA 4YT4A 1PSDA 1PEDA 3E48A 3AOEA 3TOXA 4A5OA 3DWFA 1PWZA 3VHRA 2J6IA 1GUFA 2Z5LA 3BMOA 1LJ8A 3QLJA 4DBVO 3FNFA 3C3XA 5G0SA 3DOCA 3NGLA 3AI1A 4B7CA 5U9CA 4JN6B 2OP0A 5KCZA 3AFMA 4KUHA 4WCFB 4ZQGA 3OEYA 2Y1FA 2X0RA 5TF4A 2BKAA 1H6BA 2JD2A 2CDBA 2RIRA 1MG5A 3DO5A 3ZU5A 1PGPA 4L8VA 5L3ZA 1GL3A 2ZB8A 3LDHA 1YKFA 2DPHA 2ZATA 3JD3A 2ZKLA 4XB2A 1WAMA 1Q0QA 1C1XA 2LDXA 2FPGA 4PIVA 3GVXA 3VDRA 3CXRA 5B12A 5JAQA 2X9VA 1ISIA 4J43A 3V2GA 3OJOA 3HJAA 1QV6A 4LN1A 4BS9A 4NI5A 3ROPA 1T26A 2R2GA 5I9NA 4JBIA 4DC0A 2XOXA 2P91A 3JQ7A 2GZ3A 3JD4A 2X9GA 1NVMB 4AJJA 4EJ0A 1HZZA 2G76A 3OM9A 5CEEA 1AN9A 1O9BA 2I9PA 3JYPA 3PJEA 4M1QA 1I01A 2VNSA 1VC2A 2O3TA 2VN8A 5JFOA 4CPDA 3ONDA 3GVPA 1B7GO 4J1NA 3ROKA 2CMDA 2WD7B 4OOFA 3CZRA 4CM8B 1HLPA 4E2WA 3NGXA 4M54A 4DREA 3ZI0A 2YV3A 3MWDB 4YAEA 2MAOA 2HMTA 2BF7A 2VRCD 3NJ8A 5C7OO 2RHCA 1DRWA 1IY8A 3H6KA 5ES3A 2EKPA 2P2SA 4ROSA 2NU8A 4JQCA 4CM9A 1MFPA 3U3XA 3LT1A 5CDYA 3C1AA 4JBGA 3AUTA 1P33A 4CMHA 2E6UX 3D3EA 2DLDA 4UVEA 3WIDA 1NR7A 3NTOA 1Y9EA 4K6FA 1LUAA 2ZB4A 3KM0A 1U7TA 3PHGA 4N18A 2DT5A 3AUSA 4ND1A 1W73A 3ETDA 1P3DA 3EAGA 1LA2A 2Q3EA 1DBVO 4TRMA 4Q3BA 3H2ZA 3IKTA 1XEAA 2ZCVA 3PYXA 4BNLA 1NP3A 2BD0A 4L74A 4K1LA 3WYEA 3BMCB 4Y9DA 1EQUA 5C5IA 1NPTO 2EG9A 4IJKA 1U1IA 3VDQA 4BNGA 4GVXA 1P1HA 2OORA 4A73A 2BFOA 1SPXA 2ILTA 5IZCC 3H4VA 1P1RA 4LISA 2O23A 4N5MA 4EI2A 1CQJA 2YFQA 3RFTA 4FIZA 1GY8A 3LC7O 1I3MA 4ZU3A 4ITUA 2BI8A 1GQQA 3PEFA 2D4AA 3GVCA 5T8KA 2CDCA 1PIWA 2OFPA 1FDUA 1M6HA 1NQTA 1GADO 3DZIA 4UEKA 1ISMA 3B6ZA 2GZ1A 1RM4A 2B83A 2E4AA 4G2NA 3KOUA 4JIGA 1AGNA 4B8ZA 1QLJA 4FFNA 1XGKA 4B79A 3ZWAA 3E8XA 1L1FA 4PZEA 5JXWA 3OJLA 3JD0A 4JROA 3K73O 5TS3A 3T0YA 4EUFA 1A9ZA 4J7UA 5A06A 2V6MA 3AUAA 1LSOA 1NYTA 1MLDA 3NAQA 1ADFA 1PQPA 2JAPA 3KB6A 5AVOA 2VZ9A 1ENZA 3A9WA 4GH5A 4I5FA 5I7SA 1ZBQA 3QVTA 1R0KA 3U4DA 3ZZNA 5KOIA 1Z7EA 4CV2A 1CDOA 3U4CA 4XJSA 4IGEA 1ULUA 1YB5A 2C82A 2B36A 4J3FA 3HE3A 2VHYA 5B4UA 4KMSA 3UCQA 3STHA 1M66A 4B7XA 1B2LA 5GZ1A 1I30A 3C85A 4TWRA 4RGBA 4WEOA 3ENKA 4Q3CA 5JW6A 1XCBA 4CMEA 4XRRA 2O3RA 2PZKA 2X8LA 3H5AA 4TVOA 1YRLA 2J3IA 4PRKA 1QMGA 4R9RA 4GLLA 1NBOA 4NDNE 5CG2A 4CMBA 4BNFA 4MKXA 3D5TA 5G4KA 2DBRA 4BKOA 4DIBA 2FR1A 3GY0A 1EBUA 1HSOA 4BO3A 2FRDA 3UF0A 5I8WA 1FDSA 4WLVA 4NBUA 4RVUA 3E18A 1BVUA 4J6FA 3RBVA 3F1KA 3JQEA 4E21A 3PGXA 4EYEA 2B4TO 3SC4A 4QX6A 3L6DA 3AM3A 3TQHA 2VHZA 2A4KA 4FW8A 1PJCA 3F1LA 2IZ0A 4ALKA 4J1SA 4ZRMA 1CJCA 1PJ4A 2EJWA 2HKIA 2ZYAA 4J16A 4ONEA 4EZBA 3SJUA 2WWRA 5G0WA 4LK3A 4XQGA 5IF3A 2GR9A 3UKOA 3JQBA 5K0ZA 3GEMA 4FQ8A 3PFWO 3PI7A 2YDYA 2O3SA 3H9UA 4CL3A 2EJVA 4JXKA 2ZTUA 3SC6A 1YGYA 4I9NA 2VOJA 5KIAA 3ZWVA 1K3TA 1X7GA 2P9CA 4WASA 4D79A 4GPD1 3T7EA 5LDHA 1NAIA 1U3UA 1JDJA 2J5QA 3PWKA 1SC6A 2ZJ1A 4MVJP 4ALMA 1IZ0A 4NZ9A 5G0UA 1GPJA 4FLQA 1C14A 2HK8A 2RH8A 4RVHA 4GQAA 1DOHA 2VT3A 3HG7A 4IQ8A 1ZFNA 1L7DA 1XLTA 1A7AA 3F4BA 3CZKA 1WW8A 3INTA 2B69A 2YV1A 3HDQA 3SX2A 4BO1A 3UGKA 1FDTA 4M86A 4YXFA 3ZCXA 3D4NA 5EIOA 3CINA 4L73A 4XYBA 1BRMA 4IS3A 1X1TA 1EUZA 1ID1A 2QHXA 3I9KA 4RPJA 4OJNA 4PVDA 3O03A 3JQFA 3EMKA 2WYUA 3ZU4A 4FD3A 4BNMA 5JY6A 4YEDA 1OMOA 2Q1WA 1J5PA 2IXAA 5A5FA 1DJNA 3GAZA 1ADGA 2AG8A 3FRJA 4JCOA 4PCVA 1F06A 3IJRA 3GHYA 3EY4A 3OETA 2RH4A 4CR7A 4DQVA 3GGOA 1NQ5A 3NTQA 1O95A 3DMTC 3V5NA 2JL1A 4FJ2A 4CMCA 3FR7A 1C3VA 1KVRA 3VPSA 2AQKA 5I7VA 1XG5A 5J23A 1KERA 4Q9NA 4DMMA 1GEGA 2ZK7A 5DULA 3NJ4A 4XEHA 5DT9A 3WS7A 3WSVA 1LDGA 5A04A 4DWVA 1T2FA 5ICMA 2CSUA 4QXMA 1E5LA 4YJGB 4NQWA 3ZDFA 3FSRA 2W2LA 1T25A 3TPCA 1JKJA 1HYHA 4FJ1A 3PFFA 4CMIB 3NDRA 3MJVA 2DTXA 2HMUA 2VRCA 3QWAA 1N1GA 1SNYA 3JQ6A 4FGSA 2GGSA 3RD5A 3RBZA 1VPDA 1YH3A 2YYYA 1S7CA 4YAJA 2W4QA 3Q0EA 2R00C 3V1UA 3K5PA 1RKXA 1W0CA 1VRWA 2EWMA 1IHYA 3G79A 3IMFA 3Q1LA 4CQMB 1DC3A 2CDAA 4MVJM 3S2GA 5L9AA 1PJ2A 1LU9A 3LVFO 5JC1A 1XWFA 3PYLA 2J5KA 2FSVA 1G6KA
chains in the Genus database with same CATH superfamily
1MR3F 1QF7A 4WY5A 2VCEA 1KVQA 2DSTA 3WNVA 5JCZA 3TS1A 4ZI5A 4NV1A 2OG1A 3PP8A 6YASA 3X2EA 1QFYA 2VUUA 1Z8NA 2I34A 4RDHA 3EMBA 1TTPB 5C1DA 2LZ0A 3FZNA 3K0AA 4UNNA 3KZVA 4N48A 3SQWA 2N1BA 1VPEA 2AZTA 5JSZA 2O3UA 1B23P 1DAOA 4GYWA 3CEAA 3BA6A 2OV8A 2Z2XA 1MG0A 1B8PA 3HBJA 5JYEA 1T4BA 2F3PA 1UP7A 2YVLA 4JVLA 4CF7A 3DZ8A 4G5FA 3ZQKA 3GMTA 1U9JA 1J9EA 1DP4A 1V35A 2ZWIA 4YPFA 4K0KB 3BWYA 4BMNA 4LE2A 2PRIA 1L7BA 3KE9A 4GHWA 4IIHA 3WGUA 1QH8A 4I4NA 3LQYA 1KY2A 2OHJA 1U0SY 3IS3A 1YZTA 4URZR 5CM9C 1HMPA 4AVYA 5A6SA 1K8XB 3VX4A 3N0TA 5EEGA 5JEDA 1SC4A 2KS6A 1PN3A 1UJNA 2ENUA 2HWWA 3ZCVA 4UDNA 3EQ2A 1E5QA 5IDQA 5BWOA 2R5NA 2ZUUA 3DDCA 3IBYA 2I67A 4K6OA 4OBWA 5DZSA 3VFDA 4LC9A 1N6OA 2FWMX 2ZRJA 3BVPA 3TIVA 2Q50A 1L5YA 1PDOA 3LCVB 3VPAA 1S3FA 5A3QA 2OCDA 1NZJA 1G6HA 2HA0A 5FR1A 1QS0A 1JKMA 1C3LA 1GSHA 1T9DA 3GF4A 3AL2A 4PYQA 2SCUB 1T1JA 1BQ4A 3E8MA 1U8XX 1A8UA 1G0NA 3JQAD 2AMJA 3B6IA 5E7MA 3T3PB 4H31A 4OB8A 4YRAA 1I51A 1Z07A 3SZOA 1M5RA 1MTZA 1JT9A 2WM8A 3ZQJA 2ZBDA 3B13B 2GN4A 5EZ6B 2PZLA 1DQSA 2M9MA 3GCWA 4JODA 2A0UA 5CCBA 9ATCA 3K1AA 5CGZA 4OAPA 1FUEA 3E9RA 4PVBA 4BMXA 3OJ0A 3FYUC 5JPIA 3EBOA 2NT4A 2Y0DA 3NZEA 3KQMA 4JB0A 2H52A 4MQEB 1U7WA 1UPAA 3IGFA 1M0EA 1N32B 4PFQA 4FZRA 2KB0A 2OWEA 1V3QE 1P7CA 2FLVA 3AF0A 3C6BA 2OZPA 1XDZA 4ML3A 1L4NA 3FVQA 2VTVA 1H42A 4GZ3A 4Y8VA 3PIIA 3FNQA 3RVDA 2J9FA 4FE4A 4OOEA 2BGTA 1KAOA 5KYUA 2JAHA 1KP2A 1TK3A 2ZJ3A 4D9IA 5A1JA 1JR6A 1NI5A 3C5EA 1TJ4A 3WWOA 5SYAA 3FVVA 2YJ4A 4QFBA 1VHDA 4AO7A 1PRYA 4RZSA 3WR5A 4A1FA 1L4MA 4NK5A 3IO5A 3T0IA 3IP6A 4ZI7B 1SVWA 4TRJA 1QE0A 4TTIA 4V38A 5BPPA 1NE2A 2PVSA 5HWSA 3WHIA 3IIEA 3T4PA 3K0BA 2LXNA 3CEJA 2R8ZA 4ETNA 1NKVA 1XMPA 2F4NA 3W3AD 2A86A 3L93A 3MRXA 2E1PA 1KI3A 5JY1A 3MINA 4L8WB 1KH3A 3ROGA 1ELOA 1NBMD 4Q9KA 3GH3A 4II2A 4XYMA 4F4CA 1Q21A 1VE3A 3O8BA 3QKUA 1ZOLA 1XJQA 3DUWA 4BBPA 4F3YA 1QGUB 3BGOS 4RHEA 4ZDJA 3GNQA 3DBOB 4HFJA 1NA5A 1YSCA 2C2XA 2NQTA 1QRAA 3MVEA 1Y6JA 3RWOA 1F38A 1KEUA 4UTNA 3FZGA 3GEPA 5BNTA 4V0ME 3R5FA 1XQWA 3R6WA 1AK2A 2Q5QA 2GBIA 2VDWB 5FFMA 1QORA 4RV9A 3B1KA 2CJYA 2GCGA 4FHGA 4PEVA 2PEZA 3SS9X 4CT0A 3IBTA 4MTCA 1PUJA 5EP4A 4A5SA 2PR2A 1U2PA 4OU4A 2B5WA 2HA5A 5EGSA 1BNCA 4I3HA 5I7EA 3EZLA 4G1FA 5G0TA 3HYSA 3DMYA 4J1TC 1NXXA 1YCDA 2Z1MA 4H4EA 5B1IA 4FCWA 2BDTA 5F7XA 2C20A 2ZS7A 2QL6A 2NU8B 1RWBA 3B53X 5TR9A 1E1NA 3X44A 3ZQ6A 2IYXA 3FBWA 2OWDA 5FADA 3OF3A 4NRDA 3UAXA 4XYGA 4E1BA 4G4SP 2VF8A 2DTEA 3K71B 3Q85A 1TLLA 5IJWA 1ZXBA 5KNBD 1XMQB 2RHWA 1Y7TA 2EWVA 4LK2A 4Z86A 1SVSA 2GUWA 1IH8A 3UCEA 2IX3A 1N0IA 2EQBA 4XNAA 4H7FA 5EIHA 4H7PA 4M83A 3M7IA 3BFJA 1QWSA 2GPTA 2NTVA 4YLEA 3M9LA 3SBDA 3ZW7A 1JAYA 2UYQA 3AZOA 3CF4A 3U3MA 5KYGA 3ZLVA 1USIA 2BM9A 4P7GA 2JI4A 4ZU1X 2IJGX 3Q2IA 4JLJA 4MHSA 3DDWA 5DP1A 1SUWA 3RQIA 1C8LA 1XQ6A 4HAZA 3F3YA 1JA9A 2WLSA 2WTNA 1QPBA 1X92A 3LT4A 3O8QA 4LZLA 3ZXUB 2GKSA 4NKRA 1FLNA 2O5CA 3C3EA 3D1VA 1PVDA 4R7GA 4BUZA 5DIFA 3WA7A 4EAQA 4Y2HA 3SC2B 4RJJA 1ZW1A 1OWNA 2N9UA 2ZSBA 3CCCA 4U4AA 1MD9A 3FD8A 5JAIA 4RTSA 3ZH2A 3VPXA 3U3RA 1Z0KA 4C7VA 1W8DA 2HHAA 3KHKA 2PANA 2BR4A 5LXTF 3UQZA 4LF8B 3DR5A 3PFIA 3VVMA 4LDQA 4CODB 1DFIA 2HTEA 4CXFA 1K08A 3PTZA 4XR4A 1RE1A 5DNAA 5T41A 1YIOA 4EBBA 1USVA 1F2VA 5DEIA 3KZKA 3KVRA 2ZYGA 4JEUA 1YBMA 1TQ8A 5JYBA 3LQQA 2CMKA 3VC7A 4ZOAA 1JECA 1G8PA 4F1WA 3WB2A 121PA 1KAEA 2QN7A 1N57A 3RABA 3RROA 4RHXA 4UUQA 3WIBA 1K6JA 1U5BA 1QP8A 1I4EB 1Z8DA 2F67A 2O1SA 4RVSA 2UUPA 4WKPA 1R5OA 5LMCA 4HH0A 5AT1A 3SOZA 4AY5A 2FZ4A 1SFRA 3SBXA 3W5UA 3RB8A 1PSWA 2DPMA 4Z0HO 1VL0A 2WDZA 4CGYA 1BMFA 3R9XB 3ID6C 4BLPA 1TCCA 1RYYA 4OXIA 4L7QA 13PKA 3EGDB 3N2YA 3UJPA 3A6GA 3LRTA 1WQ1R 2CL5A 2PWZA 4FU0A 4QUBA 3E5MA 1TEZA 1G59A 1TD1A 2V7VA 3V7UA 5TLSA 1Z28A 2DUUA 1HE2A 2RD2A 4E2FA 4XPIB 1NNEA 1KDPA 2GZHA 4BMSA 3ABIA 4D46A 3QI7A 1ZM3A 4ZKEA 4DLPA 1KMMA 4OK3A 5ALNA 3RFVA 3ZE2B 2NXJA 1W59A 4IIUA 4NJOA 3V2UA 3ZNOA 3TX2A 5IVPA 3QXJA 4D6XA 1MDFA 3PENA 5ALSA 4G36A 3E2IA 4QQ8A 2IPAB 4MKRA 1VCNA 2HUPA 4DXHA 3QUTA 1HETA 2XTAA 3DJFA 3OU6A 4JJIA 2VATA 3NFYA 1J1ZA 2PG3A 4NPAA 2PZAA 4IXMA 2J0VA 2X2EA 3X3HA 2V0GA 1S8OA 1V43A 3ZTTA 1Z45A 2HAEA 4QHPA 3FHLA 5FRDA 5ECWA 4A0RA 1IXSB 1AA9A 2PIAA 3AVPA 5M5BA 2PUHA 4MP8A 4FFVA 4RH0A 1FSZA 2GXUA 5T4HA 2QUZA 3GMSA 1VB3A 2X2OA 5J5VA 3TINA 3SSAA 3K5WA 2AHOA 1Y63A 1FTYA 5THQA 1KPHA 5JLAA 5JXHA 3QNUA 1NXTA 3FBGA 2CNOA 1F8XA 1KDRA 3I4CA 4MZXA 5HFJA 3A1NA 1OOEA 4FYVA 4LA4A 5IXSA 3E9CA 4W6ZA 2BHTA 4PZCA 3PWSA 1AO0A 2AJ8A 1NVUQ 3GDOA 4M0CA 1N2BA 1AKNA 1OFGA 2SBTA 1BGVA 2J8ZA 2PBLA 3ERCA 2PFGA 3OSZA 1N1EA 2R62A 3FH0A 4XARA 3TZBA 3V8PA 1QH1A 4ZTUB 2FW7A 3IQDB 1X87A 1E2EA 1XC7A 5T64A 2TS1A 4K9NA 3WAJA 3R7BA 3HO8A 3INGA 2R8XA 5J2UA 1Y9DA 3O5AA 2OGWA 4IMIB 1J5EB 3KU4A 4BO2A 4R3NA 5CTJA 1GLVA 5DO9A 1JEDA 4HBGA 4X9XA 1MW1A 1YBFA 4G8CA 1YA8A 3IUEA 3TGPA 1N2ZA 2BDEA 2J5RA 2FHPA 3NWOA 4HHEA 4M21A 2H11A 1I3KA 2JB9A 1NW7A 1WP9A 3TI7A 1LDMA 1C29B 5ADWA 3HCWA 5GONF 1XX6A 5L53A 2BHLA 3IQWA 5IC5A 3LNCA 4N1AA 2YZKA 2GI4A 3CZPA 4WZBA 5IMSA 4ZOCA 2XY4A 3B1XA 3U17A 3TGLA 2XITA 5JNWA 1GZ5A 2Q9CA 2X8JA 2P4QA 3LCUA 3GT4A 1CR0A 2WVHA 1JQKA 1LRJA 3RE1A 4C4SA 2PGJA 1HT2E 3CZLA 1JHOA 2OGTA 2PKRA 3HWX1 5IVIA 3QE9Y 1NM5A 2QX9A 3TYXA 2DGDA 2OXFA 2P9BA 2HD4A 4PSUA 4TVBA 5FH9A 5DCLA 1STOA 1UEJA 1IHUA 4UHCA 1A1VA 2NTNA 3PA8A 1O0BA 3N2GA 3DR3A 2ZP1A 3IIKA 3D6TB 3WLFA 3DCNA 4LS3A 2VZLA 4LG1A 4D25A 3BMQA 2UU9B 1RYBA 4JI0B 4IWYA 2ZVQX 4WN9B 4D6PA 3BXHA 1KVSA 4W5HA 1UK9A 2AV6A 4E5YA 2PM8A 3KQNA 2VTBA 1R4NB 1RKBA 1M2JA 2PKYX 3P9YA 4IXNA 3ODPA 5C8VA 1ECLA 1GV0A 2PZBA 3OPMA 3R0ZA 5T5QA 3E3NA 1BYUA 1UT6A 3B8EA 3CF4G 2WYVA 3NCHA 1Z36A 2HADA 4FYKA 4XWYA 3EIUA 4JYMA 5DW3A 3FH8A 3BJMA 4LJYA 5FHQA 5FLEX 2I6TA 1I8TA 3FUTA 2LCQA 3AV3A 5HBGA 4OK5A 1J1IA 4DV7B 1CE8A 2GPWA 2JLZA 4RZUA 1GITA 1N6RA 2AR7A 3DDHA 3FNIA 3GFSA 3WJ7A 3JQ8A 3R8XA 4CHGA 2X6TA 3NRBA 2OESA 3AR5A 4OI0A 3A10A 1EGVB 2P2YA 1H9BA 1H22A 3HFGA 2KWIA 1W87A 5JAHA 3THRA 4DQUA 5KBYA 3AUKA 2YL2A 5FA8A 5DHTA 4AKSA 4JA2A 3F49S 1W4ZA 2G71A 1JSLA 3HA7A 4KN5A 4ODIA 4PRYA 3TZEA 4B85A 4R0MA 1JLMA 2XTJA 3QLUC 3ZHSA 3IERA 2R1ZA 5FI3A 4HJRA 2XMSA 5KQRA 1NUQA 2H85A 4HNSA 2FE4A 5AQEA 3QHAA 1AS2A 1CQXA 5IS2A 3MSCA 2ZRPA 2XQKA 2WZGA 2Q3BA 3GPCA 4FTWA 2RKOA 1YQDA 2D1TA 3COWA 4QUHA 2O2SA 3FWHA 4U6QA 2YCLA 4BB0A 2Y71A 4B3TB 3U31A 2CXOA 3OCZA 4JJ4A 2FZKA 2PH7A 5BY2A 4ZN6A 2X4DA 1AZLA 2I7TA 4YCLA 1FP4B 1JG9A 1T8SA 1XZPA 1QIEA 3Q2OA 3S8MA 4ZODA 1OXKB 2ZU0C 4I8DA 5ARDA 2QWXA 3F90A 1XTKA 2NOAA 1XTBA 2YY5A 3FNGA 5AJVB 3M89A 1DHTA 1Z7BA 4X24A 1LCIA 1NBWB 2ZWVA 3EEYA 4WUTA 4YH1A 5CX1B 5EUBA 5A05A 3S70A 2FFBA 1GPDG 4WNCA 5LDGA 4ZJYA 2OC4A 1PWEA 4K5MA 2H3EA 1JG3A 1T9KA 2ECFA 3QVUA 1OV6A 4MV1A 1CJUC 4X20A 4JBLA 1KFEB 1P1KA 4RPGA 1R1DA 5AHXA 1PJBA 4KITB 4UPVA 4GYKA 3U3OA 2A7OA 4DOMA 1C3EA 2OCXA 2WR8A 4YMIA 3L9XA 2WJYA 1G64A 3EZNA 3HB4X 3NUZA 1BW9A 1VL1A 3GUUA 4YP9A 3DCYA 3GEEA 1G16A 2GZ2A 2VJPA 3RRFA 4IMPA 3UHPA 4EBFA 4GVLA 5KMGB 4A23A 3S8EA 4N0PA 2B5VA 2GO1A 4CQNA 3PDHA 2C3UA 2QRPA 2G1UA 1BG6A 3VTFA 3H5LA 1KDZA 1GAJA 1DKQA 4JOCA 4AN1A 4WINA 2DYKA 3JSZA 2OQIA 3GW8A 2JHPA 3PE3A 2AR9A 2C78A 2EFCB 3FJOA 3KYCB 9ABPA 1KQPA 2PGNA 5C18A 5JBNA 1SO8A 1DV1A 1WBDA 3T5TA 3RYHA 1ZSNA 1RWQA 2JIRA 2WKWA 2VPQA 2NV2B 3MGGA 4YREA 3RGGA 2AI2A 4MMYB 4N7JA 1OB2A 1GPH1 2AE2A 4N0DA 3GARA 1QHIA 1SXPA 4U6NA 3JTMA 1P7YA 3PQ6A 1FVHA 1TJNA 4EZEA 1E69A 5FAKA 5K05A 4B3FX 1CZRA 1Y48E 1N3LA 3L43A 3QUAA 5ALLA 1BCRA 2LD4A 4G09A 4KDFA 4G37A 2WAAA 2C2ZA 1EX9A 1WSBA 2HMAA 2O7VA 4MMXB 4V2UA 5DDIP 4FDAA 3VGPA 3BBPA 3VPGA 16PKA 1SVNA 2IT1A 1ZEMA 4YHBA 4ZX3A 4F6RA 4RTPA 4EHHA 4DYVA 2BHNA 2FEKA 3KSUA 4C29A 2CVOA 2BTQA 2F8LA 4QGHA 3B48A 5TMEA 1SXJC 3NBAA 2HJ9A 4NE7A 5JMOA 4DEVA 2VJLA 5CA0B 5JWRA 4M8SA 3P9ZA 3FHEA 2CMHA 2AWNA 5F12A 1P8AA 2MMCA 2WD8A 4AULA 2IE8A 5F1YA 5AKYA 5KJ1A 1EZ4A 1KJZA 1L2TA 4NU5A 4OXNA 3IURA 1PDWA 1OYYA 1H2AS 1TF7A 3A9RA 1YJCA 1QP7A 4I4TF 4PNPA 4BO4A 5L3VA 4Z4QA 1T9GS 3N2KB 2LW7A 3PXCX 2E89A 4QJIA 5TF0A 1VHWA 1CX9B 2V5AA 4S35A 2RI6A 2GPSA 1LBSA 3AY3A 2AK2A 5IAJA 2R6JA 3WGIA 1Z0ZA 3OFNA 4IJ5A 3H11A 2O0LA 4KWEA 4RMJA 1M8KA 1MF7A 2G9NA 4LGMA 2ZOSA 1P77A 3BERA 3GZ4A 2WWTA 3MFQA 4K9RA 4K9LA 4MP3A 2ZBVA 4EUEA 5CXQA 1BKDR 1OIXA 4EZIA 1M0WA 2VJCA 1N6KA 3ZHXA 3LC2O 4GSKA 4BLVA 5TNXA 2WKQA 3V1KA 3TAXA 4C05A 3MWKA 1M7HA 1CVRA 1COZA 4AO8A 1HYBA 4MS1A 2QJTA 2JFVA 3I6IA 3K9HA 3NNDA 2C2MA 4RCVA 1WULS 2H1FA 4XIIA 3ZHYA 2D2VA 3LFUA 3GFGA 4QUOA 3N9IA 3WLRA 4CG3A 4H9GA 1S3SA 5AMXA 3WK8A 1JGTA 4ARSA 3E0QA 2A5YB 5JDCA 5TMDA 3HCBA 3R3XA 1V8FA 3FCOA 2ZJ8A 4GDMA 2YUTA 4M0FA 3A4YA 4EYGA 2EKQA 3BX1A 4JOSA 4PZYA 5FTMA 1TB4A 2ZAOA 1NMYA 4KXQA 3RS9A 2VYVA 2PVCA 3OBBA 2QZJA 2IYWA 3GG2A 3RHFA 3TMYA 5MN5A 1K7XB 1FUKA 2NU9A 3MIIA 4CIVA 5ER6A 1CP3A 5IC6A 1F20A 1P72A 1EK5A 3DBLA 2ZWAA 1SBQA 2HCTA 3MA0A 1C3OA 3K5HA 3GLGA 1MIHA 5H9WA 1JYSA 5K7SA 1EK6A 2FTKE 4NPHA 5KDLA 5LL6P 1MU0A 1L5GB 5C8YB 3UJ6A 3ZV6A 1RMTA 1LNZA 4A9AA 4V1CA 2WICA 2WPDD 1LSUA 1QTQA 2O50A 4NZMA 2L18A 1U8AA 4MVXA 2V0CA 4RADA 2PVPA 3N3AC 2JDIA 5E3HA 5KB3A 5BSFA 3THWB 4TLMB 5D00A 1M75A 1N78A 4LF6B 1MOSA 2ZBFA 5C7YA 2NUPA 1Z4PX 3AO0B 1JAHA 4RZHA 2WUGA 4XCVA 1XTQA 1JEYA 1OKKA 1U3WA 1YJAA 3A0RB 3ZGVA 1HQDA 3U1VA 4FFWA 3QY9A 4FS8A 1EVKA 2QW8A 4YWJA 1P8JA 4NYIR 1UJ4A 2DJIA 4YDSA 4C4TA 2DT8A 5SY4A 3QVMA 4BO7A 1AKRA 1W25A 1SIWA 3OX3A 3PHHA 4XOIA 5F4ZA 4Q1EA 4G84A 3IV7A 1SUFA 3ISTA 2I22A 2GF2A 2MYNA 3EWSA 3NYRA 4JENA 2YN2A 4GOJA 1TW2A 3CNNA 3QHQA 1M6EX 1WU8A 1ZH6A 2FJ0A 2FZ5A 2F7SA 1I3LA 2WFLA 4J76A 4JYBA 4OGLA 1RLIA 4PGHA 3CRVA 3DT9A 3F5QA 3R74A 1FQJA 1GYRA 1V9LA 1TFRA 1G41A 3O83A 4XSVA 4XJXA 1Y34E 3RUPA 2QXUA 3DBRB 1IJKA 3DDNA 3ROQA 1BO6A 3OZ7A 1JEEA 2JZCA 3G89A 3G7SA 4IDEA 3LY9A 2JFUA 3BRSA 4CMGA 1Q0ZA 1JL3A 3CKKA 1L7PA 4Z2AA 4OYYA 4EY6A 4RD1A 3FWPA 3ZDBA 2I1LA 2LIPA 4E03A 4TLLB 2QR3A 4D96A 3AOEC 3KL2A 3LBAA 4I9GA 1Z5WA 2P6UA 4AICA 1TA4A 2ASVA 2YTZA 2WU8A 4MIKA 3NJRA 5NLLA 1VPLA 4UFPA 1YS2X 1UWVA 4KTVE 1XQYA 2IEIA 1C0PA 4EQZA 2C77A 2VSFA 2IU4A 5JQGF 1GA4A 1RHMA 2OZVA 5DNEA 3BN3A 4L1KA 2ERCA 8ATCA 3D43A 1YR2A 2DUMA 4UBOA 4WBSA 4S12A 1MC5A 2Z6QA 4F72A 2QX8A 3R0QA 3RCBA 2UUCB 2I6UA 1OE0A 3D3KA 4LVNA 1R0LA 1MTOA 4N0MA 5EQTA 3RJ5A 3NWBA 1R0SA 3VKUA 2ECOA 5JXJA 1H6AA 3W6OA 4ZGWA 3BK2A 1NR1A 4U3JA 2Z83A 5JATA 1TJPB 3A6HA 3B6MA 4PYLA 3WXMA 3L7LA 4L8GA 3BSYA 5H8WA 1KO5A 3Q5GA 1SR8A 1AU9A 2H4WA 2WJHA 2PKWA 2I6FA 2AN9A 2ORVA 2W8BB 1ISSA 4UUMA 5DHRA 3IRVA 1RPAA 3OIGA 4AM8A 4PG5A 2FVXA 2A3RA 1L7QA 1PP4A 4NJMB 4HY3A 3ZWPA 1JG2A 4DBVO 2FUNB 2D5AA 1JDTA 3MJRA 4IINA 4UDOA 4OHUA 4BGDA 3O4VA 3JRNA 2AOTA 4LV5B 1FUIA 3W2FA 3P5BA 1JIVA 2QSZA 4X1IB 1RZUA 2A78A 3E58A 5EOVA 3HJNA 2CCJA 4PTYA 1Q6ZA 1J0CA 2IHTA 4L4ZA 2N75A 1SWVA 3MC1A 1EHIA 4U7HA 2WF6A 5BWCA 2ERYA 5UKDA 4YR9A 3AFGA 2R7NA 3DF9A 3ROFA 1XRLA 4N47A 2GLUA 3SHOA 5KUTA 3B37A 5IHXA 1J4AA 1CZKA 4E12A 3C8UA 2VH5R 4HF7A 3IEIA 1UQRA 4KO2S 1Y5IA 4ZQEA 2B7LA 1KMHB 5TARA 3LP5A 3CPEA 3UPUA 4WI1A 1U7HA 3QQ5A 4TZ0A 2IUFA 4GPBA 1MVNA 1ZNXA 3I9FA 4QO7A 2V65A 2VO1A 4A8JC 5EXXA 2PLAA 4NNOA 4TSKA 3K3PA 3PNPA 4XQEA 1Q14A 2RHOA 1N8KA 3HN2A 3P4XA 4R51A 3W78A 1E5TA 1UDRA 3D0KA 4KR9A 3KFVA 3V33A 2BGNA 3L7IA 2O8CA 3PX2A 4G5OA 1O03A 1N3BA 3GGGA 3PXUA 2OVBA 3TQFA 4BUJA 4EI7A 3ZK7A 2RKBA 2NM0A 4EY5A 1QYDA 2NO4A 1YMUA 4DIEA 2PBRA 4MDFA 3GUHA 3NKVA 5EZ5A 1GTZA 2K6GA 4MIEA 5B53A 3U1TA 3U3DA 3PLNA 3RKSA 1T6BY 4ZAFA 2O05A 3R20A 2ZUDA 4M0DA 4IRMA 1MXHA 1D0SA 1IPHA 2WJ3A 4JMPA 3QPVA 1LZLA 2TMGA 1ZCZA 3EZ7A 2BI4A 2JKYA 3I9MA 4KRYA 5K03A 2WU3A 2HEGA 3LWZA 1WUIS 3ZHRA 5JNVA 3L0CA 4OL0A 4C0KA 4YALA 3I6BA 4F1KA 3EAFA 1Z9BA 3TNJA 2GVNA 4PPNA 2ZSIA 2GYVA 2OECA 1Z16A 1CQIB 3C3DA 4KK3A 2WRZA 3Q0IA 1PWYE 3WHLA 3MS4A 1G21A 3C7KA 5C5EA 3H2IA 2RAUA 3IP1A 1MQAA 1OA1A 1VJ1A 4D81A 1WXIA 1UQUA 1NN0A 3A1FA 3MJEA 2EOAA 1ZJYA 3BICA 3QPUA 4X1YB 5JO0A 1HDCA 4LWPA 5EZYB 2GSWA 1OLOA 2XWSA 2OY0A 4QO8A 2IH5A 4G86A 4EGSA 1PJLA 4YA6A 1A4IA 1M2HA 4WOPA 2IYOA 3QU5A 1QG4A 1B3BA 2SICE 4QBIA 5AM5A 3V6LA 4P3XA 1IQ0A 1Y8QB 2BCGY 7REQA 3BXEA 3CZ5A 4TSFA 4G5YA 2RH5A 3DBHA 1IULA 1LPBB 1EMDA 3WE7A 3SGLA 5DVZA 1EFRD 3AUUA 5MN6A 3QIAA 4RACA 4E94A 3Q9LA 3UB3A 4IWXA 4K87A 2HIGA 4XGRA 5F2OA 4C3UA 1QM5A 5JH7F 1FNMA 3DEAA 4L75A 1TI7A 5EIBD 1IY9A 2ENWA 4KYTA 4XPZA 3PEVA 1LC3A 4CDGA 1E7WA 2MOKA 5ALHA 1C1DB 3SKYA 1XMJA 3LE8A 1OQAA 4O08A 5LWQA 1GTG1 2A92A 1O97C 3CRQA 3IT2A 4QHSA 4A3SA 3OIFA 4IZHA 1SVLA 1WR8A 3VNVA 1G8YA 2NVWA 2YINC 4AKGA 1CUCA 5GWXA 1U6JA 5K0EA 4KQFA 1P1CA 3R0IA 1D0VA 4L7VA 1KFBB 4PAOA 3WMEA 1TKBA 1EQAA 1WO8A 3KDPA 2C7OA 2P9GA 4MUEA 5LXTA 1ESNA 1ZVKA 1O0SA 2YJZA 2JCSA 4PHHA 3WMRA 2PUVA 1AUXA 3FFTA 3T7RA 1NX6A 2JA2A 5K8UA 1IE3A 3O2QB 4EMSA 4F2PA 3SHWA 1TNDA 4F91B 5KTKA 1Y3BE 1E0AA 4L8LA 1ZVVA 2ZCUA 4XJTA 2OHFA 2XE4A 3IL2A 3RVKA 5ENVA 4OA5A 3QELB 4YB8A 1B15A 1BXGA 4I4CA 1PR3A 4WECA 5LA6B 4BFUA 3THSA 1NJ8A 1IMJA 1X8JA 4CMEC 5INTA 1J2RA 3JRXA 2FRDC 1LBIA 1YIAA 4QUIA 3TW8A 1Q6YA 1YGPA 3W77A 3MWFA 4X62B 2WF9A 3SS8A 3GNSA 4TOIA 4EQ6B 4DLKA 3U7HB 1S5PA 1UCFA 4ZYXA 2A5GA 3FUJA 5IBQA 3U09A 2PTHA 2XB4A 3ELYA 4Q3LA 3AFOA 1T9ZA 4B6JA 4CIYA 3O47A 1B00A 4HWKA 3IPAA 1T2CA 2XYVA 5TPWA 2ZIXA 3HP4A 5ESXA 1Z4KA 3UW1A 2FN9A 4J16C 4QOGA 1N6IA 2BPOA 4QODA 1J2UA 4WEQA 221PA 1W0KA 1SBTA 3F7MA 2GN8A 4XYEA 1XZIA 4G0ZA 4PO8A 3ORQA 2QZZA 3GO4A 1X7YB 4W5JA 1E66A 4NC9A 5IM5A 3U60B 1M74A 3L07A 4M8IA 2AE1A 4NCJA 4C0HA 3C4JA 3FHCB 4HGOA 5E1BA 2FSGA 3MXTA 4ANFA 1UEIA 3G9UA 3IUYA 3TLCA 5BT8A 1HDYA 2W2XA 4Q00A 2VJAA 2Z4RA 3D59A 1ZIDA 1NG9A 2RB5A 1Q83A 2XYPA 5DOZA 1RQNA 4P36A 3NTLA 3KOWA 4LX8A 2XI4A 1HYEA 2AFHB 2ZB3A 3L6OO 3W5SA 3W7BA 5KX5F 4WXRA 3KAJA 1ECFA 4JLUA 2BFNA 2ZRCA 3SZUA 4EPXA 1CUUA 1K5DA 2VBFA 2OKCA 4UEOA 4W1PA 4S24A 4DQ0A 4ND5A 5CB8A 2VKTA 5DF1A 4HDSB 1YUMA 5HG0A 3FOAA 3ZIAD 4C01A 1Y80A 2J0UA 3DO6A 4ND4A 5C37A 4ALNA 4FDVA 3FRHA 1UPBA 5EUQB 3GCZA 2B4YA 5CUQA 4ZV4A 5IULC 3LH5A 1KYTA 1NWCA 2QJOA 2QQFA 4U8GA 3GJXC 2F1KA 3ORSA 1GIAA 5HPYB 2F6RA 4RYLA 2Z57A 2Q2WA 3ZCQA 3M6UA 2XHEA 4HFMA 5DHQA 4EYOA 3AVTA 3EN0A 1I2AA 1I4TD 3ANXA 5AI0A 4B4OA 5JJKA 2ECPA 2EFJA 1NKTA 2ZIGA 2QPOA 4BE7B 4A7PA 3H83A 3P9NA 5JV5A 2BMVA 2W5UA 3FPGA 4N8SA 4KUEA 1SCIA 1Y4DE 1MA3A 1F7UA 2CCGA 4X7MA 5K4AA 4ETWA 3C24A 5GINE 3C3WA 2CNKA 2DHRA 1RC0A 3EXG2 2FSSA 2JD0A 2P6NA 3CNLA 5G4LA 4YO8A 2FOLA 3WRWA 4GR9A 3TDNA 4MVJH 2FEAA 3DMHA 4DR1B 3FSGD 5F5LA 1RRMA 4MWOA 1L8XA 4KI7A 3UAWA 4ZAYA 1VLJA 3BQNB 1QB7A 2QT0A 3M4YA 4EFMA 3JYHA 1XROA 1V8BA 4MRSA 4WVFA 1HTTA 4D3XA 1T0IA 3DTVA 3GFFA 3BH0A 3PA6A 5DM0A 4FLSA 5EGNA 2NP6A 3I6MA 1OJ7A 1ZUD1 5FJIA 3UT6A 1GTL1 4GYJA 1K5PA 4ZPXA 3ADKA 4URYR 4H17A 3N07A 1S3GA 1GW6A 2OQ2A 2QY6A 4WJZA 1UOPA 3UVEA 3LA6A 3WV4A 2AD1A 4R71A 1SUPA 4WK0B 3FSEA 1KC3A 5AW6A 1DCKA 2HDHA 4RNCA 3W8EA 3EFOA 3WDMA 4WNAA 1GR0A 5AR1A 3G0OA 5DE3A 3OZGA 5FOSA 3WOHA 2QE7A 3HUEA 1NXPA 5L3RA 4XIFA 4G1EB 2AG1A 4D4HA 4LXIA 1XI2A 1RJ9B 1T8WA 3EA4A 2HJGA 2XAUA 2VHUA 3CT4A 4J49A 3V8NA 3HUTA 1J8QA 3OAAD 5KOHB 4DBLC 4E07A 1PFYA 4JITA 5BV2P 1N0HA 4K05A 4G4SO 3VYWA 4GZLA 2W2KB 2WIDA 3BSSA 2TMYA 1P4GA 3OCCA 4FKMA 4RY2A 4AMZA 4ZEVA 1NI3A 1MB0A 2WWYA 1QO0D 2HK9A 2B4RO 4PSAA 3BRWA 4ZCQA 2QRVB 3I52A 1XOIA 4LV6A 1UJ2A 1PTJA 1DIBA 1L0BA 2VF5X 5FDFA 1TE2A 3JQCA 2KLBA 2JBWA 1FFEA 2BJWA 2J46A 3F7TA 1OXTA 4RD2A 2PX4A 3RSCA 3JVDA 3SCZA 4HWTA 3L0IB 3M6XA 1JTFA 3KLBA 4KBGA 4LXGA 3CHRA 6LDHA 1WZ2A 2JC3A 3PRKE 5J63A 5IP5A 5K20A 2GHTA 4G01B 1P39A 1UBJS 2F1HA 4YAOA 4CKCB 3EX7C 4RY9A 1W9MA 1SMKA 4AMGA 3VKFA 1UZNA 4BBJA 3AB7A 4WKOA 4IIEA 1A82A 2APJA 4IIVA 2ZVDA 3ILHA 4LJ5A 3KEDA 2R1VB 1ZCFA 2J6HA 3H1AA 3O1JC 4C7BA 3UFXB 3QOYA 1T3HA 4UMFA 2P5TB 4X61A 1EE1A 3TJRA 3K8YA 4LNUA 2V5VA 2A9RA 3O8OB 3FOWA 1EUQA 1SQFA 2XT6A 3K9BA 1X7WA 4CLEA 2D7CA 1XF1A 1CPYA 2YZ2A 4P3OA 5LMNB 5KJ6A 3UWMA 1AQYA 1DXHA 4D80A 4HYQA 2XH8A 3DEJA 3O75A 1Q1BA 1OA0A 4ZI7F 1AOXA 4MAAA 1T2NA 5JEEA 1T5LA 2DR0A 3PHJA 2F64A 3CX8A 1J09A 4F3CA 1DKMA 5KNBA 4KLZA 1O6GA 1RI5A 2J7PD 5F1PA 5I4IA 3PLRA 3DBIA 4FE7A 3PXAA 4RTNA 1ZOPA 4DLBA 3F5FA 1QHFA 2C4WA 3GGCA 5IK2D 3RHZA 3T3IA 1P2SA 3PFGA 3SR0A 1T5OA 4IHAA 3UYKA 4D42A 3C7DB 1PJQA 3V9PA 4HLUA 3WNQA 1IJEA 1ZJWA 1E2IA 3A3YA 5FPHA 5P21A 1XKXA 5BSWA 5C51B 1E4VA 5TT0A 2IGBA 2VYNA 2PQ6A 5CLQA 3KAPA 4OFZA 4OQFA 2BI7A 3DAHA 5AW9A 4GW3A 4P0TA 1E1QA 4TWZA 3AW9A 3VR0A 4D9BA 5BVHB 4QQRA 4WZAB 3VYTB 3K4HA 2XVXA 4PX9A 1Y1QA 4IUDS 2D54A 3DKPA 5K2MA 3RRZA 2HQOA 1C7QA 4G85A 2GPYA 3J7AC 2PSEA 4D0SA 4E6PA 4BO6A 1M7GA 3A58B 1JSRA 3PT9A 3QPDA 3VV3A 1GUZA 2RCYA 2DECA 3CLRD 1ZAKA 4RSMA 1RADA 5K3OA 3DSRA 4PLCA 1W0JD 1H05A 2HGZA 4ILKA 3L6RA 5KS2A 1TXGA 3HVJA 3IVMA 3MCWA 3Q0TA 4M7OA 2PUCA 1VXOA 2AFRA 3M6FA 4F5WA 2VDOB 3FZYA 2HHJA 1ZA1A 1TPZA 4L3VA 2DHCA 3EIXA 4LHXA 4ZCIA 3N7UA 3RJZA 3K9GA 3MHPA 3PNMA 4B9EA 2Z1DA 3QVKA 4LRWA 5TQ0B 1Z62A 4AYWA 5BUQA 1XZGA 3TQTA 3V4LA 2Y66A 3KXDA 1I6WA 1GCOA 1XHLA 4UU0A 5AJZA 2FPIA 2IYTA 3GLQA 3X1DA 4DVGA 5EJ9A 2FPKA 2O7SA 1E4EB 2IW3A 4JT8A 1Q74A 4BJ1A 5CG1A 3FPFA 1I5OA 1RMYA 2VXYA 1BTOA 3G8BA 3GRVA 3IC5A 1V9SA 2NACA 3JS5A 2NZJA 1YK1A 2XUJA 1V6SA 4UVGA 3B2NA 5CIWA 3C45A 3G23A 4BPRA 5BN5A 1H66A 2FCAA 1E0KA 1Z82A 2PWPA 5DEOA 5AM4A 1PR1A 3R5JA 3SEQA 4RF5A 1L5HA 2ID7A 1TW3A 2D13A 1BOFA 2GEDA 1MX3A 2C54A 2Q6LA 3MTBA 3OJEA 3ECCA 4ZWNA 4F9TA 3EDOA 4U9IS 1U0JA 1SCBA 1DSSG 4PX5A 3PUZA 5EMKA 4BYGA 3R5XA 2D62A 4BO8A 4RA6A 5ALPA 4WRRA 1P4AA 2X0FA 1RHQA 2EF0A 2EGHA 4HWPA 4W7HA 3EYWA 1ONNA 1A8PA 2VXCA 3WLHA 3X1YA 1Y1KE 4J7AA 4P4SB 1NVAA 1PV1A 3UGTA 2WDPA 3MTQA 4GEGA 4I4TA 3SI7A 1X1SA 4E88A 2WIGA 2OR3A 3AZQA 4R54A 2AXQA 1AF7A 2IXBA 1EWKA 4NCXA 1B16A 3CF2A 1H6DA 1NPDA 1W85A 2Y27A 3JATA 3TFWA 2G0AA 3G0CA 5KNDH 5MHTA 4ZDIA 1M7BA 1BXRA 2G6BA 3A4TA 5E0OA 1CHDA 3EUEA 2ZR9A 1COWD 2I2CA 4FLFA 1IZYA 3MD9A 1JEAA 2EW8A 2AFHE 4DZZA 3TFOA 3ELDA 2XT0A 3DAGA 1BXKA 2FJUA 2G4VA 3S2YA 3DC7A 2NYRA 4OVKA 1TD9A 1Y7PA 2JLSA 3ADPA 4F6LA 5KTYA 4RTKA 2FWPA 5KKAA 3P2IA 1NVFA 4G1CA 4PZZA 4OI1A 4RD0A 1QOZA 3W7AA 5KTSA 4WLOA 3VMMA 3DKVA 4E31A 3OEWA 2EKDA 5EIFA 4CM4B 2CNNA 1TCUA 4UBNA 2NYUA 2QN9A 5AXDA 1KDYA 2PPVA 5HTKA 1JALA 3VR4H 1QTRA 1X14A 3OLWA 1ZJ5A 3FU6A 3QG1A 4Z1OA 5AVZA 3ZJVA 2I76A 2FX5A 2RHHA 3O8LA 4ZK6A 1YDHA 1YMVA 2OXRA 4MIOA 4JI6B 5E1OA 3S2FA 5WRFA 5G40A 1QVRA 5IWCA 3FKSA 4TX1A 1UBLS 1PLLA 1Y3CE 1HPLA 3DPIA 2K2QB 3FF1A 4OBXA 1OPXA 1RRFA 1VE1A 2VJDA 4ESHA 1HI9A 2BEWB 3C41J 1IWPB 1U8CB 1W75A 2H1RA 3VVLA 2KLHA 2VJKA 5B1EA 2WZCA 1NUSA 4I2VA 4Q3DA 5U1PA 2R6GA 5GGXA 2HCFA 5D7BA 5AI4A 2HJRA 4TLBA 1ZICA 1PS0A 4BFLA 3Q40A 1S2GA 3K8ZA 4FDLA 3T1HB 3RUDA 5FBKA 5IJAA 2H59A 2PN1A 4MQMA 3WGJA 1DG9A 2MWMA 4BQFA 1LLCA 2AR0A 1RC1A 1VTKA 2GA9A 3RANA 4ITVA 3SE0A 1RQ2A 2BFEA 3ZV4A 1BMTA 4YXWD 2OHGA 3VVBA 4G5QA 5C8XA 4Q1AA 1JFSA 3OMWA 4D8UA 2VDPB 1YS7A 5KKCA 4X7PA 2ZBRA 1A96A 2XSZA 3TW0A 1T3SA 4P3YA 4G5XA 2NZWA 1TCAA 1K6IA 3UUEA 4B71A 3OPYI 4GX0A 3I5MA 2DU8A 5EWMB 1D9XA 1ULAA 3OTHA 4HGNA 4BAGA 1YXMA 4DDKA 4R69A 3SVTA 4HVLA 1G20E 3KO8A 3E4CA 2RGEA 4FSXA 4INJA 4E32A 3IEMA 3P2OA 1WLYA 5A0VA 2XGMA 1XF9A 3O82A 2BBWA 2Y05A 3O2SB 4EG0A 3IX7A 4WCFA 3NWPA 4AKTA 4WV3A 4PONA 1RXYA 1J99A 1HE5A 2V74B 2YQ5A