2JV7A

Nmr solution structure of histoplasma capsulatum cbp homodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
DQPSVGDAFDKYNEAVRVFTQLSSAANCDWAACLSSLSASSAACIAAVGELGLDVPLDLACAATATSSATEACKGCLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of a fungal virulence factor reveals structural homology with mammalian saposin B.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Calcium-binding protein
total genus 16
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12192 CBP Fungal calcium binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.120 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2jv7A00
2JV7A
chains in the Genus database with same CATH superfamily
3EBGA 2DQMA 2WZFA 4RCVA 4XO3A 4AICA 4K5PA 4RVBA 4XN1A 1K5HA 2RJIA 3FTYA 2EGHA 4MS6A 5JO0A 4XN7A 1ONNA 2JCXA 3AU8A 4L2LA 2JCYA 3FTZA 4KP7A 3U9WA 3FUHA 4ZW3A 3ANMA 3ZHYA 4FLSA 3FTVA 2Y1EA 4XMZA 2HPOA 4XMXA 3FTXA 4XMTA 3CZEA 3WQSB 1MW3A 4R7LA 4XNAA 3CHSA 1Q0QA 1ONPA 1MVYA 2PUSA 1SC5A 3FUDA 4XN8A 5JMPA 4ZW5A 2Y1DA 3B2PA 5DLLA 2WZGA 3FHEA 3B2XA 3CHQA 3FULA 4Q4IA 3VVMA 4K5MA 4XO4A 4Q4EA 1MW1A 3FUKA 2DQ6A 4QMEA 4J3BA 2QVWA 2XPZA 3RC8A 2VLAA 4ZX4A 1X3WA 3PUUA 3FU5A 5HNHA 4ZQGA 5JAZA 3Q44A 3ANLA 3FUEA 3A06A 1T1RA 3B34A 2XQ0A 4ZW7A 4AR8A 3FH7A 4Y6PA 1S46A 1SG7A 4K5OA 4PW4A 4XN9A 4FLOA 3FU3A 3RASA 2Y1CA 3IIEA 1T1SA 3QJXA 4BKXA 2PL5A 2VJ8A 4ARFA 3UEQA 1MW0A 4DPRA 3R0IA 4FLRA 4R5TA 4ZN6A 3B3BA 4XNDA 3EBHA 4ZW8A 5JC1A 2MAPA 3FH5A 4A03A 4AYSA 3JSZA 2JCVA 1OR7A 3CHPA 4QHPA 4Y67A 4PU2A 3CHOA 4FCAA 1SQMA 3FU6A 3CHRA 1JGIA 3FTWA 1R0LA 3FUIA 4R5VA 4R5XA 3WQRA 4ZQFA 3B7TA 5BPPA 1R0KA 2XPYA 4AR1A 3A14A 3FH8A 4QPEA 2JD2A 2Y1FA 5FWQA 3B37A 4GAAA 5AENA 2C82A 3CZKA 3EBIA 1JG9A 2QJ1A 3HW2A 2PGGA 4CXFA 3WQQA 3ZHZA 4GAEA 5JBIA 3FU0A 4QUOA 4K5LA 3CZGA 3ANNA 4ZQEA 4QIRA 1HS6A 4RSYA 5EV7A 2HPTA 4ZQTA 2R70A 4Y6SA 2MAOA 4OOEA 3KEDA 1GW6A 3B7RL 3B7UX 3Q43A 3RC3A 2R59A 1ONOA 1ZS2A 4XN4A 4MKTA 5JNLA 4ZX3A 2JD1A 4FLQA 4XN5A 4XNBA 3ZI0A 1RP3A 1H19A 4K5NA 4XMWA 3VVLA 3CZLA 3FTUA 1Q0HA 2WPGA 2ZXGA 4X2UA 3T8VA 3AU9A 5HNFA 2A7OA 4XN2A 3AUAA 2GTQA 3B7SA 5HLTA 3CIAA 4ZW6A 5DYFA 2Y1GA 4NQWA 4XMVA 4XO5A 3FUMA 3T0YA 3JT1A 4AR9A 4ZX6A 1MW2A 4JNDA 1G5AA 2C5ZA 4ZQHA 4PVBA 2R72A 5DULA 1H3LA 3UCQA 4LUPA 3FTSA 2JD0A 2FFLA 4OOFA 5JMWA 3FUNA 4XMUA 2O7GA 3CXBA 3FUFA 2JV7A 1Q0LA 4Y6RA 3FUJA 2B61A 4ZX5A 3UERA 3ZHXA 1JVSA 1X3ZA
chains in the Genus database with same CATH topology
3EBGA 2DQMA 2WZFA 4RCVA 4XO3A 4AICA 4K5PA 4RVBA 4XN1A 1K5HA 2RJIA 3FTYA 2EGHA 4MS6A 5JO0A 4XN7A 1ONNA 2JCXA 3AU8A 4L2LA 2JCYA 3FTZA 4KP7A 3U9WA 3FUHA 4ZW3A 3ANMA 3ZHYA 4FLSA 3FTVA 2Y1EA 4XMZA 2HPOA 4XMXA 3FTXA 4XMTA 3CZEA 3WQSB 1MW3A 4R7LA 4XNAA 3CHSA 1Q0QA 1ONPA 1MVYA 2PUSA 1SC5A 3FUDA 4XN8A 5JMPA 4ZW5A 2Y1DA 3B2PA 5DLLA 2WZGA 3FHEA 3B2XA 3CHQA 3FULA 4Q4IA 3VVMA 4K5MA 4XO4A 4Q4EA 1MW1A 3FUKA 2DQ6A 4QMEA 4J3BA 2QVWA 2XPZA 3RC8A 2VLAA 4ZX4A 1X3WA 3PUUA 3FU5A 5HNHA 4ZQGA 5JAZA 3Q44A 3ANLA 3FUEA 3A06A 1T1RA 3B34A 2XQ0A 4ZW7A 4AR8A 3FH7A 4Y6PA 1S46A 1SG7A 4K5OA 4PW4A 4XN9A 4FLOA 3FU3A 3RASA 2Y1CA 3IIEA 1T1SA 3QJXA 4BKXA 2PL5A 2VJ8A 4ARFA 3UEQA 1MW0A 4DPRA 3R0IA 4FLRA 4R5TA 4ZN6A 3B3BA 4XNDA 3EBHA 4ZW8A 5JC1A 2MAPA 3FH5A 4A03A 4AYSA 3JSZA 2JCVA 1OR7A 3CHPA 4QHPA 4Y67A 4PU2A 3CHOA 4FCAA 1SQMA 3FU6A 3CHRA 1JGIA 3FTWA 1R0LA 3FUIA 4R5VA 4R5XA 3WQRA 4ZQFA 3B7TA 5BPPA 1R0KA 2XPYA 4AR1A 3A14A 3FH8A 4QPEA 2JD2A 2Y1FA 5FWQA 3B37A 4GAAA 5AENA 2C82A 3CZKA 3EBIA 1JG9A 2QJ1A 2PGGA 4CXFA 3WQQA 3ZHZA 4GAEA 5JBIA 3FU0A 4QUOA 4K5LA 3CZGA 3ANNA 4ZQEA 4QIRA 1HS6A 4RSYA 5EV7A 2HPTA 4ZQTA 2R70A 4Y6SA 2MAOA 4OOEA 3KEDA 1GW6A 3B7RL 3B7UX 3Q43A 3RC3A 2R59A 1ONOA 1ZS2A 4XN4A 4MKTA 5JNLA 4ZX3A 2JD1A 4FLQA 4XN5A 4XNBA 3ZI0A 1RP3A 1H19A 4K5NA 4XMWA 3VVLA 3CZLA 3FTUA 1Q0HA 2WPGA 2ZXGA 4X2UA 3T8VA 3AU9A 5HNFA 2A7OA 4XN2A 3AUAA 2GTQA 3B7SA 5HLTA 3CIAA 4ZW6A 5DYFA 2Y1GA 4NQWA 4XMVA 4XO5A 3FUMA 3T0YA 3JT1A 4AR9A 4ZX6A 1MW2A 4JNDA 1G5AA 2C5ZA 4ZQHA 4PVBA 2R72A 5DULA 1H3LA 3UCQA 4LUPA 3FTSA 2JD0A 2FFLA 4OOFA 5JMWA 3FUNA 4XMUA 2O7GA 3FUFA 2JV7A 1Q0LA 4Y6RA 3FUJA 2B61A 4ZX5A 3UERA 3ZHXA 1JVSA 1X3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV7 A; 
#chains in the Genus database with same CATH topology
 3EBG A;  2DQM A;  2WZF A;  4RCV A;  4XO3 A;  4AIC A;  4K5P A;  4RVB A;  4XN1 A;  1K5H A;  2RJI A;  3FTY A;  2EGH A;  4MS6 A;  5JO0 A;  4XN7 A;  1ONN A;  2JCX A;  3AU8 A;  4L2L A;  2JCY A;  3FTZ A;  4KP7 A;  3U9W A;  3FUH A;  4ZW3 A;  3ANM A;  3ZHY A;  4FLS A;  3FTV A;  2Y1E A;  4XMZ A;  2HPO A;  4XMX A;  3FTX A;  4XMT A;  3CZE A;  3WQS B;  1MW3 A;  4R7L A;  4XNA A;  3CHS A;  1Q0Q A;  1ONP A;  1MVY A;  2PUS A;  1SC5 A;  3FUD A;  4XN8 A;  5JMP A;  4ZW5 A;  2Y1D A;  3B2P A;  5DLL A;  2WZG A;  3FHE A;  3B2X A;  3CHQ A;  3FUL A;  4Q4I A;  3VVM A;  4K5M A;  4XO4 A;  4Q4E A;  1MW1 A;  3FUK A;  2DQ6 A;  4QME A;  4J3B A;  2QVW A;  2XPZ A;  3RC8 A;  2VLA A;  4ZX4 A;  1X3W A;  3PUU A;  3FU5 A;  5HNH A;  4ZQG A;  5JAZ A;  3Q44 A;  3ANL A;  3FUE A;  3A06 A;  1T1R A;  3B34 A;  2XQ0 A;  4ZW7 A;  4AR8 A;  3FH7 A;  4Y6P A;  1S46 A;  1SG7 A;  4K5O A;  4PW4 A;  4XN9 A;  4FLO A;  3FU3 A;  3RAS A;  2Y1C A;  3IIE A;  1T1S A;  3QJX A;  4BKX A;  2PL5 A;  2VJ8 A;  4ARF A;  3UEQ A;  1MW0 A;  4DPR A;  3R0I A;  4FLR A;  4R5T A;  4ZN6 A;  3B3B A;  4XND A;  3EBH A;  4ZW8 A;  5JC1 A;  2MAP A;  3FH5 A;  4A03 A;  4AYS A;  3JSZ A;  2JCV A;  1OR7 A;  3CHP A;  4QHP A;  4Y67 A;  4PU2 A;  3CHO A;  4FCA A;  1SQM A;  3FU6 A;  3CHR A;  1JGI A;  3FTW A;  1R0L A;  3FUI A;  4R5V A;  4R5X A;  3WQR A;  4ZQF A;  3B7T A;  5BPP A;  1R0K A;  2XPY A;  4AR1 A;  3A14 A;  3FH8 A;  4QPE A;  2JD2 A;  2Y1F A;  5FWQ A;  3B37 A;  4GAA A;  5AEN A;  2C82 A;  3CZK A;  3EBI A;  1JG9 A;  2QJ1 A;  3HW2 A;  2PGG A;  4CXF A;  3WQQ A;  3ZHZ A;  4GAE A;  5JBI A;  3FU0 A;  4QUO A;  4K5L A;  3CZG A;  3ANN A;  4ZQE A;  4QIR A;  1HS6 A;  4RSY A;  5EV7 A;  2HPT A;  4ZQT A;  2R70 A;  4Y6S A;  2MAO A;  4OOE A;  3KED A;  1GW6 A;  3B7R L;  3B7U X;  3Q43 A;  3RC3 A;  2R59 A;  1ONO A;  1ZS2 A;  4XN4 A;  4MKT A;  5JNL A;  4ZX3 A;  2JD1 A;  4FLQ A;  4XN5 A;  4XNB A;  3ZI0 A;  1RP3 A;  1H19 A;  4K5N A;  4XMW A;  3VVL A;  3CZL A;  3FTU A;  1Q0H A;  2WPG A;  2ZXG A;  4X2U A;  3T8V A;  3AU9 A;  5HNF A;  2A7O A;  4XN2 A;  3AUA A;  2GTQ A;  3B7S A;  5HLT A;  3CIA A;  4ZW6 A;  5DYF A;  2Y1G A;  4NQW A;  4XMV A;  4XO5 A;  3FUM A;  3T0Y A;  3JT1 A;  4AR9 A;  4ZX6 A;  1MW2 A;  4JND A;  1G5A A;  2C5Z A;  4ZQH A;  4PVB A;  2R72 A;  5DUL A;  1H3L A;  3UCQ A;  4LUP A;  3FTS A;  2JD0 A;  2FFL A;  4OOF A;  5JMW A;  3FUN A;  4XMU A;  2O7G A;  3CXB A;  3FUF A;  2JV7 A;  1Q0L A;  4Y6R A;  3FUJ A;  2B61 A;  4ZX5 A;  3UER A;  3ZHX A;  1JVS A;  1X3Z A; 
#chains in the Genus database with same CATH homology
 3EBG A;  2DQM A;  2WZF A;  4RCV A;  4XO3 A;  4AIC A;  4K5P A;  4RVB A;  4XN1 A;  1K5H A;  2RJI A;  3FTY A;  2EGH A;  4MS6 A;  5JO0 A;  4XN7 A;  1ONN A;  2JCX A;  3AU8 A;  4L2L A;  2JCY A;  3FTZ A;  4KP7 A;  3U9W A;  3FUH A;  4ZW3 A;  3ANM A;  3ZHY A;  4FLS A;  3FTV A;  2Y1E A;  4XMZ A;  2HPO A;  4XMX A;  3FTX A;  4XMT A;  3CZE A;  3WQS B;  1MW3 A;  4R7L A;  4XNA A;  3CHS A;  1Q0Q A;  1ONP A;  1MVY A;  2PUS A;  1SC5 A;  3FUD A;  4XN8 A;  5JMP A;  4ZW5 A;  2Y1D A;  3B2P A;  5DLL A;  2WZG A;  3FHE A;  3B2X A;  3CHQ A;  3FUL A;  4Q4I A;  3VVM A;  4K5M A;  4XO4 A;  4Q4E A;  1MW1 A;  3FUK A;  2DQ6 A;  4QME A;  4J3B A;  2QVW A;  2XPZ A;  3RC8 A;  2VLA A;  4ZX4 A;  1X3W A;  3PUU A;  3FU5 A;  5HNH A;  4ZQG A;  5JAZ A;  3Q44 A;  3ANL A;  3FUE A;  3A06 A;  1T1R A;  3B34 A;  2XQ0 A;  4ZW7 A;  4AR8 A;  3FH7 A;  4Y6P A;  1S46 A;  1SG7 A;  4K5O A;  4PW4 A;  4XN9 A;  4FLO A;  3FU3 A;  3RAS A;  2Y1C A;  3IIE A;  1T1S A;  3QJX A;  4BKX A;  2PL5 A;  2VJ8 A;  4ARF A;  3UEQ A;  1MW0 A;  4DPR A;  3R0I A;  4FLR A;  4R5T A;  4ZN6 A;  3B3B A;  4XND A;  3EBH A;  4ZW8 A;  5JC1 A;  2MAP A;  3FH5 A;  4A03 A;  4AYS A;  3JSZ A;  2JCV A;  1OR7 A;  3CHP A;  4QHP A;  4Y67 A;  4PU2 A;  3CHO A;  4FCA A;  1SQM A;  3FU6 A;  3CHR A;  1JGI A;  3FTW A;  1R0L A;  3FUI A;  4R5V A;  4R5X A;  3WQR A;  4ZQF A;  3B7T A;  5BPP A;  1R0K A;  2XPY A;  4AR1 A;  3A14 A;  3FH8 A;  4QPE A;  2JD2 A;  2Y1F A;  5FWQ A;  3B37 A;  4GAA A;  5AEN A;  2C82 A;  3CZK A;  3EBI A;  1JG9 A;  2QJ1 A;  2PGG A;  4CXF A;  3WQQ A;  3ZHZ A;  4GAE A;  5JBI A;  3FU0 A;  4QUO A;  4K5L A;  3CZG A;  3ANN A;  4ZQE A;  4QIR A;  1HS6 A;  4RSY A;  5EV7 A;  2HPT A;  4ZQT A;  2R70 A;  4Y6S A;  2MAO A;  4OOE A;  3KED A;  1GW6 A;  3B7R L;  3B7U X;  3Q43 A;  3RC3 A;  2R59 A;  1ONO A;  1ZS2 A;  4XN4 A;  4MKT A;  5JNL A;  4ZX3 A;  2JD1 A;  4FLQ A;  4XN5 A;  4XNB A;  3ZI0 A;  1RP3 A;  1H19 A;  4K5N A;  4XMW A;  3VVL A;  3CZL A;  3FTU A;  1Q0H A;  2WPG A;  2ZXG A;  4X2U A;  3T8V A;  3AU9 A;  5HNF A;  2A7O A;  4XN2 A;  3AUA A;  2GTQ A;  3B7S A;  5HLT A;  3CIA A;  4ZW6 A;  5DYF A;  2Y1G A;  4NQW A;  4XMV A;  4XO5 A;  3FUM A;  3T0Y A;  3JT1 A;  4AR9 A;  4ZX6 A;  1MW2 A;  4JND A;  1G5A A;  2C5Z A;  4ZQH A;  4PVB A;  2R72 A;  5DUL A;  1H3L A;  3UCQ A;  4LUP A;  3FTS A;  2JD0 A;  2FFL A;  4OOF A;  5JMW A;  3FUN A;  4XMU A;  2O7G A;  3FUF A;  2JV7 A;  1Q0L A;  4Y6R A;  3FUJ A;  2B61 A;  4ZX5 A;  3UER A;  3ZHX A;  1JVS A;  1X3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...