2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
5HNHA 5HNFA 5HLTA 2VLAA
chains in the Genus database with same CATH superfamily
4FASD 4XMTA 4EATA 2Z2SB 3FXJA 2WV1A 5BOXA 2YU9J 4B3AA 4I7HA 1FOXA 4BJ6C 2XPVA 2GIZA 3B73A 5IOYA 5HLHA 1W4MA 4MLOA 2PX9A 4HF0A 4O5VA 3FUKA 5H6RA 3U9WA 4ARFA 3RZOJ 4BUPA 3DEWA 3DTIA 2VT2A 3IH2A 4LMYA 5TJJA 3GTOJ 4WX9A 5JVGF 1RP3A 1QPIA 3P9IA 2FMLA 4KN7X 4RB3C 3CF2A 2QKLB 4R1HA 3OYAA 2HKXA 1N78A 3FXUA 3I58A 4MEYF 4G6DA 1NH3A 4MFEA 4XN2A 2ZO4A 1IN5A 5IYCJ 2OQRA 4YRVA 1LE8A 2XC7A 1TQPA 2LBFB 3RI4A 2KZVA 4MKTA 3ZQGA 2K7LA 4LITA 2XUBA 4RMNA 2HPMA 4QIRA 3OYMA 3G1LA 1XPXA 2XGXA 2F5CA 2LRDA 4MQVA 5KHDA 4S05A 4J3BA 5J1RA 2LLKA 1D1AA 1X4OA 2QZ8A 3W2VA 1YOVB 2GAUA 3FUFA 3NWSA 4E7IA 2B61A 3RQIA 3PQJA 1OR7A 4N0BA 2FXAA 1HC8A 2Y2ZA 2BE5F 3MVPA 4BQOA 4ZDOA 2MFZA 2RKHA 4HRIA 3UKGA 4XLAA 3UERA 2WBMA 4A0XA 4AR9A 2L01A 1Q1HA 2DK5A 4XN8A 2BW3B 3FXRA 5DD4A 5H6QA 3WGHA 1W0TA 3QPLA 1MBFA 4Z6YA 4RB1A 4BBRJ 2R5ZA 3FTXA 3FUDA 2FEZA 1J0RA 1X3WA 3V4GA 4IQJA 3BR6A 3CIAA 2JTVA 3K2ZA 3PM1A 4BXUA 4M3GA 1H19A 2GOMA 1FP2A 5EYRA 1IXCA 2NS0A 4X0GA 1I1SA 2IS2A 1R0KA 3WQRA 2XROA 5HNHA 2XASA 1B6AA 4HZFA 2QA4I 3FWEA 2BHYA 2HYFA 3U1KA 1DU0A 1JVSA 4FE4A 1FSEA 5JO0A 3ZHYA 1KYWA 3IAM2 2ZSHB 3TP0A 1O4XA 1E3OC 1ERDA 4XO4A 3DQVC 4A3JJ 1F36A 2JVGA 3GFMA 1G59A 1ZR4A 4ZN6A 2DJIA 4LJZF 1ZELA 3F8NA 4L5JA 5JMPA 5FD6A 1F4KA 3GBGA 3AKZA 1R6RA 1ETVA 3JSPA 2FBKA 3LSTA 2M45A 4MHGA 2L3DA 1G5AA 4P5OA 5LD2C 4F7ZA 5E18F 2UXXA 2K86A 4NC7A 2IGMA 1IAWA 3ABUA 3GTJJ 1W7PA 2KJCA 1UAAA 2C82A 1WGXA 1M1EB 3M9AA 3VPRA 2VT3A 1Y1VJ 1OCZH 2KIUA 5TGTA 3VVMA 5D5WB 1YFHA 2QSGX 4XOTA 1E17A 3VYUB 3Q5FA 4UY8I 5JAZA 3EQLF 2MD0A 3FUIA 1T08B 5J4YA 3E6BA 2DQRA 1MNDA 4BH9A 5IT9Z 3ZQ7A 1WRJA 4N4OB 2HKOA 1D0YA 4V2GA 3F23A 3FXMA 4U87A 4PJMA 4GDFA 2DOEA 1KA8A 2QVWA 5JNLA 1U8BA 3FXKA 2CFXA 5KCMA 4Y6SA 2NYXA 3LNQA 4ABZA 4HG2A 1LE8B 2A5WA 3BJOA 4QLCU 4ZQHA 5IOZA 2MG4A 5FRNA 5EJCA 4IXAA 3OWTA 4IF4A 5E8IA 5GTIC 3FTSA 5J4VA 1RPWA 3OSGA 2E35A 1UB9A 1YITI 4HV6A 4WF2A 3AU9A 2Z33A 2KRHA 3J80K 4M73A 4I01A 1KQ0A 1FIAA 4AYBN 1LDKB 1REPC 3SDBA 2Y9ZA 5CYVA 5ILVA 1J09A 1S9HA 2AHQA 4MGRA 4PSXA 5FO5A 1MGTA 4A3BJ 3JW4A 3SQNA 3GMEA 3K6GA 4IHTA 4A93J 2JVHA 3WU0A 1HW5A 4ZX4A 2ELKA 4Z2YA 3E5XA 3HPHA 3SYTA 4D7NA 4G9YA 3OYCA 4M3EA 3SZPA 5IP7J 1CF7A 1FMWA 3CJRB 1Z91A 3FK6A 1SC7A 2G7HA 4LD5A 1LVKA 2NRAC 3BR3A 2DOFA 2FSWA 3KP2A 3PQKA 3LFKA 4XORA 2RQQA 3BROA 3ABTA 1Z6TA 3O8GA 4I99C 2MA3A 2Z1DA 2PJRA 1I3QJ 3WTVC 4IHYA 2R4GA 5FKLA 1MNMC 4XRSG 2XB5A 2F4OB 2QENA 4G94A 2EA2A 2IJLA 1HF0A 2DYRH 2WAFA 5J47A 1YIJI 2Y1EA 4BYYA 4XNFA 2VQGA 3BQYA 1TNTA 4LLNA 4ZDPA 2ZXWH 4II3A 1U2WA 3DF8A 1ZG5A 2ZKZA 4CCOA 5HS7A 1HKTA 1NK3P 3HM5A 2BZTA 3ZGKA 4GYGA 3Q3SA 1TBXA 2M1BA 3L09A 2VKDA 3LSRA 1YW8A 3DWLE 3FHEA 1HW2A 1NG6A 4AYBA 3HOTA 1IG7A 5ICEA 4A12A 4IHSA 1FSHA 4UUVA 5B66C 2JA8J 4P9FA 3LSPA 1PVEA 2EZIA 1HA8A 3LSGA 3OIPA 4HNTA 1A31A 3BC8A 2V6EA 1MH4A 3ANNA 3MMYB 3E6MA 2BY1A 4D7MA 3DLLF 4RGRA 1R5ID 3IIEA 4I6ZA 1T98A 1WJBA 2AXLA 4UVAA 1U9NA 1AKHA 2A5YB 2LYCA 4Y13A 2X9DA 3NARA 1R49A 4MIMA 3HC7A 1J2XA 4HSTA 2PMUA 3OYLA 1FZPB 1TWCJ 3M4OJ 5L3BA 4K5OA 1X1BA 3IH4A 5D8LB 3N4MA 3WTTC 4M6YA 1WKMA 3K1MA 2HVSA 1F43A 4U0YA 1RC9A 1UG0A 1JTXA 4Y7NJ 1RESA 3S16J 2XPWA 2NAZA 1P92A 3H1CA 4NBQA 4LG0A 1OKRA 3R0AA 5IYDJ 3G71I 2LF8A 1YE9A 4XO3A 4XLEA 1X3UA 2X51A 4XN7A 3J7ZI 3RCOA 1TZLA 2V1UA 1S46A 1QA6A 3D5SC 4AUXA 3X2QH 3VSLA 4UNOA 4M3DA 1HSTA 4UVCA 2BOLA 4HSRA 5KAIC 3E3VA 2OC6A 1ZK8A 2R5ZB 4U0VA 3OYGA 2MLGA 1G2HA 3JRCA 3HTSB 2DA6A 2E5NA 2R5YA 1FMVA 5EEHA 3EETA 4B1RA 1BN5A 2QF7A 3ZQFA 3F9KA 4G6QA 1SVLA 5IP6A 1Z6RA 5HLGA 3FH8A 1MJ9A 3MFKA 2OD5A 1H9TA 3QODA 2VE9A 2K27A 3RYPA 3KZIC 3WTSC 2J5OA 3FXOA 3CHSA 1YJ9I 5CVUA 1QVUA 4FTHA 1TTYA 1XCBA 2PBIA 4PW4A 3RSNA 3V7RA 3ANMA 4HNUA 1WJEA 4RM3A 4RGUA 3ABKH 3OYKA 1T1RA 3HB9A 3EYYA 1IF1A 3NQOA 2LD5A 4HF1A 1U6GA 2FJ1A 1BJZA 1ETWA 3E5QA 2M87A 4ZC3A 1NTCA 4WXHA 1O3TA 1VQ7I 1WH5A 5IPAA 3PSIA 1O57A 3LSJA 1MDMB 4NHJA 3S3OA 2EZLA 1W0UA 3L2UA 3E7LA 2DDAA 3BTIA 2K02A 2UWMA 1BI0A 2DCEA 1ONPA 5M5WJ 2H6BA 4HF2A 4II2A 3IRQA 2VIXA 1V5FA 4E7HA 1KU9A 2VBXA 2JRTA 3SFZA 4ZQGA 2HPOA 3C18A 1TW3A 3BT9A 3TOAA 3V7SA 5L3GA 2M8GX 2G7UA 1N75A 1Q0LA 1R71A 4RAYA 1HQCA 1X3ZA 3ZMDA 2R7UA 2PL5A 2J5PA 3I53A 1DPUA 1X3WB 4RB0A 1TL8A 2O61A 2VC1A 3CQZJ 2GQQA 4Y4RA 5F08A 3KP5A 3P9KA 1T38A 5DYMA 4F3QA 5E3MA 3D1NI 4K5MA 2P7VB 4QMEA 1W5SA 3AFHA 2FBIA 2G9WA 2FOKA 2XF5A 1O3QA 3VFZA 5DM6F 4L2LA 3QU6A 2BXZA 1K83J 5DEQA 1RIOH 1IRGA 3GTQJ 3U9GA 5M3FJ 1MMNA 2WV0A 3K1PA 1B9NA 4I0AA 3B6CA 5A2QK 2DMUA 3FK7A 3SEZA 3FHZA 4LG0B 1E0EA 1MIJA 1YS6A 2HVRA 1VFCA 2JD2A 1Z9CA 2KLOA 4IL6C 4BGDA 1P7IA 3OSFA 4XNAA 4PJNA 4Y15A 2F6CA 4RAZA 5HOOA 3RC8A 5E1WA 2ZXIA 2OA4A 2M34A 3HL2A 4U0WA 4W1UA 4CUGA 4HDUA 2JJ7A 3G3ZA 4XBFA 2QGUA 1I6XA 3VEPA 5HDNA 1LJ9A 4E7JA 3DBHB 2CW7A 2HNHA 1UMQA 2KP6A 3RIRA 4RM2A 1WWXA 3ZQQA 2E19A 1ZG3A 1XSXA 2DA3A 2OTLI 1LEBA 1Z21A 4FISA 3FU0A 3B37A 2EFWA 1S7EA 2DYSH 1WPKA 3G73A 1EKEA 3QPTA 3I4MJ 1LFPA 2JCYA 3L1PA 3C3WA 2NVXJ 1K6YA 4L5EA 1TP4A 5F0CA 2MH9A 4NDLA 3T8TA 3H36A 4R5TA 2VLAA 3BJAA 2EIKH 3KETA 1FYKA 3ZP5A 3WE2A 2JA7J 1ETOA 4BQQA 4XKBA 1EA3A 4KMFA 3W2AA 4YFKF 5DUIA 1OYYA 1SFOJ 1ZHFA 3GUDA 2M7AA 1I6HJ 5FKOA 5IT3A 2W48A 2D1HA 2DA7A 1GXPA 1SFUA 2PEXA 1USTA 2XDVA 4BJ5C 3Q43A 1FC3A 1QGPA 3QP6A 4DYRA 3SZTA 5K1YA 3CP8A 3FIWA 3LA2A 3AU8A 1XMKA 2RV8A 3JSOA 2CV1A 1WFXA 5F6FA 5FJ8J 2XPYA 2WAQA 3HGGA 2LG4A 5DLLA 2QBYB 3LSMA 3TEDA 3CC4I 3CXBA 4XMZA 1WVRA 5GAEJ 1A5JA 4XM3A 3A03A 1ETKA 4TV7A 1B9MA 2BVLA 2K9LA 2R7XA 3T5XA 2IXSA 1QHHD 1VF9A 2V26A 3LWFA 3CCSI 5AONA 1EV7A 3EUHA 1S5LC 3H0GJ 5ED4A 2VI6A 3LA3A 1VQOI 3AL0C 2RGVA 3GVAA 3E1SA 1UHSA 5D6FA 2JA6J 4BS9A 4LIVA 3FXQA 1IDYA 2W85A 2R7WA 1VQKI 4BEHA 1BL0A 2HDDA 3WQSB 3CMYA 3O6BB 4DYCA 1G3SA 5CLSA 2XAHA 3OOPA 2LP0A 2A69F 3JREA 4ZX3A 4F93B 5C4JJ 1PP7U 2HOSA 3I55I 5F0FA 2DMQA 2K40A 1WJCA 2HQAA 3ERMA 1GDTA 3W6VA 5JMWA 3JCUC 5F64A 4E7LA 1P4XA 4ZQTA 1YQAA 3GXOA 3HRMA 2RDPA 1DP7P 3DKYA 2CGPA 3LA7A 1YJWI 2VJJA 4RLQA 2L9NA 1H89C 1JTYA 4ZJZA 1JKPC 1QO0D 3IKTA 4J01A 1ACIA 4HNVA 3EYIA 3Q44A 3DPLC 3M8FA 3T8RA 2E1CA 2FE3A 4F52A 1HBXG 2WY7Q 1R1TA 4KP7A 3OYFA 4CCNA 2P5LC 4GCVA 1IXSB 1MW0A 1G4DA 1X1DA 1E3PA 4ENKA 1G3WA 1GHCA 2M4KA 3HIFA 1FEXA 4OOEA 1EJ9A 5GAHJ 5CQGA 4OINF 3EBGA 4JP0A 3M07A 1OPCA 4RA2A 1TNSA 2PN6A 4DZPA 2CRGA 4HX7A 5ILUA 4HX8A 2HPTA 4XKWA 3IV5A 2CUEA 4MFDA 3ZMSA 5K5RA 3RC3A 4HLYA 1XMXA 2YU3A 1VQMI 3WG7H 2ZCWA 1T56A 4BY7J 3TW7A 2PMZN 2NVQJ 3KEDA 3T1BA 1V5GA 2ZXHA 4RSYA 3QP5A 1YYVA 3ELKA 1IXRC 1J5YA 2D45A 5M3MJ 3BTCA 5CPRB 3RKQA 1UCRA 5KK1A 1T95A 2BBYA 3S17J 3OR2C 2MAPA 1LUJB 3IWZA 3JRGA 1Z05A 1T0FC 4RGSA 5LLQA 1XSDA 2PLYA 1MZBA 5B1BH 5BPPA 2DXIA 2X4HA 4BU2A 2MBFA 2CQKA 2KMUA 2M0CA 1I50J 2NOJB 4BDYA 5EZGA 2QSHX 5DTDA 1NHAA 1OCCH 1VZ0A 5JFRA 3B2XA 2D2WA 2FNPA 4YIIA 2QJ1A 1W5TA 3KEYA 3CCJI 1SEUA 2VKVA 2FD5A 4KIGA 1Q0QA 3TKYA 4OWRB 3OS2A 3HZJA 3UEQA 5IYBJ 3GTMJ 2E60A 1R9TJ 5CVVA 4YELA 1IRZA 4OAZA 4ON0A 5K5OA 2YR2A 2HR3A 3HG9A 2M2EA 3RPUD 4U88A 3LSKA 3QJXA 4EQQA 2IA1A 2O3FA 1Z67A 4ZW7A 5ICGA 1R4MB 3R0JA 2JMWA 1TT0A 5B5EC 2WA0A 1S7AA 2BEOA 3OL3A 4E70A 2O5RA 2V9VA 3DCFA 1DDNA 1PDNC 1PUEE 2HXIA 4NQWB 3EBIA 3I4NJ 3BZCA 3JSZA 2MC4A 2RVCA 4QTRA 3FTVA 2CW8A 2VKHA 1XGSA 1MSFC 1ZQ3P 2XRNA 1X2MA 2YX4A 3JRDA 2VE8A 5FWQA 2QBYA 1ETXA 3HDDA 5GPCA 2V4JC 3VOEA 4M6VA 1IN6A 2DT5A 3ZXSA 3S3MA 4EM2A 2EV6A 3F8FA 5EV7A 1QU3A 1ODDA 4AM3A 2F48A 2HOEA 2V7FA 4UB8C 2GWRA 4AIJA 4B8XA 2P4WA 3ECOA 1LDDA 3H92A 5F27A 2EJRA 1FOKA 3RQ4A 1KU2A 4S04A 3CUQC 4LOCA 4XMVA 1WI9A 2V1XA 3VWBA 3BCBA 1JUSA 1YIOA 3QYBA 1ETYA 3M8EA 3P7NA 1OCOH 3OS0A 4CGZA 2HFHA 1USSA 2WAEA 2TCTA 1A36A 3LMMA 1TWGJ 3WTWC 3LFUA 4XIDA 1Z7UA 1AKHB 4XN1A 1KU3A 1XS9A 3BTJA 4H4KC 2EFOA 4FQGA 1A6QA 1ZREA 2QQ9A 4ZW3A 1LEAA 1JG9A 4YIFA 2PMZA 4ZYGA 3H9GA 4QPQA 3E6DA 3HRUA 3HUGA 3DXJF 5EDNA 2H8RA 3A14A 3W3CA 2ZXGA 4D0PA 2VOPA 2E71A 5GAGJ 2R7QA 3MZHA 2LY1A 3J7AY 4CICA 4UB6C 1R1VA 3J80Z 1FTZA 3DTEA 2E34A 1B72A 1R22A 2EK5A 4Q4IA 4BL0B 5FLXZ 1RR8C 2OV7A 2R7FA 4QHPA 4KYWA 2RAEA 3A02A 3HSFA 3DBLB 2VQHA 4P96A 2LTPA 1DU6A 5B1AH 2LFBA 3K4BA 1WCMJ 3CJQB 4XRMA 2O0YA 4E7SA 2QEXI 1TW2A 2RQPA 1V3FA 2BV6A 4PGHA 1IW7F 2XAGA 4KUMA 2JT1A 1H9GA 5FRMA 3BPXA 3R61A 4E4HA 3A0HC 3M1EA 1X2NA 4FCYA 2VJ8A 5LEJA 1FOYA 4U7BA 3R4KA 2V1NA 4I02A 1AWCA 1F9NA 1WHUA 2ZJ2A 2DODA 3QOEA 5K7FA 3PFIA 1K61A 5D8KB 1W7PD 2HTJA 4XL9A 1O7FA 1J59A 2JD0A 5C4XJ 4RAGA 2CG4A 2HWVA 2I8DA 2AS5F 4G7HF 2XV4S 4C2MJ 1QPMA 2CQQA 2DLLA 2XGCA 4KITB 4PJJA 3CUQB 2O7GA 1K4TA 1ZRCA 3A01A 2EIJH 2DTRA 2K3FA 2Y0MA 3KYCB 4EJOA 4GFBA 1VQPI 3HHHA 3V8KA 1S7OA 2XGEA 5JHUA 1J9IA 3ZQIA 4WK8F 4B48A 2Z16A 1IJWC 4GO1A 5KVRA 1WH7A 1IN7A 3O8HA 2BGCA 2Q1ZB 4A3FJ 3R60A 2XIGA 4A03A 2HXOA 2AO9A 2XF6A 4Y52J 2CQNA 3ESWB 2DPUA 3GFLA 1BR4A 4GAEA 3GZ5A 3C7JA 2JK3A 4KFCA 1FNNA 3E5UA 3GCMA 3G4SI 2NVUB 1CF7B 2OUMA 4FE7A 1MMAA 5EG0B 3AAFA 2FFLA 3CHOA 4LLGF 2E36A 1FYMA 2COBA 1KONA 4PDKA 2XVCA 5DDGA 2PMHA 3NRVA 2MAOA 3WHBA 3OL4A 2PJRB 5HDKA 4Q48A 3TBIA 2XQ0A 2OU2A 3QPHA 2R93J 3HRSA 1E3HA 1LPQA 1LDJA 2EFNA 4IX7A 1ZGAA 3BR0A 1I27A 3E97A 3HOWJ 3ULQB 2NVYJ 1LNWA 1RKTA 2DQLA 3BR1A 4ESFA 3L2RA 2NVTJ 1MBGA 4HW0A 1SD6A 3ROUA 2JCXA 1A6IA 3PFYA 4XLNF 3RYRA 4BHBA 3GF2A 2DA1A 3I9V2 1ONNA 3WTYC 4AR1A 4LUPA 4RAFA 2KT0A 3JRHA 1X1CA 5FFZA 2E1NA 5HS8A 1E2XA 3ZMZA 4AVPA 4E6KG 5E20A 3HBLA 4ZTFA 3TDZC 3CTAA 3F3XA 3HHGA 3KEQA 2CSOA 2DBBA 1JT0A 2QCOA 3CMMA 2VXZA 4EJTA 1ZR2A 3MQ0A 5M5YJ 1Q1VA 3SEQA 1BR2A 3K9TA 4IRIA 2JA2A 3KP4A 1IZ1A 1JJ6C 3WGGA 5CVRA 4EJUA 4MTEA 4U7DA 1HLVA 1ONOA 5J8FA 4PU2A 1TLHB 1R7JA 2BYVE 2DTZA 4EJWA 1W5CC 4LK1F 2ZJPF 2E1MC 2V9PA 3I64A 4HYEA 1A35A 2IS6A 4V2FA 5F1JA 2GA2A 2QQAA 2P8TA 3GLXA 3TP3A 3CCQI 4ZTJA 3VODA 1OCTC 2XAFA 3REOA 3B7TA 2A61A 2FQ4A 3T0YA 2HDWA 2IPQX 5ICFA 1DQUA 1S29A 1YJNI 2STTA 3B3BA 1O7LA 4PFOA 1BIBA 4I98B 4OIQF 2PQ8A 3MAJA 5J40A 3S2WA 3L2CA 2CU7A 4PK4A 2IAIA 2VONA 2EINH 4R79A 5GP9A 3V8JA 4A3DJ 2VJ5A 2KRFA 3IH3A 4B3XA 3HRTA 3K2AA 5HODA 3I59B 1O3SA 2IS1A 2WB1N 2R70A 4DZJA 2MYSA 2O6GE 3RKXA 2F5DA 5LGUA 4BBSJ 2W82A 2A6EF 2C6YA 3HSEA 1Z0XA 2K4BA 3FHNA 4M3BA 2BHZA 3BG5A 1WJDA 3FU5A 1H88C 2Q0OA 3M8JA 2KDZA 3AG3H 4M6XA 1MD0A 1JE8A 3VYRB 2HOTA 4L0ZB 2DJNA 2XKOA 4CZCA 4J19A 3ASNH 4B09A 5D4SA 5J8CA 3L2WA 3GYHX 4XOPA 5DCFA 2L0KA 3A01B 1FWZA 2IP2A 2DQMA 4XMWA 1ZAOA 3RJPA 1VI0A 3LOCA 4EVIA 2QSFX 4M9SA 4PJLA 3WU2C 2P5KA 2W1OA 3RPUA 3NEUA 1GW6A 3WHCA 5D6EA 3OYIA 1XGNA 4JX6A 4UUSA 4ZW5A 2VC0A 2A3SA 4CYDA 2WPGA 3IRRA 1JHHA 2NOGA 1J7KA 2W4SA 4G7OF 4FLRA 3ZN1A 2Z9OA 1U9OA 2ACJA 4L0YB 2ZSIB 1U8RA 1W36D 3CC2I 2YPRA 2EZHA 2NNNA 4L9TA 3F6OA 1Z7LA 1ZLJA 5JC1A 1XGMA 2R7ZJ 4S0HB 2GXAA 4OOIA 3JR9A 2EBIA 4ZH4F 3RKYA 1K6OA 3QYEA 1AHDP 1WI3A 2X1CA 5FD5A 1D1CA 1PYVA 4L9JA 4DOZA 3CCRI 4LK0F 3UNGC 3FMRA 3CMAI 3B7SA 2HEOA 3OYBA 2DFHA 2EQRA 5LHGA 4JX5A 4UUTA 2R72A 4ESBA 3S2DJ 3GFJA 3HSRA 1VQ8I 3FXLA 1F1ZA 4KT6A 1P4WA 2P81A 4HQEA 4XKCA 5HDGA 4NC8A 2STWA 4OU0A 3MKZA 4M72A 1P6RA 2BVMA 3S8PA 3JAMK 3DBRB 3P9CA 1VQ6I 1UFMA 4DNCA 2XRLA 1MDMA 1DP3A 3MD2A 5AIPA 3AL0B 3ZI0A 5F1RA 2OCEA 3CZGA 1G8XA 5CQEA 2YS9A 3OMYA 3IHUA 3TO9A 2CV2A 2GXBA 4HOBA 5E17F 2LF7A 2ME0A 5K7HA 1HCRA 2IRFG 2CS3A 1HDDC 4EEFG 2ME6A 2P6TA 2ZNYA 5J1UA 4BQNA 1N77A 4XN3A 1YRNB 3K0LA 3DKWA 2ZMEA 4JK1X 2MGQA 5FLMJ 3CJTB 3KZYA 2L02A 3JRFA 2ELHA 3FBIB 4XLCA 2IVMA 3DP7A 3I59A 3F72A 4QPEA 2M9HA 3TO6A 3HJEA 3EUHC 5CVIA 3D5LA 4M9ZA 1CGPA 3H35A 2Y1CA 2KJBA 1QZEA 1AA7A 4DBRA 2FA5A 3TGNA 4E7KA 3DLAA 2OZUA 1BOAA 4Q4EA 3QQAA 3F22A 5BPDA 4GYIA 4W97A 4ENNA 2EFQA 5LGNA 2Y1DA 5LHIA 3HKZA 2YSRA 2CW0F 2TDXA 1R36A 3CHRA 1HW1A 2RJIA 3HOVJ 3F21A 4YFNF 1IV8A 2R92J 3PO2J 2FX0A 4OIPF 4EMSA 1D5VA 3MWMA 1KQ9A 1RI7A 3C2HA 3E6CC 3TQNA 1Y56A 2E5ZA 2Z99A 5K7ZA 5EEAA 3N05A 1Z1DA 3KE2A 3CHPA 2ZMEB 3ZCOA 4DPRA 3ABMH 4CCJA 1O3RA 5K5QA 4GAAA 4XSZF 2ID3A 2LKXA 3FTWA 1W7PB 1KGSA 3VDXA 2EFPA 1XC5A 1K78A 2P7CB 1MH3A 3ZHXA 3FUNA 4LG3A 4RVBA 1QQIA 1H0MA 3GWZA 2MSYA 1VNDA 2CQ7A 2ISYA 3C2GA 4NC6A 3RPQA 3CCEI 5LEKA 3B7UX 3G1MA 3I4PA 1PJRA 1TT5B 1LB2A 4BXXJ 2DW4A 2IA0A 2CUZA 2LVSA 1YO5C 2XPUA 3K1NA 5CJ9A 5J3LA 1JJ8C 1XCVA 4IPAA 3FTZA 3V42A 2O8XA 3KZZA 1JXSA 4FT8A 3PIPF 1B4AA 1FIPA 2GOXB 2YUSA 1FLIA 1Y0NA 2P6SA 5FLVA 2XSDC 3IP4B 1K5HA 2LREA 1JHFA 2Y9YA 4ASNA 2GA1A 4IRGA 4AR8A 3CMEI 4Y3OA 1RRJA 1YW7A 3CCLI 4PFPA 1QHGA 3ZHZA 2HQ5A 2HYJA 3ERED 2L9RA 2NXNB 4KN4X 1T2KA 1IV6A 2IGOA 2Y30A 4ZDLA 3S3NA 1ENHA 3GW2A 4PVBA 3S32A 1Q0HA 2M3AA 3WE3A 2Y0SA 3MZYA 2F2EA 4QSHA 1IDZA 2K3PA 4R5VA 1HDPA 2DA2A 1Y8QB 5AENA 3PSFA 2IGNA 6PAXA 2ZJRF 2KPMA 2RC4A 1HOMA 2DFIA 3DU5A 3FUEA 3JT1A 3ZQHA 4ETSA 1SVOA 2EILH 4A3EJ 1L3LA 2L5QA 1MMSA 1HSJA 5DYFA 4XNDA 4DYQA 4FLOA 3I0TA 3BY6A 2ETHA 2K9MA 3Q9SA 4I0BA 5JLXA 5E3OA 3HOYJ 1RKWA 3Q0WA 3GZ6A 3MKWB 1P9QC 2DU9A 2A07F 1D3YA 2VJIA 4KMUX 3PJRA 2VL8A 2JUCA 2EV5A 2LY9A 2QLZA 2ZFWA 1R00A 4Y6PA 4D1QA 2RNJA 1UZCA 4M71A 1RUOA 3CLOA 4IHXA 1D0ZA 4CDGA 4R5XA 4BXFA 1I1GA 2JSCA 1FBUA 5BMZA 3BR2A 5HNFA 3LSHA 1P4AA 1OFCX 2F4IA 2FQ3A 2JCVA 2JPCA 3BG3A 5L3FA 3TOBA 1ITYA 3FH7A 3WG9A 4K5LA 3QAHA 1EF4A 3F8BA 2DO7A 1YI2I 3S1QJ 1IUYA 4BDZA 1BJAA 1I3AA 1XDUA 4XN0A 2V9KA 3GFIA 1HS6A 3DV8A 3WODF 1Y1WJ 4HX4A 1SMTA 4GRIA 2LBFA 3ZMTA 4OOFA 2R5YB 4FHTA 3KEOA 2IEKA 4ZYEA 3RDIA 4B43A 1VQ5I 3KLOA 1YTYA 5B3SH 5HVQC 3WTXC 2B9SA 1JI8A 2E1OA 2ADUA 3BCAA 4EM1A 3COAC 3IUOA 2HQNA 3M1CA 4EM0B 4A5MA 4DW6A 4CCKA 1HKQA 5LRSA 1SD4A 4IZZA 3H9QA 3CZ6A 2H27A 1RETA 4G8XA 3G2BA 2Z3YA 3A2KA 1MW7A 4AC0A 3HW2A 1A04A 3OYJA 2CUJA 4XK4A 3ONQA 5DM7F 3K4LA 3GEZA 1ORKA 3KLNA 4KISA 2R7OA 2O7OA 2M0MA 4Y33A 4BE1A 3NWTA 3BJ6A 3PUUA 3LSIA 2W7NA 3CZLA 4EGYA 4BHPA 2HGCA 4IRHA 4B47A 2P5VA 2UZKA 1EH7A 4IKFA 2ECBA 1XSVA 4BY1J 4YEJA 5GPAA 2HTSA 3KP6A 4ZX5A 1IN8A 2H1LA 4WCGA 1TWHJ 5EF6A 2QKMB 3L2QA 2X6YA 2BY2A 2X6WA 3BOQA 4BQAA 2LKPA 3FKIJ 2TRTA 3I71A 3O3KA 1MMDA 3ECHA 4N4NB 3H3ZA 1VQNI 2OAZA 2K5CA 3A4CA 4M3FA 5LRRA 5LHHA 2HQRA 4MTDA 3CLQA 2Y75A 2COMA 2DOAA 2HS5A 3K69A 2XSJC 1XD7A 3ZMUA 4BJTA 1DGRM 2LH9A 3IKVA 5GTHC 4OMYA 4A3KJ 4CCLA 4C2TA 5JI6A 5FFXA 2OPTA 2M8EA 3ZMVA 1JKQC 4Q5SF 3DPUA 5FKKA 1I5ZA 2MW8A 4K2EA 2ICWG 3CCUI 1RNLA 3B2PA 3GX4X 4UUSB 1RR7A 2E2IJ 3DU6A 4K5NA 3IAS2 2CYYA 4ENJA 3W6JB 3WQQA 1ZRFA 3CHQA 1N25A 4L18B 3FU3A 2EIMH 1ZRDA 4MS6A 1K79A 3LQQA 1SMYF 2VXDA 3K4MA 3ZR8X 1MNEA 2VB6A 4UV9A 5FROA 2O9LA 3FTYA 2XAUA 4IQ4A 3IL2A 2ZNZA 5IT9K 1X3ZB 1YHQI 2F4MB 1VTNC 3V8LA 4C30A 2A05A 2AQEA 3FULA 1X19A 4C3JJ 2KIMA 2JQ7A 4ZYAA 3CP2A 1BI1A 4JBAA 3CESA 3R6SA 5ILSA 1H3LA 2L54A 1R4NB 2IGKA 3QWLA 5EG0A 2ESHA 2M5WA 4UV8A 4P9UA 3I56I 1SG7A 3L2VA 4JQFA 1SVMA 2X6OA 2LK2A 1JGGA 4HLXA 2JN6A 4ZZDA 4OIOF 3EBHA 4P1WA 3PNYA 3HYIA 2W00A 4XQFA 2DI3A 1XN7A 1D0XA 3HEFA 1V4RA 2LNBA 2Y48A 2VKEA 3S1RJ 4KDPA 3OV8A 3MCZA 1ZTRA 3U2RA 4B44A 2DT7B 4BEHB 4XLHA 3Q0VA 3H5NA 5L3EA 4A3CJ 2UV1A 4FX0A 4IO9F 1YX3A 3O2PE 3QYFA 2DMTA 2OF7A 3HKZN 3CO6C 4LGWA 5JBIA 2MD5A 5J1YA 5F0HA 1R1UA 3F8CA 3AG1H 2C5ZA 2CJJA 4HPQA 3FUJA 5E79C 2O03A 3GZNB 2G0EA 3H0DA 1ZARA 2JWTA 3AG2H 1U5TC 1BOBA 2CWEA 2L4AA 4F91B 5E3NA 1H8AC 2XB0X 1BI3A 1DUXC 2VBWA 2VPRA 2CO5A 1ONVA 1GXQA 2P0WA 4Q4ZF 1MVYA 2EV0A 4QUOA 2QM3A 1JUMA 2NS8A 2WY8Q 4N9IA 4CSWA 3KFWX 5JVTA 1QVTA 2E2HJ 4KIBA 2EB7A 3P5JA 4XRSA 3BG7A 4E7ZA 1TQMA 2K85A 4IOAF 4XLFA 1X1PA 3BZ6A 2XKPA 1BW5A 3CUOA 2E7WA 3LQRA 3FDYA 4XKVA 3HOUJ 2Y31A 3EPZA 4XN4A 4ZZLA 4ZQFA 1WJFA 2L4MA 2Y69H 1IC8A 3GTKJ 3AG4H 3CC7I 2HVQA 3M7GA 4X2UA 1MMGA 1SC5A 4AWXB 1VQLI 3J81K 2VQLA 3BDDA 3E0JB 1IRXA 3CUQA 2KFDA 3G1OA 2KISA 5AIQA 3DEEA 4F92B 1WZ2A 3FM5A 1IRFA 1LKXA 1GUUA 2L2OA 1W1WE 4FLQA 2DFEA 1B8IB 4B4CA 3KYLA 1XTAA 3FF5A 4CXFA 2IT0A 4A2UA 2F5FA 2JZYA 1OMIA 3FISA 3MEXA 3U1DA 1MSEC 3UR3C 3MKLA 1K78B 1XGOA 1QRYA 2HPIA 4G7ZF 2NNYA 3WGIA 2ELJA 5BQTA 4DBQA 2GLOA 2M30A 3EUAA 2HYGD 3A0BC 4JNDA 4XONA 3HGYA 5EGOB 1B72B 1HKSA 1JGIA 1R5GA 2VBZA 4A6DA 4ANJA 2KIFA 4BE2A 1QBJA 3MKYB 2Y1FA 1BW6A 3VSKA 4D9JA 3S93A 2JPBA 3UCQA 1VQ4I 1B1BA 2D1VA 1V54H 5FLXK 2VJ4A 2XAJA 3QRFF 4I2OA 5E3LA 3ISPA 5JR3A 2LSOA 1AU7A 2ZFUA 4XR6A 2HI3A 1UJ8A 3SFIA 2ISZA 3WTZA 3G6EI 2M7BA 2CQXA 3IWFA 3TW6A 2HDCA 4MQ9F 3VYSB 5DV5A 4X1EA 4M9XA 2DMNA 3KYDB 2EH3A 1JUPA 2DT6A 1GVJA 2X48A 3PL8A 1FTTA 3W6KB 4RB2C 2VASA 3WU1B 2FMYA 3OYDA 3BG6A 4MEXF 3ASOH 3J7YJ 2EA4A 1YG2A 1ZG1A 2CFOA 3H5RA 3GTPJ 3BLYA 1GT0C 1FP1D 2AQFA 3NAUA 3DTKA 1MW3A 2KIQA 1PP8F 2PI0A 4NNJA 1BC7C 1UHWA 3FMQA 3K7AJ 3A1YA 2PFBA 3CJNA 2K9SA 4NQWA 3CCMI 1MW1A 1MW2A 3GTGJ 4V19K 4MNUA 1WJ5A 2ZC2A 2BY3A 3GLLA 3PUBA 2R7VA 4CH7A 2GM4A 1F5TA 2H1KA 2V6CA 5LBQA 1T0FA 2LDUA 1HXDA 4C9YA 2FRHA 4CO8A 4DIQA 3N97A 3ANLA 2DA5A 3KX2A 1FPQA 2DFFA 4G6TB 1KQ8A 4KJZA 4A3LJ 2PG4A 2MH2A 2WB1A 4XRFA 2ID6A 1FOWA 3R0IA 3KCCA 2L7ZA 1PUFB 1APLC 1D8KA 4I76A 2E1MB 5CKTA 1IUFA 1X58A 1Z77A 2MC3A 1XB4A 4WXCA 5DD8A 3RKWA 4YFXF 1D8JA 1BIAA 3KIOA 2EZKA 1FBSA 5DULA 3FKJA 5EEGA 1PUFA 2FNAA 3CO7C 3I3LA 2ESNA 1Y6IA 4HA8A 3BTLA 1IO2A 5D5UB 2L7KA 3OIOA 1ZGWA 2KKOA 4L9VA 2HOAA 3LAPA 3Q9VA 2R7DA 3A06A 5FKNA 4DGWB 3K4CA 3L00A 4BE0A 2Q2EB 1ZYRF 4HDVA 5CVJA 4A3IJ 4RS8A 4XLPF 1T33A 2DMPA 4HQMA 1ZKGA 1Z3YA 2DPDA 2H94A 2RN7A 1BA5A 1X4PA 2EGHA 1BI2A 3AUAA 2Q2EA 3DFGA 1IGNA 1D1BA 3JRIA 1SAUA 3DEUA 1S72I 1Y8RB 4AU7A 1XDSA 4PGGA 4ZW8A 4J00A 1EH6A 1MBJA 1R58A 2JRMA 5DUKA 5HLTA 3CF5F 3BPVA 4P55A 5HS9A 2I10A 5KAFC 2PJPA 5FGMA 2KHMA 3C1DA 3OYHA 3RTRA 5TRDA 1RZ4A 1GVDA 2GXGA 3FUMA 2GBYA 2OCCH 2VQCA 3CDIA 1U5TB 4ZQEA 2R7TA 5TISC 1ON1A 4KT5C 5J6XA 4ENMA 2QQ8A 4QIWN 2Q8KA 1NK2P 2A6HF 1BC8C 4UVBA 5DCMA 3GTLJ 3MZ8A 1DPRA 2OJED 3CZKA 3HPGA 4K5PA 1ULYA 3OYEA 2F5VA 4WXDA 1MBKA 4AIDA 2FBHA 5GADJ 5EZHA 3CD6I 5L3DA 5D4RA 2RNGA 1RUNA 5FB2A 3RZDJ 1GLNA 2VPLA 2FF4A 4RDUA 2L7FP 3F8MA 3OS1A 3RASA 3PIOF 2XAQA 2ZMEC 1WSUA 1LQ1A 4XN5A 5H20A 3B34A 3JRBA 1BR1A 1LFBA 3K70C 3OIQA 5F04A 1TWFJ 1T6SA 2JSPA 3K4NA 1ETQA 1ZS2A 2ZBKA 1YS7A 2WAQN 3B6AA 2BW3A 3KPHA 4XMYA 4XSXF 4A3MJ 5HLIA 1S8NA 1U78A 2PUSA 3BQZA 4L5IA 5L3CA 3H9JA 4D5FA 4M74A 3WTUC 3BR5A 1TC3C 3HOZJ 1ZGJA 4CA0A 1XMAA 3KP3A 4LB6B 1OISA 4ESJA 2LY2A 2W84A 4FLSA 3DPTA 1MJBA 3FM3A 1XG1A 3HXLA 3BWGA 4UHTA 3ZQCA 2L9SA 4R7LA 3CCYA 1B8IA 2KL4A 2MABA 3ZRGA 2R59A 1YX5A 1OYIA 4C2UA 4HEA2 5C44J 3QU3A 1C0WA 2B0LA 3K4JA 2CV0A 1MJAA 2FOWA 4IHWA 1ON2A 9ANTA 1SD5A 4LB5A 3HOSA 1SFXA 4F55A 4EGZA 4AYSA 2ECCA 1JGSA 2AXTC 2WADA 3SZGA 2QYOA 2VOOA 4XICA 1OLTA 3S2HJ 2W24A 4BACA 3VB2A 2K9NA 4BAYA 2F5EA 2HZTA 2IA2A 2N8GA 1P7JA 5ERIA 1K7AA 4XMUA 1V5EA 2B63J 3S15J 3JTHA 3SHFA 3OY9A 2IS4A 2H6CA 4A69C 4AVZA 2O8KA 3H3VK 4RCVA 3OOUA 1GV2A 1XX5A 3VYTB 3B7RL 3OR1C 4AIHA 4GXOA 3IC7A 1TQIA 3SDGA 3I5UA 5M5XJ 4XO5A 1JT6A 2K4JA 2W25A 3CDHA 3FZVA 1NG7A 1SFKA 4IEJA 2YX7A 1AOYA 3H5AA 3ABLH 4D5CA 1OCPA 3TDUC 1KU7A 1DGWY 1YLFA 4BNCA 2R0QC 4FCAA 1G3TA 2JV7A 5D5VB 3EUKL 4CHUA 4RGXA 2OQGA 4PJ0C 2W57A 4ITVA 5LFAA 3C2BA 2KDOA 3JAMZ 4JYKA 4EJVA 4ZYHA 1OJLA 3JTGA 1BBYA 2IW5A 1LFUP 2X1DA 1R0LA 2A7OA 4NB5A 4ZX6A 1FX7A 2DQ6A 4WWCA 1KYZA 3I54A 1MBHA 4NUBA 5E8GA 2D5VA 4BHCA 4ZYDA 4LIUA 2RREA 4A3GJ 1FYLA 2JUGA 4XMXA 3J81Z 1YW9A 2HU9A 2KZGA 3D0SA 1UG2A 3BZKA 3PNTA 4G12A 3TO7A 5KNLA 3FBNB 2VBYA 3L7WA 2XHKA 1IN4A 2XGDA 2QVOA 3GO5A 3HOXJ 1U3EM 1OCRH 4IHVA 2GZWA 5ICCA 5EGOA 1U0JA 2WWYA 4Q47A 1OR7C 4A0YA 1ZLKA 1QNTA 4JX4A 1V55H 4IVNA 4X6AJ 3K4KA 2JA5J 3LAJA 2QWWA 4AICA 5DCMB 1QZZA 5H2FC 1GV5A 2KRCA 4KNYA 2E2JJ 2LR8A 1SQMA 1FBQA 1FY7A 4BKXA 2E7XA 2X0LA 3KP7A 3ZQLA 1K4SA 1T1SA 1OQYA 2BXYA 2V1DA 2VODA 4O6JA 1CQTA 1P2FA 1POGA 3L9FA 2WTEA 5A2QZ 4KIFA 2JD1A 3TL4X 4C3HJ 4DJAA 1SFEA 3FUHA 2MLKA 3W2WA 4AIKA 3T8VA 2WC2A 2CUFA 2LOOA 3OYNA 4RBOA 2K9QA 5BPIA 2A68F 3U21A 3S1NJ 2V79A 4A5NA 5BS6A 3HTUA 1X1AA 3V7CA 2WZGA 3ZOBA 1Y0UA 4MO7A 4CZZA 5LGTA 4HAMA 3CCVI 4IJAA 3ZPLA 5D5XB 2QUFA 2X85A 3S1MJ 4JOMA 2R7RA 3S14J 4I09A 4XNBA 3TMOA 5JLWA 5DS9A 1T8IA 4PSWA 2UXNA 3QPSA 2PGGA 3SJMA 4R8HA 1LVAA 5E1ZB 4YIRX 1ZN2A 3BP8A 3F0CA 3MN2A 4H0EA 1BM9A 2HZDA 5C3EJ 2A6TA 3H3UA 4FX4A 2WZFA 4EV0A 1U5TA 4PUSA 4Y67A 1R5HA 1TWAJ 4QWQA 1S6LA 2L9VA 4KICA 2EPFA 1OYWA 2R7SA 4PCQA 1YRNA 2NS7A 4LLLA 4A0ZA 2BY0A 5IP9J 4OMZA 4A6EA 1STZA 1SANA 2KQRA 2L7MP 3K70D 4UXNA 1W36C 4PZJA 2I5UA 3LL7A 2M4GA 3HUGB 4FETA 2EWNA 4ZW6A 4YG2F 1JKOC 3ZN0A 5E1XA 4LFUA 3J7AO 2ZB9A 1WJAA 2DDBA 4OIRF 4AD9A 2XPZA 1Z3XA 3PUFA 3BG9A 3QOPA 4N9HA 2H8WA 1EH8A 4KA4A 3SXYA 2Y1GA 4DQ2A 3PO3J 2FUG2 2DK8A 3F6VA 2LMDA 1KZHA 1L0OC 2LKSA 4CYCA 3FX3A 1SD7A 1J75A 3Q0UA 2VUMJ 5FKMA 4XN9A 2CH0A 2X6XA 4O3MA 4GGGA 1MBEA 2CMPA 3DKXA 2ZJQF 4OAYA 3CDLA 2B7EA 1JKRC 2IBDA 2R3SA 4IOCF 2X1EA 4CYCB 1VQ9I 2QQBA 1G3YA 1G6NA 2FU4A 2ZXJA 1Y39A 1FJLA 2OBPA 3ML6A 1I39A 4RLFA 1UELB 2DA4A 1FT9A 2OZ6A 2UUZA 1B59A 2VN2A 2Y0SN 2OTJI 3K10A 3VVLA 3B02A 5JHFA 3FMSA 2DN0A 2DAOA 1R23A 3FTUA 1SAXA 5BNGA 2LC2A 4HBLA 4C3IJ 4QPOA 3PNVA 1ZH5A 3JRAA 4Y6RA 3CZEA 2XF7A 3FU6A 3D5RC 1UHMA 3EDPA 2GIVA 1S3JA 2H09A 1T39A 4L9NA 1QZYA 1WQ2A 2Z5UA 4HV5A 4CCMA 3M3YJ 1D5YA 1MKMA 2GTQA 3FH5A 4Y17A 5IY5H
chains in the Genus database with same CATH topology
4FASD 4XMTA 4EATA 2Z2SB 2DQMA 4XMWA 2VQLA 4F92B 3E0JB 1IRXA 4R5TA 2VLAA 3DEEA 4PJLA 1LKXA 2W1OA 4BJ6C 1GW6A 2L2OA 4FLQA 3OYIA 4MLOA 3KYLA 4CXFA 4BQQA 4XKBA 1EA3A 4ZW5A 3FUKA 2WPGA 3UR3C 3W2AA 3U9WA 4ARFA 4BUPA 4FLRA 2HPIA 2W4SA 3DTIA 2ELJA 4DBQA 3EUAA 4JNDA 2ZSIB 2M7AA 1W36D 1RP3A 4XONA 3CF2A 2QKLB 4ANJA 3OYAA 1N78A 4BE2A 1Z7LA 1JGIA 2Y1FA 3MKYB 3UCQA 3VSKA 4D9JA 5JC1A 3S93A 3PUUA 2XDVA 4BJ5C 3Q43A 2VJ4A 4XN2A 3QYEA 2X1CA 1D1CA 1PYVA 3CP8A 4DOZA 2ZFUA 3AU8A 3UNGC 2XPYA 2CV1A 1WFXA 4XR6A 4YRVA 2XC7A 2WAQA 3B7SA 2LG4A 5DLLA 3OYBA 3LSMA 2LBFB 2M7BA 4XMZA 2KZVA 3VYSB 4MKTA 4XM3A 2HPMA 4LITA 2R72A 2DT6A 4RMNA 4QIRA 3OYMA 3PL8A 2BVLA 4KT6A 2K9LA 2R7XA 2LRDA 2VASA 5KHDA 4XKCA 2IXSA 1QHHD 3OYDA 3BG6A 4NC8A 4J3BA 1D1AA 1X4OA 2V26A 3MKZA 3W2VA 2BVMA 3S8PA 2CFOA 3AL0C 3H5RA 3BLYA 1DP3A 3FUFA 2AQFA 3E1SA 3MD2A 3AL0B 3DTKA 1MW3A 4BS9A 4LIVA 3NWSA 3ZI0A 4E7IA 4NNJA 2B61A 2R7WA 3CZGA 1G8XA 3A1YA 4BEHA 1OR7A 4NQWA 3WQSB 1MW1A 5CQEA 3OMYA 2CV2A 1MW2A 4BQOA 4ZDOA 4ZX3A 2MFZA 4HRIA 4F93B 1WJ5A 4XLAA 2CS3A 2WBMA 3PUBA 3UERA 2R7VA 4CH7A 4AR9A 4XN8A 2BW3B 1WJCA 2HQAA 4BQNA 1N77A 5JMWA 4C9YA 3FTXA 4DIQA 3FUDA 4XN3A 4E7LA 4ZQTA 3ANLA 1X3WA 4IQJA 3KX2A 3DKYA 4G6TB 3CIAA 4KJZA 2VJJA 2WB1A 4RLQA 2L9NA 1H19A 2GOMA 4X0GA 1R0KA 4ZJZA 3FBIB 2IS2A 3WQRA 4XLCA 5HNHA 4J01A 3R0IA 3Q44A 3DPLC 4QPEA 1JVSA 4F52A 2WY7Q 4KP7A 3EUHC 5JO0A 3D5LA 2E1MB 5CKTA 3ZHYA 3H35A 3IAM2 2Y1CA 3OYFA 4CCNA 2ZSHB 1MW0A 1AA7A 1X1DA 4DBRA 3DQVC 1ERDA 4XO4A 4E7KA 3DLAA 4Q4EA 2JVGA 5DULA 2M4KA 1G59A 3FKJA 3I3LA 2DJIA 4OOEA 1ZELA 4ZN6A 5JMPA 1Y6IA 5CQGA 2Y1DA 3HKZA 2L7KA 3EBGA 3GBGA 3AKZA 1R6RA 3CHRA 2RJIA 1G5AA 4P5OA 5LD2C 2HPTA 4NC7A 4XKWA 4DGWB 2IGMA 3K4CA 3A06A 4BE0A 2Q2EB 1UAAA 3RC3A 3C2HA 2C82A 1Y56A 2E5ZA 3VVMA 5TGTA 3N05A 3CHPA 3KEDA 4XOTA 1V5GA 2ZXHA 3VYUB 3ZCOA 1Z3YA 4CCJA 4DPRA 5JAZA 4RSYA 4GAAA 1X4PA 2MD0A 2EGHA 3AUAA 3FUIA 3FTWA 1D1BA 5CPRB 1SAUA 1T95A 3VDXA 1MNDA 3OR2C 4AU7A 2MAPA 4N4OB 3ZHXA 4ZW8A 4J00A 1T0FC 4LG3A 3FUNA 4RVBA 5BPPA 1D0YA 2DXIA 5HLTA 4U87A 4PJMA 4BU2A 5JNLA 3C2GA 2QVWA 3B7UX 2KMUA 2KHMA 3OYHA 1SC5A 1PJRA 3RTRA 5KCMA 3FUMA 4Y6SA 2NOJB 4BDYA 2CUZA 2VQCA 1VZ0A 3B2XA 2R7TA 4HG2A 4ZQEA 2A5WA 2QJ1A 4ZQHA 3KEYA 5FRNA 3FTZA 1Q0QA 3OWTA 3V42A 3FTSA 4OWRB 3OS2A 3UEQA 2GOXB 2E60A 3CZKA 3HPGA 3AU9A 4YELA 4K5PA 4OAZA 2KRHA 3HG9A 3OYEA 2F5VA 3RPUD 3IP4B 3LSKA 1K5HA 2LREA 3QJXA 4AR8A 4ZW7A 1LDKB 4Y3OA 2RNGA 3SDBA 1TT0A 4PFPA 1QHGA 1GLNA 2WA0A 1J09A 1S9HA 2O5RA 3OL3A 2VPLA 3ZHZA 4PSXA 4NQWB 3OS1A 3EBIA 3JSZA 2MC4A 3FTVA 3RASA 2CW8A 2VKHA 2IGOA 3K6GA 4XN5A 4ZDLA 3S3NA 3B34A 1BR1A 2JVHA 5FWQA 3K70C 4PVBA 2V4JC 3OIQA 3S32A 4ZX4A 3ZXSA 1Q0HA 2M3AA 3S3MA 5EV7A 2Y0SA 3HPHA 3SYTA 2JSPA 1QU3A 3OYCA 3K4NA 2K3PA 1ZS2A 2V7FA 4R5VA 2BW3A 5AENA 4XMYA 1FMWA 3PSFA 2PUSA 2IGNA 3CJRB 3H9JA 2KPMA 3RQ4A 1LVKA 3DU5A 3FUEA 3JT1A 4XMVA 3VWBA 2L5QA 3BCBA 4CA0A 5DYFA 3QYBA 2RQQA 4XORA 4XNDA 4FLOA 3OS0A 2LY2A 2K9MA 2WAEA 3DPTA 4FLSA 3LMMA 2Z1DA 2PJRA 3LFUA 2R4GA 3HXLA 1P9QC 3MKWB 4XN1A 2L9SA 4R7LA 2VJIA 4H4KC 2Y1EA 2WAFA 2KL4A 3PJRA 2MABA 2VL8A 3ZRGA 1JG9A 4ZW3A 4XNFA 1YX5A 2VQGA 2R59A 2PMZA 4Y6PA 3H9GA 4HEA2 4QPQA 4II3A 4ZDPA 4D1QA 4C2UA 3A14A 2ZXGA 3W3CA 4Y6RA 4CCOA 1D0ZA 3K4JA 2CV0A 3J7AY 2R7QA 2LY1A 3ZGKA 4R5XA 4BXFA 3DTEA 2VKDA 4F55A 5HNFA 3LSHA 3HOSA 4Q4IA 4AYSA 3DWLE 2F4IA 3FHEA 2JCVA 1NG6A 4AYBA 2WADA 3SZGA 3HOTA 4BL0B 3FH7A 2OV7A 1OLTA 4K5LA 4QHPA 4BACA 4BDZA 2VQHA 3K4BA 2V9KA 4XN0A 1HA8A 3LSGA 3OIPA 4HNTA 1HS6A 3CJQB 3BC8A 2V6EA 4E7SA 4GRIA 3ANNA 3MMYB 4XMUA 1V5EA 2LBFA 4OOFA 3OY9A 2IS4A 4AVZA 3IIEA 4B43A 1WJBA 5FRMA 4RCVA 3OOUA 4E4HA 5HVQC 3VYTB 2LYCA 1JI8A 3BCAA 3B7RL 3OYLA 3HC7A 3IUOA 3M1CA 4HSTA 3OR1C 2VJ8A 4K5OA 4CCKA 1X1BA 4IZZA 3H9QA 3CZ6A 4U7BA 2V1NA 3G2BA 2HVSA 3A2KA 1UG0A 4XO5A 1MW7A 3QOEA 1NG7A 1SFKA 3H5AA 3OYJA 2CUJA 4XL9A 1DGWY 2JD0A 3ONQA 4FCAA 2JV7A 3EUKL 1YE9A 3K4LA 2I8DA 4KISA 4XO3A 2R7OA 4XLEA 2X51A 4ITVA 5LFAA 4XN7A 2KDOA 2M0MA 4Y33A 1TZLA 3NWTA 3RCOA 4BE1A 4KITB 3D5SC 4PJJA 3LSIA 2X1DA 2W7NA 1R0LA 1S46A 3VSLA 2A7OA 2O7GA 2DQ6A 3CZLA 4B47A 2BOLA 4HSRA 4NUBA 4IKFA 2OC6A 4LIUA 4YEJA 2RREA 3OYGA 4ZX5A 4XMXA 2JUGA 2HU9A 2QKMB 2E5NA 3PNTA 2X6YA 3L2QA 2X6WA 4B48A 1FMVA 2Z16A 3FBNB 5KNLA 1MMDA 4N4NB 3F9KA 1U0JA 2K5CA 2Q1ZB 3A4CA 3FH8A 3QODA 1OR7C 4A03A 2XF6A 2DOAA 3K4KA 3CHSA 1BR4A 4GAEA 4AICA 2XSJC 2KRCA 4BJTA 1DGRM 2LH9A 3RSNA 4PW4A 1SQMA 4CCLA 4C2TA 1T1SA 4BKXA 2OUMA 3ANMA 1MMAA 4HNUA 2FFLA 3DPUA 3CHOA 1WJEA 4RM3A 3OYKA 1T1RA 3B2PA 2JD1A 3TL4X 1KONA 4DJAA 3DU6A 4K5NA 3FUHA 3IAS2 3W2WA 3T8VA 3WQQA 4ZC3A 3CHQA 2LOOA 3OYNA 2MAOA 3FU3A 3OL4A 2PJRB 3PSIA 4MS6A 3TBIA 2XQ0A 3U21A 3S3OA 3L2UA 3ZR8X 2VXDA 3K4MA 1X1AA 1MNEA 4IX7A 2UWMA 2DCEA 2VB6A 5FROA 1ONPA 2WZGA 3FTYA 2XAUA 4IQ4A 4II2A 2VIXA 1V5FA 4E7HA 2X85A 4ZQGA 4JOMA 4C30A 2AQEA 2R7RA 2HPOA 1X19A 3FULA 3L2RA 4XNBA 3TMOA 4ZYAA 2JCXA 3CP2A 3PFYA 4PSWA 3CESA 1N75A 1Q0LA 3I9V2 1ONNA 2PGGA 1H3LA 4AR1A 4LUPA 1X3ZA 2IGKA 2R7UA 2WZFA 2HZDA 1X1CA 2PL5A 2A6TA 4PUSA 4Y67A 4Y4RA 4E6KG 3L2VA 4JQFA 1SG7A 2R7SA 4ZTFA 3EBHA 4P1WA 3PNYA 2KQRA 4F3QA 2W00A 3K70D 4XQFA 1W36C 4K5MA 3LL7A 4QMEA 1D0XA 2M4GA 3HUGB 2VXZA 3AFHA 3CMMA 4FETA 3SEQA 1BR2A 4ZW6A 2XF5A 2JA2A 4B44A 4L2LA 4PU2A 1ONOA 2DT7B 1WJAA 4BEHB 4XLHA 2XPZA 1Z3XA 1MMNA 3H5NA 2UV1A 1YX3A 2E1MC 3QYFA 2Y1GA 5JBIA 2IS6A 3SEZA 2FUG2 1E0EA 4ZTJA 2HVRA 2C5ZA 2JD2A 2KLOA 4BGDA 3B7TA 4HPQA 4XNAA 3T0YA 2HDWA 3FUJA 4PJNA 3H0DA 2F6CA 1DQUA 5HOOA 4XN9A 3RC8A 2CH0A 3B3BA 2X6XA 1BOBA 4PFOA 4F91B 2ZXIA 2CMPA 3HL2A 3DKXA 4PK4A 4OAYA 4CUGA 4R79A 2P0WA 1MVYA 2X1EA 2VJ5A 4B3XA 4QUOA 4E7JA 2IS1A 2WY8Q 2CW7A 4CSWA 2R70A 2HNHA 2MYSA 4RLFA 1UELB 2KP6A 4RM2A 3ZQQA 2UUZA 3K10A 3VVLA 2W82A 5JHFA 3BG7A 4E7ZA 4XLFA 3FHNA 3FTUA 1Z21A 2LC2A 3FU0A 1WJDA 3B37A 3FDYA 4XKVA 4QPOA 3PNVA 3FU5A 3M8JA 3EPZA 3CZEA 2XF7A 3FU6A 4XN4A 3D5RC 4ZQFA 4ZX6A 3VYRB 1WJFA 2GTQA 1LFPA 2JCYA 4CCMA 4CZCA 3L2WA 3FH5A 2HVQA 4X2UA 4XOPA 1MMGA 1K6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  5HNF A;  5HLT A;  2VLA A; 
#chains in the Genus database with same CATH topology
 4FAS D;  4XMT A;  4EAT A;  2Z2S B;  3FXJ A;  2WV1 A;  5BOX A;  2YU9 J;  4B3A A;  4I7H A;  1FOX A;  4BJ6 C;  2XPV A;  2GIZ A;  3B73 A;  5IOY A;  5HLH A;  1W4M A;  4MLO A;  2PX9 A;  4HF0 A;  4O5V A;  3FUK A;  5H6R A;  3U9W A;  4ARF A;  3RZO J;  4BUP A;  3DEW A;  3DTI A;  2VT2 A;  3IH2 A;  4LMY A;  5TJJ A;  3GTO J;  4WX9 A;  5JVG F;  1RP3 A;  1QPI A;  3P9I A;  2FML A;  4KN7 X;  4RB3 C;  3CF2 A;  2QKL B;  4R1H A;  3OYA A;  2HKX A;  1N78 A;  3FXU A;  3I58 A;  4MEY F;  4G6D A;  1NH3 A;  4MFE A;  4XN2 A;  2ZO4 A;  1IN5 A;  5IYC J;  2OQR A;  4YRV A;  1LE8 A;  2XC7 A;  1TQP A;  2LBF B;  3RI4 A;  2KZV A;  4MKT A;  3ZQG A;  2K7L A;  4LIT A;  2XUB A;  4RMN A;  2HPM A;  4QIR A;  3OYM A;  3G1L A;  1XPX A;  2XGX A;  2F5C A;  2LRD A;  4MQV A;  5KHD A;  4S05 A;  4J3B A;  5J1R A;  2LLK A;  1D1A A;  1X4O A;  2QZ8 A;  3W2V A;  1YOV B;  2GAU A;  3FUF A;  3NWS A;  4E7I A;  2B61 A;  3RQI A;  3PQJ A;  1OR7 A;  4N0B A;  2FXA A;  1HC8 A;  2Y2Z A;  2BE5 F;  3MVP A;  4BQO A;  4ZDO A;  2MFZ A;  2RKH A;  4HRI A;  3UKG A;  4XLA A;  3UER A;  2WBM A;  4A0X A;  4AR9 A;  2L01 A;  1Q1H A;  2DK5 A;  4XN8 A;  2BW3 B;  3FXR A;  5DD4 A;  5H6Q A;  3WGH A;  1W0T A;  3QPL A;  1MBF A;  4Z6Y A;  4RB1 A;  4BBR J;  2R5Z A;  3FTX A;  3FUD A;  2FEZ A;  1J0R A;  1X3W A;  3V4G A;  4IQJ A;  3BR6 A;  3CIA A;  2JTV A;  3K2Z A;  3PM1 A;  4BXU A;  4M3G A;  1H19 A;  2GOM A;  1FP2 A;  5EYR A;  1IXC A;  2NS0 A;  4X0G A;  1I1S A;  2IS2 A;  1R0K A;  3WQR A;  2XRO A;  5HNH A;  2XAS A;  1B6A A;  4HZF A;  2QA4 I;  3FWE A;  2BHY A;  2HYF A;  3U1K A;  1DU0 A;  1JVS A;  4FE4 A;  1FSE A;  5JO0 A;  3ZHY A;  1KYW A;  3IAM 2;  2ZSH B;  3TP0 A;  1O4X A;  1E3O C;  1ERD A;  4XO4 A;  3DQV C;  4A3J J;  1F36 A;  2JVG A;  3GFM A;  1G59 A;  1ZR4 A;  4ZN6 A;  2DJI A;  4LJZ F;  1ZEL A;  3F8N A;  4L5J A;  5JMP A;  5FD6 A;  1F4K A;  3GBG A;  3AKZ A;  1R6R A;  1ETV A;  3JSP A;  2FBK A;  3LST A;  2M45 A;  4MHG A;  2L3D A;  1G5A A;  4P5O A;  5LD2 C;  4F7Z A;  5E18 F;  2UXX A;  2K86 A;  4NC7 A;  2IGM A;  1IAW A;  3ABU A;  3GTJ J;  1W7P A;  2KJC A;  1UAA A;  2C82 A;  1WGX A;  1M1E B;  3M9A A;  3VPR A;  2VT3 A;  1Y1V J;  1OCZ H;  2KIU A;  5TGT A;  3VVM A;  5D5W B;  1YFH A;  2QSG X;  4XOT A;  1E17 A;  3VYU B;  3Q5F A;  4UY8 I;  5JAZ A;  3EQL F;  2MD0 A;  3FUI A;  1T08 B;  5J4Y A;  3E6B A;  2DQR A;  1MND A;  4BH9 A;  5IT9 Z;  3ZQ7 A;  1WRJ A;  4N4O B;  2HKO A;  1D0Y A;  4V2G A;  3F23 A;  3FXM A;  4U87 A;  4PJM A;  4GDF A;  2DOE A;  1KA8 A;  2QVW A;  5JNL A;  1U8B A;  3FXK A;  2CFX A;  5KCM A;  4Y6S A;  2NYX A;  3LNQ A;  4ABZ A;  4HG2 A;  1LE8 B;  2A5W A;  3BJO A;  4QLC U;  4ZQH A;  5IOZ A;  2MG4 A;  5FRN A;  5EJC A;  4IXA A;  3OWT A;  4IF4 A;  5E8I A;  5GTI C;  3FTS A;  5J4V A;  1RPW A;  3OSG A;  2E35 A;  1UB9 A;  1YIT I;  4HV6 A;  4WF2 A;  3AU9 A;  2Z33 A;  2KRH A;  3J80 K;  4M73 A;  4I01 A;  1KQ0 A;  1FIA A;  4AYB N;  1LDK B;  1REP C;  3SDB A;  2Y9Z A;  5CYV A;  5ILV A;  1J09 A;  1S9H A;  2AHQ A;  4MGR A;  4PSX A;  5FO5 A;  1MGT A;  4A3B J;  3JW4 A;  3SQN A;  3GME A;  3K6G A;  4IHT A;  4A93 J;  2JVH A;  3WU0 A;  1HW5 A;  4ZX4 A;  2ELK A;  4Z2Y A;  3E5X A;  3HPH A;  3SYT A;  4D7N A;  4G9Y A;  3OYC A;  4M3E A;  3SZP A;  5IP7 J;  1CF7 A;  1FMW A;  3CJR B;  1Z91 A;  3FK6 A;  1SC7 A;  2G7H A;  4LD5 A;  1LVK A;  2NRA C;  3BR3 A;  2DOF A;  2FSW A;  3KP2 A;  3PQK A;  3LFK A;  4XOR A;  2RQQ A;  3BRO A;  3ABT A;  1Z6T A;  3O8G A;  4I99 C;  2MA3 A;  2Z1D A;  2PJR A;  1I3Q J;  3WTV C;  4IHY A;  2R4G A;  5FKL A;  1MNM C;  4XRS G;  2XB5 A;  2F4O B;  2QEN A;  4G94 A;  2EA2 A;  2IJL A;  1HF0 A;  2DYR H;  2WAF A;  5J47 A;  1YIJ I;  2Y1E A;  4BYY A;  4XNF A;  2VQG A;  3BQY A;  1TNT A;  4LLN A;  4ZDP A;  2ZXW H;  4II3 A;  1U2W A;  3DF8 A;  1ZG5 A;  2ZKZ A;  4CCO A;  5HS7 A;  1HKT A;  1NK3 P;  3HM5 A;  2BZT A;  3ZGK A;  4GYG A;  3Q3S A;  1TBX A;  2M1B A;  3L09 A;  2VKD A;  3LSR A;  1YW8 A;  3DWL E;  3FHE A;  1HW2 A;  1NG6 A;  4AYB A;  3HOT A;  1IG7 A;  5ICE A;  4A12 A;  4IHS A;  1FSH A;  4UUV A;  5B66 C;  2JA8 J;  4P9F A;  3LSP A;  1PVE A;  2EZI A;  1HA8 A;  3LSG A;  3OIP A;  4HNT A;  1A31 A;  3BC8 A;  2V6E A;  1MH4 A;  3ANN A;  3MMY B;  3E6M A;  2BY1 A;  4D7M A;  3DLL F;  4RGR A;  1R5I D;  3IIE A;  4I6Z A;  1T98 A;  1WJB A;  2AXL A;  4UVA A;  1U9N A;  1AKH A;  2A5Y B;  2LYC A;  4Y13 A;  2X9D A;  3NAR A;  1R49 A;  4MIM A;  3HC7 A;  1J2X A;  4HST A;  2PMU A;  3OYL A;  1FZP B;  1TWC J;  3M4O J;  5L3B A;  4K5O A;  1X1B A;  3IH4 A;  5D8L B;  3N4M A;  3WTT C;  4M6Y A;  1WKM A;  3K1M A;  2HVS A;  1F43 A;  4U0Y A;  1RC9 A;  1UG0 A;  1JTX A;  4Y7N J;  1RES A;  3S16 J;  2XPW A;  2NAZ A;  1P92 A;  3H1C A;  4NBQ A;  4LG0 A;  1OKR A;  3R0A A;  5IYD J;  3G71 I;  2LF8 A;  1YE9 A;  4XO3 A;  4XLE A;  1X3U A;  2X51 A;  4XN7 A;  3J7Z I;  3RCO A;  1TZL A;  2V1U A;  1S46 A;  1QA6 A;  3D5S C;  4AUX A;  3X2Q H;  3VSL A;  4UNO A;  4M3D A;  1HST A;  4UVC A;  2BOL A;  4HSR A;  5KAI C;  3E3V A;  2OC6 A;  1ZK8 A;  2R5Z B;  4U0V A;  3OYG A;  2MLG A;  1G2H A;  3JRC A;  3HTS B;  2DA6 A;  2E5N A;  2R5Y A;  1FMV A;  5EEH A;  3EET A;  4B1R A;  1BN5 A;  2QF7 A;  3ZQF A;  3F9K A;  4G6Q A;  1SVL A;  5IP6 A;  1Z6R A;  5HLG A;  3FH8 A;  1MJ9 A;  3MFK A;  2OD5 A;  1H9T A;  3QOD A;  2VE9 A;  2K27 A;  3RYP A;  3KZI C;  3WTS C;  2J5O A;  3FXO A;  3CHS A;  1YJ9 I;  5CVU A;  1QVU A;  4FTH A;  1TTY A;  1XCB A;  2PBI A;  4PW4 A;  3RSN A;  3V7R A;  3ANM A;  4HNU A;  1WJE A;  4RM3 A;  4RGU A;  3ABK H;  3OYK A;  1T1R A;  3HB9 A;  3EYY A;  1IF1 A;  3NQO A;  2LD5 A;  4HF1 A;  1U6G A;  2FJ1 A;  1BJZ A;  1ETW A;  3E5Q A;  2M87 A;  4ZC3 A;  1NTC A;  4WXH A;  1O3T A;  1VQ7 I;  1WH5 A;  5IPA A;  3PSI A;  1O57 A;  3LSJ A;  1MDM B;  4NHJ A;  3S3O A;  2EZL A;  1W0U A;  3L2U A;  3E7L A;  2DDA A;  3BTI A;  2K02 A;  2UWM A;  1BI0 A;  2DCE A;  1ONP A;  5M5W J;  2H6B A;  4HF2 A;  4II2 A;  3IRQ A;  2VIX A;  1V5F A;  4E7H A;  1KU9 A;  2VBX A;  2JRT A;  3SFZ A;  4ZQG A;  2HPO A;  3C18 A;  1TW3 A;  3BT9 A;  3TOA A;  3V7S A;  5L3G A;  2M8G X;  2G7U A;  1N75 A;  1Q0L A;  1R71 A;  4RAY A;  1HQC A;  1X3Z A;  3ZMD A;  2R7U A;  2PL5 A;  2J5P A;  3I53 A;  1DPU A;  1X3W B;  4RB0 A;  1TL8 A;  2O61 A;  2VC1 A;  3CQZ J;  2GQQ A;  4Y4R A;  5F08 A;  3KP5 A;  3P9K A;  1T38 A;  5DYM A;  4F3Q A;  5E3M A;  3D1N I;  4K5M A;  2P7V B;  4QME A;  1W5S A;  3AFH A;  2FBI A;  2G9W A;  2FOK A;  2XF5 A;  1O3Q A;  3VFZ A;  5DM6 F;  4L2L A;  3QU6 A;  2BXZ A;  1K83 J;  5DEQ A;  1RIO H;  1IRG A;  3GTQ J;  3U9G A;  5M3F J;  1MMN A;  2WV0 A;  3K1P A;  1B9N A;  4I0A A;  3B6C A;  5A2Q K;  2DMU A;  3FK7 A;  3SEZ A;  3FHZ A;  4LG0 B;  1E0E A;  1MIJ A;  1YS6 A;  2HVR A;  1VFC A;  2JD2 A;  1Z9C A;  2KLO A;  4IL6 C;  4BGD A;  1P7I A;  3OSF A;  4XNA A;  4PJN A;  4Y15 A;  2F6C A;  4RAZ A;  5HOO A;  3RC8 A;  5E1W A;  2ZXI A;  2OA4 A;  2M34 A;  3HL2 A;  4U0W A;  4W1U A;  4CUG A;  4HDU A;  2JJ7 A;  3G3Z A;  4XBF A;  2QGU A;  1I6X A;  3VEP A;  5HDN A;  1LJ9 A;  4E7J A;  3DBH B;  2CW7 A;  2HNH A;  1UMQ A;  2KP6 A;  3RIR A;  4RM2 A;  1WWX A;  3ZQQ A;  2E19 A;  1ZG3 A;  1XSX A;  2DA3 A;  2OTL I;  1LEB A;  1Z21 A;  4FIS A;  3FU0 A;  3B37 A;  2EFW A;  1S7E A;  2DYS H;  1WPK A;  3G73 A;  1EKE A;  3QPT A;  3I4M J;  1LFP A;  2JCY A;  3L1P A;  3C3W A;  2NVX J;  1K6Y A;  4L5E A;  1TP4 A;  5F0C A;  2MH9 A;  4NDL A;  3T8T A;  3H36 A;  4R5T A;  2VLA A;  3BJA A;  2EIK H;  3KET A;  1FYK A;  3ZP5 A;  3WE2 A;  2JA7 J;  1ETO A;  4BQQ A;  4XKB A;  1EA3 A;  4KMF A;  3W2A A;  4YFK F;  5DUI A;  1OYY A;  1SFO J;  1ZHF A;  3GUD A;  2M7A A;  1I6H J;  5FKO A;  5IT3 A;  2W48 A;  2D1H A;  2DA7 A;  1GXP A;  1SFU A;  2PEX A;  1UST A;  2XDV A;  4BJ5 C;  3Q43 A;  1FC3 A;  1QGP A;  3QP6 A;  4DYR A;  3SZT A;  5K1Y A;  3CP8 A;  3FIW A;  3LA2 A;  3AU8 A;  1XMK A;  2RV8 A;  3JSO A;  2CV1 A;  1WFX A;  5F6F A;  5FJ8 J;  2XPY A;  2WAQ A;  3HGG A;  2LG4 A;  5DLL A;  2QBY B;  3LSM A;  3TED A;  3CC4 I;  3CXB A;  4XMZ A;  1WVR A;  5GAE J;  1A5J A;  4XM3 A;  3A03 A;  1ETK A;  4TV7 A;  1B9M A;  2BVL A;  2K9L A;  2R7X A;  3T5X A;  2IXS A;  1QHH D;  1VF9 A;  2V26 A;  3LWF A;  3CCS I;  5AON A;  1EV7 A;  3EUH A;  1S5L C;  3H0G J;  5ED4 A;  2VI6 A;  3LA3 A;  1VQO I;  3AL0 C;  2RGV A;  3GVA A;  3E1S A;  1UHS A;  5D6F A;  2JA6 J;  4BS9 A;  4LIV A;  3FXQ A;  1IDY A;  2W85 A;  2R7W A;  1VQK I;  4BEH A;  1BL0 A;  2HDD A;  3WQS B;  3CMY A;  3O6B B;  4DYC A;  1G3S A;  5CLS A;  2XAH A;  3OOP A;  2LP0 A;  2A69 F;  3JRE A;  4ZX3 A;  4F93 B;  5C4J J;  1PP7 U;  2HOS A;  3I55 I;  5F0F A;  2DMQ A;  2K40 A;  1WJC A;  2HQA A;  3ERM A;  1GDT A;  3W6V A;  5JMW A;  3JCU C;  5F64 A;  4E7L A;  1P4X A;  4ZQT A;  1YQA A;  3GXO A;  3HRM A;  2RDP A;  1DP7 P;  3DKY A;  2CGP A;  3LA7 A;  1YJW I;  2VJJ A;  4RLQ A;  2L9N A;  1H89 C;  1JTY A;  4ZJZ A;  1JKP C;  1QO0 D;  3IKT A;  4J01 A;  1ACI A;  4HNV A;  3EYI A;  3Q44 A;  3DPL C;  3M8F A;  3T8R A;  2E1C A;  2FE3 A;  4F52 A;  1HBX G;  2WY7 Q;  1R1T A;  4KP7 A;  3OYF A;  4CCN A;  2P5L C;  4GCV A;  1IXS B;  1MW0 A;  1G4D A;  1X1D A;  1E3P A;  4ENK A;  1G3W A;  1GHC A;  2M4K A;  3HIF A;  1FEX A;  4OOE A;  1EJ9 A;  5GAH J;  5CQG A;  4OIN F;  3EBG A;  4JP0 A;  3M07 A;  1OPC A;  4RA2 A;  1TNS A;  2PN6 A;  4DZP A;  2CRG A;  4HX7 A;  5ILU A;  4HX8 A;  2HPT A;  4XKW A;  3IV5 A;  2CUE A;  4MFD A;  3ZMS A;  5K5R A;  3RC3 A;  4HLY A;  1XMX A;  2YU3 A;  1VQM I;  3WG7 H;  2ZCW A;  1T56 A;  4BY7 J;  3TW7 A;  2PMZ N;  2NVQ J;  3KED A;  3T1B A;  1V5G A;  2ZXH A;  4RSY A;  3QP5 A;  1YYV A;  3ELK A;  1IXR C;  1J5Y A;  2D45 A;  5M3M J;  3BTC A;  5CPR B;  3RKQ A;  1UCR A;  5KK1 A;  1T95 A;  2BBY A;  3S17 J;  3OR2 C;  2MAP A;  1LUJ B;  3IWZ A;  3JRG A;  1Z05 A;  1T0F C;  4RGS A;  5LLQ A;  1XSD A;  2PLY A;  1MZB A;  5B1B H;  5BPP A;  2DXI A;  2X4H A;  4BU2 A;  2MBF A;  2CQK A;  2KMU A;  2M0C A;  1I50 J;  2NOJ B;  4BDY A;  5EZG A;  2QSH X;  5DTD A;  1NHA A;  1OCC H;  1VZ0 A;  5JFR A;  3B2X A;  2D2W A;  2FNP A;  4YII A;  2QJ1 A;  1W5T A;  3KEY A;  3CCJ I;  1SEU A;  2VKV A;  2FD5 A;  4KIG A;  1Q0Q A;  3TKY A;  4OWR B;  3OS2 A;  3HZJ A;  3UEQ A;  5IYB J;  3GTM J;  2E60 A;  1R9T J;  5CVV A;  4YEL A;  1IRZ A;  4OAZ A;  4ON0 A;  5K5O A;  2YR2 A;  2HR3 A;  3HG9 A;  2M2E A;  3RPU D;  4U88 A;  3LSK A;  3QJX A;  4EQQ A;  2IA1 A;  2O3F A;  1Z67 A;  4ZW7 A;  5ICG A;  1R4M B;  3R0J A;  2JMW A;  1TT0 A;  5B5E C;  2WA0 A;  1S7A A;  2BEO A;  3OL3 A;  4E70 A;  2O5R A;  2V9V A;  3DCF A;  1DDN A;  1PDN C;  1PUE E;  2HXI A;  4NQW B;  3EBI A;  3I4N J;  3BZC A;  3JSZ A;  2MC4 A;  2RVC A;  4QTR A;  3FTV A;  2CW8 A;  2VKH A;  1XGS A;  1MSF C;  1ZQ3 P;  2XRN A;  1X2M A;  2YX4 A;  3JRD A;  2VE8 A;  5FWQ A;  2QBY A;  1ETX A;  3HDD A;  5GPC A;  2V4J C;  3VOE A;  4M6V A;  1IN6 A;  2DT5 A;  3ZXS A;  3S3M A;  4EM2 A;  2EV6 A;  3F8F A;  5EV7 A;  1QU3 A;  1ODD A;  4AM3 A;  2F48 A;  2HOE A;  2V7F A;  4UB8 C;  2GWR A;  4AIJ A;  4B8X A;  2P4W A;  3ECO A;  1LDD A;  3H92 A;  5F27 A;  2EJR A;  1FOK A;  3RQ4 A;  1KU2 A;  4S04 A;  3CUQ C;  4LOC A;  4XMV A;  1WI9 A;  2V1X A;  3VWB A;  3BCB A;  1JUS A;  1YIO A;  3QYB A;  1ETY A;  3M8E A;  3P7N A;  1OCO H;  3OS0 A;  4CGZ A;  2HFH A;  1USS A;  2WAE A;  2TCT A;  1A36 A;  3LMM A;  1TWG J;  3WTW C;  3LFU A;  4XID A;  1Z7U A;  1AKH B;  4XN1 A;  1KU3 A;  1XS9 A;  3BTJ A;  4H4K C;  2EFO A;  4FQG A;  1A6Q A;  1ZRE A;  2QQ9 A;  4ZW3 A;  1LEA A;  1JG9 A;  4YIF A;  2PMZ A;  4ZYG A;  3H9G A;  4QPQ A;  3E6D A;  3HRU A;  3HUG A;  3DXJ F;  5EDN A;  2H8R A;  3A14 A;  3W3C A;  2ZXG A;  4D0P A;  2VOP A;  2E71 A;  5GAG J;  2R7Q A;  3MZH A;  2LY1 A;  3J7A Y;  4CIC A;  4UB6 C;  1R1V A;  3J80 Z;  1FTZ A;  3DTE A;  2E34 A;  1B72 A;  1R22 A;  2EK5 A;  4Q4I A;  4BL0 B;  5FLX Z;  1RR8 C;  2OV7 A;  2R7F A;  4QHP A;  4KYW A;  2RAE A;  3A02 A;  3HSF A;  3DBL B;  2VQH A;  4P96 A;  2LTP A;  1DU6 A;  5B1A H;  2LFB A;  3K4B A;  1WCM J;  3CJQ B;  4XRM A;  2O0Y A;  4E7S A;  2QEX I;  1TW2 A;  2RQP A;  1V3F A;  2BV6 A;  4PGH A;  1IW7 F;  2XAG A;  4KUM A;  2JT1 A;  1H9G A;  5FRM A;  3BPX A;  3R61 A;  4E4H A;  3A0H C;  3M1E A;  1X2N A;  4FCY A;  2VJ8 A;  5LEJ A;  1FOY A;  4U7B A;  3R4K A;  2V1N A;  4I02 A;  1AWC A;  1F9N A;  1WHU A;  2ZJ2 A;  2DOD A;  3QOE A;  5K7F A;  3PFI A;  1K61 A;  5D8K B;  1W7P D;  2HTJ A;  4XL9 A;  1O7F A;  1J59 A;  2JD0 A;  5C4X J;  4RAG A;  2CG4 A;  2HWV A;  2I8D A;  2AS5 F;  4G7H F;  2XV4 S;  4C2M J;  1QPM A;  2CQQ A;  2DLL A;  2XGC A;  4KIT B;  4PJJ A;  3CUQ B;  2O7G A;  1K4T A;  1ZRC A;  3A01 A;  2EIJ H;  2DTR A;  2K3F A;  2Y0M A;  3KYC B;  4EJO A;  4GFB A;  1VQP I;  3HHH A;  3V8K A;  1S7O A;  2XGE A;  5JHU A;  1J9I A;  3ZQI A;  4WK8 F;  4B48 A;  2Z16 A;  1IJW C;  4GO1 A;  5KVR A;  1WH7 A;  1IN7 A;  3O8H A;  2BGC A;  2Q1Z B;  4A3F J;  3R60 A;  2XIG A;  4A03 A;  2HXO A;  2AO9 A;  2XF6 A;  4Y52 J;  2CQN A;  3ESW B;  2DPU A;  3GFL A;  1BR4 A;  4GAE A;  3GZ5 A;  3C7J A;  2JK3 A;  4KFC A;  1FNN A;  3E5U A;  3GCM A;  3G4S I;  2NVU B;  1CF7 B;  2OUM A;  4FE7 A;  1MMA A;  5EG0 B;  3AAF A;  2FFL A;  3CHO A;  4LLG F;  2E36 A;  1FYM A;  2COB A;  1KON A;  4PDK A;  2XVC A;  5DDG A;  2PMH A;  3NRV A;  2MAO A;  3WHB A;  3OL4 A;  2PJR B;  5HDK A;  4Q48 A;  3TBI A;  2XQ0 A;  2OU2 A;  3QPH A;  2R93 J;  3HRS A;  1E3H A;  1LPQ A;  1LDJ A;  2EFN A;  4IX7 A;  1ZGA A;  3BR0 A;  1I27 A;  3E97 A;  3HOW J;  3ULQ B;  2NVY J;  1LNW A;  1RKT A;  2DQL A;  3BR1 A;  4ESF A;  3L2R A;  2NVT J;  1MBG A;  4HW0 A;  1SD6 A;  3ROU A;  2JCX A;  1A6I A;  3PFY A;  4XLN F;  3RYR A;  4BHB A;  3GF2 A;  2DA1 A;  3I9V 2;  1ONN A;  3WTY C;  4AR1 A;  4LUP A;  4RAF A;  2KT0 A;  3JRH A;  1X1C A;  5FFZ A;  2E1N A;  5HS8 A;  1E2X A;  3ZMZ A;  4AVP A;  4E6K G;  5E20 A;  3HBL A;  4ZTF A;  3TDZ C;  3CTA A;  3F3X A;  3HHG A;  3KEQ A;  2CSO A;  2DBB A;  1JT0 A;  2QCO A;  3CMM A;  2VXZ A;  4EJT A;  1ZR2 A;  3MQ0 A;  5M5Y J;  1Q1V A;  3SEQ A;  1BR2 A;  3K9T A;  4IRI A;  2JA2 A;  3KP4 A;  1IZ1 A;  1JJ6 C;  3WGG A;  5CVR A;  4EJU A;  4MTE A;  4U7D A;  1HLV A;  1ONO A;  5J8F A;  4PU2 A;  1TLH B;  1R7J A;  2BYV E;  2DTZ A;  4EJW A;  1W5C C;  4LK1 F;  2ZJP F;  2E1M C;  2V9P A;  3I64 A;  4HYE A;  1A35 A;  2IS6 A;  4V2F A;  5F1J A;  2GA2 A;  2QQA A;  2P8T A;  3GLX A;  3TP3 A;  3CCQ I;  4ZTJ A;  3VOD A;  1OCT C;  2XAF A;  3REO A;  3B7T A;  2A61 A;  2FQ4 A;  3T0Y A;  2HDW A;  2IPQ X;  5ICF A;  1DQU A;  1S29 A;  1YJN I;  2STT A;  3B3B A;  1O7L A;  4PFO A;  1BIB A;  4I98 B;  4OIQ F;  2PQ8 A;  3MAJ A;  5J40 A;  3S2W A;  3L2C A;  2CU7 A;  4PK4 A;  2IAI A;  2VON A;  2EIN H;  4R79 A;  5GP9 A;  3V8J A;  4A3D J;  2VJ5 A;  2KRF A;  3IH3 A;  4B3X A;  3HRT A;  3K2A A;  5HOD A;  3I59 B;  1O3S A;  2IS1 A;  2WB1 N;  2R70 A;  4DZJ A;  2MYS A;  2O6G E;  3RKX A;  2F5D A;  5LGU A;  4BBS J;  2W82 A;  2A6E F;  2C6Y A;  3HSE A;  1Z0X A;  2K4B A;  3FHN A;  4M3B A;  2BHZ A;  3BG5 A;  1WJD A;  3FU5 A;  1H88 C;  2Q0O A;  3M8J A;  2KDZ A;  3AG3 H;  4M6X A;  1MD0 A;  1JE8 A;  3VYR B;  2HOT A;  4L0Z B;  2DJN A;  2XKO A;  4CZC A;  4J19 A;  3ASN H;  4B09 A;  5D4S A;  5J8C A;  3L2W A;  3GYH X;  4XOP A;  5DCF A;  2L0K A;  3A01 B;  1FWZ A;  2IP2 A;  2DQM A;  4XMW A;  1ZAO A;  3RJP A;  1VI0 A;  3LOC A;  4EVI A;  2QSF X;  4M9S A;  4PJL A;  3WU2 C;  2P5K A;  2W1O A;  3RPU A;  3NEU A;  1GW6 A;  3WHC A;  5D6E A;  3OYI A;  1XGN A;  4JX6 A;  4UUS A;  4ZW5 A;  2VC0 A;  2A3S A;  4CYD A;  2WPG A;  3IRR A;  1JHH A;  2NOG A;  1J7K A;  2W4S A;  4G7O F;  4FLR A;  3ZN1 A;  2Z9O A;  1U9O A;  2ACJ A;  4L0Y B;  2ZSI B;  1U8R A;  1W36 D;  3CC2 I;  2YPR A;  2EZH A;  2NNN A;  4L9T A;  3F6O A;  1Z7L A;  1ZLJ A;  5JC1 A;  1XGM A;  2R7Z J;  4S0H B;  2GXA A;  4OOI A;  3JR9 A;  2EBI A;  4ZH4 F;  3RKY A;  1K6O A;  3QYE A;  1AHD P;  1WI3 A;  2X1C A;  5FD5 A;  1D1C A;  1PYV A;  4L9J A;  4DOZ A;  3CCR I;  4LK0 F;  3UNG C;  3FMR A;  3CMA I;  3B7S A;  2HEO A;  3OYB A;  2DFH A;  2EQR A;  5LHG A;  4JX5 A;  4UUT A;  2R72 A;  4ESB A;  3S2D J;  3GFJ A;  3HSR A;  1VQ8 I;  3FXL A;  1F1Z A;  4KT6 A;  1P4W A;  2P81 A;  4HQE A;  4XKC A;  5HDG A;  4NC8 A;  2STW A;  4OU0 A;  3MKZ A;  4M72 A;  1P6R A;  2BVM A;  3S8P A;  3JAM K;  3DBR B;  3P9C A;  1VQ6 I;  1UFM A;  4DNC A;  2XRL A;  1MDM A;  1DP3 A;  3MD2 A;  5AIP A;  3AL0 B;  3ZI0 A;  5F1R A;  2OCE A;  3CZG A;  1G8X A;  5CQE A;  2YS9 A;  3OMY A;  3IHU A;  3TO9 A;  2CV2 A;  2GXB A;  4HOB A;  5E17 F;  2LF7 A;  2ME0 A;  5K7H A;  1HCR A;  2IRF G;  2CS3 A;  1HDD C;  4EEF G;  2ME6 A;  2P6T A;  2ZNY A;  5J1U A;  4BQN A;  1N77 A;  4XN3 A;  1YRN B;  3K0L A;  3DKW A;  2ZME A;  4JK1 X;  2MGQ A;  5FLM J;  3CJT B;  3KZY A;  2L02 A;  3JRF A;  2ELH A;  3FBI B;  4XLC A;  2IVM A;  3DP7 A;  3I59 A;  3F72 A;  4QPE A;  2M9H A;  3TO6 A;  3HJE A;  3EUH C;  5CVI A;  3D5L A;  4M9Z A;  1CGP A;  3H35 A;  2Y1C A;  2KJB A;  1QZE A;  1AA7 A;  4DBR A;  2FA5 A;  3TGN A;  4E7K A;  3DLA A;  2OZU A;  1BOA A;  4Q4E A;  3QQA A;  3F22 A;  5BPD A;  4GYI A;  4W97 A;  4ENN A;  2EFQ A;  5LGN A;  2Y1D A;  5LHI A;  3HKZ A;  2YSR A;  2CW0 F;  2TDX A;  1R36 A;  3CHR A;  1HW1 A;  2RJI A;  3HOV J;  3F21 A;  4YFN F;  1IV8 A;  2R92 J;  3PO2 J;  2FX0 A;  4OIP F;  4EMS A;  1D5V A;  3MWM A;  1KQ9 A;  1RI7 A;  3C2H A;  3E6C C;  3TQN A;  1Y56 A;  2E5Z A;  2Z99 A;  5K7Z A;  5EEA A;  3N05 A;  1Z1D A;  3KE2 A;  3CHP A;  2ZME B;  3ZCO A;  4DPR A;  3ABM H;  4CCJ A;  1O3R A;  5K5Q A;  4GAA A;  4XSZ F;  2ID3 A;  2LKX A;  3FTW A;  1W7P B;  1KGS A;  3VDX A;  2EFP A;  1XC5 A;  1K78 A;  2P7C B;  1MH3 A;  3ZHX A;  3FUN A;  4LG3 A;  4RVB A;  1QQI A;  1H0M A;  3GWZ A;  2MSY A;  1VND A;  2CQ7 A;  2ISY A;  3C2G A;  4NC6 A;  3RPQ A;  3CCE I;  5LEK A;  3B7U X;  3G1M A;  3I4P A;  1PJR A;  1TT5 B;  1LB2 A;  4BXX J;  2DW4 A;  2IA0 A;  2CUZ A;  2LVS A;  1YO5 C;  2XPU A;  3K1N A;  5CJ9 A;  5J3L A;  1JJ8 C;  1XCV A;  4IPA A;  3FTZ A;  3V42 A;  2O8X A;  3KZZ A;  1JXS A;  4FT8 A;  3PIP F;  1B4A A;  1FIP A;  2GOX B;  2YUS A;  1FLI A;  1Y0N A;  2P6S A;  5FLV A;  2XSD C;  3IP4 B;  1K5H A;  2LRE A;  1JHF A;  2Y9Y A;  4ASN A;  2GA1 A;  4IRG A;  4AR8 A;  3CME I;  4Y3O A;  1RRJ A;  1YW7 A;  3CCL I;  4PFP A;  1QHG A;  3ZHZ A;  2HQ5 A;  2HYJ A;  3ERE D;  2L9R A;  2NXN B;  4KN4 X;  1T2K A;  1IV6 A;  2IGO A;  2Y30 A;  4ZDL A;  3S3N A;  1ENH A;  3GW2 A;  4PVB A;  3S32 A;  1Q0H A;  2M3A A;  3WE3 A;  2Y0S A;  3MZY A;  2F2E A;  4QSH A;  1IDZ A;  2K3P A;  4R5V A;  1HDP A;  2DA2 A;  1Y8Q B;  5AEN A;  3PSF A;  2IGN A;  6PAX A;  2ZJR F;  2KPM A;  2RC4 A;  1HOM A;  2DFI A;  3DU5 A;  3FUE A;  3JT1 A;  3ZQH A;  4ETS A;  1SVO A;  2EIL H;  4A3E J;  1L3L A;  2L5Q A;  1MMS A;  1HSJ A;  5DYF A;  4XND A;  4DYQ A;  4FLO A;  3I0T A;  3BY6 A;  2ETH A;  2K9M A;  3Q9S A;  4I0B A;  5JLX A;  5E3O A;  3HOY J;  1RKW A;  3Q0W A;  3GZ6 A;  3MKW B;  1P9Q C;  2DU9 A;  2A07 F;  1D3Y A;  2VJI A;  4KMU X;  3PJR A;  2VL8 A;  2JUC A;  2EV5 A;  2LY9 A;  2QLZ A;  2ZFW A;  1R00 A;  4Y6P A;  4D1Q A;  2RNJ A;  1UZC A;  4M71 A;  1RUO A;  3CLO A;  4IHX A;  1D0Z A;  4CDG A;  4R5X A;  4BXF A;  1I1G A;  2JSC A;  1FBU A;  5BMZ A;  3BR2 A;  5HNF A;  3LSH A;  1P4A A;  1OFC X;  2F4I A;  2FQ3 A;  2JCV A;  2JPC A;  3BG3 A;  5L3F A;  3TOB A;  1ITY A;  3FH7 A;  3WG9 A;  4K5L A;  3QAH A;  1EF4 A;  3F8B A;  2DO7 A;  1YI2 I;  3S1Q J;  1IUY A;  4BDZ A;  1BJA A;  1I3A A;  1XDU A;  4XN0 A;  2V9K A;  3GFI A;  1HS6 A;  3DV8 A;  3WOD F;  1Y1W J;  4HX4 A;  1SMT A;  4GRI A;  2LBF A;  3ZMT A;  4OOF A;  2R5Y B;  4FHT A;  3KEO A;  2IEK A;  4ZYE A;  3RDI A;  4B43 A;  1VQ5 I;  3KLO A;  1YTY A;  5B3S H;  5HVQ C;  3WTX C;  2B9S A;  1JI8 A;  2E1O A;  2ADU A;  3BCA A;  4EM1 A;  3COA C;  3IUO A;  2HQN A;  3M1C A;  4EM0 B;  4A5M A;  4DW6 A;  4CCK A;  1HKQ A;  5LRS A;  1SD4 A;  4IZZ A;  3H9Q A;  3CZ6 A;  2H27 A;  1RET A;  4G8X A;  3G2B A;  2Z3Y A;  3A2K A;  1MW7 A;  4AC0 A;  3HW2 A;  1A04 A;  3OYJ A;  2CUJ A;  4XK4 A;  3ONQ A;  5DM7 F;  3K4L A;  3GEZ A;  1ORK A;  3KLN A;  4KIS A;  2R7O A;  2O7O A;  2M0M A;  4Y33 A;  4BE1 A;  3NWT A;  3BJ6 A;  3PUU A;  3LSI A;  2W7N A;  3CZL A;  4EGY A;  4BHP A;  2HGC A;  4IRH A;  4B47 A;  2P5V A;  2UZK A;  1EH7 A;  4IKF A;  2ECB A;  1XSV A;  4BY1 J;  4YEJ A;  5GPA A;  2HTS A;  3KP6 A;  4ZX5 A;  1IN8 A;  2H1L A;  4WCG A;  1TWH J;  5EF6 A;  2QKM B;  3L2Q A;  2X6Y A;  2BY2 A;  2X6W A;  3BOQ A;  4BQA A;  2LKP A;  3FKI J;  2TRT A;  3I71 A;  3O3K A;  1MMD A;  3ECH A;  4N4N B;  3H3Z A;  1VQN I;  2OAZ A;  2K5C A;  3A4C A;  4M3F A;  5LRR A;  5LHH A;  2HQR A;  4MTD A;  3CLQ A;  2Y75 A;  2COM A;  2DOA A;  2HS5 A;  3K69 A;  2XSJ C;  1XD7 A;  3ZMU A;  4BJT A;  1DGR M;  2LH9 A;  3IKV A;  5GTH C;  4OMY A;  4A3K J;  4CCL A;  4C2T A;  5JI6 A;  5FFX A;  2OPT A;  2M8E A;  3ZMV A;  1JKQ C;  4Q5S F;  3DPU A;  5FKK A;  1I5Z A;  2MW8 A;  4K2E A;  2ICW G;  3CCU I;  1RNL A;  3B2P A;  3GX4 X;  4UUS B;  1RR7 A;  2E2I J;  3DU6 A;  4K5N A;  3IAS 2;  2CYY A;  4ENJ A;  3W6J B;  3WQQ A;  1ZRF A;  3CHQ A;  1N25 A;  4L18 B;  3FU3 A;  2EIM H;  1ZRD A;  4MS6 A;  1K79 A;  3LQQ A;  1SMY F;  2VXD A;  3K4M A;  3ZR8 X;  1MNE A;  2VB6 A;  4UV9 A;  5FRO A;  2O9L A;  3FTY A;  2XAU A;  4IQ4 A;  3IL2 A;  2ZNZ A;  5IT9 K;  1X3Z B;  1YHQ I;  2F4M B;  1VTN C;  3V8L A;  4C30 A;  2A05 A;  2AQE A;  3FUL A;  1X19 A;  4C3J J;  2KIM A;  2JQ7 A;  4ZYA A;  3CP2 A;  1BI1 A;  4JBA A;  3CES A;  3R6S A;  5ILS A;  1H3L A;  2L54 A;  1R4N B;  2IGK A;  3QWL A;  5EG0 A;  2ESH A;  2M5W A;  4UV8 A;  4P9U A;  3I56 I;  1SG7 A;  3L2V A;  4JQF A;  1SVM A;  2X6O A;  2LK2 A;  1JGG A;  4HLX A;  2JN6 A;  4ZZD A;  4OIO F;  3EBH A;  4P1W A;  3PNY A;  3HYI A;  2W00 A;  4XQF A;  2DI3 A;  1XN7 A;  1D0X A;  3HEF A;  1V4R A;  2LNB A;  2Y48 A;  2VKE A;  3S1R J;  4KDP A;  3OV8 A;  3MCZ A;  1ZTR A;  3U2R A;  4B44 A;  2DT7 B;  4BEH B;  4XLH A;  3Q0V A;  3H5N A;  5L3E A;  4A3C J;  2UV1 A;  4FX0 A;  4IO9 F;  1YX3 A;  3O2P E;  3QYF A;  2DMT A;  2OF7 A;  3HKZ N;  3CO6 C;  4LGW A;  5JBI A;  2MD5 A;  5J1Y A;  5F0H A;  1R1U A;  3F8C A;  3AG1 H;  2C5Z A;  2CJJ A;  4HPQ A;  3FUJ A;  5E79 C;  2O03 A;  3GZN B;  2G0E A;  3H0D A;  1ZAR A;  2JWT A;  3AG2 H;  1U5T C;  1BOB A;  2CWE A;  2L4A A;  4F91 B;  5E3N A;  1H8A C;  2XB0 X;  1BI3 A;  1DUX C;  2VBW A;  2VPR A;  2CO5 A;  1ONV A;  1GXQ A;  2P0W A;  4Q4Z F;  1MVY A;  2EV0 A;  4QUO A;  2QM3 A;  1JUM A;  2NS8 A;  2WY8 Q;  4N9I A;  4CSW A;  3KFW X;  5JVT A;  1QVT A;  2E2H J;  4KIB A;  2EB7 A;  3P5J A;  4XRS A;  3BG7 A;  4E7Z A;  1TQM A;  2K85 A;  4IOA F;  4XLF A;  1X1P A;  3BZ6 A;  2XKP A;  1BW5 A;  3CUO A;  2E7W A;  3LQR A;  3FDY A;  4XKV A;  3HOU J;  2Y31 A;  3EPZ A;  4XN4 A;  4ZZL A;  4ZQF A;  1WJF A;  2L4M A;  2Y69 H;  1IC8 A;  3GTK J;  3AG4 H;  3CC7 I;  2HVQ A;  3M7G A;  4X2U A;  1MMG A;  1SC5 A;  4AWX B;  1VQL I;  3J81 K;  2VQL A;  3BDD A;  3E0J B;  1IRX A;  3CUQ A;  2KFD A;  3G1O A;  2KIS A;  5AIQ A;  3DEE A;  4F92 B;  1WZ2 A;  3FM5 A;  1IRF A;  1LKX A;  1GUU A;  2L2O A;  1W1W E;  4FLQ A;  2DFE A;  1B8I B;  4B4C A;  3KYL A;  1XTA A;  3FF5 A;  4CXF A;  2IT0 A;  4A2U A;  2F5F A;  2JZY A;  1OMI A;  3FIS A;  3MEX A;  3U1D A;  1MSE C;  3UR3 C;  3MKL A;  1K78 B;  1XGO A;  1QRY A;  2HPI A;  4G7Z F;  2NNY A;  3WGI A;  2ELJ A;  5BQT A;  4DBQ A;  2GLO A;  2M30 A;  3EUA A;  2HYG D;  3A0B C;  4JND A;  4XON A;  3HGY A;  5EGO B;  1B72 B;  1HKS A;  1JGI A;  1R5G A;  2VBZ A;  4A6D A;  4ANJ A;  2KIF A;  4BE2 A;  1QBJ A;  3MKY B;  2Y1F A;  1BW6 A;  3VSK A;  4D9J A;  3S93 A;  2JPB A;  3UCQ A;  1VQ4 I;  1B1B A;  2D1V A;  1V54 H;  5FLX K;  2VJ4 A;  2XAJ A;  3QRF F;  4I2O A;  5E3L A;  3ISP A;  5JR3 A;  2LSO A;  1AU7 A;  2ZFU A;  4XR6 A;  2HI3 A;  1UJ8 A;  3SFI A;  2ISZ A;  3WTZ A;  3G6E I;  2M7B A;  2CQX A;  3IWF A;  3TW6 A;  2HDC A;  4MQ9 F;  3VYS B;  5DV5 A;  4X1E A;  4M9X A;  2DMN A;  3KYD B;  2EH3 A;  1JUP A;  2DT6 A;  1GVJ A;  2X48 A;  3PL8 A;  1FTT A;  3W6K B;  4RB2 C;  2VAS A;  3WU1 B;  2FMY A;  3OYD A;  3BG6 A;  4MEX F;  3ASO H;  3J7Y J;  2EA4 A;  1YG2 A;  1ZG1 A;  2CFO A;  3H5R A;  3GTP J;  3BLY A;  1GT0 C;  1FP1 D;  2AQF A;  3NAU A;  3DTK A;  1MW3 A;  2KIQ A;  1PP8 F;  2PI0 A;  4NNJ A;  1BC7 C;  1UHW A;  3FMQ A;  3K7A J;  3A1Y A;  2PFB A;  3CJN A;  2K9S A;  4NQW A;  3CCM I;  1MW1 A;  1MW2 A;  3GTG J;  4V19 K;  4MNU A;  1WJ5 A;  2ZC2 A;  2BY3 A;  3GLL A;  3PUB A;  2R7V A;  4CH7 A;  2GM4 A;  1F5T A;  2H1K A;  2V6C A;  5LBQ A;  1T0F A;  2LDU A;  1HXD A;  4C9Y A;  2FRH A;  4CO8 A;  4DIQ A;  3N97 A;  3ANL A;  2DA5 A;  3KX2 A;  1FPQ A;  2DFF A;  4G6T B;  1KQ8 A;  4KJZ A;  4A3L J;  2PG4 A;  2MH2 A;  2WB1 A;  4XRF A;  2ID6 A;  1FOW A;  3R0I A;  3KCC A;  2L7Z A;  1PUF B;  1APL C;  1D8K A;  4I76 A;  2E1M B;  5CKT A;  1IUF A;  1X58 A;  1Z77 A;  2MC3 A;  1XB4 A;  4WXC A;  5DD8 A;  3RKW A;  4YFX F;  1D8J A;  1BIA A;  3KIO A;  2EZK A;  1FBS A;  5DUL A;  3FKJ A;  5EEG A;  1PUF A;  2FNA A;  3CO7 C;  3I3L A;  2ESN A;  1Y6I A;  4HA8 A;  3BTL A;  1IO2 A;  5D5U B;  2L7K A;  3OIO A;  1ZGW A;  2KKO A;  4L9V A;  2HOA A;  3LAP A;  3Q9V A;  2R7D A;  3A06 A;  5FKN A;  4DGW B;  3K4C A;  3L00 A;  4BE0 A;  2Q2E B;  1ZYR F;  4HDV A;  5CVJ A;  4A3I J;  4RS8 A;  4XLP F;  1T33 A;  2DMP A;  4HQM A;  1ZKG A;  1Z3Y A;  2DPD A;  2H94 A;  2RN7 A;  1BA5 A;  1X4P A;  2EGH A;  1BI2 A;  3AUA A;  2Q2E A;  3DFG A;  1IGN A;  1D1B A;  3JRI A;  1SAU A;  3DEU A;  1S72 I;  1Y8R B;  4AU7 A;  1XDS A;  4PGG A;  4ZW8 A;  4J00 A;  1EH6 A;  1MBJ A;  1R58 A;  2JRM A;  5DUK A;  5HLT A;  3CF5 F;  3BPV A;  4P55 A;  5HS9 A;  2I10 A;  5KAF C;  2PJP A;  5FGM A;  2KHM A;  3C1D A;  3OYH A;  3RTR A;  5TRD A;  1RZ4 A;  1GVD A;  2GXG A;  3FUM A;  2GBY A;  2OCC H;  2VQC A;  3CDI A;  1U5T B;  4ZQE A;  2R7T A;  5TIS C;  1ON1 A;  4KT5 C;  5J6X A;  4ENM A;  2QQ8 A;  4QIW N;  2Q8K A;  1NK2 P;  2A6H F;  1BC8 C;  4UVB A;  5DCM A;  3GTL J;  3MZ8 A;  1DPR A;  2OJE D;  3CZK A;  3HPG A;  4K5P A;  1ULY A;  3OYE A;  2F5V A;  4WXD A;  1MBK A;  4AID A;  2FBH A;  5GAD J;  5EZH A;  3CD6 I;  5L3D A;  5D4R A;  2RNG A;  1RUN A;  5FB2 A;  3RZD J;  1GLN A;  2VPL A;  2FF4 A;  4RDU A;  2L7F P;  3F8M A;  3OS1 A;  3RAS A;  3PIO F;  2XAQ A;  2ZME C;  1WSU A;  1LQ1 A;  4XN5 A;  5H20 A;  3B34 A;  3JRB A;  1BR1 A;  1LFB A;  3K70 C;  3OIQ A;  5F04 A;  1TWF J;  1T6S A;  2JSP A;  3K4N A;  1ETQ A;  1ZS2 A;  2ZBK A;  1YS7 A;  2WAQ N;  3B6A A;  2BW3 A;  3KPH A;  4XMY A;  4XSX F;  4A3M J;  5HLI A;  1S8N A;  1U78 A;  2PUS A;  3BQZ A;  4L5I A;  5L3C A;  3H9J A;  4D5F A;  4M74 A;  3WTU C;  3BR5 A;  1TC3 C;  3HOZ J;  1ZGJ A;  4CA0 A;  1XMA A;  3KP3 A;  4LB6 B;  1OIS A;  4ESJ A;  2LY2 A;  2W84 A;  4FLS A;  3DPT A;  1MJB A;  3FM3 A;  1XG1 A;  3HXL A;  3BWG A;  4UHT A;  3ZQC A;  2L9S A;  4R7L A;  3CCY A;  1B8I A;  2KL4 A;  2MAB A;  3ZRG A;  2R59 A;  1YX5 A;  1OYI A;  4C2U A;  4HEA 2;  5C44 J;  3QU3 A;  1C0W A;  2B0L A;  3K4J A;  2CV0 A;  1MJA A;  2FOW A;  4IHW A;  1ON2 A;  9ANT A;  1SD5 A;  4LB5 A;  3HOS A;  1SFX A;  4F55 A;  4EGZ A;  4AYS A;  2ECC A;  1JGS A;  2AXT C;  2WAD A;  3SZG A;  2QYO A;  2VOO A;  4XIC A;  1OLT A;  3S2H J;  2W24 A;  4BAC A;  3VB2 A;  2K9N A;  4BAY A;  2F5E A;  2HZT A;  2IA2 A;  2N8G A;  1P7J A;  5ERI A;  1K7A A;  4XMU A;  1V5E A;  2B63 J;  3S15 J;  3JTH A;  3SHF A;  3OY9 A;  2IS4 A;  2H6C A;  4A69 C;  4AVZ A;  2O8K A;  3H3V K;  4RCV A;  3OOU A;  1GV2 A;  1XX5 A;  3VYT B;  3B7R L;  3OR1 C;  4AIH A;  4GXO A;  3IC7 A;  1TQI A;  3SDG A;  3I5U A;  5M5X J;  4XO5 A;  1JT6 A;  2K4J A;  2W25 A;  3CDH A;  3FZV A;  1NG7 A;  1SFK A;  4IEJ A;  2YX7 A;  1AOY A;  3H5A A;  3ABL H;  4D5C A;  1OCP A;  3TDU C;  1KU7 A;  1DGW Y;  1YLF A;  4BNC A;  2R0Q C;  4FCA A;  1G3T A;  2JV7 A;  5D5V B;  3EUK L;  4CHU A;  4RGX A;  2OQG A;  4PJ0 C;  2W57 A;  4ITV A;  5LFA A;  3C2B A;  2KDO A;  3JAM Z;  4JYK A;  4EJV A;  4ZYH A;  1OJL A;  3JTG A;  1BBY A;  2IW5 A;  1LFU P;  2X1D A;  1R0L A;  2A7O A;  4NB5 A;  4ZX6 A;  1FX7 A;  2DQ6 A;  4WWC A;  1KYZ A;  3I54 A;  1MBH A;  4NUB A;  5E8G A;  2D5V A;  4BHC A;  4ZYD A;  4LIU A;  2RRE A;  4A3G J;  1FYL A;  2JUG A;  4XMX A;  3J81 Z;  1YW9 A;  2HU9 A;  2KZG A;  3D0S A;  1UG2 A;  3BZK A;  3PNT A;  4G12 A;  3TO7 A;  5KNL A;  3FBN B;  2VBY A;  3L7W A;  2XHK A;  1IN4 A;  2XGD A;  2QVO A;  3GO5 A;  3HOX J;  1U3E M;  1OCR H;  4IHV A;  2GZW A;  5ICC A;  5EGO A;  1U0J A;  2WWY A;  4Q47 A;  1OR7 C;  4A0Y A;  1ZLK A;  1QNT A;  4JX4 A;  1V55 H;  4IVN A;  4X6A J;  3K4K A;  2JA5 J;  3LAJ A;  2QWW A;  4AIC A;  5DCM B;  1QZZ A;  5H2F C;  1GV5 A;  2KRC A;  4KNY A;  2E2J J;  2LR8 A;  1SQM A;  1FBQ A;  1FY7 A;  4BKX A;  2E7X A;  2X0L A;  3KP7 A;  3ZQL A;  1K4S A;  1T1S A;  1OQY A;  2BXY A;  2V1D A;  2VOD A;  4O6J A;  1CQT A;  1P2F A;  1POG A;  3L9F A;  2WTE A;  5A2Q Z;  4KIF A;  2JD1 A;  3TL4 X;  4C3H J;  4DJA A;  1SFE A;  3FUH A;  2MLK A;  3W2W A;  4AIK A;  3T8V A;  2WC2 A;  2CUF A;  2LOO A;  3OYN A;  4RBO A;  2K9Q A;  5BPI A;  2A68 F;  3U21 A;  3S1N J;  2V79 A;  4A5N A;  5BS6 A;  3HTU A;  1X1A A;  3V7C A;  2WZG A;  3ZOB A;  1Y0U A;  4MO7 A;  4CZZ A;  5LGT A;  4HAM A;  3CCV I;  4IJA A;  3ZPL A;  5D5X B;  2QUF A;  2X85 A;  3S1M J;  4JOM A;  2R7R A;  3S14 J;  4I09 A;  4XNB A;  3TMO A;  5JLW A;  5DS9 A;  1T8I A;  4PSW A;  2UXN A;  3QPS A;  2PGG A;  3SJM A;  4R8H A;  1LVA A;  5E1Z B;  4YIR X;  1ZN2 A;  3BP8 A;  3F0C A;  3MN2 A;  4H0E A;  1BM9 A;  2HZD A;  5C3E J;  2A6T A;  3H3U A;  4FX4 A;  2WZF A;  4EV0 A;  1U5T A;  4PUS A;  4Y67 A;  1R5H A;  1TWA J;  4QWQ A;  1S6L A;  2L9V A;  4KIC A;  2EPF A;  1OYW A;  2R7S A;  4PCQ A;  1YRN A;  2NS7 A;  4LLL A;  4A0Z A;  2BY0 A;  5IP9 J;  4OMZ A;  4A6E A;  1STZ A;  1SAN A;  2KQR A;  2L7M P;  3K70 D;  4UXN A;  1W36 C;  4PZJ A;  2I5U A;  3LL7 A;  2M4G A;  3HUG B;  4FET A;  2EWN A;  4ZW6 A;  4YG2 F;  1JKO C;  3ZN0 A;  5E1X A;  4LFU A;  3J7A O;  2ZB9 A;  1WJA A;  2DDB A;  4OIR F;  4AD9 A;  2XPZ A;  1Z3X A;  3PUF A;  3BG9 A;  3QOP A;  4N9H A;  2H8W A;  1EH8 A;  4KA4 A;  3SXY A;  2Y1G A;  4DQ2 A;  3PO3 J;  2FUG 2;  2DK8 A;  3F6V A;  2LMD A;  1KZH A;  1L0O C;  2LKS A;  4CYC A;  3FX3 A;  1SD7 A;  1J75 A;  3Q0U A;  2VUM J;  5FKM A;  4XN9 A;  2CH0 A;  2X6X A;  4O3M A;  4GGG A;  1MBE A;  2CMP A;  3DKX A;  2ZJQ F;  4OAY A;  3CDL A;  2B7E A;  1JKR C;  2IBD A;  2R3S A;  4IOC F;  2X1E A;  4CYC B;  1VQ9 I;  2QQB A;  1G3Y A;  1G6N A;  2FU4 A;  2ZXJ A;  1Y39 A;  1FJL A;  2OBP A;  3ML6 A;  1I39 A;  4RLF A;  1UEL B;  2DA4 A;  1FT9 A;  2OZ6 A;  2UUZ A;  1B59 A;  2VN2 A;  2Y0S N;  2OTJ I;  3K10 A;  3VVL A;  3B02 A;  5JHF A;  3FMS A;  2DN0 A;  2DAO A;  1R23 A;  3FTU A;  1SAX A;  5BNG A;  2LC2 A;  4HBL A;  4C3I J;  4QPO A;  3PNV A;  1ZH5 A;  3JRA A;  4Y6R A;  3CZE A;  2XF7 A;  3FU6 A;  3D5R C;  1UHM A;  3EDP A;  2GIV A;  1S3J A;  2H09 A;  1T39 A;  4L9N A;  1QZY A;  1WQ2 A;  2Z5U A;  4HV5 A;  4CCM A;  3M3Y J;  1D5Y A;  1MKM A;  2GTQ A;  3FH5 A;  4Y17 A;  5IY5 H; 
#chains in the Genus database with same CATH homology
 4FAS D;  4XMT A;  4EAT A;  2Z2S B;  2DQM A;  4XMW A;  2VQL A;  4F92 B;  3E0J B;  1IRX A;  4R5T A;  2VLA A;  3DEE A;  4PJL A;  1LKX A;  2W1O A;  4BJ6 C;  1GW6 A;  2L2O A;  4FLQ A;  3OYI A;  4MLO A;  3KYL A;  4CXF A;  4BQQ A;  4XKB A;  1EA3 A;  4ZW5 A;  3FUK A;  2WPG A;  3UR3 C;  3W2A A;  3U9W A;  4ARF A;  4BUP A;  4FLR A;  2HPI A;  2W4S A;  3DTI A;  2ELJ A;  4DBQ A;  3EUA A;  4JND A;  2ZSI B;  2M7A A;  1W36 D;  1RP3 A;  4XON A;  3CF2 A;  2QKL B;  4ANJ A;  3OYA A;  1N78 A;  4BE2 A;  1Z7L A;  1JGI A;  2Y1F A;  3MKY B;  3UCQ A;  3VSK A;  4D9J A;  5JC1 A;  3S93 A;  3PUU A;  2XDV A;  4BJ5 C;  3Q43 A;  2VJ4 A;  4XN2 A;  3QYE A;  2X1C A;  1D1C A;  1PYV A;  3CP8 A;  4DOZ A;  2ZFU A;  3AU8 A;  3UNG C;  2XPY A;  2CV1 A;  1WFX A;  4XR6 A;  4YRV A;  2XC7 A;  2WAQ A;  3B7S A;  2LG4 A;  5DLL A;  3OYB A;  3LSM A;  2LBF B;  2M7B A;  4XMZ A;  2KZV A;  3VYS B;  4MKT A;  4XM3 A;  2HPM A;  4LIT A;  2R72 A;  2DT6 A;  4RMN A;  4QIR A;  3OYM A;  3PL8 A;  2BVL A;  4KT6 A;  2K9L A;  2R7X A;  2LRD A;  2VAS A;  5KHD A;  4XKC A;  2IXS A;  1QHH D;  3OYD A;  3BG6 A;  4NC8 A;  4J3B A;  1D1A A;  1X4O A;  2V26 A;  3MKZ A;  3W2V A;  2BVM A;  3S8P A;  2CFO A;  3AL0 C;  3H5R A;  3BLY A;  1DP3 A;  3FUF A;  2AQF A;  3E1S A;  3MD2 A;  3AL0 B;  3DTK A;  1MW3 A;  4BS9 A;  4LIV A;  3NWS A;  3ZI0 A;  4E7I A;  4NNJ A;  2B61 A;  2R7W A;  3CZG A;  1G8X A;  3A1Y A;  4BEH A;  1OR7 A;  4NQW A;  3WQS B;  1MW1 A;  5CQE A;  3OMY A;  2CV2 A;  1MW2 A;  4BQO A;  4ZDO A;  4ZX3 A;  2MFZ A;  4HRI A;  4F93 B;  1WJ5 A;  4XLA A;  2CS3 A;  2WBM A;  3PUB A;  3UER A;  2R7V A;  4CH7 A;  4AR9 A;  4XN8 A;  2BW3 B;  1WJC A;  2HQA A;  4BQN A;  1N77 A;  5JMW A;  4C9Y A;  3FTX A;  4DIQ A;  3FUD A;  4XN3 A;  4E7L A;  4ZQT A;  3ANL A;  1X3W A;  4IQJ A;  3KX2 A;  3DKY A;  4G6T B;  3CIA A;  4KJZ A;  2VJJ A;  2WB1 A;  4RLQ A;  2L9N A;  1H19 A;  2GOM A;  4X0G A;  1R0K A;  4ZJZ A;  3FBI B;  2IS2 A;  3WQR A;  4XLC A;  5HNH A;  4J01 A;  3R0I A;  3Q44 A;  3DPL C;  4QPE A;  1JVS A;  4F52 A;  2WY7 Q;  4KP7 A;  3EUH C;  5JO0 A;  3D5L A;  2E1M B;  5CKT A;  3ZHY A;  3H35 A;  3IAM 2;  2Y1C A;  3OYF A;  4CCN A;  2ZSH B;  1MW0 A;  1AA7 A;  1X1D A;  4DBR A;  3DQV C;  1ERD A;  4XO4 A;  4E7K A;  3DLA A;  4Q4E A;  2JVG A;  5DUL A;  2M4K A;  1G59 A;  3FKJ A;  3I3L A;  2DJI A;  4OOE A;  1ZEL A;  4ZN6 A;  5JMP A;  1Y6I A;  5CQG A;  2Y1D A;  3HKZ A;  2L7K A;  3EBG A;  3GBG A;  3AKZ A;  1R6R A;  3CHR A;  2RJI A;  1G5A A;  4P5O A;  5LD2 C;  2HPT A;  4NC7 A;  4XKW A;  4DGW B;  2IGM A;  3K4C A;  3A06 A;  4BE0 A;  2Q2E B;  1UAA A;  3RC3 A;  3C2H A;  2C82 A;  1Y56 A;  2E5Z A;  3VVM A;  5TGT A;  3N05 A;  3CHP A;  3KED A;  4XOT A;  1V5G A;  2ZXH A;  3VYU B;  3ZCO A;  1Z3Y A;  4CCJ A;  4DPR A;  5JAZ A;  4RSY A;  4GAA A;  1X4P A;  2MD0 A;  2EGH A;  3AUA A;  3FUI A;  3FTW A;  1D1B A;  5CPR B;  1SAU A;  1T95 A;  3VDX A;  1MND A;  3OR2 C;  4AU7 A;  2MAP A;  4N4O B;  3ZHX A;  4ZW8 A;  4J00 A;  1T0F C;  4LG3 A;  3FUN A;  4RVB A;  5BPP A;  1D0Y A;  2DXI A;  5HLT A;  4U87 A;  4PJM A;  4BU2 A;  5JNL A;  3C2G A;  2QVW A;  3B7U X;  2KMU A;  2KHM A;  3OYH A;  1SC5 A;  1PJR A;  3RTR A;  5KCM A;  3FUM A;  4Y6S A;  2NOJ B;  4BDY A;  2CUZ A;  2VQC A;  1VZ0 A;  3B2X A;  2R7T A;  4HG2 A;  4ZQE A;  2A5W A;  2QJ1 A;  4ZQH A;  3KEY A;  5FRN A;  3FTZ A;  1Q0Q A;  3OWT A;  3V42 A;  3FTS A;  4OWR B;  3OS2 A;  3UEQ A;  2GOX B;  2E60 A;  3CZK A;  3HPG A;  3AU9 A;  4YEL A;  4K5P A;  4OAZ A;  2KRH A;  3HG9 A;  3OYE A;  2F5V A;  3RPU D;  3IP4 B;  3LSK A;  1K5H A;  2LRE A;  3QJX A;  4AR8 A;  4ZW7 A;  1LDK B;  4Y3O A;  2RNG A;  3SDB A;  1TT0 A;  4PFP A;  1QHG A;  1GLN A;  2WA0 A;  1J09 A;  1S9H A;  2O5R A;  3OL3 A;  2VPL A;  3ZHZ A;  4PSX A;  4NQW B;  3OS1 A;  3EBI A;  3JSZ A;  2MC4 A;  3FTV A;  3RAS A;  2CW8 A;  2VKH A;  2IGO A;  3K6G A;  4XN5 A;  4ZDL A;  3S3N A;  3B34 A;  1BR1 A;  2JVH A;  5FWQ A;  3K70 C;  4PVB A;  2V4J C;  3OIQ A;  3S32 A;  4ZX4 A;  3ZXS A;  1Q0H A;  2M3A A;  3S3M A;  5EV7 A;  2Y0S A;  3HPH A;  3SYT A;  2JSP A;  1QU3 A;  3OYC A;  3K4N A;  2K3P A;  1ZS2 A;  2V7F A;  4R5V A;  2BW3 A;  5AEN A;  4XMY A;  1FMW A;  3PSF A;  2PUS A;  2IGN A;  3CJR B;  3H9J A;  2KPM A;  3RQ4 A;  1LVK A;  3DU5 A;  3FUE A;  3JT1 A;  4XMV A;  3VWB A;  2L5Q A;  3BCB A;  4CA0 A;  5DYF A;  3QYB A;  2RQQ A;  4XOR A;  4XND A;  4FLO A;  3OS0 A;  2LY2 A;  2K9M A;  2WAE A;  3DPT A;  4FLS A;  3LMM A;  2Z1D A;  2PJR A;  3LFU A;  2R4G A;  3HXL A;  1P9Q C;  3MKW B;  4XN1 A;  2L9S A;  4R7L A;  2VJI A;  4H4K C;  2Y1E A;  2WAF A;  2KL4 A;  3PJR A;  2MAB A;  2VL8 A;  3ZRG A;  1JG9 A;  4ZW3 A;  4XNF A;  1YX5 A;  2VQG A;  2R59 A;  2PMZ A;  4Y6P A;  3H9G A;  4HEA 2;  4QPQ A;  4II3 A;  4ZDP A;  4D1Q A;  4C2U A;  3A14 A;  2ZXG A;  3W3C A;  4Y6R A;  4CCO A;  1D0Z A;  3K4J A;  2CV0 A;  3J7A Y;  2R7Q A;  2LY1 A;  3ZGK A;  4R5X A;  4BXF A;  3DTE A;  2VKD A;  4F55 A;  5HNF A;  3LSH A;  3HOS A;  4Q4I A;  4AYS A;  3DWL E;  2F4I A;  3FHE A;  2JCV A;  1NG6 A;  4AYB A;  2WAD A;  3SZG A;  3HOT A;  4BL0 B;  3FH7 A;  2OV7 A;  1OLT A;  4K5L A;  4QHP A;  4BAC A;  4BDZ A;  2VQH A;  3K4B A;  2V9K A;  4XN0 A;  1HA8 A;  3LSG A;  3OIP A;  4HNT A;  1HS6 A;  3CJQ B;  3BC8 A;  2V6E A;  4E7S A;  4GRI A;  3ANN A;  3MMY B;  4XMU A;  1V5E A;  2LBF A;  4OOF A;  3OY9 A;  2IS4 A;  4AVZ A;  3IIE A;  4B43 A;  1WJB A;  5FRM A;  4RCV A;  3OOU A;  4E4H A;  5HVQ C;  3VYT B;  2LYC A;  1JI8 A;  3BCA A;  3B7R L;  3OYL A;  3HC7 A;  3IUO A;  3M1C A;  4HST A;  3OR1 C;  2VJ8 A;  4K5O A;  4CCK A;  1X1B A;  4IZZ A;  3H9Q A;  3CZ6 A;  4U7B A;  2V1N A;  3G2B A;  2HVS A;  3A2K A;  1UG0 A;  4XO5 A;  1MW7 A;  3QOE A;  1NG7 A;  1SFK A;  3H5A A;  3OYJ A;  2CUJ A;  4XL9 A;  1DGW Y;  2JD0 A;  3ONQ A;  4FCA A;  2JV7 A;  3EUK L;  1YE9 A;  3K4L A;  2I8D A;  4KIS A;  4XO3 A;  2R7O A;  4XLE A;  2X51 A;  4ITV A;  5LFA A;  4XN7 A;  2KDO A;  2M0M A;  4Y33 A;  1TZL A;  3NWT A;  3RCO A;  4BE1 A;  4KIT B;  3D5S C;  4PJJ A;  3LSI A;  2X1D A;  2W7N A;  1R0L A;  1S46 A;  3VSL A;  2A7O A;  2O7G A;  2DQ6 A;  3CZL A;  4B47 A;  2BOL A;  4HSR A;  4NUB A;  4IKF A;  2OC6 A;  4LIU A;  4YEJ A;  2RRE A;  3OYG A;  4ZX5 A;  4XMX A;  2JUG A;  2HU9 A;  2QKM B;  2E5N A;  3PNT A;  2X6Y A;  3L2Q A;  2X6W A;  4B48 A;  1FMV A;  2Z16 A;  3FBN B;  5KNL A;  1MMD A;  4N4N B;  3F9K A;  1U0J A;  2K5C A;  2Q1Z B;  3A4C A;  3FH8 A;  3QOD A;  1OR7 C;  4A03 A;  2XF6 A;  2DOA A;  3K4K A;  3CHS A;  1BR4 A;  4GAE A;  4AIC A;  2XSJ C;  2KRC A;  4BJT A;  1DGR M;  2LH9 A;  3RSN A;  4PW4 A;  1SQM A;  4CCL A;  4C2T A;  1T1S A;  4BKX A;  2OUM A;  3ANM A;  1MMA A;  4HNU A;  2FFL A;  3DPU A;  3CHO A;  1WJE A;  4RM3 A;  3OYK A;  1T1R A;  3B2P A;  2JD1 A;  3TL4 X;  1KON A;  4DJA A;  3DU6 A;  4K5N A;  3FUH A;  3IAS 2;  3W2W A;  3T8V A;  3WQQ A;  4ZC3 A;  3CHQ A;  2LOO A;  3OYN A;  2MAO A;  3FU3 A;  3OL4 A;  2PJR B;  3PSI A;  4MS6 A;  3TBI A;  2XQ0 A;  3U21 A;  3S3O A;  3L2U A;  3ZR8 X;  2VXD A;  3K4M A;  1X1A A;  1MNE A;  4IX7 A;  2UWM A;  2DCE A;  2VB6 A;  5FRO A;  1ONP A;  2WZG A;  3FTY A;  2XAU A;  4IQ4 A;  4II2 A;  2VIX A;  1V5F A;  4E7H A;  2X85 A;  4ZQG A;  4JOM A;  4C30 A;  2AQE A;  2R7R A;  2HPO A;  1X19 A;  3FUL A;  3L2R A;  4XNB A;  3TMO A;  4ZYA A;  2JCX A;  3CP2 A;  3PFY A;  4PSW A;  3CES A;  1N75 A;  1Q0L A;  3I9V 2;  1ONN A;  2PGG A;  1H3L A;  4AR1 A;  4LUP A;  1X3Z A;  2IGK A;  2R7U A;  2WZF A;  2HZD A;  1X1C A;  2PL5 A;  2A6T A;  4PUS A;  4Y67 A;  4Y4R A;  4E6K G;  3L2V A;  4JQF A;  1SG7 A;  2R7S A;  4ZTF A;  3EBH A;  4P1W A;  3PNY A;  2KQR A;  4F3Q A;  2W00 A;  3K70 D;  4XQF A;  1W36 C;  4K5M A;  3LL7 A;  4QME A;  1D0X A;  2M4G A;  3HUG B;  2VXZ A;  3AFH A;  3CMM A;  4FET A;  3SEQ A;  1BR2 A;  4ZW6 A;  2XF5 A;  2JA2 A;  4B44 A;  4L2L A;  4PU2 A;  1ONO A;  2DT7 B;  1WJA A;  4BEH B;  4XLH A;  2XPZ A;  1Z3X A;  1MMN A;  3H5N A;  2UV1 A;  1YX3 A;  2E1M C;  3QYF A;  2Y1G A;  5JBI A;  2IS6 A;  3SEZ A;  2FUG 2;  1E0E A;  4ZTJ A;  2HVR A;  2C5Z A;  2JD2 A;  2KLO A;  4BGD A;  3B7T A;  4HPQ A;  4XNA A;  3T0Y A;  2HDW A;  3FUJ A;  4PJN A;  3H0D A;  2F6C A;  1DQU A;  5HOO A;  4XN9 A;  3RC8 A;  2CH0 A;  3B3B A;  2X6X A;  1BOB A;  4PFO A;  4F91 B;  2ZXI A;  2CMP A;  3HL2 A;  3DKX A;  4PK4 A;  4OAY A;  4CUG A;  4R79 A;  2P0W A;  1MVY A;  2X1E A;  2VJ5 A;  4B3X A;  4QUO A;  4E7J A;  2IS1 A;  2WY8 Q;  2CW7 A;  4CSW A;  2R70 A;  2HNH A;  2MYS A;  4RLF A;  1UEL B;  2KP6 A;  4RM2 A;  3ZQQ A;  2UUZ A;  3K10 A;  3VVL A;  2W82 A;  5JHF A;  3BG7 A;  4E7Z A;  4XLF A;  3FHN A;  3FTU A;  1Z21 A;  2LC2 A;  3FU0 A;  1WJD A;  3B37 A;  3FDY A;  4XKV A;  4QPO A;  3PNV A;  3FU5 A;  3M8J A;  3EPZ A;  3CZE A;  2XF7 A;  3FU6 A;  4XN4 A;  3D5R C;  4ZQF A;  4ZX6 A;  3VYR B;  1WJF A;  2GTQ A;  1LFP A;  2JCY A;  4CCM A;  4CZC A;  3L2W A;  3FH5 A;  2HVQ A;  4X2U A;  4XOP A;  1MMG A;  1K6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...