2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
5HNFA 5HNHA 5HLTA 2VLAA
chains in the Genus database with same CATH superfamily
2LOOA 1XN7A 1PP7U 1Z3XA 3V7RA 5FLXZ 2L7MP 4XMYA 4A12A 3S14J 1G2HA 5E3OA 2DA3A 3FU6A 1OLTA 3FXLA 5M5YJ 4M9ZA 1TLHB 4NB5A 4BXXJ 1IRXA 2R3SA 5K7HA 4M6XA 1T0FC 3P5JA 3P9KA 4ABZA 1TW3A 2IBDA 1AA7A 3ISPA 3K70C 4J19A 1ONOA 2VOOA 4EMSA 1NG6A 3FHZA 2XDVA 4EV0A 2DT5A 3IUOA 3L9FA 2VQGA 1MZBA 3H3VK 4JYKA 3LOCA 1WZ2A 3E1SA 4XRMA 4OIOF 4R5VA 3UERA 4OAYA 4DYQA 2DMQA 3RCOA 2EB7A 2BYVE 5H2FC 1GXPA 2VJIA 2KP6A 1V54H 2DFIA 4XNAA 2FNPA 1R00A 4NDLA 1ZGWA 4BYYA 3OV8A 3DTIA 3PUBA 1WHUA 3D1NI 3COAC 3EBGA 1FBUA 5F08A 3CO7C 2O5RA 2Q8KA 3KZYA 3MKYB 2G7UA 5M3MJ 4E7JA 2DU9A 2W48A 4MQVA 1LKXA 2I5UA 4IZZA 2XROA 1VNDA 4IVNA 4RB2C 1MMNA 3BROA 5BPIA 1SVMA 1S29A 5A2QZ 4CICA 3CP2A 2BXYA 2DDBA 1HKTA 1BIBA 3RTRA 4EM2A 1JHHA 2X4HA 1MD0A 4UVBA 1DUXC 3FK7A 1OCRH 1XSVA 3WHBA 3CMEI 3BR5A 2LLKA 2Q0OA 3FXUA 2IJLA 1T8IA 2P5LC 1LEBA 1N75A 2DDAA 1YW9A 4I0AA 2XVCA 5E18F 1IG7A 2FBHA 4IQ4A 4I2OA 3NQOA 2GWRA 1JKOC 1ZR4A 3CCJI 4G6TB 4Y6SA 2DN0A 1AOYA 2YUSA 2ACJA 2CQKA 3M8EA 4QPQA 3F8MA 4ZTJA 4XNBA 3G1MA 4AWXB 1FTTA 2NYXA 2VBXA 1YYVA 1YW7A 3OIPA 3LSGA 2Y0MA 3JSPA 1TZLA 4ENKA 5HS7A 1IRGA 4A6EA 3CZGA 4LB5A 2CU7A 1X3UA 2OJED 3KYCB 4I01A 4BBSJ 4CZCA 4RGUA 1E3HA 3GFLA 3OIQA 1UG2A 3TBIA 3DEWA 2QJ1A 4FLQA 2EILH 3CTAA 5KAFC 1F36A 2VONA 1O3SA 1JUSA 3QWLA 2F48A 3CMAI 1WKMA 1ZG3A 2M8GX 2R5ZB 1ERDA 4OINF 4BHCA 2BY3A 2VKEA 4JOMA 3L2QA 3KLOA 3HEFA 3OOUA 3L2VA 2XIGA 2DJNA 5HS9A 2CUFA 2QGUA 3ERMA 3OYKA 2HZDA 1DDNA 1EV7A 1OMIA 1J75A 3KIOA 4LMYA 4AYBN 1VQOI 1TTYA 2BVLA 3L09A 3I4MJ 3IH4A 1HDPA 4HX4A 3KETA 2MABA 4PFPA 4XSXF 3CLOA 4UUSA 2STWA 3JTGA 2JVHA 4HNUA 4AR1A 2W84A 3NRVA 4PZJA 4HSRA 1XMAA 3LSIA 3GLLA 4ESFA 4Z6YA 5KCMA 1T95A 2MA3A 4F92B 3V8JA 5D5VB 3RIRA 2X1CA 4PJMA 2VPRA 4M3BA 5EF6A 2IS4A 2EIJH 4E7KA 4E70A 1GT0C 4JK1X 1GVDA 3ZQLA 2HQRA 2OBPA 2X9DA 2W7NA 2WPGA 1MMGA 4BY7J 4M74A 2UXXA 3P9CA 1OQYA 2EFOA 4XSZF 4H4KC 2X51A 1MSEC 5K7ZA 4EATA 4HF2A 2Y1DA 2GQQA 2VT3A 5HS8A 3S2WA 2P7CB 2UWMA 3S3OA 2W82A 2CGPA 4XMZA 3NEUA 1BM9A 2XGCA 2L9SA 5GTHC 2DW4A 4GAAA 2R4GA 3DKXA 2YU3A 3LWFA 5FLMJ 2JVGA 2OD5A 3ERED 3OYIA 2DPDA 2Y48A 1VFCA 4IHSA 2D1HA 1HSTA 3KE2A 4FE7A 4GO1A 2XQ0A 3FXJA 1U6GA 1WWXA 1XGSA 2Z5UA 3K4NA 4IHWA 4KYWA 3CZ6A 1K61A 4LG0A 3W2VA 2BGCA 3LSKA 3R4KA 1ZLJA 4GGGA 3LA2A 1GW6A 4YELA 2VBWA 4Y33A 2O3FA 3KP5A 4BQQA 5LRSA 2LP0A 3OS0A 4RB0A 3QP6A 2DQLA 2BBYA 3BC8A 4AIJA 3QODA 4YRVA 4L5IA 4FASD 4GDFA 4HA8A 2E2HJ 3OL3A 2RKHA 2FBIA 3CUOA 4LLGF 3RPUA 3FMRA 1Z1DA 2GZWA 1PUEE 1X58A 3QU6A 4GCVA 2V1UA 3FU3A 2XAUA 2PFBA 1FY7A 2STTA 5C4JJ 4AR8A 2CO5A 3CC7I 4R79A 1JTYA 3OYFA 5GAGJ 1X1BA 4MHGA 1HF0A 3M1EA 1YOVB 1NK2P 2FE3A 4HZFA 1NH3A 4A3EJ 2V9PA 2KIUA 4HF1A 1UHMA 3SYTA 5M5XJ 3MKZA 5FD6A 3FU0A 1R5HA 3MEXA 1H88C 4KT5C 2LKSA 1MDMA 4OOIA 2HOEA 2CQQA 3V4GA 5BNGA 3F3XA 1YS7A 5AONA 1EA3A 2LK2A 1ZH5A 3M4OJ 1YIOA 2Q2EA 3Q0UA 4M9SA 2ID6A 4AM3A 3REOA 1O57A 1IC8A 2VPLA 2KRHA 4RLQA 3EBHA 4U87A 4UNOA 4Y3OA 5HLHA 1J0RA 3OYBA 4NHJA 3HOZJ 1UHWA 1KU3A 1H3LA 3Q44A 3CHRA 2FJ1A 5J40A 2ETHA 1BI2A 1ZYRF 4V2FA 2KT0A 3E5XA 2EFWA 5GP9A 4IF4A 4DYCA 2EV0A 2P81A 2VKHA 1DP3A 2HWVA 5TRDA 1JE8A 1SMYF 3GZ6A 2NVUB 1HDDC 2O0YA 2Q1ZB 3UR3C 3SEQA 4B43A 2DYSH 3CCUI 1WJCA 1SQMA 4QHPA 4HQEA 3DKWA 4BE0A 2QSFX 1T08B 3CMYA 1P4WA 1MJ9A 3PFIA 2GA2A 3T8RA 2JA8J 2OQGA 1IF1A 1JG9A 1T33A 2AS5F 2UV1A 1QBJA 4IRIA 2E7WA 4G6DA 1BI3A 1JJ6C 3L2WA 4Y6RA 1Y8RB 4OWRB 3TO6A 3S1NJ 4A3LJ 4L9JA 4BE2A 2QQAA 2Y0SA 3MZYA 3O2PE 1JKRC 2LREA 2VT2A 3FKJA 2XUBA 4XKBA 3B34A 5FB2A 5CJ9A 2PGGA 4I02A 3WE2A 3DBLB 2XC7A 5HNHA 4FCYA 3D0SA 3OYNA 1LVKA 3HDDA 4K5MA 3ZMTA 5IYCJ 4BJ6C 2RQPA 3BPXA 3HRUA 3O3KA 4XN7A 1V5GA 4N9HA 2JJ7A 3HOVJ 4UUSB 3K2ZA 4ZN6A 4C3HJ 3ZGKA 5D8LB 2J5OA 2W25A 1LUJB 3ML6A 5HDKA 2DMPA 1QVTA 3PNYA 3R60A 5JFRA 3NARA 3J7YJ 2LF7A 1YI2I 4HOBA 4IRHA 3FBNB 3WTSC 4ZH4F 2O61A 2YS9A 5IT3A 2HPOA 4EEFG 3NWSA 2RC4A 4LFUA 3A2KA 4PFOA 4FX4A 2W4SA 1BI1A 3H9GA 3FH5A 4B09A 3PQKA 3LNQA 3OWTA 2R5ZA 1Y0NA 2NVTJ 1ZKGA 3KEOA 4QWQA 4M72A 1R36A 1R4MB 1Y6IA 1XTAA 3PUFA 4ENNA 2L7KA 1HC8A 4O6JA 2JN6A 2QCOA 5FFZA 3MWMA 1VI0A 2ICWG 3I54A 1RR7A 1UAAA 4NBQA 3JRGA 3DU5A 1WJFA 4B8XA 1OCOH 4XMUA 1Z67A 4CSWA 4PK4A 1TC3C 3AUAA 2Z1DA 1RRJA 3JAMZ 1WJDA 3M8FA 1USSA 2IW5A 1REPC 4MNUA 2VKVA 2I10A 2M45A 3QJXA 3EPZA 3K4JA 1N77A 1E17A 4B3AA 4XN1A 1EKEA 2YPRA 3I9V2 1UFMA 3WU1B 1L0OC 3VVMA 5GPAA 3FZVA 1V4RA 2BOLA 2IA0A 4L0ZB 3TP0A 5FROA 5H6QA 4X1EA 2KZVA 3ZMZA 4F91B 2K7LA 1FP2A 2RN7A 3F8FA 4XR6A 2Z9OA 3WQQA 1Q0LA 4N4OB 2F5CA 3JCUC 4NQWA 2PMZA 2M30A 3BTCA 3C2HA 4P96A 2HTSA 1T6SA 2HKOA 2RVCA 3BG3A 5F1RA 1YRNB 1W4MA 1QZYA 3VFZA 3CJQB 1GV2A 3FUHA 1A04A 3ZMUA 5C44J 6PAXA 1ZARA 3T0YA 4HF0A 4B4CA 3T8VA 5E1XA 3DBRB 3HGYA 3ZQFA 1XB4A 1AHDP 2JPBA 3L7WA 1MW1A 1PUFA 4XKWA 3ULQB 3AG1H 5FKMA 3CF2A 1BIAA 1F9NA 3HOXJ 4DOZA 3J7ZI 3GTGJ 1ETOA 3I0TA 2ZKZA 4HAMA 1I6XA 1DPUA 2DA5A 4LB6B 4PGHA 4RB3C 2HYGD 3IL2A 5IOYA 1B8IB 2JZYA 5TGTA 1YO5C 1YJWI 1YJ9I 1I3QJ 3WTXC 1U2WA 3O8HA 5LEKA 2DA7A 4RVBA 1KYWA 2E36A 1OFCX 1TBXA 3G2BA 4II3A 4ENJA 2EJRA 1MMDA 3R0IA 1LFUP 1SVOA 5CVJA 2E1MC 1MMSA 3BWGA 3IHUA 4V19K 3GFMA 1FP1D 3FBIB 5DD8A 2JA6J 1ONPA 2GA1A 5K5QA 4LIVA 3OS1A 2A07F 2H27A 2H1LA 4XORA 2CQNA 3CCRI 1YS6A 2LY2A 2LDUA 3FUIA 4BHPA 1MBJA 3JAMK 4A5NA 3GTOJ 2HOTA 5JC1A 5LLQA 1S46A 3D5LA 3FH7A 3KZZA 4UVCA 4E7HA 2H1KA 3L00A 1JUMA 2FXAA 2QVOA 2BV6A 2IA2A 2RNGA 2L4AA 1MW0A 1FWZA 3TDZC 1X3WB 3DTEA 3HKZN 4WXDA 3ZMSA 5D5XB 3PM1A 3ABTA 2MD5A 4WCGA 1LE8B 4A3CJ 3IKVA 5ERIA 2HI3A 3SJMA 1OR7C 2JRTA 3HSFA 4PSWA 4B48A 1A31A 4G9YA 1RPWA 3HOSA 5JVTA 3W2WA 4IXAA 5ILUA 2O8XA 3IC7A 4DBRA 5ICCA 3FDYA 3B7SA 5TJJA 1XD7A 9ANTA 3ABUA 4S04A 2GTQA 5LBQA 4QIWN 2VJ8A 3GUDA 3IWFA 5DCMB 3ZP5A 4UY8I 2QVWA 2L3DA 4Y67A 1P7JA 2JMWA 3BR2A 2NRAC 1PJRA 3KEDA 2ZCWA 2KL4A 3JTHA 1BBYA 2V79A 2BZTA 5IY5H 1HQCA 1W5SA 3I59B 5EZGA 2IT0A 4LLNA 4A03A 4PJNA 1FYMA 3FH8A 1OKRA 2XGDA 1LJ9A 1IDZA 4X0GA 3CCQI 3W6VA 4EJWA 3B7UX 3OYMA 5F0FA 2ZMEA 2FUG2 3IH3A 2PJRA 3JW4A 3WTZA 4DYRA 4PU2A 2XHKA 2OA4A 3R0JA 3O8GA 3B2PA 4RGRA 2HPTA 2RREA 4JX4A 1MBHA 3IKTA 2TRTA 2HTJA 3BJOA 4C2MJ 1XGMA 1CF7A 5DDGA 4D9JA 1IJWC 3A1YA 2H94A 2M0MA 2ECBA 3GWZA 2XAFA 3CCYA 1SD5A 2K3FA 1PYVA 3PNTA 5JLWA 2CQXA 2ZXIA 2P5VA 2ME0A 3VYTB 4X2UA 5KVRA 4S05A 4G7ZF 1Z0XA 2F2EA 1Y39A 1MMAA 2ADUA 3RDIA 3SEZA 2BW3B 2A5WA 4ZX5A 3I4NJ 2EH3A 3EUHA 1FC3A 5HLTA 4PGGA 3HW2A 4QUOA 4P9FA 1ONVA 2VJ4A 4RS8A 3LA7A 4BHBA 3J80K 2VXDA 2X48A 4NUBA 4IQJA 1G59A 3VYUB 1SVLA 2XF6A 2K4JA 4IPAA 2HYJA 2GM4A 3RZOJ 2F4OB 4XRSA 1I50J 2VIXA 1XGNA 4BH9A 4DJAA 2LFBA 5FLVA 2R93J 2DQ6A 3DPLC 4FLRA 3CESA 4LK1F 4E7ZA 5FRNA 4FLOA 1G3SA 3RQIA 3ANLA 2KHMA 5CKTA 2CUZA 2PJPA 5CVVA 1AKHA 1FYKA 1VQ8I 2R7FA 5FKKA 3VSKA 4ZW5A 4XICA 3S2DJ 5EGOA 1AWCA 5TISC 4GFBA 4RAZA 3UEQA 3N97A 1Z21A 4B44A 1T2KA 1UJ8A 3H3ZA 2M9HA 2CMPA 1WH7A 5J4VA 3GTMJ 5K7FA 3DCFA 1QNTA 2AXLA 4E7LA 2JCVA 2LY1A 3L2RA 4D1QA 1T98A 2EIMH 1QHGA 2ZO4A 4BXFA 5K5RA 1H9TA 1I3AA 3DKYA 1YIJI 4R8HA 4ZW7A 2K5CA 1IDYA 2X6OA 3RKWA 4OOFA 1OYWA 2EBIA 3RASA 4U7DA 3CJNA 5M5WJ 2RDPA 4UB8C 1JGGA 5IOZA 1BOAA 1Y56A 4HSTA 4L9TA 3CMMA 5J3LA 1FNNA 2F5FA 2VC0A 2K4BA 3CJRB 4ZYEA 5AIQA 3WGHA 2BHYA 2QLZA 3BQZA 3H36A 3MN2A 1KU7A 1VTNC 3K7AJ 2PMZN 1K7AA 2HR3A 3W3CA 5H20A 3B7TA 1SAUA 2F6CA 2VUMJ 2Z33A 1R0KA 4EQQA 4CYCB 1RESA 3DTKA 3UNGC 3RI4A 4QPEA 1TWGJ 3CXBA 3OYAA 2ECCA 3VSLA 4FTHA 2HVSA 3FXOA 3LSJA 4EGYA 1P4XA 4S0HB 4KISA 1VQ6I 3GLXA 3OY9A 4IO9F 5FGMA 2EWNA 5F64A 1D1BA 2R7UA 2P5KA 2A5YB 1CF7B 2Y30A 5KHDA 2MW8A 1KGSA 1NK3P 1SFEA 2CW8A 2Z16A 2CFOA 4UHTA 1MSFC 2L7FP 3CJTB 3ASOH 4HYEA 1VQNI 3S2HJ 2XPUA 5D8KB 1HA8A 1P4AA 4RM2A 1QZEA 5DTDA 1PUFB 1YJNI 4LG3A 2DPUA 1DU6A 4F3QA 3CC4I 3K4CA 1E2XA 5L3DA 1HW2A 4CZZA 2XKOA 1KQ0A 4N9IA 4B1RA 2EFNA 1VQ4I 1F43A 3V7CA 1B4AA 5B1AH 2E34A 2PMUA 3Q9SA 3HSEA 1B9MA 1HCRA 2HOSA 2B63J 3B7RL 1PP8F 1Z77A 1UCRA 3AFHA 3BJAA 3FM5A 2HDCA 2V6CA 1UELB 1IXSB 2L4MA 3BCAA 2BW3A 2DT7B 3A14A 1HBXG 2CS3A 3KP4A 2Y31A 1X1DA 2AXTC 3I71A 4EJTA 4X6AJ 3ZQGA 4I09A 1GV5A 1K83J 2KISA 4BU2A 2JSCA 2NNNA 3JREA 2EV6A 4ZQTA 3I4PA 2ME6A 3PUUA 1ZELA 2YX7A 2M4GA 1X1PA 1IV8A 3VWBA 4PCQA 3W6JB 3JRFA 3GEZA 1VQ9I 3B6CA 5CYVA 1MNEA 2OQRA 3T5XA 2XF7A 1ON2A 4MQ9F 2KJCA 4ZW6A 4DNCA 1X3ZA 1RC9A 4CHUA 4XLEA 5KAIC 4FE4A 4UXNA 3IIEA 3BTJA 1JGSA 4IL6C 2LR8A 3HRSA 4HX8A 1FSEA 3WQSB 5FRMA 1D0YA 4NC6A 1XMXA 2CV0A 2XAGA 3D5RC 4YFXF 1MGTA 4BKXA 4EVIA 1HS6A 1BC7C 1O3TA 3TOBA 2FNAA 4Y6PA 1BI0A 3BR6A 3QOEA 1S72I 3BZKA 4U0VA 3HOTA 1JKPC 2NOJB 4KITB 3LSHA 3IRRA 4M3EA 2DOFA 1BN5A 2VQCA 3RKQA 3M1CA 3PQJA 3A02A 5GAEJ 5F0HA 2ISZA 2XRLA 2FA5A 1SFOJ 1ZQ3P 1OYYA 1R1VA 2A6EF 1ITYA 1XSXA 5F6FA 4PJ0C 4L5JA 4ZDOA 3WTWC 2E2IJ 3G3ZA 3LFUA 1U5TC 1MW7A 4A3MJ 3HYIA 4XBFA 4UB6C 1A6IA 1ZRFA 1JUPA 1X3WA 2X85A 2M5WA 4KT6A 1RUOA 4MO7A 2PQ8A 2A61A 2WTEA 4HV6A 2DAOA 3RC8A 1BR4A 3RYPA 3CLQA 3KX2A 1TWFJ 4ZDLA 1LPQA 2ELKA 1WPKA 1U0JA 1N78A 2IGNA 2QQBA 4RGSA 2K9NA 3SDGA 3WU0A 3LFKA 3FTVA 1NG7A 3U9WA 1MIJA 3ONQA 3OYEA 2Y1CA 2CUJA 4FETA 3CUQB 1BJAA 1R0LA 4Y13A 1OCPA 4HV5A 4OIPF 2PMHA 3ABLH 1IUYA 2CV2A 4A0YA 2ZXJA 1OJLA 4AIKA 5IP9J 1Y1WJ 4RA2A 4XN3A 1RI7A 2OZ6A 1OCZH 1FPQA 2QENA 3F22A 2GXGA 2EZKA 1FJLA 2X1EA 3A4CA 3BOQA 4XN0A 3MVPA 2DFHA 1VQMI 1V5FA 4IJAA 3KEQA 3HTSB 1KQ8A 1HOMA 2OPTA 5A2QK 4L9VA 3EUAA 2WAEA 3KP7A 4BXUA 3LSRA 4A3BJ 1EF4A 2AO9A 4G94A 3SDBA 3K6GA 1A35A 2F5DA 3ABKH 4ZYGA 4JQFA 1Z6TA 2BXZA 3KLNA 3PIPF 2HPMA 2EIKH 1W36D 3H35A 2MH9A 3FUMA 3ELKA 4KJZA 3HIFA 3WTVC 3FUNA 3E6BA 4XLFA 3SQNA 3UKGA 4LITA 3EYYA 1O4XA 5C4XJ 5HODA 3TQNA 3M7GA 1LDJA 1TNSA 4XRFA 4P1WA 3MZHA 4IHTA 2HYFA 2ZB9A 5DCFA 4LUPA 3ROUA 4DW6A 3LSTA 4ESBA 2VBZA 4PJLA 3HB9A 5BOXA 4XN8A 2XPWA 2JCXA 2LC2A 3A0BC 3QPTA 3LSPA 2DMUA 2HU9A 1YG2A 3BR1A 3G73A 5IT9K 2UUZA 3S3NA 2F4MB 2ZFUA 4MFEA 4MFDA 1K5HA 2E7XA 3FWEA 3H5RA 1D8JA 2VE9A 2M34A 1RNLA 4CCKA 4Y7NJ 1WJBA 2Z3YA 1D1CA 4KMUX 4IHYA 4Q4EA 1Z91A 3HG9A 2QSHX 2DODA 2C82A 1YX3A 5FKOA 1FX7A 1RETA 3BG9A 1MNMC 3RPQA 2E71A 3M07A 3ZXSA 4D5CA 3AKZA 3PJRA 1FT9A 1QO0D 3E6DA 4KDPA 1HW5A 1MBFA 1SG7A 3CHOA 1QRYA 3A01B 1AKHB 2VKDA 1WI3A 2L9NA 2R0QC 2LNBA 1XPXA 5K1YA 3MQ0A 3K4MA 3VYRB 4B3XA 3U1KA 2DMNA 2MSYA 3K9TA 3P9IA 5L3CA 1JXSA 4M9XA 4MTEA 5LEJA 2JUCA 4BE1A 1O3QA 1VQLI 2ZJ2A 4XN2A 2ZJRF 1WRJA 3ABMH 2YR2A 2IS6A 5FKNA 3G71I 4E6KG 1J59A 2R59A 3LQRA 1YRNA 4MTDA 1RUNA 2IA1A 1IZ1A 3K10A 1GHCA 1T38A 1Z05A 3FULA 4DIQA 4AIDA 2QA4I 2E1CA 1B9NA 1BJZA 5E1ZB 3V42A 5D4SA 1MVYA 2LSOA 1HSJA 5J1YA 3OYDA 1W36C 4KFCA 4KN7X 1ETXA 3E3VA 4BAYA 3DP7A 4XO3A 5LFAA 4BDZA 2B0LA 2HDWA 2UZKA 2ESNA 2PI0A 2IGOA 1MDMB 2R7XA 3ASNH 3HBLA 2FEZA 4XQFA 3OOPA 4JBAA 2MAOA 2BY2A 2PL5A 2JA7J 1MJBA 3F72A 2L0KA 2XSJC 1KU2A 2LD5A 2O6GE 5B3SH 2ZMEB 2M7AA 2BEOA 3PO3J 2W24A 1MKMA 2QEXI 3I59A 3QPLA 1K6YA 1SFKA 3TW6A 1E3OC 1TP4A 4XLHA 2LBFB 4CGZA 4G12A 2KIFA 2E2JJ 4HNTA 2R7QA 2IP2A 2K9QA 1HW1A 1ODDA 3K1NA 3IAS2 4WK8F 1BL0A 5DULA 5EGOB 2ZJPF 4AR9A 4ZZLA 3K1MA 2E1MB 3I3LA 3RKYA 1SD7A 1WQ2A 5B1BH 3H1CA 4WXCA 3PFYA 3Q5FA 2DMTA 4ASNA 3B3BA 1QZZA 2DA6A 3KP6A 5ILVA 4BDYA 2O7GA 2EQRA 1U9NA 4G8XA 1X4OA 2K02A 4L5EA 3SZTA 5BPPA 3FM3A 4Y52J 3FXMA 4K5LA 1FBSA 2ZC2A 5HLGA 1Q0QA 2K27A 2Y1GA 2VC1A 5LHGA 3I55I 3GZ5A 4EGZA 3ZOBA 3BZCA 4NQWB 2FMYA 1ETVA 2CH0A 2XASA 1BW6A 5JHUA 4CUGA 3WTTC 1DGRM 4FX0A 1VF9A 1W5TA 3VYSB 4YFNF 3OYLA 1F5TA 4XRSG 3MFKA 3E6MA 3K4KA 1LNWA 2LKXA 3DEEA 5B66C 3OR2C 3TDUC 2RJIA 2DLLA 3CZLA 3CCEI 2HXIA 4F52A 3J81Z 2QQ8A 2EFPA 4K5NA 3F8NA 4DPRA 3ZHZA 2CRGA 2ELJA 4AD9A 3HC7A 3H92A 4YEJA 2JA2A 4FLSA 3OR1C 1DQUA 1FIPA 3EUHC 1R71A 2R7TA 1IO2A 1DPRA 3B73A 1P7IA 1T0FA 2OCCH 4D7MA 1L3LA 3BTLA 3FUKA 3JSZA 3MAJA 3U1DA 2E5ZA 4A2UA 3GXOA 1X2MA 2DT6A 2X6YA 3F9KA 1ZLKA 3HUGA 5HDGA 4K5OA 3TEDA 5BS6A 4PDKA 2JV7A 3Q0WA 1IN7A 4L2LA 2HOAA 2EGHA 2IAIA 2HQAA 4XM3A 4FHTA 2V4JC 5HVQC 3SHFA 2CSOA 4GXOA 5BMZA 3SZGA 3GFIA 4B47A 1ZRDA 3UCQA 2DK8A 4BJTA 2N8GA 2P0WA 3K0LA 4A0ZA 2O7OA 2M2EA 3V7SA 2KLOA 5DD4A 3CCLI 3V8LA 4OU0A 2D45A 4J00A 3QRFF 2J5PA 2PX9A 1T56A 4ENMA 1FMVA 3GX4X 1FMWA 3IAM2 3E5UA 1VQ7I 2YX4A 4NC7A 4R7LA 3ZHXA 3WQRA 2CG4A 3HTUA 4CCLA 4W1UA 4BACA 3WE3A 5EG0B 2DBBA 1A36A 1Z6RA 3LMMA 4M73A 4ZX3A 2L2OA 3VODA 1U3EM 5H6RA 2KIMA 1G4DA 1E0EA 1X1AA 5IYDJ 3PIOF 3W6KB 2ISYA 2EK5A 4Q47A 5JHFA 3ZPLA 4LG0B 3BG5A 4OIRF 3JSOA 3B02A 3BPVA 1F1ZA 2HS5A 3BZ6A 3WHCA 3CCSI 2V1DA 1G8XA 3TMOA 3GZNB 2A68F 1FBQA 2XRNA 1K4TA 4EJOA 3CZKA 3Q0VA 4XMVA 1U9OA 2HXOA 2XB0X 2Y69H 3CDIA 2ZXGA 1W0TA 3GFJA 4R1HA 1UHSA 2NAZA 1Q0HA 3R61A 5EG0A 4G7OF 4DBQA 3MCZA 1ETKA 2GOXB 5HLIA 1B72B 4AYBA 1O3RA 3K2AA 4RAYA 4P9UA 3LL7A 3K4BA 1H19A 5CVRA 3PL8A 4KIBA 3RC3A 5EEHA 2DFFA 2E5NA 1ORKA 2EZLA 1FZPB 4L0YB 3NAUA 3HKZA 3S3MA 3VEPA 3VPRA 4DQ2A 2DYRH 2DTZA 2HQNA 3DF8A 3OYHA 4UUTA 1BR1A 1XDSA 1HLVA 1G3WA 2JQ7A 5J4YA 2BHZA 2DOAA 3D5SC 2CWEA 4ZYDA 1JJ8C 2WC2A 2BY1A 1I1SA 2Y1FA 1YQAA 2GXBA 1BOBA 3ZHYA 3BCBA 5D5UB 4I76A 4EM0B 2BY0A 4MKTA 2R70A 1FOKA 1R4NB 3CQZJ 2TCTA 3HZJA 2XGEA 5DEQA 5JBIA 1R9TJ 3KCCA 2XAQA 3HUGB 1SEUA 1UZCA 4UVAA 4UUVA 3S17J 4QMEA 5CLSA 5CVIA 4ZTFA 3CC2I 4QSHA 2MGQA 4RLFA 2GIZA 3X2QH 1SANA 3HOYJ 3CHPA 2A05A 1IN8A 1XX5A 2JK3A 1TW2A 2MFZA 1J7KA 2VLAA 4CCJA 2RNJA 2OC6A 4Q5SF 2WB1N 3WGGA 5DLLA 4JNDA 2CYYA 3JRIA 3DV8A 2EINH 3F0CA 1K79A 4QLCU 3GTJJ 1IW7F 1POGA 1DU0A 2NOGA 1ETYA 2G9WA 2RQQA 3ESWB 4A69C 4ZQHA 5J1UA 1Z3YA 4OMZA 5ILSA 4EJUA 4HG2A 4IOAF 2LTPA 2A6TA 2L01A 3HPHA 3CIAA 1EJ9A 3I58A 5EV7A 2FRHA 4MLOA 4XKCA 1MH4A 5HDNA 2O03A 4ITVA 2DA1A 4UV8A 3BQYA 3GW2A 1Z7LA 4E7SA 5LHIA 1YLFA 3KP3A 1KA8A 2UXNA 2L9RA 3R6SA 5ICGA 1LFBA 4P55A 3DPTA 3H0GJ 3OYGA 1R5GA 3FK6A 3OIOA 1QU3A 3FX3A 1QA6A 2NS7A 2DK5A 4HDVA 2OU2A 2NVXJ 1JT6A 2KDOA 2WZFA 5DM7F 4I99C 4XO5A 4GAEA 3BP8A 2ZXWH 4HLXA 1GLNA 4HX7A 3ANNA 1LEAA 1YE9A 2K85A 2K86A 4EJVA 1B6AA 1SFXA 2V7FA 3AG3H 1PVEA 5JO0A 1OPCA 5E1WA 2IPQX 2GXAA 4M71A 1WJAA 1J9IA 3JR9A 1USTA 3C1DA 1TT5B 4IRGA 2WWYA 4AC0A 4BL0B 2A6HF 2RGVA 4GRIA 2MG4A 4AU7A 4MIMA 1GXQA 1K4SA 3FTSA 2FBKA 1MH3A 2DQRA 1BR2A 2PN6A 2EV5A 3EETA 1D5VA 3WTUC 3AG4H 4FISA 3ZQHA 1O7LA 2TDXA 3CCMI 4II2A 1XS9A 5B5EC 3VVLA 5E8IA 2EZHA 4PW4A 2RAEA 3RPUD 2CJJA 2COBA 2EZIA 4XLAA 1ONNA 1B72A 5DYFA 1QPMA 3HRTA 2XB5A 1JI8A 1APLC 1EH6A 2VB6A 1V3FA 3FF5A 4E7IA 2V9VA 4RMNA 4CYDA 4M6VA 3B6AA 1SAXA 4A3JJ 3B2XA 3GO5A 2QKLB 2IS2A 5GPCA 2K9SA 4HPQA 2D1VA 4XMXA 1A6QA 4C2UA 2HQ5A 4RGXA 1WSUA 4BNCA 5JNLA 1X4PA 3Q3SA 5J8FA 3BR3A 1D0XA 2E35A 5BPDA 3ZMVA 1XG1A 2IGMA 3FXRA 4PJJA 4XN5A 5FFXA 3G6EI 1S3JA 4RAFA 3ZQCA 1X3ZB 2DOEA 1Q1VA 2COMA 5JI6A 2JPCA 4TV7A 1RKTA 2L7ZA 1VZ0A 5F04A 2V9KA 4XMTA 2LY9A 2H6BA 1IRFA 1LVAA 1LQ1A 1IN4A 4XOTA 4KMFA 1RP3A 1IRZA 5D6EA 4YFKF 3AAFA 2VXZA 2WZGA 2LBFA 2B61A 4BQOA 1WJEA 2ESHA 2ZXHA 2Y9ZA 5ICEA 1DP7P 4CCNA 1X2NA 5L3EA 2DCEA 2QUFA 1C0WA 2PLYA 3F6OA 5IT9Z 1YX5A 3U2RA 1O7FA 2QQ9A 1WGXA 2XKPA 3CDLA 3ZQQA 5IP7J 4AYSA 1TL8A 4MGRA 1D8KA 2CW7A 2ZJQF 4A5MA 2KZGA 3DEUA 3C2GA 1ACIA 5J47A 4Y17A 2M1BA 4IHVA 5FKLA 1FOYA 2E1OA 4L18B 4V2GA 2QSGX 3ZN0A 3SFZA 5FLXK 5DS9A 3S1RJ 4PSXA 1TWAJ 3GBGA 1TQMA 4ZYHA 4FQGA 4BS9A 2QBYA 4RBOA 1I39A 4NC8A 3IP4B 2KKOA 4RSYA 5D6FA 2QKMB 2HDDA 2O8KA 4KA4A 1FEXA 3BT9A 2JA5J 2KDZA 1R22A 4KN4X 4YIRX 3VOEA 2ZSHB 3A01A 4WX9A 1IV6A 3NWTA 4K5PA 1H89C 1R1UA 1XGOA 4XNFA 3GTLJ 3JRHA 3FXQA 3HM5A 5LGTA 1ZG1A 1SFUA 5E8GA 2IXSA 2VJ5A 4I98B 4HBLA 3S8PA 3ANMA 2W1OA 2MC3A 3K69A 4Q48A 1NTCA 2VQHA 1P9QC 2RV8A 5F1JA 3RYRA 3Q9VA 3HPGA 5K5OA 1H0MA 3WG9A 2YU9J 3FHEA 1ZN2A 1U8RA 4U88A 1QPIA 5EEGA 4XOPA 3LSMA 1D0ZA 1R1TA 1RIOH 3ZI0A 2VN2A 3CDHA 4F55A 2IRFG 2JUGA 3CO6C 4CYCA 5LHHA 3K70D 4JX5A 3LA3A 1R5ID 1W7PD 4QTRA 3HGGA 1IXRC 3FXKA 4D5FA 1U8BA 2R7VA 1ZR2A 2WAFA 1WVRA 3SZPA 3I5UA 3Q43A 4U7BA 5AENA 4I6ZA 1ETQA 3A0HC 2JTVA 1I27A 4FCAA 2GIVA 4K2EA 2JD1A 1V5EA 1IXCA 1S5LC 3T1BA 1KYZA 3CF5F 2OF7A 5E20A 1UB9A 2NXNB 2MLKA 2O9LA 1W7PB 1IAWA 1V55H 3H9JA 1S9HA 2R7DA 2AQFA 2H09A 3G1OA 1JGIA 1OYIA 3EDPA 1YITI 1UMQA 2LVSA 3ECOA 2W00A 3VDXA 3ZR8X 4KIFA 1I6HJ 2K40A 3EQLF 3L2CA 4GYIA 1Q1HA 3IWZA 3F8CA 3SFIA 2QYOA 2NS8A 4KICA 1A5JA 3GTPJ 1D1AA 1KZHA 4OIQF 1JVSA 2Y2ZA 3C7JA 1JTXA 5HNFA 1SD6A 1Z7UA 3JRDA 5FO5A 1RR8C 4AIHA 2E19A 5E3NA 4HRIA 3WGIA 2V26A 3C18A 2ELHA 2NS0A 3A03A 2L54A 5E79C 3DLAA 2I8DA 4Z2YA 2NVQJ 3J7AO 1ZGAA 4ZW3A 2QWWA 2XSDC 2LRDA 2EFQA 1ZG5A 3IV5A 1STZA 2IGKA 4RDUA 4RM3A 4JP0A 3V8KA 3HJEA 1JHFA 4XLNF 2WAQN 3OYJA 3FUJA 2W85A 2ZSIB 4RB1A 2B9SA 5JVGF 1WJ5A 3KEYA 3KZIC 1H9GA 2BE5F 3F6VA 3TO9A 3FUDA 3SXYA 1FLIA 5LGNA 3ZMDA 2WY7Q 5EDNA 3J7AY 2VL8A 3QU3A 4PUSA 3N4MA 3HXLA 2MLGA 4AICA 2P8TA 2KRCA 5DYMA 1F4KA 1KONA 2G0EA 4ZQFA 2MBFA 1DGWY 1QHHD 1S8NA 3GMEA 3J81K 3FMQA 2ZBKA 3AL0B 1S7OA 3MKLA 2OTLI 1T1RA 3CHQA 4MEYF 2DI3A 1JT0A 2HGCA 5JLXA 4PVBA 3O6BB 3S93A 4LD5A 1M1EB 1XSDA 1QQIA 2ZMEC 1Y0UA 2QF7A 2CQ7A 2WV1A 1FTZA 4BEHB 3N05A 1NHAA 2VE8A 1ZTRA 3HSRA 2DFEA 2JT1A 3E6CC 4IX7A 4M3DA 3S16J 3CP8A 2VODA 1ULYA 4A6DA 2MD0A 1B59A 2X6XA 4CXFA 3G1LA 1N25A 3IRQA 2MC4A 3FUEA 5DV5A 1TWHJ 1S7EA 4IEJA 3JRAA 3U9GA 4ZDPA 3F23A 2FQ3A 4ZZDA 1AU7A 2M4KA 4ON0A 4DZPA 1U5TA 1FOWA 4ZX4A 1FOXA 2XAHA 4O5VA 2OUMA 4ANJA 3E0JB 2XPZA 4MS6A 2BVMA 1D3YA 4L9NA 4CCMA 1R58A 3RJPA 3ZN1A 3DFGA 1JKQC 3IH2A 3ZCOA 2WAQA 4BBRJ 1MBEA 2EPFA 3CUQA 4KNYA 3TW7A 4IKFA 3H3UA 2ID3A 2R7ZJ 1XCVA 3F8BA 2L5QA 4D7NA 3AU8A 1GVJA 2XGXA 2HKXA 4CCOA 2MAPA 1VQPI 1LB2A 2K3PA 1VQKI 3CZEA 3EYIA 2NNYA 3M8JA 4IHXA 1LFPA 4E4HA 4QIRA 2GBYA 3MMYB 3QOPA 2G7HA 4BUPA 2AQEA 2KQRA 1OISA 2JSPA 4WF2A 3RQ4A 4U0WA 2EA4A 3ECHA 4U0YA 4A3FJ 5IYBJ 4AUXA 3DBHB 3S1MJ 5DM6F 4C30A 3EBIA 4BEHA 4NNJA 4Y15A 2W57A 2OTJI 1G6NA 1ETWA 3KFWX 3U21A 3LAPA 4BQAA 4C2TA 1SMTA 1WI9A 2OAZA 2PJRB 3R0AA 5J1RA 2M8EA 5E3MA 4XIDA 4H0EA 1R7JA 4A0XA 1P92A 2DQMA 3H5AA 2IEKA 4R5TA 1VQ5I 2P7VB 2R72A 2X0LA 4F7ZA 1TT0A 4HEA2 5L3GA 2P6TA 2QM3A 2QBYB 3FHNA 3TL4X 1OCTC 4AVPA 2FQ4A 3QAHA 2R7SA 1P6RA 2A69F 3TOAA 5LD2C 3TP3A 2FFLA 4KP7A 1ZK8A 4MEXF 2YSRA 2F4IA 2WADA 4LGWA 2Y9YA 1YTYA 2VI6A 1WCMJ 3RSNA 3BLYA 3DPUA 5L3FA 4YIIA 1G5AA 1QGPA 1KU9A 3OSGA 2WB1A 2HVRA 1BW5A 1B1BA 1CQTA 4ARFA 2MH2A 3LAJA 2AHQA 1J5YA 1MBKA 4UV9A 2FF4A 3DU6A 2LF8A 1D5YA 5JMPA 1WFXA 5EZHA 2R5YA 1W1WE 4ZYAA 3H0DA 3TKYA 3BDDA 3FIWA 3BTIA 3FISA 2K9LA 2V1XA 3E7LA 1SC7A 2VBYA 2LG4A 5J8CA 2M7BA 1IGNA 3ZQIA 3WTYC 1LDKB 4ESJA 4ETSA 3FUFA 1U5TB 4C3IJ 1K78B 1J2XA 2L02A 3I53A 3W2AA 2WBMA 3PNVA 3FMSA 1ENHA 4Y4RA 1K78A 5D4RA 4HNVA 2R7WA 2R7RA 5M3FJ 4XLPF 2OV7A 1FYLA 2FU4A 1UG0A 4OOEA 1EH8A 2WV0A 3AG2H 2VQLA 4XKVA 2C6YA 3QYBA 1R49A 5EYRA 2H8RA 2KMUA 5GADJ 4Q4IA 3KYDB 2WY8Q 2VJJA 2V1NA 3M9AA 3DWLE 1WH5A 3L1PA 4A3DJ 1ZGJA 2IS1A 1MBGA 2R92J 1B8IA 2LYCA 1LDDA 4XK4A 3OYCA 1YHQI 3ZQ7A 2B7EA 3FTZA 1GDTA 5DUKA 2L9VA 3JRBA 2XPVA 2Z99A 1HXDA 3WG7H 2DXIA 4ZQEA 3K4LA 3AU9A 4XN4A 3DLLF 4R5XA 1IN5A 2FSWA 2VASA 3GTKJ 1QVUA 2F5EA 2P4WA 3GCMA 1T39A 5JMWA 1ZRCA 5GAHJ 4DZJA 3BR0A 2HZTA 1P2FA 3OS2A 4OMYA 3P7NA 4J3BA 4M3GA 2HPIA 4CA0A 2FX0A 1H8AC 5FJ8J 3DQVC 1XC5A 1FIAA 2XAJA 5JAZA 4XN9A 2MYSA 4C9YA 1RKWA 3KPHA 2IVMA 4XLCA 2LMDA 4CDGA 5LGUA 2DA2A 4OAZA 4ZQGA 3E97A 3FKIJ 4JX6A 4ZW8A 3CD6I 2DA4A 3C3WA 2X6WA 1XDUA 3QYFA 3ZRGA 3G4SI 2LH9A 5F0CA 1GUUA 2GAUA 2M0CA 2LKPA 5ICFA 2GOMA 1IUFA 5HOOA 2CUEA 4ZJZA 2Y0SN 5D5WB 2OZUA 5DCMA 4EM1A 3HOUJ 4ZX6A 2F5VA 3I56I 3GYHX 1FSHA 1G3YA 3HRMA 4A3GJ 4F93B 5L3BA 2JWTA 4A93J 3HL2A 3QPSA 5IPAA 1S6LA 2M87A 1CGPA 2QZ8A 1SD4A 3BG6A 3QP5A 1MJAA 3E5QA 2P6SA 3KP2A 4XL9A 1Y1VJ 2E1NA 2VOPA 1MW2A 1TWCJ 4A3KJ 3QPHA 5JR3A 4J01A 2FD5A 2Q2EB 2X1DA 3EUKL 3DXJF 2JRMA 2OCEA 3HHGA 1J09A 3B37A 4P5OA 1MNDA 2K9MA 2E60A 3AL0C 3CHSA 3S32A 3I64A 4CO8A 3WU2C 3GTQJ 2R5YB 5KNLA 2CFXA 3BJ6A 1ZAOA 5F27A 3JRCA 3HHHA 2HNHA 3C2BA 4LK0F 2H8WA 4G7HF 4HW0A 2KJBA 3L2UA 4HQMA 1TQIA 2D2WA 5CPRB 1XCBA 4CH7A 3CCVI 1T1SA 4DGWB 4LLLA 3TGNA 3QQAA 4LOCA 5J6XA 4O3MA 5CQGA 1ON1A 4I0BA 3S1QJ 1Z9CA 4AVZA 4KUMA 4N0BA 1X1CA 4GYGA 2KPMA 4HLYA 2HVQA 5C3EJ 2GLOA 3KYLA 4ZC3A 2NVYJ 4HDUA 1IN6A 2CV1A 2KIQA 1OR7A 3H9QA 2PUSA 2FOKA 3OL4A 2D5VA 4LJZF 4BQNA 2Y75A 1R23A 4LIUA 1PDNC 5ED4A 5FWQA 1Y8QB 3VB2A 3MKWB 4QPOA 1U78A 4WWCA 1EH7A 3BY6A 2JCYA 1I5ZA 4RCVA 1XMKA 4IOCF 2DJIA 2FOWA 1HKQA 1OCCH 5E3LA 2M3AA 5FD5A 2ZNZA 2C5ZA 4BJ5C 2JD2A 3OMYA 4XONA 4XMWA 1RZ4A 4XO4A 1ZS2A 2KRFA 1G3TA 4WXHA 2DTRA 2Z2SB 1E3PA 4YIFA 2R7OA 4KIGA 1KQ9A 3FTYA 3QYEA 3PSFA 5IP6A 4W97A 3HOWJ 4D0PA 2CW0F 4RAGA 3WODF 4YG2F 2WA0A 3LQQA 4N4NB 1YFHA 1MW3A 1ZREA 3PSIA 1W5CC 3RZDJ 3FTXA 5BQTA 4A3IJ 1BA5A 1SC5A 2XPYA 4XNDA 5KK1A 1K6OA 4I7HA 2H6CA 4G6QA 5E17F 4FT8A 2PEXA 2HEOA 2Y1EA 3GVAA 5AIPA 3TO7A 3MZ8A 2ZNYA 3BG7A 1ZHFA 4M3FA 3M3YJ 3J80Z 2PBIA 2XV4S 3OSFA 4M6YA 2A3SA 2FMLA 4BY1J 4BGDA 4Q4ZF 5CQEA 2ZFWA 1HKSA 2EA2A 4C3JJ 1R6RA 1X19A 3CUQC 2DO7A 3S15J 3MD2A 2V6EA 2PG4A 2JD0A 1TQPA 2HFHA 3H5NA 3T8TA 3FU5A 3JT1A 1I1GA 1W0UA 5EEAA 5EJCA 5LRRA 1W7PA 2XF5A 3F21A 3A06A 5CVUA 3K1PA 3GF2A 3FTWA 5GTIC 1LE8A 5DUIA 1S7AA 3PO2J 1BC8C 1YW8A 3RKXA 2A7OA 1TNTA 2KFDA 3FTUA
chains in the Genus database with same CATH topology
2LOOA 1X4OA 2GTQA 1Z3XA 4XMYA 2VJ8A 5BPPA 2QVWA 3FU6A 4K5LA 4Y67A 1Q0QA 1OLTA 2Y1GA 1D1AA 1JVSA 1PJRA 3KEDA 5HNFA 4NQWB 1IRXA 2KL4A 1T0FC 2CH0A 4A03A 1AA7A 3K70C 4CUGA 4PJNA 1ONOA 3FH8A 1NG6A 1DGRM 4X0GA 3B7UX 3OYMA 3VYSB 3OYLA 2XDVA 4HRIA 2FUG2 2V26A 3IUOA 2PJRA 2VQGA 4PU2A 3DLAA 3E1SA 3K4KA 2I8DA 3B2PA 4ZW3A 4R5VA 2RREA 2HPTA 3UERA 2LRDA 3DEEA 3OR2C 2RJIA 4OAYA 2IGKA 4RM3A 3RCOA 3CZLA 4F52A 2VJIA 4D9JA 2KP6A 4XNAA 4K5NA 3A1YA 4DPRA 3ZHZA 2M0MA 2ELJA 3PUBA 3DTIA 3OYJA 3EBGA 3FUJA 1PYVA 2ZSIB 3PNTA 3HC7A 2ZXIA 4YEJA 2JA2A 2O5RA 3VYTB 4FLSA 1WJ5A 1DQUA 3OR1C 3MKYB 4X2UA 3KEYA 3EUHC 2R7TA 1MMAA 4E7JA 3SEZA 1LKXA 2BW3B 3FUDA 4IZZA 3FUKA 1MMNA 2A5WA 4ZX5A 3JSZA 2WY7Q 2E5ZA 3J7AY 2VL8A 3CP2A 4PUSA 5HLTA 3F9KA 2DT6A 2X6YA 3HXLA 4QUOA 2VJ4A 4AICA 3RTRA 4K5OA 2KRCA 2VXDA 2JV7A 1KONA 4NUBA 1G59A 4IQJA 3VYUB 2XF6A 2EGHA 4L2LA 2HQAA 4XM3A 4ZQFA 1DGWY 1QHHD 2V4JC 1N75A 5HVQC 2VIXA 4DJAA 3AL0B 2DQ6A 3CHQA 1T1RA 3DPLC 4FLRA 3CESA 3SZGA 4E7ZA 5FRNA 4B47A 4IQ4A 3UCQA 4PVBA 4BJTA 3S93A 4FLOA 3ANLA 2KHMA 5CKTA 2P0WA 2CUZA 4G6TB 4Y6SA 2KLOA 4QPQA 4ZTJA 3VSKA 4XNBA 4ZW5A 4J00A 4BEHB 3N05A 3OIPA 3LSGA 4IX7A 1FMVA 3UEQA 1FMWA 1TZLA 3IAM2 1Z21A 3CP8A 4B44A 2MD0A 2CMPA 2X6XA 4NC7A 3CZGA 4CXFA 3FUEA 2MC4A 4E7LA 2JCVA 4R7LA 2LY1A 3L2RA 3WQRA 3ZHXA 4D1QA 4CZCA 4CCLA 4BACA 1QHGA 3TBIA 3OIQA 4BXFA 4FLQA 3LMMA 4ZDPA 2QJ1A 3DKYA 4ZX3A 2L2OA 4ZW7A 2K5CA 2M4KA 4ZX4A 1E0EA 1X1AA 4OOFA 2OUMA 4ANJA 3RASA 3E0JB 2XPZA 4MS6A 2BVMA 5JHFA 1ERDA 4CCMA 1Y56A 4HSTA 3CMMA 3ZCOA 2WAQA 3CJRB 4JOMA 4IKFA 3L2QA 3L2VA 3OOUA 1G8XA 3TMOA 2L5QA 3AU8A 3W3CA 3OYKA 2HZDA 3B7TA 1SAUA 2F6CA 4CCOA 3CZKA 4XMVA 2MAPA 1R0KA 2K3PA 3DTKA 2BVLA 2ZXGA 3CZEA 2MABA 4PFPA 3UNGC 3M8JA 4QPEA 1Q0HA 3OYAA 1LFPA 4E4HA 3VSLA 4QIRA 2JVHA 4DBQA 4HNUA 2GOXB 2HVSA 4AR1A 4AYBA 3MMYB 4KISA 4HSRA 3LSIA 4BUPA 2AQEA 2KQRA 2JSPA 1T95A 5KCMA 3RQ4A 4F92B 3OY9A 2X1CA 3LL7A 4PJMA 1D1BA 3K4BA 2IS4A 2R7UA 1H19A 3PL8A 4E7KA 3RC3A 2E5NA 5KHDA 3HKZA 4C30A 4BEHA 3S3MA 4NNJA 3EBIA 3OYHA 3U21A 2W7NA 1BR1A 2CW8A 1MMGA 4C2TA 2WPGA 2Z16A 2CFOA 2PJRB 2DOAA 3D5SC 4H4KC 2X51A 4EATA 1HA8A 4RM2A 2Y1DA 2DQMA 3H5AA 2Y1FA 2UWMA 4LG3A 3S3OA 1BOBA 4R5TA 2W82A 4XMZA 3BCBA 2R72A 3ZHYA 1TT0A 4HEA2 4F3QA 3K4CA 4MKTA 2L9SA 2R70A 2R4GA 3DKXA 3FHNA 3TL4X 5JBIA 2R7SA 5LD2C 2JVGA 3OYIA 2FFLA 4KP7A 3HUGB 2F4IA 2WADA 3B7RL 4QMEA 4ZTFA 3AFHA 4RLFA 3CHPA 1UELB 3RSNA 2XQ0A 3BLYA 3DPUA 3BCAA 3K4NA 2BW3A 2DT7B 3A14A 2MFZA 2CS3A 1G5AA 3CZ6A 2WB1A 1X1DA 2VLAA 2HVRA 4CCJA 3W2VA 4ARFA 2OC6A 3LSKA 5DLLA 4JNDA 3DU6A 1GW6A 4BU2A 4YELA 4Y33A 4ZQTA 4BQQA 3OS0A 3PUUA 1ZELA 5JMPA 1WFXA 3BC8A 2M4GA 3QODA 4YRVA 4ZYAA 2RQQA 4FASD 3VWBA 3H0DA 3OL3A 4ZQHA 1Z3YA 4HG2A 1MNEA 2K9LA 4GAAA 2XF7A 2A6TA 2LG4A 2M7BA 3HPHA 3CIAA 3FU3A 1LDKB 2XAUA 4ZW6A 5EV7A 1X3ZA 4AR8A 4XLEA 3FUFA 4MLOA 4XKCA 4R79A 3IIEA 3OYFA 1X1BA 3WQSB 5FRMA 1D0YA 3W2AA 2WBMA 3PNVA 4ITVA 2CV0A 3D5RC 4Y4RA 3SYTA 3MKZA 1Z7LA 4E7SA 3FTUA 3FU0A 2R7WA 2R7RA 1HS6A 4BKXA 2OV7A 1UG0A 4Y6PA 3DPTA 3QOEA 4OOEA 4XKVA 3HOTA 2VQLA 2NOJB 4KITB 3OYGA 1QU3A 3QYBA 3LSHA 2KMUA 4Q4IA 2VJJA 1EA3A 2V1NA 2WY8Q 3DWLE 2VQCA 2KDOA 2VPLA 2IS1A 3M1CA 2LYCA 2KRHA 3OYCA 4RLQA 2WZFA 3EBHA 4U87A 4Y3OA 4XO5A 3FTZA 4ZDOA 4GAEA 3LFUA 3OYBA 1GLNA 3ANNA 1MW7A 2DXIA 1H3LA 3Q44A 4ZQEA 3CHRA 3K4LA 3AU9A 1YE9A 4XN4A 4R5XA 1X3WA 2X85A 2VASA 4KT6A 2VKHA 2V7FA 1DP3A 5JMWA 5JO0A 3RC8A 1BR4A 3KX2A 4ZDLA 3OS2A 1U0JA 2Q1ZB 3UR3C 3SEQA 4B43A 2HPIA 1N78A 4J3BA 2IGNA 1WJAA 1WJCA 4CA0A 3FTVA 1SQMA 4QHPA 1NG7A 3U9WA 3DQVC 3ONQA 3OYEA 5JAZA 2Y1CA 4BE0A 4BL0B 2CUJA 4FETA 4GRIA 4XN9A 2MYSA 1R0LA 4C9YA 4AU7A 2CV2A 4XLCA 1JG9A 2UV1A 4OAZA 4ZQGA 4ZW8A 3FTSA 4XN3A 2X6WA 3QYFA 3ZRGA 3L2WA 2LH9A 4Y6RA 1BR2A 4OWRB 4BE2A 2X1EA 3A4CA 2Y0SA 4XN0A 2LREA 3B34A 3FKJA 4XKBA 2GOMA 5HOOA 2PGGA 1V5FA 4ZJZA 4II2A 3VVLA 2XC7A 5HNHA 4PW4A 3OYNA 3EUAA 1LVKA 2WAEA 4ZX6A 2F5VA 3RPUD 4K5MA 3SDBA 3K6GA 4F93B 4XLAA 1ONNA 4JQFA 4BJ6C 3HL2A 2HPMA 4XN7A 5DYFA 1V5GA 1JI8A 1W36D 3BG6A 3H35A 3FUMA 4ZN6A 4XL9A 2VB6A 4KJZA 3FUNA 3ZGKA 1MW2A 4XLFA 4E7IA 4LITA 4RMNA 2Q2EB 2X1DA 4J01A 3EUKL 3B2XA 2QKLB 1J09A 3PNYA 3B37A 4P5OA 1MNDA 2K9MA 4P1WA 2IS2A 2E60A 3FBNB 4HPQA 3AL0C 3CHSA 4XMXA 3S32A 2HPOA 4LUPA 4C2UA 3NWSA 4PJLA 4XN8A 5KNLA 3A2KA 2JCXA 4PFOA 5JNLA 2LC2A 2W4SA 3H9GA 1X4PA 3FH5A 2HU9A 2UUZA 3S3NA 2HNHA 3OWTA 1D0XA 2IGMA 4PJJA 4XN5A 1Y6IA 2ZFUA 1K5HA 2L7KA 3L2UA 5CPRB 3H5RA 4CH7A 4CCKA 1UAAA 1VZ0A 1WJBA 1D1CA 2V9KA 1T1SA 4XMTA 3DU5A 4DGWB 1WJFA 4Q4EA 3HG9A 1RP3A 4XMUA 4XOTA 4CSWA 2VXZA 5CQGA 2C82A 1YX3A 2LBFA 4PK4A 4AVZA 2WZGA 2Z1DA 3AUAA 2B61A 1WJDA 1X1CA 3ZXSA 4BQOA 1WJEA 3AKZA 3PJRA 2KPMA 2ZXHA 2HVQA 3KYLA 4CCNA 4ZC3A 1SG7A 2CV1A 3QJXA 3EPZA 3K4JA 1N77A 1OR7A 4XN1A 3H9QA 2DCEA 2PUSA 3CHOA 3I9V2 3OL4A 2VKDA 2L9NA 3VVMA 1YX5A 2BOLA 4BQNA 3ZQQA 5FROA 4AYSA 2KZVA 3K4MA 4LIUA 4F91B 3VYRB 4B3XA 2CW7A 5FWQA 3MKWB 3C2GA 4QPOA 4XR6A 3WQQA 1Q0LA 4N4OB 4NQWA 2PMZA 3C2HA 4BE1A 2JCYA 3CJQB 4XN2A 4PSXA 3GBGA 4RCVA 3FUHA 2IS6A 4BS9A 2DJIA 4E6KG 2R59A 3T0YA 3T8VA 2M3AA 4NC8A 2C5ZA 3IP4B 1MW1A 4RSYA 4BJ5C 2QKMB 2JD2A 4XKWA 3K10A 3OMYA 4XONA 4XMWA 3CF2A 4DOZA 4XO4A 3FULA 1ZS2A 4DIQA 2ZSHB 2Z2SB 3V42A 1MVYA 2R7OA 3NWTA 4K5PA 3OYDA 1W36C 5TGTA 4XNFA 3QYEA 3FTYA 4RVBA 4XO3A 5LFAA 3PSFA 4BDZA 2HDWA 2IXSA 2IGOA 2VJ5A 3G2BA 4II3A 3S8PA 2W1OA 2R7XA 3ANMA 1MMDA 2WA0A 2VQHA 1P9QC 4N4NB 4XQFA 2MAOA 2PL5A 3R0IA 2E1MC 1MW3A 3PSIA 3HPGA 3FHEA 3FBIB 2XSJC 3FTXA 1ONPA 1SC5A 4LIVA 4XOPA 3LSMA 1D0ZA 2M7AA 3OS1A 2XPYA 4XORA 4XNDA 3ZI0A 4F55A 2JUGA 2LY2A 3FUIA 3K70D 1K6YA 1SFKA 2Y1EA 5JC1A 4XLHA 2LBFB 1S46A 3D5LA 3FH7A 4E7HA 3BG7A 2R7VA 4HNTA 2WAFA 2R7QA 3Q43A 4U7BA 5AENA 2RNGA 4FCAA 4BGDA 3IAS2 5CQEA 1MW0A 5DULA 2JD1A 1V5EA 3DTEA 1R6RA 4AR9A 1X19A 2E1MB 3I3LA 3MD2A 2V6EA 2JD0A 3H5NA 3FU5A 3JT1A 1OR7C 3PFYA 4PSWA 4B48A 3HOSA 2XF5A 3A06A 3W2WA 3H9JA 1S9HA 4DBRA 3B7SA 2AQFA 3FDYA 1JGIA 3FTWA 3VDXA 3B3BA 2W00A 3ZR8X 4BDYA 2A7OA 2O7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNF A;  5HNH A;  5HLT A;  2VLA A; 
#chains in the Genus database with same CATH topology
 2LOO A;  1XN7 A;  1PP7 U;  1Z3X A;  3V7R A;  5FLX Z;  2L7M P;  4XMY A;  4A12 A;  3S14 J;  1G2H A;  5E3O A;  2DA3 A;  3FU6 A;  1OLT A;  3FXL A;  5M5Y J;  4M9Z A;  1TLH B;  4NB5 A;  4BXX J;  1IRX A;  2R3S A;  5K7H A;  4M6X A;  1T0F C;  3P5J A;  3P9K A;  4ABZ A;  1TW3 A;  2IBD A;  1AA7 A;  3ISP A;  3K70 C;  4J19 A;  1ONO A;  2VOO A;  4EMS A;  1NG6 A;  3FHZ A;  2XDV A;  4EV0 A;  2DT5 A;  3IUO A;  3L9F A;  2VQG A;  1MZB A;  3H3V K;  4JYK A;  3LOC A;  1WZ2 A;  3E1S A;  4XRM A;  4OIO F;  4R5V A;  3UER A;  4OAY A;  4DYQ A;  2DMQ A;  3RCO A;  2EB7 A;  2BYV E;  5H2F C;  1GXP A;  2VJI A;  2KP6 A;  1V54 H;  2DFI A;  4XNA A;  2FNP A;  1R00 A;  4NDL A;  1ZGW A;  4BYY A;  3OV8 A;  3DTI A;  3PUB A;  1WHU A;  3D1N I;  3COA C;  3EBG A;  1FBU A;  5F08 A;  3CO7 C;  2O5R A;  2Q8K A;  3KZY A;  3MKY B;  2G7U A;  5M3M J;  4E7J A;  2DU9 A;  2W48 A;  4MQV A;  1LKX A;  2I5U A;  4IZZ A;  2XRO A;  1VND A;  4IVN A;  4RB2 C;  1MMN A;  3BRO A;  5BPI A;  1SVM A;  1S29 A;  5A2Q Z;  4CIC A;  3CP2 A;  2BXY A;  2DDB A;  1HKT A;  1BIB A;  3RTR A;  4EM2 A;  1JHH A;  2X4H A;  1MD0 A;  4UVB A;  1DUX C;  3FK7 A;  1OCR H;  1XSV A;  3WHB A;  3CME I;  3BR5 A;  2LLK A;  2Q0O A;  3FXU A;  2IJL A;  1T8I A;  2P5L C;  1LEB A;  1N75 A;  2DDA A;  1YW9 A;  4I0A A;  2XVC A;  5E18 F;  1IG7 A;  2FBH A;  4IQ4 A;  4I2O A;  3NQO A;  2GWR A;  1JKO C;  1ZR4 A;  3CCJ I;  4G6T B;  4Y6S A;  2DN0 A;  1AOY A;  2YUS A;  2ACJ A;  2CQK A;  3M8E A;  4QPQ A;  3F8M A;  4ZTJ A;  4XNB A;  3G1M A;  4AWX B;  1FTT A;  2NYX A;  2VBX A;  1YYV A;  1YW7 A;  3OIP A;  3LSG A;  2Y0M A;  3JSP A;  1TZL A;  4ENK A;  5HS7 A;  1IRG A;  4A6E A;  3CZG A;  4LB5 A;  2CU7 A;  1X3U A;  2OJE D;  3KYC B;  4I01 A;  4BBS J;  4CZC A;  4RGU A;  1E3H A;  3GFL A;  3OIQ A;  1UG2 A;  3TBI A;  3DEW A;  2QJ1 A;  4FLQ A;  2EIL H;  3CTA A;  5KAF C;  1F36 A;  2VON A;  1O3S A;  1JUS A;  3QWL A;  2F48 A;  3CMA I;  1WKM A;  1ZG3 A;  2M8G X;  2R5Z B;  1ERD A;  4OIN F;  4BHC A;  2BY3 A;  2VKE A;  4JOM A;  3L2Q A;  3KLO A;  3HEF A;  3OOU A;  3L2V A;  2XIG A;  2DJN A;  5HS9 A;  2CUF A;  2QGU A;  3ERM A;  3OYK A;  2HZD A;  1DDN A;  1EV7 A;  1OMI A;  1J75 A;  3KIO A;  4LMY A;  4AYB N;  1VQO I;  1TTY A;  2BVL A;  3L09 A;  3I4M J;  3IH4 A;  1HDP A;  4HX4 A;  3KET A;  2MAB A;  4PFP A;  4XSX F;  3CLO A;  4UUS A;  2STW A;  3JTG A;  2JVH A;  4HNU A;  4AR1 A;  2W84 A;  3NRV A;  4PZJ A;  4HSR A;  1XMA A;  3LSI A;  3GLL A;  4ESF A;  4Z6Y A;  5KCM A;  1T95 A;  2MA3 A;  4F92 B;  3V8J A;  5D5V B;  3RIR A;  2X1C A;  4PJM A;  2VPR A;  4M3B A;  5EF6 A;  2IS4 A;  2EIJ H;  4E7K A;  4E70 A;  1GT0 C;  4JK1 X;  1GVD A;  3ZQL A;  2HQR A;  2OBP A;  2X9D A;  2W7N A;  2WPG A;  1MMG A;  4BY7 J;  4M74 A;  2UXX A;  3P9C A;  1OQY A;  2EFO A;  4XSZ F;  4H4K C;  2X51 A;  1MSE C;  5K7Z A;  4EAT A;  4HF2 A;  2Y1D A;  2GQQ A;  2VT3 A;  5HS8 A;  3S2W A;  2P7C B;  2UWM A;  3S3O A;  2W82 A;  2CGP A;  4XMZ A;  3NEU A;  1BM9 A;  2XGC A;  2L9S A;  5GTH C;  2DW4 A;  4GAA A;  2R4G A;  3DKX A;  2YU3 A;  3LWF A;  5FLM J;  2JVG A;  2OD5 A;  3ERE D;  3OYI A;  2DPD A;  2Y48 A;  1VFC A;  4IHS A;  2D1H A;  1HST A;  3KE2 A;  4FE7 A;  4GO1 A;  2XQ0 A;  3FXJ A;  1U6G A;  1WWX A;  1XGS A;  2Z5U A;  3K4N A;  4IHW A;  4KYW A;  3CZ6 A;  1K61 A;  4LG0 A;  3W2V A;  2BGC A;  3LSK A;  3R4K A;  1ZLJ A;  4GGG A;  3LA2 A;  1GW6 A;  4YEL A;  2VBW A;  4Y33 A;  2O3F A;  3KP5 A;  4BQQ A;  5LRS A;  2LP0 A;  3OS0 A;  4RB0 A;  3QP6 A;  2DQL A;  2BBY A;  3BC8 A;  4AIJ A;  3QOD A;  4YRV A;  4L5I A;  4FAS D;  4GDF A;  4HA8 A;  2E2H J;  3OL3 A;  2RKH A;  2FBI A;  3CUO A;  4LLG F;  3RPU A;  3FMR A;  1Z1D A;  2GZW A;  1PUE E;  1X58 A;  3QU6 A;  4GCV A;  2V1U A;  3FU3 A;  2XAU A;  2PFB A;  1FY7 A;  2STT A;  5C4J J;  4AR8 A;  2CO5 A;  3CC7 I;  4R79 A;  1JTY A;  3OYF A;  5GAG J;  1X1B A;  4MHG A;  1HF0 A;  3M1E A;  1YOV B;  1NK2 P;  2FE3 A;  4HZF A;  1NH3 A;  4A3E J;  2V9P A;  2KIU A;  4HF1 A;  1UHM A;  3SYT A;  5M5X J;  3MKZ A;  5FD6 A;  3FU0 A;  1R5H A;  3MEX A;  1H88 C;  4KT5 C;  2LKS A;  1MDM A;  4OOI A;  2HOE A;  2CQQ A;  3V4G A;  5BNG A;  3F3X A;  1YS7 A;  5AON A;  1EA3 A;  2LK2 A;  1ZH5 A;  3M4O J;  1YIO A;  2Q2E A;  3Q0U A;  4M9S A;  2ID6 A;  4AM3 A;  3REO A;  1O57 A;  1IC8 A;  2VPL A;  2KRH A;  4RLQ A;  3EBH A;  4U87 A;  4UNO A;  4Y3O A;  5HLH A;  1J0R A;  3OYB A;  4NHJ A;  3HOZ J;  1UHW A;  1KU3 A;  1H3L A;  3Q44 A;  3CHR A;  2FJ1 A;  5J40 A;  2ETH A;  1BI2 A;  1ZYR F;  4V2F A;  2KT0 A;  3E5X A;  2EFW A;  5GP9 A;  4IF4 A;  4DYC A;  2EV0 A;  2P81 A;  2VKH A;  1DP3 A;  2HWV A;  5TRD A;  1JE8 A;  1SMY F;  3GZ6 A;  2NVU B;  1HDD C;  2O0Y A;  2Q1Z B;  3UR3 C;  3SEQ A;  4B43 A;  2DYS H;  3CCU I;  1WJC A;  1SQM A;  4QHP A;  4HQE A;  3DKW A;  4BE0 A;  2QSF X;  1T08 B;  3CMY A;  1P4W A;  1MJ9 A;  3PFI A;  2GA2 A;  3T8R A;  2JA8 J;  2OQG A;  1IF1 A;  1JG9 A;  1T33 A;  2AS5 F;  2UV1 A;  1QBJ A;  4IRI A;  2E7W A;  4G6D A;  1BI3 A;  1JJ6 C;  3L2W A;  4Y6R A;  1Y8R B;  4OWR B;  3TO6 A;  3S1N J;  4A3L J;  4L9J A;  4BE2 A;  2QQA A;  2Y0S A;  3MZY A;  3O2P E;  1JKR C;  2LRE A;  2VT2 A;  3FKJ A;  2XUB A;  4XKB A;  3B34 A;  5FB2 A;  5CJ9 A;  2PGG A;  4I02 A;  3WE2 A;  3DBL B;  2XC7 A;  5HNH A;  4FCY A;  3D0S A;  3OYN A;  1LVK A;  3HDD A;  4K5M A;  3ZMT A;  5IYC J;  4BJ6 C;  2RQP A;  3BPX A;  3HRU A;  3O3K A;  4XN7 A;  1V5G A;  4N9H A;  2JJ7 A;  3HOV J;  4UUS B;  3K2Z A;  4ZN6 A;  4C3H J;  3ZGK A;  5D8L B;  2J5O A;  2W25 A;  1LUJ B;  3ML6 A;  5HDK A;  2DMP A;  1QVT A;  3PNY A;  3R60 A;  5JFR A;  3NAR A;  3J7Y J;  2LF7 A;  1YI2 I;  4HOB A;  4IRH A;  3FBN B;  3WTS C;  4ZH4 F;  2O61 A;  2YS9 A;  5IT3 A;  2HPO A;  4EEF G;  3NWS A;  2RC4 A;  4LFU A;  3A2K A;  4PFO A;  4FX4 A;  2W4S A;  1BI1 A;  3H9G A;  3FH5 A;  4B09 A;  3PQK A;  3LNQ A;  3OWT A;  2R5Z A;  1Y0N A;  2NVT J;  1ZKG A;  3KEO A;  4QWQ A;  4M72 A;  1R36 A;  1R4M B;  1Y6I A;  1XTA A;  3PUF A;  4ENN A;  2L7K A;  1HC8 A;  4O6J A;  2JN6 A;  2QCO A;  5FFZ A;  3MWM A;  1VI0 A;  2ICW G;  3I54 A;  1RR7 A;  1UAA A;  4NBQ A;  3JRG A;  3DU5 A;  1WJF A;  4B8X A;  1OCO H;  4XMU A;  1Z67 A;  4CSW A;  4PK4 A;  1TC3 C;  3AUA A;  2Z1D A;  1RRJ A;  3JAM Z;  1WJD A;  3M8F A;  1USS A;  2IW5 A;  1REP C;  4MNU A;  2VKV A;  2I10 A;  2M45 A;  3QJX A;  3EPZ A;  3K4J A;  1N77 A;  1E17 A;  4B3A A;  4XN1 A;  1EKE A;  2YPR A;  3I9V 2;  1UFM A;  3WU1 B;  1L0O C;  3VVM A;  5GPA A;  3FZV A;  1V4R A;  2BOL A;  2IA0 A;  4L0Z B;  3TP0 A;  5FRO A;  5H6Q A;  4X1E A;  2KZV A;  3ZMZ A;  4F91 B;  2K7L A;  1FP2 A;  2RN7 A;  3F8F A;  4XR6 A;  2Z9O A;  3WQQ A;  1Q0L A;  4N4O B;  2F5C A;  3JCU C;  4NQW A;  2PMZ A;  2M30 A;  3BTC A;  3C2H A;  4P96 A;  2HTS A;  1T6S A;  2HKO A;  2RVC A;  3BG3 A;  5F1R A;  1YRN B;  1W4M A;  1QZY A;  3VFZ A;  3CJQ B;  1GV2 A;  3FUH A;  1A04 A;  3ZMU A;  5C44 J;  6PAX A;  1ZAR A;  3T0Y A;  4HF0 A;  4B4C A;  3T8V A;  5E1X A;  3DBR B;  3HGY A;  3ZQF A;  1XB4 A;  1AHD P;  2JPB A;  3L7W A;  1MW1 A;  1PUF A;  4XKW A;  3ULQ B;  3AG1 H;  5FKM A;  3CF2 A;  1BIA A;  1F9N A;  3HOX J;  4DOZ A;  3J7Z I;  3GTG J;  1ETO A;  3I0T A;  2ZKZ A;  4HAM A;  1I6X A;  1DPU A;  2DA5 A;  4LB6 B;  4PGH A;  4RB3 C;  2HYG D;  3IL2 A;  5IOY A;  1B8I B;  2JZY A;  5TGT A;  1YO5 C;  1YJW I;  1YJ9 I;  1I3Q J;  3WTX C;  1U2W A;  3O8H A;  5LEK A;  2DA7 A;  4RVB A;  1KYW A;  2E36 A;  1OFC X;  1TBX A;  3G2B A;  4II3 A;  4ENJ A;  2EJR A;  1MMD A;  3R0I A;  1LFU P;  1SVO A;  5CVJ A;  2E1M C;  1MMS A;  3BWG A;  3IHU A;  4V19 K;  3GFM A;  1FP1 D;  3FBI B;  5DD8 A;  2JA6 J;  1ONP A;  2GA1 A;  5K5Q A;  4LIV A;  3OS1 A;  2A07 F;  2H27 A;  2H1L A;  4XOR A;  2CQN A;  3CCR I;  1YS6 A;  2LY2 A;  2LDU A;  3FUI A;  4BHP A;  1MBJ A;  3JAM K;  4A5N A;  3GTO J;  2HOT A;  5JC1 A;  5LLQ A;  1S46 A;  3D5L A;  3FH7 A;  3KZZ A;  4UVC A;  4E7H A;  2H1K A;  3L00 A;  1JUM A;  2FXA A;  2QVO A;  2BV6 A;  2IA2 A;  2RNG A;  2L4A A;  1MW0 A;  1FWZ A;  3TDZ C;  1X3W B;  3DTE A;  3HKZ N;  4WXD A;  3ZMS A;  5D5X B;  3PM1 A;  3ABT A;  2MD5 A;  4WCG A;  1LE8 B;  4A3C J;  3IKV A;  5ERI A;  2HI3 A;  3SJM A;  1OR7 C;  2JRT A;  3HSF A;  4PSW A;  4B48 A;  1A31 A;  4G9Y A;  1RPW A;  3HOS A;  5JVT A;  3W2W A;  4IXA A;  5ILU A;  2O8X A;  3IC7 A;  4DBR A;  5ICC A;  3FDY A;  3B7S A;  5TJJ A;  1XD7 A;  9ANT A;  3ABU A;  4S04 A;  2GTQ A;  5LBQ A;  4QIW N;  2VJ8 A;  3GUD A;  3IWF A;  5DCM B;  3ZP5 A;  4UY8 I;  2QVW A;  2L3D A;  4Y67 A;  1P7J A;  2JMW A;  3BR2 A;  2NRA C;  1PJR A;  3KED A;  2ZCW A;  2KL4 A;  3JTH A;  1BBY A;  2V79 A;  2BZT A;  5IY5 H;  1HQC A;  1W5S A;  3I59 B;  5EZG A;  2IT0 A;  4LLN A;  4A03 A;  4PJN A;  1FYM A;  3FH8 A;  1OKR A;  2XGD A;  1LJ9 A;  1IDZ A;  4X0G A;  3CCQ I;  3W6V A;  4EJW A;  3B7U X;  3OYM A;  5F0F A;  2ZME A;  2FUG 2;  3IH3 A;  2PJR A;  3JW4 A;  3WTZ A;  4DYR A;  4PU2 A;  2XHK A;  2OA4 A;  3R0J A;  3O8G A;  3B2P A;  4RGR A;  2HPT A;  2RRE A;  4JX4 A;  1MBH A;  3IKT A;  2TRT A;  2HTJ A;  3BJO A;  4C2M J;  1XGM A;  1CF7 A;  5DDG A;  4D9J A;  1IJW C;  3A1Y A;  2H94 A;  2M0M A;  2ECB A;  3GWZ A;  2XAF A;  3CCY A;  1SD5 A;  2K3F A;  1PYV A;  3PNT A;  5JLW A;  2CQX A;  2ZXI A;  2P5V A;  2ME0 A;  3VYT B;  4X2U A;  5KVR A;  4S05 A;  4G7Z F;  1Z0X A;  2F2E A;  1Y39 A;  1MMA A;  2ADU A;  3RDI A;  3SEZ A;  2BW3 B;  2A5W A;  4ZX5 A;  3I4N J;  2EH3 A;  3EUH A;  1FC3 A;  5HLT A;  4PGG A;  3HW2 A;  4QUO A;  4P9F A;  1ONV A;  2VJ4 A;  4RS8 A;  3LA7 A;  4BHB A;  3J80 K;  2VXD A;  2X48 A;  4NUB A;  4IQJ A;  1G59 A;  3VYU B;  1SVL A;  2XF6 A;  2K4J A;  4IPA A;  2HYJ A;  2GM4 A;  3RZO J;  2F4O B;  4XRS A;  1I50 J;  2VIX A;  1XGN A;  4BH9 A;  4DJA A;  2LFB A;  5FLV A;  2R93 J;  2DQ6 A;  3DPL C;  4FLR A;  3CES A;  4LK1 F;  4E7Z A;  5FRN A;  4FLO A;  1G3S A;  3RQI A;  3ANL A;  2KHM A;  5CKT A;  2CUZ A;  2PJP A;  5CVV A;  1AKH A;  1FYK A;  1VQ8 I;  2R7F A;  5FKK A;  3VSK A;  4ZW5 A;  4XIC A;  3S2D J;  5EGO A;  1AWC A;  5TIS C;  4GFB A;  4RAZ A;  3UEQ A;  3N97 A;  1Z21 A;  4B44 A;  1T2K A;  1UJ8 A;  3H3Z A;  2M9H A;  2CMP A;  1WH7 A;  5J4V A;  3GTM J;  5K7F A;  3DCF A;  1QNT A;  2AXL A;  4E7L A;  2JCV A;  2LY1 A;  3L2R A;  4D1Q A;  1T98 A;  2EIM H;  1QHG A;  2ZO4 A;  4BXF A;  5K5R A;  1H9T A;  1I3A A;  3DKY A;  1YIJ I;  4R8H A;  4ZW7 A;  2K5C A;  1IDY A;  2X6O A;  3RKW A;  4OOF A;  1OYW A;  2EBI A;  3RAS A;  4U7D A;  3CJN A;  5M5W J;  2RDP A;  4UB8 C;  1JGG A;  5IOZ A;  1BOA A;  1Y56 A;  4HST A;  4L9T A;  3CMM A;  5J3L A;  1FNN A;  2F5F A;  2VC0 A;  2K4B A;  3CJR B;  4ZYE A;  5AIQ A;  3WGH A;  2BHY A;  2QLZ A;  3BQZ A;  3H36 A;  3MN2 A;  1KU7 A;  1VTN C;  3K7A J;  2PMZ N;  1K7A A;  2HR3 A;  3W3C A;  5H20 A;  3B7T A;  1SAU A;  2F6C A;  2VUM J;  2Z33 A;  1R0K A;  4EQQ A;  4CYC B;  1RES A;  3DTK A;  3UNG C;  3RI4 A;  4QPE A;  1TWG J;  3CXB A;  3OYA A;  2ECC A;  3VSL A;  4FTH A;  2HVS A;  3FXO A;  3LSJ A;  4EGY A;  1P4X A;  4S0H B;  4KIS A;  1VQ6 I;  3GLX A;  3OY9 A;  4IO9 F;  5FGM A;  2EWN A;  5F64 A;  1D1B A;  2R7U A;  2P5K A;  2A5Y B;  1CF7 B;  2Y30 A;  5KHD A;  2MW8 A;  1KGS A;  1NK3 P;  1SFE A;  2CW8 A;  2Z16 A;  2CFO A;  4UHT A;  1MSF C;  2L7F P;  3CJT B;  3ASO H;  4HYE A;  1VQN I;  3S2H J;  2XPU A;  5D8K B;  1HA8 A;  1P4A A;  4RM2 A;  1QZE A;  5DTD A;  1PUF B;  1YJN I;  4LG3 A;  2DPU A;  1DU6 A;  4F3Q A;  3CC4 I;  3K4C A;  1E2X A;  5L3D A;  1HW2 A;  4CZZ A;  2XKO A;  1KQ0 A;  4N9I A;  4B1R A;  2EFN A;  1VQ4 I;  1F43 A;  3V7C A;  1B4A A;  5B1A H;  2E34 A;  2PMU A;  3Q9S A;  3HSE A;  1B9M A;  1HCR A;  2HOS A;  2B63 J;  3B7R L;  1PP8 F;  1Z77 A;  1UCR A;  3AFH A;  3BJA A;  3FM5 A;  2HDC A;  2V6C A;  1UEL B;  1IXS B;  2L4M A;  3BCA A;  2BW3 A;  2DT7 B;  3A14 A;  1HBX G;  2CS3 A;  3KP4 A;  2Y31 A;  1X1D A;  2AXT C;  3I71 A;  4EJT A;  4X6A J;  3ZQG A;  4I09 A;  1GV5 A;  1K83 J;  2KIS A;  4BU2 A;  2JSC A;  2NNN A;  3JRE A;  2EV6 A;  4ZQT A;  3I4P A;  2ME6 A;  3PUU A;  1ZEL A;  2YX7 A;  2M4G A;  1X1P A;  1IV8 A;  3VWB A;  4PCQ A;  3W6J B;  3JRF A;  3GEZ A;  1VQ9 I;  3B6C A;  5CYV A;  1MNE A;  2OQR A;  3T5X A;  2XF7 A;  1ON2 A;  4MQ9 F;  2KJC A;  4ZW6 A;  4DNC A;  1X3Z A;  1RC9 A;  4CHU A;  4XLE A;  5KAI C;  4FE4 A;  4UXN A;  3IIE A;  3BTJ A;  1JGS A;  4IL6 C;  2LR8 A;  3HRS A;  4HX8 A;  1FSE A;  3WQS B;  5FRM A;  1D0Y A;  4NC6 A;  1XMX A;  2CV0 A;  2XAG A;  3D5R C;  4YFX F;  1MGT A;  4BKX A;  4EVI A;  1HS6 A;  1BC7 C;  1O3T A;  3TOB A;  2FNA A;  4Y6P A;  1BI0 A;  3BR6 A;  3QOE A;  1S72 I;  3BZK A;  4U0V A;  3HOT A;  1JKP C;  2NOJ B;  4KIT B;  3LSH A;  3IRR A;  4M3E A;  2DOF A;  1BN5 A;  2VQC A;  3RKQ A;  3M1C A;  3PQJ A;  3A02 A;  5GAE J;  5F0H A;  2ISZ A;  2XRL A;  2FA5 A;  1SFO J;  1ZQ3 P;  1OYY A;  1R1V A;  2A6E F;  1ITY A;  1XSX A;  5F6F A;  4PJ0 C;  4L5J A;  4ZDO A;  3WTW C;  2E2I J;  3G3Z A;  3LFU A;  1U5T C;  1MW7 A;  4A3M J;  3HYI A;  4XBF A;  4UB6 C;  1A6I A;  1ZRF A;  1JUP A;  1X3W A;  2X85 A;  2M5W A;  4KT6 A;  1RUO A;  4MO7 A;  2PQ8 A;  2A61 A;  2WTE A;  4HV6 A;  2DAO A;  3RC8 A;  1BR4 A;  3RYP A;  3CLQ A;  3KX2 A;  1TWF J;  4ZDL A;  1LPQ A;  2ELK A;  1WPK A;  1U0J A;  1N78 A;  2IGN A;  2QQB A;  4RGS A;  2K9N A;  3SDG A;  3WU0 A;  3LFK A;  3FTV A;  1NG7 A;  3U9W A;  1MIJ A;  3ONQ A;  3OYE A;  2Y1C A;  2CUJ A;  4FET A;  3CUQ B;  1BJA A;  1R0L A;  4Y13 A;  1OCP A;  4HV5 A;  4OIP F;  2PMH A;  3ABL H;  1IUY A;  2CV2 A;  4A0Y A;  2ZXJ A;  1OJL A;  4AIK A;  5IP9 J;  1Y1W J;  4RA2 A;  4XN3 A;  1RI7 A;  2OZ6 A;  1OCZ H;  1FPQ A;  2QEN A;  3F22 A;  2GXG A;  2EZK A;  1FJL A;  2X1E A;  3A4C A;  3BOQ A;  4XN0 A;  3MVP A;  2DFH A;  1VQM I;  1V5F A;  4IJA A;  3KEQ A;  3HTS B;  1KQ8 A;  1HOM A;  2OPT A;  5A2Q K;  4L9V A;  3EUA A;  2WAE A;  3KP7 A;  4BXU A;  3LSR A;  4A3B J;  1EF4 A;  2AO9 A;  4G94 A;  3SDB A;  3K6G A;  1A35 A;  2F5D A;  3ABK H;  4ZYG A;  4JQF A;  1Z6T A;  2BXZ A;  3KLN A;  3PIP F;  2HPM A;  2EIK H;  1W36 D;  3H35 A;  2MH9 A;  3FUM A;  3ELK A;  4KJZ A;  3HIF A;  3WTV C;  3FUN A;  3E6B A;  4XLF A;  3SQN A;  3UKG A;  4LIT A;  3EYY A;  1O4X A;  5C4X J;  5HOD A;  3TQN A;  3M7G A;  1LDJ A;  1TNS A;  4XRF A;  4P1W A;  3MZH A;  4IHT A;  2HYF A;  2ZB9 A;  5DCF A;  4LUP A;  3ROU A;  4DW6 A;  3LST A;  4ESB A;  2VBZ A;  4PJL A;  3HB9 A;  5BOX A;  4XN8 A;  2XPW A;  2JCX A;  2LC2 A;  3A0B C;  3QPT A;  3LSP A;  2DMU A;  2HU9 A;  1YG2 A;  3BR1 A;  3G73 A;  5IT9 K;  2UUZ A;  3S3N A;  2F4M B;  2ZFU A;  4MFE A;  4MFD A;  1K5H A;  2E7X A;  3FWE A;  3H5R A;  1D8J A;  2VE9 A;  2M34 A;  1RNL A;  4CCK A;  4Y7N J;  1WJB A;  2Z3Y A;  1D1C A;  4KMU X;  4IHY A;  4Q4E A;  1Z91 A;  3HG9 A;  2QSH X;  2DOD A;  2C82 A;  1YX3 A;  5FKO A;  1FX7 A;  1RET A;  3BG9 A;  1MNM C;  3RPQ A;  2E71 A;  3M07 A;  3ZXS A;  4D5C A;  3AKZ A;  3PJR A;  1FT9 A;  1QO0 D;  3E6D A;  4KDP A;  1HW5 A;  1MBF A;  1SG7 A;  3CHO A;  1QRY A;  3A01 B;  1AKH B;  2VKD A;  1WI3 A;  2L9N A;  2R0Q C;  2LNB A;  1XPX A;  5K1Y A;  3MQ0 A;  3K4M A;  3VYR B;  4B3X A;  3U1K A;  2DMN A;  2MSY A;  3K9T A;  3P9I A;  5L3C A;  1JXS A;  4M9X A;  4MTE A;  5LEJ A;  2JUC A;  4BE1 A;  1O3Q A;  1VQL I;  2ZJ2 A;  4XN2 A;  2ZJR F;  1WRJ A;  3ABM H;  2YR2 A;  2IS6 A;  5FKN A;  3G71 I;  4E6K G;  1J59 A;  2R59 A;  3LQR A;  1YRN A;  4MTD A;  1RUN A;  2IA1 A;  1IZ1 A;  3K10 A;  1GHC A;  1T38 A;  1Z05 A;  3FUL A;  4DIQ A;  4AID A;  2QA4 I;  2E1C A;  1B9N A;  1BJZ A;  5E1Z B;  3V42 A;  5D4S A;  1MVY A;  2LSO A;  1HSJ A;  5J1Y A;  3OYD A;  1W36 C;  4KFC A;  4KN7 X;  1ETX A;  3E3V A;  4BAY A;  3DP7 A;  4XO3 A;  5LFA A;  4BDZ A;  2B0L A;  2HDW A;  2UZK A;  2ESN A;  2PI0 A;  2IGO A;  1MDM B;  2R7X A;  3ASN H;  3HBL A;  2FEZ A;  4XQF A;  3OOP A;  4JBA A;  2MAO A;  2BY2 A;  2PL5 A;  2JA7 J;  1MJB A;  3F72 A;  2L0K A;  2XSJ C;  1KU2 A;  2LD5 A;  2O6G E;  5B3S H;  2ZME B;  2M7A A;  2BEO A;  3PO3 J;  2W24 A;  1MKM A;  2QEX I;  3I59 A;  3QPL A;  1K6Y A;  1SFK A;  3TW6 A;  1E3O C;  1TP4 A;  4XLH A;  2LBF B;  4CGZ A;  4G12 A;  2KIF A;  2E2J J;  4HNT A;  2R7Q A;  2IP2 A;  2K9Q A;  1HW1 A;  1ODD A;  3K1N A;  3IAS 2;  4WK8 F;  1BL0 A;  5DUL A;  5EGO B;  2ZJP F;  4AR9 A;  4ZZL A;  3K1M A;  2E1M B;  3I3L A;  3RKY A;  1SD7 A;  1WQ2 A;  5B1B H;  3H1C A;  4WXC A;  3PFY A;  3Q5F A;  2DMT A;  4ASN A;  3B3B A;  1QZZ A;  2DA6 A;  3KP6 A;  5ILV A;  4BDY A;  2O7G A;  2EQR A;  1U9N A;  4G8X A;  1X4O A;  2K02 A;  4L5E A;  3SZT A;  5BPP A;  3FM3 A;  4Y52 J;  3FXM A;  4K5L A;  1FBS A;  2ZC2 A;  5HLG A;  1Q0Q A;  2K27 A;  2Y1G A;  2VC1 A;  5LHG A;  3I55 I;  3GZ5 A;  4EGZ A;  3ZOB A;  3BZC A;  4NQW B;  2FMY A;  1ETV A;  2CH0 A;  2XAS A;  1BW6 A;  5JHU A;  4CUG A;  3WTT C;  1DGR M;  4FX0 A;  1VF9 A;  1W5T A;  3VYS B;  4YFN F;  3OYL A;  1F5T A;  4XRS G;  3MFK A;  3E6M A;  3K4K A;  1LNW A;  2LKX A;  3DEE A;  5B66 C;  3OR2 C;  3TDU C;  2RJI A;  2DLL A;  3CZL A;  3CCE I;  2HXI A;  4F52 A;  3J81 Z;  2QQ8 A;  2EFP A;  4K5N A;  3F8N A;  4DPR A;  3ZHZ A;  2CRG A;  2ELJ A;  4AD9 A;  3HC7 A;  3H92 A;  4YEJ A;  2JA2 A;  4FLS A;  3OR1 C;  1DQU A;  1FIP A;  3EUH C;  1R71 A;  2R7T A;  1IO2 A;  1DPR A;  3B73 A;  1P7I A;  1T0F A;  2OCC H;  4D7M A;  1L3L A;  3BTL A;  3FUK A;  3JSZ A;  3MAJ A;  3U1D A;  2E5Z A;  4A2U A;  3GXO A;  1X2M A;  2DT6 A;  2X6Y A;  3F9K A;  1ZLK A;  3HUG A;  5HDG A;  4K5O A;  3TED A;  5BS6 A;  4PDK A;  2JV7 A;  3Q0W A;  1IN7 A;  4L2L A;  2HOA A;  2EGH A;  2IAI A;  2HQA A;  4XM3 A;  4FHT A;  2V4J C;  5HVQ C;  3SHF A;  2CSO A;  4GXO A;  5BMZ A;  3SZG A;  3GFI A;  4B47 A;  1ZRD A;  3UCQ A;  2DK8 A;  4BJT A;  2N8G A;  2P0W A;  3K0L A;  4A0Z A;  2O7O A;  2M2E A;  3V7S A;  2KLO A;  5DD4 A;  3CCL I;  3V8L A;  4OU0 A;  2D45 A;  4J00 A;  3QRF F;  2J5P A;  2PX9 A;  1T56 A;  4ENM A;  1FMV A;  3GX4 X;  1FMW A;  3IAM 2;  3E5U A;  1VQ7 I;  2YX4 A;  4NC7 A;  4R7L A;  3ZHX A;  3WQR A;  2CG4 A;  3HTU A;  4CCL A;  4W1U A;  4BAC A;  3WE3 A;  5EG0 B;  2DBB A;  1A36 A;  1Z6R A;  3LMM A;  4M73 A;  4ZX3 A;  2L2O A;  3VOD A;  1U3E M;  5H6R A;  2KIM A;  1G4D A;  1E0E A;  1X1A A;  5IYD J;  3PIO F;  3W6K B;  2ISY A;  2EK5 A;  4Q47 A;  5JHF A;  3ZPL A;  4LG0 B;  3BG5 A;  4OIR F;  3JSO A;  3B02 A;  3BPV A;  1F1Z A;  2HS5 A;  3BZ6 A;  3WHC A;  3CCS I;  2V1D A;  1G8X A;  3TMO A;  3GZN B;  2A68 F;  1FBQ A;  2XRN A;  1K4T A;  4EJO A;  3CZK A;  3Q0V A;  4XMV A;  1U9O A;  2HXO A;  2XB0 X;  2Y69 H;  3CDI A;  2ZXG A;  1W0T A;  3GFJ A;  4R1H A;  1UHS A;  2NAZ A;  1Q0H A;  3R61 A;  5EG0 A;  4G7O F;  4DBQ A;  3MCZ A;  1ETK A;  2GOX B;  5HLI A;  1B72 B;  4AYB A;  1O3R A;  3K2A A;  4RAY A;  4P9U A;  3LL7 A;  3K4B A;  1H19 A;  5CVR A;  3PL8 A;  4KIB A;  3RC3 A;  5EEH A;  2DFF A;  2E5N A;  1ORK A;  2EZL A;  1FZP B;  4L0Y B;  3NAU A;  3HKZ A;  3S3M A;  3VEP A;  3VPR A;  4DQ2 A;  2DYR H;  2DTZ A;  2HQN A;  3DF8 A;  3OYH A;  4UUT A;  1BR1 A;  1XDS A;  1HLV A;  1G3W A;  2JQ7 A;  5J4Y A;  2BHZ A;  2DOA A;  3D5S C;  2CWE A;  4ZYD A;  1JJ8 C;  2WC2 A;  2BY1 A;  1I1S A;  2Y1F A;  1YQA A;  2GXB A;  1BOB A;  3ZHY A;  3BCB A;  5D5U B;  4I76 A;  4EM0 B;  2BY0 A;  4MKT A;  2R70 A;  1FOK A;  1R4N B;  3CQZ J;  2TCT A;  3HZJ A;  2XGE A;  5DEQ A;  5JBI A;  1R9T J;  3KCC A;  2XAQ A;  3HUG B;  1SEU A;  1UZC A;  4UVA A;  4UUV A;  3S17 J;  4QME A;  5CLS A;  5CVI A;  4ZTF A;  3CC2 I;  4QSH A;  2MGQ A;  4RLF A;  2GIZ A;  3X2Q H;  1SAN A;  3HOY J;  3CHP A;  2A05 A;  1IN8 A;  1XX5 A;  2JK3 A;  1TW2 A;  2MFZ A;  1J7K A;  2VLA A;  4CCJ A;  2RNJ A;  2OC6 A;  4Q5S F;  2WB1 N;  3WGG A;  5DLL A;  4JND A;  2CYY A;  3JRI A;  3DV8 A;  2EIN H;  3F0C A;  1K79 A;  4QLC U;  3GTJ J;  1IW7 F;  1POG A;  1DU0 A;  2NOG A;  1ETY A;  2G9W A;  2RQQ A;  3ESW B;  4A69 C;  4ZQH A;  5J1U A;  1Z3Y A;  4OMZ A;  5ILS A;  4EJU A;  4HG2 A;  4IOA F;  2LTP A;  2A6T A;  2L01 A;  3HPH A;  3CIA A;  1EJ9 A;  3I58 A;  5EV7 A;  2FRH A;  4MLO A;  4XKC A;  1MH4 A;  5HDN A;  2O03 A;  4ITV A;  2DA1 A;  4UV8 A;  3BQY A;  3GW2 A;  1Z7L A;  4E7S A;  5LHI A;  1YLF A;  3KP3 A;  1KA8 A;  2UXN A;  2L9R A;  3R6S A;  5ICG A;  1LFB A;  4P55 A;  3DPT A;  3H0G J;  3OYG A;  1R5G A;  3FK6 A;  3OIO A;  1QU3 A;  3FX3 A;  1QA6 A;  2NS7 A;  2DK5 A;  4HDV A;  2OU2 A;  2NVX J;  1JT6 A;  2KDO A;  2WZF A;  5DM7 F;  4I99 C;  4XO5 A;  4GAE A;  3BP8 A;  2ZXW H;  4HLX A;  1GLN A;  4HX7 A;  3ANN A;  1LEA A;  1YE9 A;  2K85 A;  2K86 A;  4EJV A;  1B6A A;  1SFX A;  2V7F A;  3AG3 H;  1PVE A;  5JO0 A;  1OPC A;  5E1W A;  2IPQ X;  2GXA A;  4M71 A;  1WJA A;  1J9I A;  3JR9 A;  1UST A;  3C1D A;  1TT5 B;  4IRG A;  2WWY A;  4AC0 A;  4BL0 B;  2A6H F;  2RGV A;  4GRI A;  2MG4 A;  4AU7 A;  4MIM A;  1GXQ A;  1K4S A;  3FTS A;  2FBK A;  1MH3 A;  2DQR A;  1BR2 A;  2PN6 A;  2EV5 A;  3EET A;  1D5V A;  3WTU C;  3AG4 H;  4FIS A;  3ZQH A;  1O7L A;  2TDX A;  3CCM I;  4II2 A;  1XS9 A;  5B5E C;  3VVL A;  5E8I A;  2EZH A;  4PW4 A;  2RAE A;  3RPU D;  2CJJ A;  2COB A;  2EZI A;  4XLA A;  1ONN A;  1B72 A;  5DYF A;  1QPM A;  3HRT A;  2XB5 A;  1JI8 A;  1APL C;  1EH6 A;  2VB6 A;  1V3F A;  3FF5 A;  4E7I A;  2V9V A;  4RMN A;  4CYD A;  4M6V A;  3B6A A;  1SAX A;  4A3J J;  3B2X A;  3GO5 A;  2QKL B;  2IS2 A;  5GPC A;  2K9S A;  4HPQ A;  2D1V A;  4XMX A;  1A6Q A;  4C2U A;  2HQ5 A;  4RGX A;  1WSU A;  4BNC A;  5JNL A;  1X4P A;  3Q3S A;  5J8F A;  3BR3 A;  1D0X A;  2E35 A;  5BPD A;  3ZMV A;  1XG1 A;  2IGM A;  3FXR A;  4PJJ A;  4XN5 A;  5FFX A;  3G6E I;  1S3J A;  4RAF A;  3ZQC A;  1X3Z B;  2DOE A;  1Q1V A;  2COM A;  5JI6 A;  2JPC A;  4TV7 A;  1RKT A;  2L7Z A;  1VZ0 A;  5F04 A;  2V9K A;  4XMT A;  2LY9 A;  2H6B A;  1IRF A;  1LVA A;  1LQ1 A;  1IN4 A;  4XOT A;  4KMF A;  1RP3 A;  1IRZ A;  5D6E A;  4YFK F;  3AAF A;  2VXZ A;  2WZG A;  2LBF A;  2B61 A;  4BQO A;  1WJE A;  2ESH A;  2ZXH A;  2Y9Z A;  5ICE A;  1DP7 P;  4CCN A;  1X2N A;  5L3E A;  2DCE A;  2QUF A;  1C0W A;  2PLY A;  3F6O A;  5IT9 Z;  1YX5 A;  3U2R A;  1O7F A;  2QQ9 A;  1WGX A;  2XKP A;  3CDL A;  3ZQQ A;  5IP7 J;  4AYS A;  1TL8 A;  4MGR A;  1D8K A;  2CW7 A;  2ZJQ F;  4A5M A;  2KZG A;  3DEU A;  3C2G A;  1ACI A;  5J47 A;  4Y17 A;  2M1B A;  4IHV A;  5FKL A;  1FOY A;  2E1O A;  4L18 B;  4V2G A;  2QSG X;  3ZN0 A;  3SFZ A;  5FLX K;  5DS9 A;  3S1R J;  4PSX A;  1TWA J;  3GBG A;  1TQM A;  4ZYH A;  4FQG A;  4BS9 A;  2QBY A;  4RBO A;  1I39 A;  4NC8 A;  3IP4 B;  2KKO A;  4RSY A;  5D6F A;  2QKM B;  2HDD A;  2O8K A;  4KA4 A;  1FEX A;  3BT9 A;  2JA5 J;  2KDZ A;  1R22 A;  4KN4 X;  4YIR X;  3VOE A;  2ZSH B;  3A01 A;  4WX9 A;  1IV6 A;  3NWT A;  4K5P A;  1H89 C;  1R1U A;  1XGO A;  4XNF A;  3GTL J;  3JRH A;  3FXQ A;  3HM5 A;  5LGT A;  1ZG1 A;  1SFU A;  5E8G A;  2IXS A;  2VJ5 A;  4I98 B;  4HBL A;  3S8P A;  3ANM A;  2W1O A;  2MC3 A;  3K69 A;  4Q48 A;  1NTC A;  2VQH A;  1P9Q C;  2RV8 A;  5F1J A;  3RYR A;  3Q9V A;  3HPG A;  5K5O A;  1H0M A;  3WG9 A;  2YU9 J;  3FHE A;  1ZN2 A;  1U8R A;  4U88 A;  1QPI A;  5EEG A;  4XOP A;  3LSM A;  1D0Z A;  1R1T A;  1RIO H;  3ZI0 A;  2VN2 A;  3CDH A;  4F55 A;  2IRF G;  2JUG A;  3CO6 C;  4CYC A;  5LHH A;  3K70 D;  4JX5 A;  3LA3 A;  1R5I D;  1W7P D;  4QTR A;  3HGG A;  1IXR C;  3FXK A;  4D5F A;  1U8B A;  2R7V A;  1ZR2 A;  2WAF A;  1WVR A;  3SZP A;  3I5U A;  3Q43 A;  4U7B A;  5AEN A;  4I6Z A;  1ETQ A;  3A0H C;  2JTV A;  1I27 A;  4FCA A;  2GIV A;  4K2E A;  2JD1 A;  1V5E A;  1IXC A;  1S5L C;  3T1B A;  1KYZ A;  3CF5 F;  2OF7 A;  5E20 A;  1UB9 A;  2NXN B;  2MLK A;  2O9L A;  1W7P B;  1IAW A;  1V55 H;  3H9J A;  1S9H A;  2R7D A;  2AQF A;  2H09 A;  3G1O A;  1JGI A;  1OYI A;  3EDP A;  1YIT I;  1UMQ A;  2LVS A;  3ECO A;  2W00 A;  3VDX A;  3ZR8 X;  4KIF A;  1I6H J;  2K40 A;  3EQL F;  3L2C A;  4GYI A;  1Q1H A;  3IWZ A;  3F8C A;  3SFI A;  2QYO A;  2NS8 A;  4KIC A;  1A5J A;  3GTP J;  1D1A A;  1KZH A;  4OIQ F;  1JVS A;  2Y2Z A;  3C7J A;  1JTX A;  5HNF A;  1SD6 A;  1Z7U A;  3JRD A;  5FO5 A;  1RR8 C;  4AIH A;  2E19 A;  5E3N A;  4HRI A;  3WGI A;  2V26 A;  3C18 A;  2ELH A;  2NS0 A;  3A03 A;  2L54 A;  5E79 C;  3DLA A;  2I8D A;  4Z2Y A;  2NVQ J;  3J7A O;  1ZGA A;  4ZW3 A;  2QWW A;  2XSD C;  2LRD A;  2EFQ A;  1ZG5 A;  3IV5 A;  1STZ A;  2IGK A;  4RDU A;  4RM3 A;  4JP0 A;  3V8K A;  3HJE A;  1JHF A;  4XLN F;  2WAQ N;  3OYJ A;  3FUJ A;  2W85 A;  2ZSI B;  4RB1 A;  2B9S A;  5JVG F;  1WJ5 A;  3KEY A;  3KZI C;  1H9G A;  2BE5 F;  3F6V A;  3TO9 A;  3FUD A;  3SXY A;  1FLI A;  5LGN A;  3ZMD A;  2WY7 Q;  5EDN A;  3J7A Y;  2VL8 A;  3QU3 A;  4PUS A;  3N4M A;  3HXL A;  2MLG A;  4AIC A;  2P8T A;  2KRC A;  5DYM A;  1F4K A;  1KON A;  2G0E A;  4ZQF A;  2MBF A;  1DGW Y;  1QHH D;  1S8N A;  3GME A;  3J81 K;  3FMQ A;  2ZBK A;  3AL0 B;  1S7O A;  3MKL A;  2OTL I;  1T1R A;  3CHQ A;  4MEY F;  2DI3 A;  1JT0 A;  2HGC A;  5JLX A;  4PVB A;  3O6B B;  3S93 A;  4LD5 A;  1M1E B;  1XSD A;  1QQI A;  2ZME C;  1Y0U A;  2QF7 A;  2CQ7 A;  2WV1 A;  1FTZ A;  4BEH B;  3N05 A;  1NHA A;  2VE8 A;  1ZTR A;  3HSR A;  2DFE A;  2JT1 A;  3E6C C;  4IX7 A;  4M3D A;  3S16 J;  3CP8 A;  2VOD A;  1ULY A;  4A6D A;  2MD0 A;  1B59 A;  2X6X A;  4CXF A;  3G1L A;  1N25 A;  3IRQ A;  2MC4 A;  3FUE A;  5DV5 A;  1TWH J;  1S7E A;  4IEJ A;  3JRA A;  3U9G A;  4ZDP A;  3F23 A;  2FQ3 A;  4ZZD A;  1AU7 A;  2M4K A;  4ON0 A;  4DZP A;  1U5T A;  1FOW A;  4ZX4 A;  1FOX A;  2XAH A;  4O5V A;  2OUM A;  4ANJ A;  3E0J B;  2XPZ A;  4MS6 A;  2BVM A;  1D3Y A;  4L9N A;  4CCM A;  1R58 A;  3RJP A;  3ZN1 A;  3DFG A;  1JKQ C;  3IH2 A;  3ZCO A;  2WAQ A;  4BBR J;  1MBE A;  2EPF A;  3CUQ A;  4KNY A;  3TW7 A;  4IKF A;  3H3U A;  2ID3 A;  2R7Z J;  1XCV A;  3F8B A;  2L5Q A;  4D7N A;  3AU8 A;  1GVJ A;  2XGX A;  2HKX A;  4CCO A;  2MAP A;  1VQP I;  1LB2 A;  2K3P A;  1VQK I;  3CZE A;  3EYI A;  2NNY A;  3M8J A;  4IHX A;  1LFP A;  4E4H A;  4QIR A;  2GBY A;  3MMY B;  3QOP A;  2G7H A;  4BUP A;  2AQE A;  2KQR A;  1OIS A;  2JSP A;  4WF2 A;  3RQ4 A;  4U0W A;  2EA4 A;  3ECH A;  4U0Y A;  4A3F J;  5IYB J;  4AUX A;  3DBH B;  3S1M J;  5DM6 F;  4C30 A;  3EBI A;  4BEH A;  4NNJ A;  4Y15 A;  2W57 A;  2OTJ I;  1G6N A;  1ETW A;  3KFW X;  3U21 A;  3LAP A;  4BQA A;  4C2T A;  1SMT A;  1WI9 A;  2OAZ A;  2PJR B;  3R0A A;  5J1R A;  2M8E A;  5E3M A;  4XID A;  4H0E A;  1R7J A;  4A0X A;  1P92 A;  2DQM A;  3H5A A;  2IEK A;  4R5T A;  1VQ5 I;  2P7V B;  2R72 A;  2X0L A;  4F7Z A;  1TT0 A;  4HEA 2;  5L3G A;  2P6T A;  2QM3 A;  2QBY B;  3FHN A;  3TL4 X;  1OCT C;  4AVP A;  2FQ4 A;  3QAH A;  2R7S A;  1P6R A;  2A69 F;  3TOA A;  5LD2 C;  3TP3 A;  2FFL A;  4KP7 A;  1ZK8 A;  4MEX F;  2YSR A;  2F4I A;  2WAD A;  4LGW A;  2Y9Y A;  1YTY A;  2VI6 A;  1WCM J;  3RSN A;  3BLY A;  3DPU A;  5L3F A;  4YII A;  1G5A A;  1QGP A;  1KU9 A;  3OSG A;  2WB1 A;  2HVR A;  1BW5 A;  1B1B A;  1CQT A;  4ARF A;  2MH2 A;  3LAJ A;  2AHQ A;  1J5Y A;  1MBK A;  4UV9 A;  2FF4 A;  3DU6 A;  2LF8 A;  1D5Y A;  5JMP A;  1WFX A;  5EZH A;  2R5Y A;  1W1W E;  4ZYA A;  3H0D A;  3TKY A;  3BDD A;  3FIW A;  3BTI A;  3FIS A;  2K9L A;  2V1X A;  3E7L A;  1SC7 A;  2VBY A;  2LG4 A;  5J8C A;  2M7B A;  1IGN A;  3ZQI A;  3WTY C;  1LDK B;  4ESJ A;  4ETS A;  3FUF A;  1U5T B;  4C3I J;  1K78 B;  1J2X A;  2L02 A;  3I53 A;  3W2A A;  2WBM A;  3PNV A;  3FMS A;  1ENH A;  4Y4R A;  1K78 A;  5D4R A;  4HNV A;  2R7W A;  2R7R A;  5M3F J;  4XLP F;  2OV7 A;  1FYL A;  2FU4 A;  1UG0 A;  4OOE A;  1EH8 A;  2WV0 A;  3AG2 H;  2VQL A;  4XKV A;  2C6Y A;  3QYB A;  1R49 A;  5EYR A;  2H8R A;  2KMU A;  5GAD J;  4Q4I A;  3KYD B;  2WY8 Q;  2VJJ A;  2V1N A;  3M9A A;  3DWL E;  1WH5 A;  3L1P A;  4A3D J;  1ZGJ A;  2IS1 A;  1MBG A;  2R92 J;  1B8I A;  2LYC A;  1LDD A;  4XK4 A;  3OYC A;  1YHQ I;  3ZQ7 A;  2B7E A;  3FTZ A;  1GDT A;  5DUK A;  2L9V A;  3JRB A;  2XPV A;  2Z99 A;  1HXD A;  3WG7 H;  2DXI A;  4ZQE A;  3K4L A;  3AU9 A;  4XN4 A;  3DLL F;  4R5X A;  1IN5 A;  2FSW A;  2VAS A;  3GTK J;  1QVU A;  2F5E A;  2P4W A;  3GCM A;  1T39 A;  5JMW A;  1ZRC A;  5GAH J;  4DZJ A;  3BR0 A;  2HZT A;  1P2F A;  3OS2 A;  4OMY A;  3P7N A;  4J3B A;  4M3G A;  2HPI A;  4CA0 A;  2FX0 A;  1H8A C;  5FJ8 J;  3DQV C;  1XC5 A;  1FIA A;  2XAJ A;  5JAZ A;  4XN9 A;  2MYS A;  4C9Y A;  1RKW A;  3KPH A;  2IVM A;  4XLC A;  2LMD A;  4CDG A;  5LGU A;  2DA2 A;  4OAZ A;  4ZQG A;  3E97 A;  3FKI J;  4JX6 A;  4ZW8 A;  3CD6 I;  2DA4 A;  3C3W A;  2X6W A;  1XDU A;  3QYF A;  3ZRG A;  3G4S I;  2LH9 A;  5F0C A;  1GUU A;  2GAU A;  2M0C A;  2LKP A;  5ICF A;  2GOM A;  1IUF A;  5HOO A;  2CUE A;  4ZJZ A;  2Y0S N;  5D5W B;  2OZU A;  5DCM A;  4EM1 A;  3HOU J;  4ZX6 A;  2F5V A;  3I56 I;  3GYH X;  1FSH A;  1G3Y A;  3HRM A;  4A3G J;  4F93 B;  5L3B A;  2JWT A;  4A93 J;  3HL2 A;  3QPS A;  5IPA A;  1S6L A;  2M87 A;  1CGP A;  2QZ8 A;  1SD4 A;  3BG6 A;  3QP5 A;  1MJA A;  3E5Q A;  2P6S A;  3KP2 A;  4XL9 A;  1Y1V J;  2E1N A;  2VOP A;  1MW2 A;  1TWC J;  4A3K J;  3QPH A;  5JR3 A;  4J01 A;  2FD5 A;  2Q2E B;  2X1D A;  3EUK L;  3DXJ F;  2JRM A;  2OCE A;  3HHG A;  1J09 A;  3B37 A;  4P5O A;  1MND A;  2K9M A;  2E60 A;  3AL0 C;  3CHS A;  3S32 A;  3I64 A;  4CO8 A;  3WU2 C;  3GTQ J;  2R5Y B;  5KNL A;  2CFX A;  3BJ6 A;  1ZAO A;  5F27 A;  3JRC A;  3HHH A;  2HNH A;  3C2B A;  4LK0 F;  2H8W A;  4G7H F;  4HW0 A;  2KJB A;  3L2U A;  4HQM A;  1TQI A;  2D2W A;  5CPR B;  1XCB A;  4CH7 A;  3CCV I;  1T1S A;  4DGW B;  4LLL A;  3TGN A;  3QQA A;  4LOC A;  5J6X A;  4O3M A;  5CQG A;  1ON1 A;  4I0B A;  3S1Q J;  1Z9C A;  4AVZ A;  4KUM A;  4N0B A;  1X1C A;  4GYG A;  2KPM A;  4HLY A;  2HVQ A;  5C3E J;  2GLO A;  3KYL A;  4ZC3 A;  2NVY J;  4HDU A;  1IN6 A;  2CV1 A;  2KIQ A;  1OR7 A;  3H9Q A;  2PUS A;  2FOK A;  3OL4 A;  2D5V A;  4LJZ F;  4BQN A;  2Y75 A;  1R23 A;  4LIU A;  1PDN C;  5ED4 A;  5FWQ A;  1Y8Q B;  3VB2 A;  3MKW B;  4QPO A;  1U78 A;  4WWC A;  1EH7 A;  3BY6 A;  2JCY A;  1I5Z A;  4RCV A;  1XMK A;  4IOC F;  2DJI A;  2FOW A;  1HKQ A;  1OCC H;  5E3L A;  2M3A A;  5FD5 A;  2ZNZ A;  2C5Z A;  4BJ5 C;  2JD2 A;  3OMY A;  4XON A;  4XMW A;  1RZ4 A;  4XO4 A;  1ZS2 A;  2KRF A;  1G3T A;  4WXH A;  2DTR A;  2Z2S B;  1E3P A;  4YIF A;  2R7O A;  4KIG A;  1KQ9 A;  3FTY A;  3QYE A;  3PSF A;  5IP6 A;  4W97 A;  3HOW J;  4D0P A;  2CW0 F;  4RAG A;  3WOD F;  4YG2 F;  2WA0 A;  3LQQ A;  4N4N B;  1YFH A;  1MW3 A;  1ZRE A;  3PSI A;  1W5C C;  3RZD J;  3FTX A;  5BQT A;  4A3I J;  1BA5 A;  1SC5 A;  2XPY A;  4XND A;  5KK1 A;  1K6O A;  4I7H A;  2H6C A;  4G6Q A;  5E17 F;  4FT8 A;  2PEX A;  2HEO A;  2Y1E A;  3GVA A;  5AIP A;  3TO7 A;  3MZ8 A;  2ZNY A;  3BG7 A;  1ZHF A;  4M3F A;  3M3Y J;  3J80 Z;  2PBI A;  2XV4 S;  3OSF A;  4M6Y A;  2A3S A;  2FML A;  4BY1 J;  4BGD A;  4Q4Z F;  5CQE A;  2ZFW A;  1HKS A;  2EA2 A;  4C3J J;  1R6R A;  1X19 A;  3CUQ C;  2DO7 A;  3S15 J;  3MD2 A;  2V6E A;  2PG4 A;  2JD0 A;  1TQP A;  2HFH A;  3H5N A;  3T8T A;  3FU5 A;  3JT1 A;  1I1G A;  1W0U A;  5EEA A;  5EJC A;  5LRR A;  1W7P A;  2XF5 A;  3F21 A;  3A06 A;  5CVU A;  3K1P A;  3GF2 A;  3FTW A;  5GTI C;  1LE8 A;  5DUI A;  1S7A A;  3PO2 J;  1BC8 C;  1YW8 A;  3RKX A;  2A7O A;  1TNT A;  2KFD A;  3FTU A; 
#chains in the Genus database with same CATH homology
 2LOO A;  1X4O A;  2GTQ A;  1Z3X A;  4XMY A;  2VJ8 A;  5BPP A;  2QVW A;  3FU6 A;  4K5L A;  4Y67 A;  1Q0Q A;  1OLT A;  2Y1G A;  1D1A A;  1JVS A;  1PJR A;  3KED A;  5HNF A;  4NQW B;  1IRX A;  2KL4 A;  1T0F C;  2CH0 A;  4A03 A;  1AA7 A;  3K70 C;  4CUG A;  4PJN A;  1ONO A;  3FH8 A;  1NG6 A;  1DGR M;  4X0G A;  3B7U X;  3OYM A;  3VYS B;  3OYL A;  2XDV A;  4HRI A;  2FUG 2;  2V26 A;  3IUO A;  2PJR A;  2VQG A;  4PU2 A;  3DLA A;  3E1S A;  3K4K A;  2I8D A;  3B2P A;  4ZW3 A;  4R5V A;  2RRE A;  2HPT A;  3UER A;  2LRD A;  3DEE A;  3OR2 C;  2RJI A;  4OAY A;  2IGK A;  4RM3 A;  3RCO A;  3CZL A;  4F52 A;  2VJI A;  4D9J A;  2KP6 A;  4XNA A;  4K5N A;  3A1Y A;  4DPR A;  3ZHZ A;  2M0M A;  2ELJ A;  3PUB A;  3DTI A;  3OYJ A;  3EBG A;  3FUJ A;  1PYV A;  2ZSI B;  3PNT A;  3HC7 A;  2ZXI A;  4YEJ A;  2JA2 A;  2O5R A;  3VYT B;  4FLS A;  1WJ5 A;  1DQU A;  3OR1 C;  3MKY B;  4X2U A;  3KEY A;  3EUH C;  2R7T A;  1MMA A;  4E7J A;  3SEZ A;  1LKX A;  2BW3 B;  3FUD A;  4IZZ A;  3FUK A;  1MMN A;  2A5W A;  4ZX5 A;  3JSZ A;  2WY7 Q;  2E5Z A;  3J7A Y;  2VL8 A;  3CP2 A;  4PUS A;  5HLT A;  3F9K A;  2DT6 A;  2X6Y A;  3HXL A;  4QUO A;  2VJ4 A;  4AIC A;  3RTR A;  4K5O A;  2KRC A;  2VXD A;  2JV7 A;  1KON A;  4NUB A;  1G59 A;  4IQJ A;  3VYU B;  2XF6 A;  2EGH A;  4L2L A;  2HQA A;  4XM3 A;  4ZQF A;  1DGW Y;  1QHH D;  2V4J C;  1N75 A;  5HVQ C;  2VIX A;  4DJA A;  3AL0 B;  2DQ6 A;  3CHQ A;  1T1R A;  3DPL C;  4FLR A;  3CES A;  3SZG A;  4E7Z A;  5FRN A;  4B47 A;  4IQ4 A;  3UCQ A;  4PVB A;  4BJT A;  3S93 A;  4FLO A;  3ANL A;  2KHM A;  5CKT A;  2P0W A;  2CUZ A;  4G6T B;  4Y6S A;  2KLO A;  4QPQ A;  4ZTJ A;  3VSK A;  4XNB A;  4ZW5 A;  4J00 A;  4BEH B;  3N05 A;  3OIP A;  3LSG A;  4IX7 A;  1FMV A;  3UEQ A;  1FMW A;  1TZL A;  3IAM 2;  1Z21 A;  3CP8 A;  4B44 A;  2MD0 A;  2CMP A;  2X6X A;  4NC7 A;  3CZG A;  4CXF A;  3FUE A;  2MC4 A;  4E7L A;  2JCV A;  4R7L A;  2LY1 A;  3L2R A;  3WQR A;  3ZHX A;  4D1Q A;  4CZC A;  4CCL A;  4BAC A;  1QHG A;  3TBI A;  3OIQ A;  4BXF A;  4FLQ A;  3LMM A;  4ZDP A;  2QJ1 A;  3DKY A;  4ZX3 A;  2L2O A;  4ZW7 A;  2K5C A;  2M4K A;  4ZX4 A;  1E0E A;  1X1A A;  4OOF A;  2OUM A;  4ANJ A;  3RAS A;  3E0J B;  2XPZ A;  4MS6 A;  2BVM A;  5JHF A;  1ERD A;  4CCM A;  1Y56 A;  4HST A;  3CMM A;  3ZCO A;  2WAQ A;  3CJR B;  4JOM A;  4IKF A;  3L2Q A;  3L2V A;  3OOU A;  1G8X A;  3TMO A;  2L5Q A;  3AU8 A;  3W3C A;  3OYK A;  2HZD A;  3B7T A;  1SAU A;  2F6C A;  4CCO A;  3CZK A;  4XMV A;  2MAP A;  1R0K A;  2K3P A;  3DTK A;  2BVL A;  2ZXG A;  3CZE A;  2MAB A;  4PFP A;  3UNG C;  3M8J A;  4QPE A;  1Q0H A;  3OYA A;  1LFP A;  4E4H A;  3VSL A;  4QIR A;  2JVH A;  4DBQ A;  4HNU A;  2GOX B;  2HVS A;  4AR1 A;  4AYB A;  3MMY B;  4KIS A;  4HSR A;  3LSI A;  4BUP A;  2AQE A;  2KQR A;  2JSP A;  1T95 A;  5KCM A;  3RQ4 A;  4F92 B;  3OY9 A;  2X1C A;  3LL7 A;  4PJM A;  1D1B A;  3K4B A;  2IS4 A;  2R7U A;  1H19 A;  3PL8 A;  4E7K A;  3RC3 A;  2E5N A;  5KHD A;  3HKZ A;  4C30 A;  4BEH A;  3S3M A;  4NNJ A;  3EBI A;  3OYH A;  3U21 A;  2W7N A;  1BR1 A;  2CW8 A;  1MMG A;  4C2T A;  2WPG A;  2Z16 A;  2CFO A;  2PJR B;  2DOA A;  3D5S C;  4H4K C;  2X51 A;  4EAT A;  1HA8 A;  4RM2 A;  2Y1D A;  2DQM A;  3H5A A;  2Y1F A;  2UWM A;  4LG3 A;  3S3O A;  1BOB A;  4R5T A;  2W82 A;  4XMZ A;  3BCB A;  2R72 A;  3ZHY A;  1TT0 A;  4HEA 2;  4F3Q A;  3K4C A;  4MKT A;  2L9S A;  2R70 A;  2R4G A;  3DKX A;  3FHN A;  3TL4 X;  5JBI A;  2R7S A;  5LD2 C;  2JVG A;  3OYI A;  2FFL A;  4KP7 A;  3HUG B;  2F4I A;  2WAD A;  3B7R L;  4QME A;  4ZTF A;  3AFH A;  4RLF A;  3CHP A;  1UEL B;  3RSN A;  2XQ0 A;  3BLY A;  3DPU A;  3BCA A;  3K4N A;  2BW3 A;  2DT7 B;  3A14 A;  2MFZ A;  2CS3 A;  1G5A A;  3CZ6 A;  2WB1 A;  1X1D A;  2VLA A;  2HVR A;  4CCJ A;  3W2V A;  4ARF A;  2OC6 A;  3LSK A;  5DLL A;  4JND A;  3DU6 A;  1GW6 A;  4BU2 A;  4YEL A;  4Y33 A;  4ZQT A;  4BQQ A;  3OS0 A;  3PUU A;  1ZEL A;  5JMP A;  1WFX A;  3BC8 A;  2M4G A;  3QOD A;  4YRV A;  4ZYA A;  2RQQ A;  4FAS D;  3VWB A;  3H0D A;  3OL3 A;  4ZQH A;  1Z3Y A;  4HG2 A;  1MNE A;  2K9L A;  4GAA A;  2XF7 A;  2A6T A;  2LG4 A;  2M7B A;  3HPH A;  3CIA A;  3FU3 A;  1LDK B;  2XAU A;  4ZW6 A;  5EV7 A;  1X3Z A;  4AR8 A;  4XLE A;  3FUF A;  4MLO A;  4XKC A;  4R79 A;  3IIE A;  3OYF A;  1X1B A;  3WQS B;  5FRM A;  1D0Y A;  3W2A A;  2WBM A;  3PNV A;  4ITV A;  2CV0 A;  3D5R C;  4Y4R A;  3SYT A;  3MKZ A;  1Z7L A;  4E7S A;  3FTU A;  3FU0 A;  2R7W A;  2R7R A;  1HS6 A;  4BKX A;  2OV7 A;  1UG0 A;  4Y6P A;  3DPT A;  3QOE A;  4OOE A;  4XKV A;  3HOT A;  2VQL A;  2NOJ B;  4KIT B;  3OYG A;  1QU3 A;  3QYB A;  3LSH A;  2KMU A;  4Q4I A;  2VJJ A;  1EA3 A;  2V1N A;  2WY8 Q;  3DWL E;  2VQC A;  2KDO A;  2VPL A;  2IS1 A;  3M1C A;  2LYC A;  2KRH A;  3OYC A;  4RLQ A;  2WZF A;  3EBH A;  4U87 A;  4Y3O A;  4XO5 A;  3FTZ A;  4ZDO A;  4GAE A;  3LFU A;  3OYB A;  1GLN A;  3ANN A;  1MW7 A;  2DXI A;  1H3L A;  3Q44 A;  4ZQE A;  3CHR A;  3K4L A;  3AU9 A;  1YE9 A;  4XN4 A;  4R5X A;  1X3W A;  2X85 A;  2VAS A;  4KT6 A;  2VKH A;  2V7F A;  1DP3 A;  5JMW A;  5JO0 A;  3RC8 A;  1BR4 A;  3KX2 A;  4ZDL A;  3OS2 A;  1U0J A;  2Q1Z B;  3UR3 C;  3SEQ A;  4B43 A;  2HPI A;  1N78 A;  4J3B A;  2IGN A;  1WJA A;  1WJC A;  4CA0 A;  3FTV A;  1SQM A;  4QHP A;  1NG7 A;  3U9W A;  3DQV C;  3ONQ A;  3OYE A;  5JAZ A;  2Y1C A;  4BE0 A;  4BL0 B;  2CUJ A;  4FET A;  4GRI A;  4XN9 A;  2MYS A;  1R0L A;  4C9Y A;  4AU7 A;  2CV2 A;  4XLC A;  1JG9 A;  2UV1 A;  4OAZ A;  4ZQG A;  4ZW8 A;  3FTS A;  4XN3 A;  2X6W A;  3QYF A;  3ZRG A;  3L2W A;  2LH9 A;  4Y6R A;  1BR2 A;  4OWR B;  4BE2 A;  2X1E A;  3A4C A;  2Y0S A;  4XN0 A;  2LRE A;  3B34 A;  3FKJ A;  4XKB A;  2GOM A;  5HOO A;  2PGG A;  1V5F A;  4ZJZ A;  4II2 A;  3VVL A;  2XC7 A;  5HNH A;  4PW4 A;  3OYN A;  3EUA A;  1LVK A;  2WAE A;  4ZX6 A;  2F5V A;  3RPU D;  4K5M A;  3SDB A;  3K6G A;  4F93 B;  4XLA A;  1ONN A;  4JQF A;  4BJ6 C;  3HL2 A;  2HPM A;  4XN7 A;  5DYF A;  1V5G A;  1JI8 A;  1W36 D;  3BG6 A;  3H35 A;  3FUM A;  4ZN6 A;  4XL9 A;  2VB6 A;  4KJZ A;  3FUN A;  3ZGK A;  1MW2 A;  4XLF A;  4E7I A;  4LIT A;  4RMN A;  2Q2E B;  2X1D A;  4J01 A;  3EUK L;  3B2X A;  2QKL B;  1J09 A;  3PNY A;  3B37 A;  4P5O A;  1MND A;  2K9M A;  4P1W A;  2IS2 A;  2E60 A;  3FBN B;  4HPQ A;  3AL0 C;  3CHS A;  4XMX A;  3S32 A;  2HPO A;  4LUP A;  4C2U A;  3NWS A;  4PJL A;  4XN8 A;  5KNL A;  3A2K A;  2JCX A;  4PFO A;  5JNL A;  2LC2 A;  2W4S A;  3H9G A;  1X4P A;  3FH5 A;  2HU9 A;  2UUZ A;  3S3N A;  2HNH A;  3OWT A;  1D0X A;  2IGM A;  4PJJ A;  4XN5 A;  1Y6I A;  2ZFU A;  1K5H A;  2L7K A;  3L2U A;  5CPR B;  3H5R A;  4CH7 A;  4CCK A;  1UAA A;  1VZ0 A;  1WJB A;  1D1C A;  2V9K A;  1T1S A;  4XMT A;  3DU5 A;  4DGW B;  1WJF A;  4Q4E A;  3HG9 A;  1RP3 A;  4XMU A;  4XOT A;  4CSW A;  2VXZ A;  5CQG A;  2C82 A;  1YX3 A;  2LBF A;  4PK4 A;  4AVZ A;  2WZG A;  2Z1D A;  3AUA A;  2B61 A;  1WJD A;  1X1C A;  3ZXS A;  4BQO A;  1WJE A;  3AKZ A;  3PJR A;  2KPM A;  2ZXH A;  2HVQ A;  3KYL A;  4CCN A;  4ZC3 A;  1SG7 A;  2CV1 A;  3QJX A;  3EPZ A;  3K4J A;  1N77 A;  1OR7 A;  4XN1 A;  3H9Q A;  2DCE A;  2PUS A;  3CHO A;  3I9V 2;  3OL4 A;  2VKD A;  2L9N A;  3VVM A;  1YX5 A;  2BOL A;  4BQN A;  3ZQQ A;  5FRO A;  4AYS A;  2KZV A;  3K4M A;  4LIU A;  4F91 B;  3VYR B;  4B3X A;  2CW7 A;  5FWQ A;  3MKW B;  3C2G A;  4QPO A;  4XR6 A;  3WQQ A;  1Q0L A;  4N4O B;  4NQW A;  2PMZ A;  3C2H A;  4BE1 A;  2JCY A;  3CJQ B;  4XN2 A;  4PSX A;  3GBG A;  4RCV A;  3FUH A;  2IS6 A;  4BS9 A;  2DJI A;  4E6K G;  2R59 A;  3T0Y A;  3T8V A;  2M3A A;  4NC8 A;  2C5Z A;  3IP4 B;  1MW1 A;  4RSY A;  4BJ5 C;  2QKM B;  2JD2 A;  4XKW A;  3K10 A;  3OMY A;  4XON A;  4XMW A;  3CF2 A;  4DOZ A;  4XO4 A;  3FUL A;  1ZS2 A;  4DIQ A;  2ZSH B;  2Z2S B;  3V42 A;  1MVY A;  2R7O A;  3NWT A;  4K5P A;  3OYD A;  1W36 C;  5TGT A;  4XNF A;  3QYE A;  3FTY A;  4RVB A;  4XO3 A;  5LFA A;  3PSF A;  4BDZ A;  2HDW A;  2IXS A;  2IGO A;  2VJ5 A;  3G2B A;  4II3 A;  3S8P A;  2W1O A;  2R7X A;  3ANM A;  1MMD A;  2WA0 A;  2VQH A;  1P9Q C;  4N4N B;  4XQF A;  2MAO A;  2PL5 A;  3R0I A;  2E1M C;  1MW3 A;  3PSI A;  3HPG A;  3FHE A;  3FBI B;  2XSJ C;  3FTX A;  1ONP A;  1SC5 A;  4LIV A;  4XOP A;  3LSM A;  1D0Z A;  2M7A A;  3OS1 A;  2XPY A;  4XOR A;  4XND A;  3ZI0 A;  4F55 A;  2JUG A;  2LY2 A;  3FUI A;  3K70 D;  1K6Y A;  1SFK A;  2Y1E A;  5JC1 A;  4XLH A;  2LBF B;  1S46 A;  3D5L A;  3FH7 A;  4E7H A;  3BG7 A;  2R7V A;  4HNT A;  2WAF A;  2R7Q A;  3Q43 A;  4U7B A;  5AEN A;  2RNG A;  4FCA A;  4BGD A;  3IAS 2;  5CQE A;  1MW0 A;  5DUL A;  2JD1 A;  1V5E A;  3DTE A;  1R6R A;  4AR9 A;  1X19 A;  2E1M B;  3I3L A;  3MD2 A;  2V6E A;  2JD0 A;  3H5N A;  3FU5 A;  3JT1 A;  1OR7 C;  3PFY A;  4PSW A;  4B48 A;  3HOS A;  2XF5 A;  3A06 A;  3W2W A;  3H9J A;  1S9H A;  4DBR A;  3B7S A;  2AQF A;  3FDY A;  1JGI A;  3FTW A;  3VDX A;  3B3B A;  2W00 A;  3ZR8 X;  4BDY A;  2A7O A;  2O7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...