2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
2VLAA 5HNFA 5HLTA 5HNHA
chains in the Genus database with same CATH superfamily
1VTNC 4HV5A 3OY9A 4O5VA 1HKSA 2JA5J 2GM4A 4XRSA 2Z1DA 2UWMA 2HTJA 2KRCA 3I64A 2V6CA 2OJED 4A3DJ 2EA2A 3FU6A 2J5OA 1S72I 2EINH 3GTLJ 1O7LA 2L7ZA 3ELKA 1R36A 1AA7A 1V3FA 2F4IA 2JPCA 3ZQGA 3FUDA 2IJLA 4PDKA 5IT9Z 1HSTA 4K5MA 4FT8A 1PVEA 4C3JJ 3WTSC 3QJXA 3JRCA 1OCOH 5TISC 5E79C 3DP7A 2VKEA 3FKIJ 3GWZA 3LSTA 3A01B 3CCSI 1E0EA 1HKTA 5FLXK 3HXLA 3WE3A 2V4JC 1IXCA 3KLOA 2P0WA 3HHHA 2JD1A 3MKYB 1Z1DA 4B4CA 3SYTA 5F0FA 4GO1A 5J40A 2CGPA 3RPUD 1IF1A 1W1WE 2CQKA 1IN7A 3UERA 5JVTA 1UJ8A 2NAZA 1ONVA 5GAEJ 1K78A 4GAEA 3UEQA 2KIMA 1X19A 3CUQC 2L9NA 5L3GA 1I6XA 3LNQA 5A2QK 3Q43A 2DU9A 1ODDA 2OTLI 3ABTA 3C7JA 4YFNF 1ZTRA 3JSPA 2E5NA 3GO5A 4BQQA 1QNTA 4QPEA 2WA0A 5E1WA 1J9IA 2EQRA 4LFUA 5CQGA 1P6RA 4M3FA 3RZDJ 1YO5C 3VYTB 2VKHA 2BHYA 2JT1A 2R7RA 2ZXGA 2O3FA 1PUFA 1WJCA 2O7GA 4OIOF 4UVCA 2KP6A 1YRNA 4R5TA 2KL4A 4RGUA 3WG7H 1POGA 4Q4ZF 2CS3A 4M6YA 1SMYF 3BQYA 4BE1A 3LSPA 3KEYA 4LG3A 1KZHA 5J6XA 5E1XA 1D8KA 1MSEC 2K4JA 3QWLA 2W25A 4A3GJ 3FHNA 1Y1WJ 1A31A 3OSFA 3BTIA 3Q5FA 4ZQHA 4KIGA 5L3FA 3G1MA 3HC7A 2H8WA 5DUIA 1YIJI 1P4WA 2D1HA 4ZQTA 1JKPC 4Y67A 3FHEA 2GIVA 1QHGA 3GTQJ 1HLVA 2K02A 3ANLA 1RPWA 1ZRDA 4E7SA 4UV8A 4XMZA 3FXRA 1D5YA 2MLKA 4U88A 1ZR2A 3JRIA 2L9VA 2DOEA 3C1DA 4BQAA 1LE8B 2GA1A 1W36C 5H6RA 2A5WA 1TT5B 3S3MA 5FD6A 2ID6A 4RB3C 4ASNA 3QP6A 2NNNA 3C3WA 3DEWA 2ZKZA 1PYVA 2LG4A 2VKVA 5J1YA 2A5YB 3LAPA 4ENKA 1RRJA 3CXBA 2FF4A 3JR9A 2W1OA 3B3BA 3HM5A 1X1BA 4EATA 1FEXA 5C3EJ 4I6ZA 1BI0A 3JRGA 4ZYDA 3WTXC 2DMPA 1BIBA 2RDPA 4AM3A 5GAGJ 4L9JA 3IRQA 2GBYA 4XOPA 2I5UA 3OL4A 4JK1X 1GHCA 2A61A 2R7OA 3CJNA 3WGGA 1PDNC 1MVYA 1RNLA 3BPVA 4U7BA 1ZGWA 3KZYA 1WZ2A 2E5ZA 3U21A 4M73A 1D5VA 2PFBA 4XO5A 1TT0A 2LKPA 1ZRFA 2W57A 2XAFA 3FMQA 1IAWA 2CQNA 4EM0B 4DYCA 1W0UA 2GWRA 3SZGA 3VB2A 4OIQF 1T08B 2CQQA 2LR8A 3E6CC 4FQGA 4BJ5C 2HKOA 2MABA 1UZCA 1FSEA 3H9JA 1MDMA 2VT2A 1E3PA 5HODA 2A05A 3VODA 3A06A 1CF7A 5JFRA 4QPOA 4JX6A 2DJNA 2QZ8A 4E7ZA 1U3EM 1G59A 2WAQA 2IPQX 3OR2C 5F1JA 1P2FA 3PFIA 1XN7A 2HI3A 2L54A 3E5QA 4HSTA 4BJ6C 4L5EA 4AU7A 1S46A 3BR2A 2IEKA 5BPPA 1N75A 2LP0A 1G3YA 1JUSA 1Z3XA 3DLAA 1U5TC 3ZQCA 2A6TA 3NARA 4J3BA 3DCFA 2QUFA 3ZGKA 4NC7A 2PX9A 5DLLA 1T1SA 3ZRGA 3CC4I 1VQ7I 2ZXHA 1I50J 1LEAA 4Y33A 3ABLH 3T0YA 2GZWA 5C4JJ 2R59A 4RMNA 2VBWA 2Z16A 4BDYA 1VQ8I 3H9QA 4A3MJ 4UUSB 1R1UA 5EGOB 2AXTC 1FSHA 2W7NA 1Q0QA 4IVNA 2LK2A 2MYSA 3M1EA 2XHKA 1A6QA 2HYGD 1ZQ3P 1KYWA 1HF0A 4KUMA 4EGYA 3A2KA 2HWVA 3CHSA 4B09A 4IHVA 4IHYA 2FQ3A 4GYGA 1JKQC 2FUG2 5FFZA 3AL0B 1S3JA 1IUFA 3H5NA 3DU6A 2K40A 3LA2A 2E71A 1XD7A 2M7BA 5D5VB 1DU6A 4BHPA 2XGDA 5IT9K 4OOIA 2XQ0A 2ZBKA 1PP8F 4AYSA 3HBLA 4XN5A 5IYBJ 4LD5A 1ZG3A 3FXUA 1WJ5A 1WJFA 5J8FA 4BUPA 1XGSA 1U2WA 3I56I 1ETOA 3H3ZA 5FD5A 2C82A 2R93J 4K5NA 3E97A 4CH7A 3O3KA 2JA2A 1XG1A 2PGGA 1SD4A 1X3WB 1E3OC 1TNSA 1APLC 1QGPA 2CUZA 2Y31A 4NC6A 1TW2A 2DQMA 3W6KB 3BWGA 2W84A 4ABZA 5JC1A 5JR3A 1RP3A 2L01A 1OMIA 1AKHB 3CC7I 3MCZA 4FETA 5HOOA 5JMWA 1DUXC 5BPDA 2JRTA 2XASA 5EZHA 1A35A 1LNWA 4M9ZA 2JA8J 5H20A 4A0XA 4D9JA 1Q1VA 4GFBA 1R0KA 4L5JA 4EMSA 2XGCA 3HB9A 3TKYA 4DBRA 3AAFA 2LD5A 1WI3A 3VDXA 2HQ5A 5F1RA 2XF5A 3MKZA 1J7KA 3QOPA 4LG0B 1JUPA 2WAFA 1B72B 1R1VA 4BHBA 1WHUA 3KPHA 1OFCX 1Y1VJ 4QWQA 5L3DA 4JP0A 4AR1A 5JO0A 1R0LA 1OR7C 2M7AA 4ZX4A 2E60A 4M3EA 3J7AO 2HGCA 4ZX6A 1T95A 1WJEA 3GFJA 2VQCA 4V2GA 1E17A 1O4XA 1H3LA 1Z6RA 2JSPA 4LB6B 3VFZA 4GAAA 1YE9A 1BW6A 1YQAA 2CUEA 3LQRA 1FX7A 4XN0A 3CF2A 1B8IA 3CJTB 3DF8A 2R4GA 3GTGJ 3EUKL 4WWCA 3RCOA 1FZPB 3QPSA 4C2MJ 2COBA 4I76A 4LK1F 2M2EA 3K4BA 1R6RA 3FTZA 3GX4X 2O5RA 2WAEA 3HOZJ 4AVZA 3PM1A 2O8KA 3FU0A 1HW1A 1WH5A 3F8FA 5FKNA 5DCMB 3BR1A 1P7JA 1XPXA 5DEQA 2CFOA 3ASOH 2ETHA 4ZN6A 3NWTA 1U0JA 4FE4A 2KZVA 4UUVA 1VQPI 5ILVA 4PCQA 3B7UX 5FRNA 4CSWA 3SJMA 1WQ2A 4C9YA 4L9VA 1R5GA 1WPKA 2M8EA 2IP2A 3E1SA 3HEFA 1ZG1A 4OMYA 2E19A 1G4DA 2DMTA 5M5YJ 3DBRB 2XF6A 1W5CC 2M5WA 4HLXA 3H5AA 2JRMA 1YJ9I 3MVPA 2KKOA 2PJPA 2TRTA 3HOYJ 3J7YJ 2BW3B 4J00A 3ABUA 2F4OB 3HOUJ 4DIQA 2JMWA 3ZN1A 3IRRA 4XONA 4HLYA 4KISA 4GXOA 1R58A 1KYZA 2VJ4A 3KCCA 2ZNZA 3DKYA 3K4LA 4MKTA 2M45A 4UY8I 4UXNA 1LDKB 3ZCOA 3QU3A 3R0IA 1TTYA 2A6HF 3ABMH 1XMAA 2D2WA 1EH8A 2BHZA 2FOWA 3L1PA 3BR3A 2GXGA 3M8EA 1BOBA 1YX3A 3LSKA 3T5XA 4XMTA 1JT0A 3K4KA 3V7SA 4DYRA 1K83J 2QENA 3FWEA 3TO6A 1HA8A 2EIKH 3BT9A 3M7GA 3HOSA 2FMLA 2GOMA 1KQ9A 3M4OJ 2FNAA 1MW2A 3B73A 1ETKA 5D6FA 2ESHA 2LF8A 2P6TA 3GZ5A 3P9CA 3ZQIA 5C4XJ 2BOLA 2EFWA 5CPRB 2JD2A 5L3BA 3B6AA 4XMVA 4E6KG 4KMUX 5FKLA 5GTIC 5DYFA 4HNUA 2P7CB 5KAIC 4RBOA 1FPQA 4OU0A 2HXOA 2A68F 2OF7A 4LB5A 2OCEA 3BPXA 3DBHB 1YW7A 2XGEA 3HYIA 2VQLA 2XAGA 3A01A 2ZXWH 1R7JA 2MGQA 2YU3A 3N05A 5IP9J 1VI0A 2KJBA 2JJ7A 2JCVA 4PFOA 2KIQA 3TDUC 2PN6A 4PJNA 1FC3A 4W97A 2K9LA 3GZ6A 4G7HF 1OCCH 3CZLA 5ICEA 1YX5A 3S8PA 4P9UA 3VWBA 2ICWG 1ON1A 1K6YA 4CZZA 2IS6A 3AL0C 3Q0VA 2CRGA 4N9IA 3O6BB 2LH9A 3BZCA 4I0AA 4XLHA 3TL4X 3L2CA 2XROA 3VYUB 3S16J 1LEBA 3JT1A 1Y56A 2KQRA 3F22A 1R9TJ 3ZHYA 2FEZA 2FBHA 4BE2A 1IV6A 3FHZA 2CWEA 1MMGA 3FMSA 1Z05A 1XGMA 1HBXG 1KU2A 2R7TA 4XRSG 4ZX5A 1VNDA 2RC4A 2XSDC 4Q48A 3SEQA 2ADUA 4EV0A 3LA7A 2XPWA 2X6YA 1D0YA 3CCYA 1SVLA 1ZLJA 4MGRA 3BROA 3RDIA 2ELHA 3CLOA 4NDLA 1WFXA 3LQQA 2HR3A 2L4AA 2IS2A 1OPCA 4LMYA 1ORKA 3FUIA 2JUCA 3FUEA 3A0HC 3GCMA 3I4NJ 1J2XA 1GUUA 1V54H 3C2HA 4KDPA 2Y1CA 4G8XA 2WC2A 5FO5A 4XMWA 3AG4H 2MBFA 4MQVA 1EH7A 1VQKI 2M8GX 3E5XA 4A5MA 1IRXA 4BXUA 3SEZA 4J19A 4B3AA 3HGYA 2WV1A 1QHHD 4CYCB 1BL0A 5LHIA 1FMVA 2EIMH 2F48A 3X2QH 3S1QJ 3WQQA 3B2PA 4HQEA 4MHGA 3L2QA 1U78A 3Q0UA 4AYBA 5LGTA 4IQ4A 3R0AA 2R70A 4MO7A 5FKOA 3VSLA 3IUOA 3WTVC 3DPUA 3B6CA 2K9NA 3BR0A 1R4NB 3OWTA 3SDBA 3WTWC 2PBIA 1OYIA 3MD2A 4CICA 4XLEA 1NH3A 1ETVA 1XTAA 5ICGA 4MS6A 3G71I 1IG7A 1IRFA 1MMAA 3IH4A 3D1NI 1ZKGA 1LE8A 1TWGJ 3IAM2 4OINF 4ZTJA 1TWFJ 2JPBA 1UFMA 3QYFA 3MKLA 2XAHA 4HW0A 1GDTA 2ISYA 4IXAA 2KDZA 4HEA2 2L0KA 3O8HA 5E1ZB 1SD6A 4YFXF 4A0YA 4ETSA 1SVOA 2F5VA 5ICFA 2R7WA 2NS0A 1RETA 3A03A 3SZTA 4D5FA 1SANA 1DDNA 2WB1A 3CP8A 1JHHA 4WX9A 2P5KA 1FTTA 2TDXA 1M1EB 1U6GA 1K7AA 1HS6A 2BY2A 1XGNA 1GT0C 1FY7A 2XPYA 3IKTA 1S8NA 5HLIA 2O6GE 3P9KA 2XPZA 2DODA 5KVRA 3FXQA 2XGXA 2K7LA 3AFHA 1H8AC 2RVCA 1BC8C 2X6XA 2XAUA 1BC7C 1MMDA 1YG2A 1ZK8A 2XVCA 3K4JA 4LITA 2DPUA 1RC9A 4ESFA 2P7VB 2FSWA 3JW4A 1S9HA 5LEKA 2JCXA 3OIQA 1TBXA 4A6EA 2M0CA 4M3BA 1XS9A 1D8JA 3BJ6A 2EK5A 3DKWA 2FBIA 5F04A 3AU9A 1EA3A 1YS7A 2E1MC 3C2BA 4AR8A 2J5PA 4KN7X 2HNHA 1USTA 3LMMA 1HQCA 1T0FA 4N0BA 4QLCU 2BV6A 2VJ8A 2CO5A 2YSRA 1SVMA 3V4GA 4XSZF 1Z21A 4RB1A 1JKOC 1R00A 2B9SA 2VONA 2FD5A 3VEPA 3JSOA 3HKZN 5ED4A 3JTGA 4JBAA 4ZYAA 1PJRA 2DW4A 3PJRA 2OC6A 3BJOA 2LYCA 1R23A 1I1SA 4Q4IA 2GAUA 2Z5UA 2K5CA 1ONPA 2V9VA 4NUBA 1XSXA 5HVQC 1IC8A 4DZPA 2P8TA 1MJBA 2VIXA 1K61A 4XMYA 4WK8F 1W7PA 4WCGA 3FTWA 1H0MA 3TW6A 3BZKA 1T6SA 1B9NA 5JMPA 4MFEA 2LDUA 4BDZA 4H4KC 5AIPA 2EILH 5F27A 3I4PA 3BG7A 1MD0A 3TEDA 2IA2A 2VE9A 3IV5A 2YX4A 3OR1C 3GFIA 3CMEI 3WTZA 3MZHA 3EUAA 2YX7A 1ONNA 3CHPA 1FBUA 2CFXA 3HPGA 2ID3A 4MFDA 5GADJ 1JGIA 3U9WA 5DD4A 3BG6A 5BOXA 1O3SA 1OYWA 3K69A 2M9HA 1VFCA 3HTSB 1LFPA 4K2EA 3ECOA 5CVIA 1XC5A 4R8HA 4L18B 1J5YA 5DM6F 1IJWC 2ME6A 3K1PA 2DI3A 4HAMA 4RSYA 3ZHXA 4FISA 1B9MA 3HOWJ 2ZJRF 3NEUA 1X2NA 4LLNA 3GVAA 4ZDLA 5K7FA 3G3ZA 3EETA 3C2GA 2DK8A 2LREA 1YHQI 3GTJJ 1YW8A 2ZMEA 3D0SA 2IAIA 3OYLA 2LVSA 4M3DA 1G6NA 1ZS2A 4KT6A 5LGNA 4M9SA 1BBYA 1ZN2A 4L2LA 2Y0SA 1AKHA 4Y52J 4CHUA 2PMZA 3JAMZ 1BJZA 3V42A 1TNTA 2W48A 4P55A 3R6SA 4RAFA 4D7NA 1X1PA 1P92A 1BIAA 2JSCA 1N25A 1G5AA 4ITVA 4IPAA 1ULYA 3GTPJ 1Y0UA 2JD0A 5DD8A 5E20A 1FIPA 2F5CA 3ZQQA 2M1BA 2WZGA 3B7TA 5GPAA 1QPMA 4PJLA 4X0GA 5KCMA 4CUGA 1B72A 4Z6YA 3HL2A 1ENHA 2MG4A 1YW9A 2VI6A 4JX4A 4KN4X 1DGRM 2OZ6A 3WU1B 2ELKA 4UVBA 4YG2F 3RASA 1Y0NA 4DW6A 4FLRA 1ZAOA 3GFMA 1V5FA 2X4HA 4A3JJ 3K70D 3K6GA 2VXZA 2CW8A 4RB0A 3SZPA 2ACJA 3PO3J 4F91B 5IP6A 1F36A 5K5OA 4U0YA 4IO9F 3DXJF 3U1DA 2E7WA 4Y4RA 4ZJZA 3OIPA 1Y8QB 1X4PA 3FK7A 1HW2A 3I59B 3ASNH 4F55A 1UAAA 4QIRA 4X1EA 2NRAC 3TO9A 2V1NA 2W82A 4OMZA 1VQMI 3H3VK 4Y17A 1S7EA 4RLQA 2OAZA 2B7EA 4BL0B 4JQFA 1D1BA 3M1CA 4DYQA 4E7HA 2UZKA 2Q2EB 2R72A 1Z9CA 2DTRA 3HRUA 2MD5A 3GLXA 5IT3A 5LLQA 5JHFA 3QPLA 3H9GA 1JHFA 5F64A 1R49A 4FE7A 2KIFA 1JI8A 4G7OF 3M07A 4RGRA 4BKXA 1ETXA 4A12A 5DULA 2DA3A 3TP0A 3IL2A 3RTRA 4N4OB 3FTUA 1SD5A 3FUJA 4CCJA 4S0HB 4O3MA 4XN4A 2QQ9A 2WV0A 3LFKA 4PFPA 2Y1EA 3RZOJ 2LF7A 4XM3A 3DWLE 3U2RA 1L0OC 3OYAA 1QA6A 1O3RA 1LPQA 2D5VA 2HS5A 2LTPA 4G9YA 4BHCA 5LRSA 4ZW7A 2P81A 4DQ2A 1UMQA 4ZZDA 3GTKJ 2Y9YA 3CZ6A 3OS2A 4PSXA 2TCTA 1JE8A 2M3AA 1DU0A 2FRHA 3COAC 3U1KA 3PNYA 5TGTA 5HNFA 1QVUA 2ZJ2A 3TOAA 4M6VA 1RIOH 3I4MJ 2WWYA 3EPZA 1Q1HA 2QF7A 5EG0A 1Y39A 2HYJA 2PI0A 4BNCA 3EYYA 3PSFA 3ZQLA 3DPTA 3F8BA 4B8XA 2B0LA 2X1EA 5KHDA 3JRBA 1P7IA 2HFHA 3VSKA 2NXNB 2XF7A 3L00A 3OS0A 2JV7A 1Z77A 3TDZC 2STTA 2QYOA 3UKGA 3W3CA 2EPFA 4XLPF 1G3SA 2H6BA 5HLHA 2Z3YA 5FKKA 4P96A 4HPQA 2FXAA 4A93J 4CCLA 3LAJA 3A14A 2EV5A 2DA5A 3GUDA 3CZEA 3RJPA 2FMYA 2X0LA 1FBQA 2DT6A 1MBKA 3FISA 2GXAA 4PVBA 4HX8A 2DPDA 4U87A 3MKWB 4UNOA 2R0QC 3FBIB 3LFUA 1TW3A 2Y9ZA 4UB8C 1B6AA 2R5YA 5GAHJ 4MIMA 4V19K 4IF4A 5TRDA 3I54A 2VXDA 3G73A 4HQMA 5LGUA 3QAHA 2H1LA 2VKDA 3DQVC 3DEEA 3EQLF 1FTZA 3B37A 3M8JA 4N9HA 2FA5A 4BQNA 2L7MP 1XCVA 3I53A 4XRFA 4ZH4F 4PW4A 2IVMA 2OQRA 5HLTA 3ZI0A 1VZ0A 3MAJA 2LKSA 3RSNA 1P4AA 4FX0A 2R7SA 4ZQGA 3RIRA 5KAFC 1J59A 3MZYA 4MEYF 2HZTA 1V4RA 2DAOA 2L7KA 3ECHA 4C2TA 1UG2A 2BZTA 2QA4I 2LLKA 3CMAI 4AIJA 2IXSA 3R61A 1U8RA 3FU3A 1I3AA 4FCAA 4DPRA 1YS6A 3EUHC 5EEAA 2EIJH 2F2EA 2V7FA 2VBZA 4QMEA 2JTVA 4NQWB 2QEXI 4A2UA 4LJZF 2KFDA 3QU6A 3JRAA 5FROA 1BN5A 2QSFX 4BU2A 1EJ9A 5E3LA 2RQQA 3BTCA 3ZMVA 4LIUA 2QKMB 3HIFA 4IOCF 1JJ8C 1QZYA 2ELJA 3CUQA 1JKRC 4C3IJ 3BJAA 3IH2A 4E7LA 2R5ZB 1BR2A 3L2VA 3FUFA 2VBYA 2WTEA 2QJ1A 4A3LJ 3WHBA 1IN8A 1OQYA 3S3NA 1GV2A 2XAQA 3TP3A 2QVWA 1JVSA 3F72A 1JTXA 2JK3A 3H92A 1WKMA 2DMUA 3CJQB 4XLFA 2RJIA 2E1NA 1QVTA 1TZLA 1W7PD 3K4CA 5E3NA 5DUKA 4OOEA 4B3XA 1L3LA 2CQ7A 2V9KA 1AHDP 3WHCA 2QSGX 2EZHA 4J01A 4S04A 3CQZJ 1Z91A 2K9QA 2Q1ZB 1FBSA 1D1AA 3UR3C 4XQFA 5KK1A 4FASD 5EV7A 3QPTA 5FFXA 3DBLB 3KZZA 3CLQA 2FOKA 5BQTA 3CD6I 1K4TA 2ZO4A 5IPAA 3CP2A 3NRVA 1VQ9I 1K4SA 4QHPA 3CCQI 4HA8A 3S2HJ 3L2UA 3I3LA 4LOCA 2B63J 3KYDB 2BGCA 4A3KJ 3GEZA 1T1RA 1RI7A 3A0BC 2BXYA 2YS9A 4CCKA 3BG3A 2BVLA 3PUBA 3HRMA 3WG9A 2GXBA 1JXSA 2OZUA 5CVVA 1P9QC 4AD9A 4CCOA 3Q9SA 1AOYA 1RUNA 2QBYB 1GLNA 4KIFA 5CVUA 1FOKA 1FP1D 2FFLA 4WXCA 1MZBA 3BDDA 3ESWB 4Q47A 3ZMUA 2CV2A 3ERED 1IUYA 1RESA 2H94A 1EF4A 2OBPA 3LOCA 5F0HA 3QPHA 3FTSA 3V8KA 3EBGA 3FBNB 1K78B 1LFBA 3QQAA 5EF6A 1GXPA 4HX4A 5B3SH 2YU9J 1SEUA 1XGOA 2UXXA 2PL5A 3S14J 4IRGA 2R7VA 2DA4A 4ZW8A 3FH7A 1X4OA 3GF2A 2XKOA 1Z7LA 1MGTA 2FX0A 1KGSA 1SC5A 3NAUA 2H8RA 5D6EA 2MSYA 3HUGB 1C0WA 2X48A 4MEXF 1B59A 2K86A 4ARFA 4EM1A 1VQOI 3LSMA 2DQLA 1PP7U 3VPRA 5DS9A 1BI2A 4S05A 1ZARA 1H88C 4E70A 1PUFB 4KIBA 2MH9A 2HPIA 5K7HA 4XKWA 4M71A 1N77A 3ZQFA 1YRNB 1DP3A 3FUMA 4BBSJ 3OOPA 2WPGA 1MBHA 2UXNA 1R5ID 3IC7A 3TGNA 5H2FC 1DPRA 2O8XA 2HVQA 4JNDA 1TQPA 2UV1A 2HPTA 2NS8A 3ZMZA 1YFHA 3MN2A 4LK0F 5HS8A 2VJJA 4P9FA 2FNPA 2NOGA 5GPCA 3HOXJ 3R0JA 2E1MB 1UHSA 1UELB 3AG2H 3FXKA 5KNLA 4ZC3A 4R5VA 4R5XA 1MJAA 2K9SA 3K2ZA 3S1NJ 4P5OA 2IGKA 2HDDA 2O7OA 3J81Z 3DTIA 4FX4A 1F1ZA 2Q8KA 4GGGA 5IYCJ 3KFWX 1LVKA 1U5TA 3K7AJ 2L4MA 1NHAA 2DLLA 2LY2A 3OYGA 4GCVA 2ZSIB 3CCMI 1SAXA 2BE5F 3C18A 1O57A 4RAYA 1V55H 3FTVA 4PK4A 4U7DA 1YLFA 2LOOA 3RKYA 3T8VA 2VQGA 1ETYA 1IN4A 4Y6RA 2MC3A 1FYKA 5GP9A 1GVJA 3KYLA 3RPUA 5E8GA 2EB7A 4Y3OA 3EUHA 1O3QA 2D1VA 2L2OA 1IO2A 4HX7A 2A7OA 1MMNA 2ZB9A 4WXDA 2WAQN 1D0ZA 4IHSA 1J0RA 3E6BA 3K1MA 4RGSA 4IRIA 2N8GA 3GFLA 3T1BA 4ESJA 3OYMA 5K5RA 1Z7UA 3WE2A 1WRJA 3DV8A 3K0LA 1E3HA 2KHMA 1A6IA 2VJ5A 4E7JA 1KONA 1RR8C 1ETWA 3DLLF 1HDPA 1OKRA 5EEGA 2RAEA 2CJJA 3WTTC 5D8KB 4WXHA 2HPOA 1CF7B 4XN2A 4CCMA 1GXQA 5M5WJ 4IHXA 2PG4A 1X3ZB 3FIWA 2LMDA 3Q9VA 2RKHA 4RGXA 2X85A 3VYRB 4E4HA 3J7ZI 1FWZA 4RA2A 4QPQA 1YOVB 1O7FA 1FYMA 1K5HA 3CTAA 2HQRA 4CZCA 2X1DA 3IP4B 2JWTA 1MW7A 3TW7A 4XKBA 1FLIA 3BZ6A 3BR6A 3PSIA 1QZZA 4EJUA 2QCOA 3MQ0A 3K1NA 1IV8A 2W24A 1JG9A 2GTQA 2E2HJ 1S5LC 2NYXA 5GTHC 2PLYA 1I5ZA 3OYJA 5JLXA 3VYSB 3CF5F 4FLSA 1D0XA 3BTLA 3S2WA 1KQ0A 4MTDA 3EDPA 4XLCA 1VQ6I 3LWFA 1SC7A 5F08A 3GYHX 1F9NA 5K7ZA 2EGHA 1RZ4A 1QO0D 3GMEA 3OMYA 3ML6A 4XK4A 3RC8A 5A2QZ 1R5HA 3HG9A 4OIPF 3KP5A 2DYSH 2Q2EA 1FP2A 2CW0F 1WVRA 1J09A 2JUGA 2X51A 3TQNA 2L9SA 2DT7B 3CDIA 4ZQFA 2EA4A 1OR7A 4RVBA 3JREA 4AIKA 2L3DA 1T98A 2LY9A 4F92B 4B1RA 2WY7Q 3B7SA 1XSDA 3Q0WA 4BS9A 5M5XJ 4HSRA 4RAZA 1JT6A 2M4GA 4CGZA 2DYRH 4IKFA 2YR2A 2ZFUA 4YIRX 3N4MA 4YIIA 1NG7A 3FDYA 1REPC 1TQMA 2O03A 2Z9OA 1TWAJ 2ZJPF 2A07F 2XPUA 1HXDA 4LLLA 4ZZLA 3ZP5A 4HDVA 1HCRA 1MNDA 2I8DA 4OIRF 4A3BJ 1UHMA 2VC1A 2K4BA 5JI6A 3BCAA 3HHGA 3E6MA 2ECBA 5EYRA 1H19A 4BACA 1ON2A 2VN2A 4KFCA 4D1QA 5JBIA 2K3FA 5C44J 3HDDA 3H35A 2Z99A 2V1XA 1QU3A 1VQ4I 1TLHB 2Z2SB 3BG5A 3W6VA 3L09A 4L9TA 4I09A 2BYVE 4I2OA 4BJTA 4HG2A 4A6DA 5DTDA 3GW2A 1X3UA 1Z6TA 5IY5H 2GLOA 3F3XA 5FLMJ 2DFEA 4D0PA 5J3LA 1HDDC 3BY6A 1ZH5A 3AUAA 3FUKA 2R7QA 1FIAA 1OLTA 3K4NA 2ZSHB 3CUOA 4CO8A 2E35A 2Q0OA 2MC4A 2HQAA 4EJVA 3F8MA 3SQNA 2MAPA 1LQ1A 3KEOA 4CXFA 3OIOA 1FYLA 2DDBA 3E0JB 2O9LA 4WF2A 1Y6IA 4L0ZB 2EZKA 3FU5A 4IZZA 2VQHA 3EYIA 3PO2J 3SDGA 5H6QA 4XNDA 2NS7A 3BOQA 3RPQA 2P5LC 3RYPA 3PIPF 4Y6SA 2I10A 2XRNA 3K2AA 4MTEA 2PMUA 2LKXA 1B8IB 5M3FJ 3WQSB 2MAOA 3V8LA 3R4KA 4BGDA 2VC0A 3HZJA 2XB5A 3WGIA 3L2WA 1ACIA 2OV7A 1J75A 3D5RC 1WGXA 2JCYA 3OYDA 2Y75A 2G7HA 1QRYA 3J81K 2CUFA 2QQAA 1W36D 4IJAA 4B43A 4UUSA 3BG9A 5EGOA 1OCZH 3VOEA 1VQNI 2OCCH 4IL6C 3Q3SA 3H0DA 2RQPA 1H9GA 4OWRB 3OYEA 1USSA 2GIZA 2COMA 1LB2A 3PNTA 4A3FJ 5BS6A 5M3MJ 2JVGA 3FX3A 3FXOA 4NQWA 2E2IJ 2XUBA 1SFXA 1OYYA 3V8JA 1X1CA 2QQBA 3HRTA 4AC0A 5BMZA 2CV0A 4XN1A 1TWHJ 1RUOA 3LL7A 4QIWN 1A04A 4NHJA 2VPLA 2DMNA 4EQQA 5FRMA 5B5EC 2PQ8A 2EJRA 4II3A 3JRFA 2KRFA 5D5UB 1W5TA 2MLGA 3E5UA 1T33A 1S7OA 2X9DA 5LBQA 1MIJA 2KRHA 3I5UA 3ZN0A 3RYRA 4G6TB 1IN5A 1IDYA 2FJ1A 4RLFA 2KDOA 1TC3C 1YITI 1G2HA 4M6XA 1R22A 1T2KA 3F21A 4I0BA 2IT0A 1X3WA 2V26A 3FXLA 3H5RA 4AWXB 2R92J 3KP3A 3LSGA 4QSHA 4IX7A 4G7ZF 3HGGA 2HKXA 3DU5A 2H1KA 4BQOA 3RC3A 4C30A 2IA1A 3WGHA 3KEDA 1GVDA 5FKMA 2STWA 4F52A 1YI2I 3D5LA 3BQZA 2W4SA 4G12A 4P1WA 4HZFA 2HOAA 4DBQA 2DQ6A 3V7CA 2JZYA 2MD0A 3IAS2 4DNCA 3CCRI 3JTHA 4B48A 1B4AA 3IWFA 2MH2A 1XMKA 1SD7A 3W6JB 4NB5A 5JHUA 5CVJA 5EDNA 1BM9A 4BH9A 4LG0A 3OV8A 2BEOA 3S32A 2LNBA 5AENA 1HKQA 3CESA 4KP7A 1P4XA 4L0YB 1Y8RB 3JSZA 5JLWA 2CQXA 4ZDPA 4IQJA 3G1LA 3KP6A 4M3GA 2QBYA 3CZGA 4XKVA 4BXXJ 2OQGA 3PL8A 4XLAA 2Y1DA 1IXRC 2QM3A 4PGHA 3H36A 2OTJI 3FM5A 4PJMA 4ENJA 4EM2A 2HDCA 4LUPA 3FK6A 3CZKA 3DPLC 1BR1A 1WJAA 1KU7A 3WODF 3VVLA 5LRRA 2GQQA 1FJLA 3HUGA 4ENNA 3LSRA 3ZPLA 1FOYA 2HOEA 5DCMA 4CYDA 4RDUA 2IS1A 2QLZA 1MSFC 3O8GA 2NVYJ 4I7HA 5JVGF 4DZJA 3BLYA 5D8LB 1DP7P 5CJ9A 3SXYA 4AYBN 2EV6A 4YIFA 1IZ1A 1IXSB 3OYIA 3MEXA 3BTJA 1X1AA 2EBIA 3ISPA 4HF1A 2ME0A 4G6QA 4QTRA 5J4VA 1HW5A 1SFKA 3W2AA 3ROUA 2VOPA 4BEHB 1ZGAA 3CCUI 1LJ9A 3F8NA 4YELA 1K6OA 4XO3A 1LFUP 2ZXJA 2DTZA 2RREA 3GTMJ 3KEQA 2BW3A 5FGMA 3UCQA 4QUOA 3IIEA 2RNGA 1DGWY 4XKCA 4CCNA 1BI1A 2G0EA 2R3SA 4I01A 3HOTA 1Q0LA 1I1GA 2DFFA 4L9NA 4PSWA 3ZQHA 4GRIA 4XBFA 2ZFWA 4A5NA 3LSHA 3WTUC 2CYYA 4IRHA 2RNJA 2WB1N 3ZR8X 2PEXA 5K5QA 3S3OA 4AIHA 2L7FP 3A1YA 2VOOA 1IGNA 1BJAA 3LSJA 1QBJA 2LC2A 1MH3A 1TWCJ 3A4CA 4M72A 4XR6A 2XB0X 1HC8A 1LDJA 4AR9A 2Y1FA 1QZEA 2LBFB 3RKQA 1G3TA 2XC7A 2CMPA 4G94A 4EJTA 1WJDA 3JRDA 4XL9A 2XIGA 1T8IA 3E7LA 5J47A 4MNUA 4AUXA 2O0YA 3H1CA 3J7AY 1MW3A 1R1TA 3OYHA 1BOAA 3KZIC 4XIDA 4M9XA 4HV6A 2BXZA 2JA7J 3DTEA 2ZC2A 1S6LA 5HDGA 3PFYA 1SMTA 2C6YA 2KLOA 2DK5A 2VPRA 1B1BA 2DO7A 3MWMA 4HBLA 3SFZA 3QRFF 4IOAF 5FWQA 2OD5A 5LFAA 2P6SA 5CQEA 2CH0A 4HNTA 5E3OA 2IGMA 4XNFA 2R7XA 3BCBA 2PJRB 3HTUA 3H0GJ 3O2PE 3HRSA 4XOTA 1MW0A 4ZQEA 1MBJA 4ZW5A 3G6EI 4HF0A 3REOA 4ANJA 1I39A 2CSOA 3FZVA 3NQOA 4RB2C 2LRDA 3KLNA 3HW2A 2XRLA 4EJWA 1SFUA 2ZCWA 5FJ8J 2JQ7A 3S15J 3U9GA 3P5JA 4N4NB 1E2XA 2DFIA 3CJRB 1X3ZA 3K9TA 4ZW6A 3ONQA 5TJJA 3CCEI 4PU2A 1IDZA 3PUUA 3SFIA 1NTCA 1OISA 2F4MB 3LA3A 5IYDJ 2KPMA 2D45A 2V79A 1YJWI 2M87A 3OYBA 4LGWA 2DA7A 2VJIA 5J1RA 5LEJA 4BE0A 5DV5A 4R7LA 3FXJA 5BPIA 4NBQA 5ILUA 2DT5A 1DQUA 4LLGF 3J80Z 4A03A 3S1MJ 1T38A 5EEHA 3WQRA 1HSJA 2VASA 5J8CA 5L3EA 5E8IA 2DOAA 1XDSA 3FM3A 4F3QA 6PAXA 3G4SI 1X2MA 2EFPA 3L7WA 2ZJQF 4U0WA 3KETA 4IHWA 1YIOA 4D5CA 9ANTA 2HXIA 2LY1A 2W85A 4CDGA 4CYCA 2CV1A 1W7PB 1XMXA 4RS8A 2ZNYA 3K70C 4BAYA 2IRFG 4RCVA 3AU8A 3GXOA 1OJLA 2DDAA 3OL3A 3CO7C 2OPTA 1LKXA 3K10A 2NNYA 4XMXA 2F6CA 3JAMK 3I55I 1BA5A 4KITB 1EH6A 3G1OA 1IRZA 3FTXA 2BBYA 1CQTA 2YUSA 2M4KA 3QYBA 2Z33A 1I27A 2HZDA 2PMHA 3HSRA 1U8BA 1ZELA 3OSGA 2EZIA 1HOMA 3E3VA 3KYCB 4II2A 3TOBA 2Y0SN 4NC8A 4ZYGA 2PMZN 2HU9A 3V7RA 1MNEA 3I58A 1OCTC 4Y6PA 4MLOA 4XLNF 2NVTJ 5DM7F 1H89C 3TBIA 4UV9A 5B1AH 3L9FA 3WU2C 2AQFA 1A36A 4Z2YA 1BI3A 1FMWA 2DMQA 2ZMEB 3F6OA 2DA1A 3KE2A 4XSXF 5B1BH 4ZTFA 5HDKA 2CG4A 1EKEA 4K5OA 3ZMSA 4UHTA 4ZW3A 2H09A 4R79A 1WWXA 2DXIA 2DA2A 4JX5A 5K1YA 3FH5A 3M9AA 4Y15A 2AHQA 2XAJA 3I71A 1R4MB 4HYEA 1YTYA 2A6EF 4ESBA 2K3PA 2DOFA 2E1OA 4BY1J 1MH4A 1VF9A 2NOJB 3QYEA 2HVRA 3Q44A 2F5EA 3GLLA 3CHOA 3HJEA 5J1UA 4FLOA 4B47A 2ZXIA 3IWZA 4K5LA 4YFKF 4XMUA 1MBEA 2XV4S 1U9OA 4HDUA 3CC2I 4XO4A 3EBIA 4PJ0C 2XSJC 3GBGA 1FOWA 1GV5A 2R7FA 3HSEA 4KNYA 4ZX3A 3CCLI 4EEFG 1LDDA 1BR4A 4I98B 1RKWA 2Y0MA 3OYFA 2NVUB 4HF2A 4XNAA 2XPVA 5IOYA 4D7MA 3F23A 1STZA 2E2JJ 2HOTA 1S29A 3W2VA 5HNHA 1JJ6C 2R7DA 1MBGA 3S2DJ 4XRMA 1F43A 3F0CA 1IRGA 1ZYRF 1TL8A 1OCPA 1RR7A 2JN6A 2X6WA 1MW1A 1QPIA 2QWWA 3BP8A 3CCJI 2AO9A 4X2UA 2V9PA 1DPUA 2IGNA 4YRVA 3KX2A 3ZQ7A 5BNGA 1O3TA 2F5DA 4PGGA 5E17F 1KA8A 4ZYHA 4F7ZA 3HKZA 1W0TA 5D4SA 5HDNA 3FH8A 2GOXB 1D1CA 4HOBA 4KT5C 2EZLA 3D5SC 2NVXJ 4JOMA 1MBFA 1AWCA 2DCEA 3P7NA 2EFQA 1ETQA 2MA3A 2JVHA 4XICA 1NG6A 4ZDOA 4A3CJ 2DQRA 1I3QJ 1WI9A 4O6JA 2HQNA 3HSFA 4KYWA 3RKWA 3N97A 3JRHA 3T8RA 3K4MA 3IHUA 4RM2A 1FT9A 2Y48A 2ESNA 2A3SA 2V1DA 4L5IA 2XDVA 1WSUA 3E6DA 3BR5A 4A69C 1XB4A 4F93B 1ZRCA 3F6VA 4HRIA 2X1CA 5IOZA 2NVQJ 3HOVJ 1MKMA 1T0FC 1IN6A 5B66C 4X6AJ 3PUFA 3QODA 2EV0A 1T39A 1KU9A 4E7IA 1V5GA 3RI4A 5CKTA 4E7KA 2HYFA 1JTYA 3PIOF 2B61A 3CDHA 3WTYC 2L9RA 4A3IJ 1ONOA 1GW6A 1R71A 5EG0B 2P5VA 1G3WA 2E7XA 1YYVA 2PUSA 1W5SA 4ON0A 3ANMA 4IHTA 3QOEA 1G8XA 4I99C 3OYNA 1MDMB 1TP4A 3HPHA 2M0MA 4XN3A 4OAZA 3WU0A 2L5QA 3S1RJ 3B02A 1X1DA 2FE3A 3ANNA 3FULA 1FNNA 3ERMA 2MW8A 4RM3A 2VT3A 4MQ9F 3PQKA 2HEOA 4ZYEA 2K27A 3J80K 1CGPA 3BC8A 5F6FA 1MNMC 1ERDA 3RKXA 2CW7A 1F4KA 3CO6C 2V1UA 2VBXA 5AIQA 5ILSA 3OOUA 4R1HA 2VE8A 3UNGC 4XN8A 2Y1GA 3M3YJ 3AG1H 3KP7A 1TQIA 2QVOA 2UUZA 4UB6C 4M74A 3RQ4A 2R5YB 2EWNA 1SFOJ 1T56A 2EFOA 2FQ4A 4A0ZA 2P4WA 1W4MA 5LD2C 5FLXZ 1SG7A 1NK3P 1UG0A 5HLGA 2VUMJ 1XSVA 1Z67A 2BVMA 1S7AA 4V2FA 1UHWA 2M30A 2KIUA 2DN0A 3I59A 5L3CA 4ENMA 2X6OA 4GYIA 1XCBA 4UUTA 2ZMEC 1LUJB 2KJCA 1VQ5I 2WBMA 2KMUA 1I6HJ 3KP2A 3DFGA 3FXMA 3NWSA 2V6EA 1ZLKA 2DJIA 4XORA 2K9MA 3ZXSA 5ERIA 4C2UA 2VODA 1JUMA 2CU7A 5JNLA 3ZOBA 5IP7J 4W1UA 3GTOJ 4BEHA 4GDFA 3CMYA 4DGWB 2WY8Q 5LHHA 2WZFA 4XN7A 2A69F 3LSIA 3CUQB 1D3YA 5CYVA 3R60A 2YPRA 3CCVI 4FLQA 5DCFA 1Q0HA 3W2WA 2HPMA 4KA4A 2W00A 1ZREA 4PUSA 2Y2ZA 5F0CA 4AICA 2AQEA 4BY7J 3JCUC 2IA0A 2WADA 3CMMA 4CA0A 2M34A 3H3UA 2OU2A 3G2BA 2QGUA 3B7RL 3FMRA 4FHTA 5JAZA 4K5PA 4JYKA 5HS9A 4KJZA 4YEJA 4C3HJ 2KT0A 3PQJA 2HOSA 2QSHX 5DYMA 3CHRA 5D5WB 1Z3YA 1ZG5A 2BY3A 2LBFA 5AONA 2KZGA 3RQIA 3EBHA 2VLAA 1SAUA 4TV7A 4FCYA 2E34A 2VL8A 2QQ8A 4IEJA 3B34A 5D4RA 4Y13A 2XKPA 1A5JA 4A3EJ 5CLSA 4OOFA 3VVMA 2FBKA 3AKZA 1U9NA 4BXFA 1UB9A 3F9KA 1F5TA 2DA6A 2F5FA 2JA6J 1NK2P 4KICA 3SHFA 1SQMA 1Z0XA 2H27A 3KIOA 4U0VA 2R7UA 2Y30A 2L02A 5J4YA 1LVAA 2GA2A 1SFEA 3GZNB 2LFBA 2E1CA 5HS7A 3OS1A 4EVIA 1WH7A 4DJAA 2CUJA 3L2RA 2H6CA 3OYCA 2IS4A 2PJRA 3CDLA 3DKXA 2R7ZJ 3T8TA 2DFHA 3M8FA 2RGVA 4RAGA 4B44A 5CVRA 1ZGJA 2EFNA 4G6DA 1X58A 2G7UA 4NNJA 5FB2A 4FTHA 4BBRJ 2Y69H 1AU7A 3ULQB 2KISA 2C5ZA 1PUEE 4XN9A 4XNBA 5DDGA 2EH3A 3B2XA 1FOXA 4Y7NJ 3S93A 4Q4EA 3QP5A 5EJCA 3FUHA 3IH3A 1OCRH 4PZJA 3MFKA 3S17J 4OAYA 3CIAA 2E36A 2MFZA 2O61A 1MMSA 1WCMJ 2ECCA 3FKJA 3FTYA 2DBBA 1EV7A 1XX5A 3FF5A 1BW5A 3MZ8A 4LIVA 5E18F 1VQLI 1V5EA 5D5XB 4PJJA 2IGOA 2HTSA 1ZHFA 3P9IA 4KMFA 3OYKA 3AG3H 2AS5F 2G9WA 3CHQA 2AXLA 3ZMDA 2BY1A 2OUMA 3DTKA 4EGZA 1N78A 4UVAA 2BY0A 2LSOA 2RV8A 3TO7A 4DOZA 2QKLB 1KU3A 5ICCA 2FU4A 3F8CA 5LHGA 1MJ9A 1XDUA 4H0EA 5FLVA 1QQIA 3TMOA 4AVPA 1YJNI 3I9V2 1WJBA 4BYYA 2R5ZA 4Q5SF 3I0TA 3MMYB 1JGGA 1UCRA 5E3MA 2RN7A 2HVSA 1RKTA 3PNVA 2K85A 1H9TA 3ZMTA 3ZHZA 2IW5A 4I02A 1K79A 3IKVA 3A02A 2OA4A 4AIDA 2IBDA 3KP4A 1ZR4A 1JGSA 4EJOA 5EZGA 3FUNA 1ITYA 2HDWA 2VB6A 1IW7F 4HNVA 2ISZA 1U5TB 3DEUA 1KQ8A 3ABKH
chains in the Genus database with same CATH topology
2CH0A 1IRXA 1Z7LA 3SEZA 3OY9A 1SC5A 4HNTA 1QHHD 3HUGB 2IGMA 2Z1DA 1FMVA 4XNFA 3BCBA 2UWMA 2PJRB 2R7XA 3WQQA 2KRCA 4ARFA 4XOTA 3B2PA 3LSMA 1MW0A 4ZQEA 3L2QA 3FU6A 4AYBA 4IQ4A 4ZW5A 2R70A 2HPIA 3VSLA 3IUOA 4ANJA 3DPUA 1AA7A 2F4IA 4XKWA 2LRDA 1N77A 3FUDA 3SDBA 3OWTA 1DP3A 4K5MA 3FUMA 3MD2A 4XLEA 3QJXA 2WPGA 4N4NB 3CJRB 1X3ZA 4MS6A 4ZW6A 3ONQA 1MMAA 4PU2A 2HVQA 3PUUA 4JNDA 2UV1A 2HPTA 3IAM2 4ZTJA 2KPMA 1E0EA 3QYFA 3HXLA 2VJJA 2V4JC 2P0WA 2JD1A 3OYBA 3MKYB 4HEA2 2E1MB 3SYTA 1UELB 2VJIA 5KNLA 4BE0A 4R5VA 4ZC3A 4R5XA 2F5VA 4R7LA 2R7WA 3RPUD 4P5OA 3UERA 1DQUA 2IGKA 4A03A 3DTIA 2WB1A 4GAEA 3UEQA 3CP8A 3WQRA 1X19A 2L9NA 2VASA 3Q43A 2DOAA 4F3QA 1LVKA 1HS6A 2E5NA 2XPYA 4BQQA 2LY2A 3OYGA 4QPEA 2ZSIB 2WA0A 2LY1A 2CV1A 2XPZA 3AFHA 5CQGA 4PK4A 3FTVA 2X6XA 2XAUA 3K70C 3VYTB 1MMDA 2LOOA 2VKHA 4RCVA 2R7RA 3AU8A 2ZXGA 3K4JA 4LITA 1WJCA 3T8VA 2VQGA 3OL3A 2O7GA 1LKXA 3K10A 4Y6RA 2KP6A 1S9HA 2JCXA 3OIQA 4XMXA 4R5TA 2KL4A 2F6CA 4KITB 3KYLA 3FTXA 2CS3A 4Y3OA 2M4KA 3QYBA 2L2OA 1EA3A 3AU9A 2E1MC 2HZDA 2A7OA 4AR8A 1MMNA 4BE1A 3KEYA 1ZELA 4LG3A 3FTYA 2HNHA 1D0ZA 3LMMA 4II2A 3OYMA 4NC8A 2VJ8A 2HU9A 3FHNA 1MNEA 2KHMA 4Y6PA 1Z21A 2VJ5A 4E7JA 4MLOA 1KONA 4ZQHA 3HC7A 3TBIA 4ZQTA 4Y67A 3FHEA 2AQFA 1QHGA 2HPOA 4ZYAA 3ANLA 1FMWA 1PJRA 3PJRA 4XN2A 2OC6A 4ZTFA 4CCMA 4E7SA 4XMZA 4Q4IA 2LYCA 4K5OA 4ZW3A 4E4HA 3VYRB 2K5CA 2X85A 4R79A 4NUBA 1ONPA 2DXIA 5HVQC 3FH5A 1W36C 4QPQA 2A5WA 2VIXA 3FTWA 4XMYA 3S3MA 1K5HA 1PYVA 2LG4A 2X1DA 4CZCA 5JMPA 3IP4B 1MW7A 4BDZA 2K3PA 2W1OA 4H4KC 4XKBA 3B3BA 1X1BA 4EATA 2NOJB 3BG7A 3QYEA 2HVRA 3Q44A 3OR1C 3CHOA 3PSIA 2GTQA 3EUAA 4FLOA 4B47A 1JG9A 4XOPA 3OL4A 1ONNA 2ZXIA 2R7OA 3HPGA 3CHPA 4K5LA 1JGIA 4XMUA 3U9WA 1MVYA 3BG6A 3OYJA 3VYSB 4FLSA 1D0XA 4U7BA 2E5ZA 1LFPA 3U21A 4XLCA 4XO5A 4XO4A 2EGHA 1TT0A 3OMYA 4RSYA 3EBIA 3ZHXA 3RC8A 3HG9A 2XSJC 3GBGA 3SZGA 4ZX3A 2JUGA 1J09A 2X51A 2MABA 3H9JA 2L9SA 2DT7B 4ZDLA 4BJ5C 4ZQFA 4RVBA 1OR7A 3C2GA 4F92B 3A06A 3B7SA 1BR4A 2LREA 2WY7Q 3OYFA 4BS9A 4HSRA 4QPOA 4XNAA 2M4GA 3OYLA 4E7ZA 4IKFA 1ZS2A 1G59A 2ZFUA 3W2VA 5HNHA 2WAQA 4KT6A 3OR2C 1NG7A 3FDYA 4L2LA 2Y0SA 2X6WA 4HSTA 1MW1A 4BJ6C 2PMZA 3V42A 4AU7A 1S46A 5BPPA 1N75A 4X2UA 2IGNA 4YRVA 3KX2A 1G5AA 4ITVA 1MNDA 2I8DA 3HKZA 1Z3XA 3DLAA 2JD0A 2A6TA 3FH8A 4J3BA 2GOXB 3BCAA 3ZGKA 4NC7A 5DLLA 1D1CA 3ZQQA 1T1SA 3ZRGA 3D5SC 2ZXHA 1H19A 4JOMA 2WZGA 4BACA 3B7TA 4PJLA 4Y33A 4D1QA 3T0YA 4X0GA 5JBIA 5KCMA 4CUGA 2DCEA 3H35A 1QU3A 2R59A 4RMNA 3HL2A 2Z2SB 2JVHA 1DGRM 2Z16A 4BDYA 1NG6A 3H9QA 4ZDOA 3RASA 4BJTA 4FLRA 4HG2A 1V5FA 2W7NA 1Q0QA 3K70D 3K4MA 2MYSA 3K6GA 4RM2A 2VXZA 2CW8A 5CQEA 2XDVA 4F93B 4HRIA 2X1CA 4F91B 3A2KA 3AUAA 3FUKA 3CHSA 1OLTA 1T0FC 3K4NA 2ZSHB 3QODA 2FUG2 3AL0B 2MC4A 2HQAA 4E7IA 1V5GA 5CKTA 4Y4RA 2MAPA 3H5NA 3DU6A 4ZJZA 4E7KA 4CXFA 2M7BA 2B61A 3OIPA 1X4PA 1ONOA 4F55A 1UAAA 1GW6A 4QIRA 2XQ0A 4AYSA 2V1NA 2W82A 3E0JB 4XN5A 1Y6IA 3FU5A 4IZZA 4RLQA 2VQHA 2PUSA 4BL0B 1WJ5A 1WJFA 4JQFA 1D1BA 3M1CA 4E7HA 3ANMA 4XNDA 2Q2EB 4BUPA 2R72A 3QOEA 1G8XA 4Y6SA 3OYNA 2C82A 3HPHA 2M0MA 4XN3A 4K5NA 3WQSB 4CH7A 4OAZA 2MAOA 5JHFA 2L5QA 4BGDA 2JA2A 2PGGA 3H9GA 1X1DA 3FULA 3ANNA 3L2WA 2CUZA 1JI8A 2OV7A 4RM3A 3D5RC 2DQMA 2JCYA 4BKXA 3OYDA 5DULA 5JC1A 3RTRA 4N4OB 3BC8A 3FTUA 1RP3A 1W36D 1ERDA 3FUJA 2CW7A 4B43A 4CCJA 5HOOA 4FETA 4XN4A 5JMWA 3OOUA 4PFPA 3UNGC 3H0DA 4OWRB 3OYEA 2Y1EA 4XN8A 2Y1GA 4XM3A 3DWLE 4D9JA 1R0KA 3OYAA 2UUZA 3PNTA 3RQ4A 2JVGA 4ZW7A 4NQWA 5LD2C 4DBRA 1X1CA 2CV0A 1SG7A 3CZ6A 3VDXA 3MKZA 4XN1A 2XF5A 3LL7A 4PSXA 3OS2A 2M3AA 1UG0A 2VPLA 5FRMA 2WAFA 2BVMA 4II3A 3PNYA 5TGTA 5HNFA 4AR1A 5JO0A 3EPZA 1R0LA 1OR7C 2M7AA 4ZX4A 2E60A 4ZX6A 2KRHA 3PSFA 1T95A 1WJEA 3DPTA 2VQCA 2WBMA 2JSPA 4G6TB 2KMUA 2X1EA 1H3LA 5KHDA 4GAAA 1YE9A 3NWSA 2V6EA 4XN0A 3VSKA 3OS0A 3CF2A 2DJIA 2XF7A 2K9MA 4RLFA 2KDOA 4XORA 2JV7A 3ZXSA 4C2UA 2R4GA 5JNLA 3EUKL 4BEHA 3W3CA 3RCOA 1X3WA 2V26A 4DGWB 2WY8Q 3H5RA 3LSGA 4IX7A 3K4BA 1R6RA 3DU5A 3FTZA 2O5RA 2WAEA 4HPQA 4AVZA 2WZFA 4BQOA 4XN7A 3FU0A 3RC3A 4CCLA 3LSIA 4C30A 3KEDA 3A14A 3CZEA 4F52A 3D5LA 2W4SA 4FLQA 2DT6A 1Q0HA 2CFOA 4P1WA 3W2WA 4PVBA 2HPMA 2W00A 4ZN6A 3NWTA 4PUSA 1U0JA 4U87A 4DBQA 3MKWB 3FBIB 2KZVA 3LFUA 2DQ6A 2MD0A 3IAS2 2AQEA 4B48A 2WADA 3CMMA 4CA0A 3B7UX 2VXDA 3G2BA 4CSWA 5FRNA 3B7RL 4C9YA 5JAZA 4K5PA 3E1SA 2VKDA 4KJZA 4YEJA 3DQVC 3DEEA 3B37A 3M8JA 2XF6A 4BQNA 3S32A 5AENA 3H5AA 3CESA 3CHRA 4KP7A 1Z3YA 4PW4A 3JSZA 2LBFA 5HLTA 3ZI0A 1VZ0A 3RSNA 2BW3B 4J00A 4ZDPA 4IQJA 2R7SA 3EBHA 4ZQGA 2VLAA 1SAUA 3CZGA 4XKVA 4DIQA 2VL8A 3PL8A 4XLAA 2L7KA 4XONA 4KISA 2Y1DA 4C2TA 3B34A 2VJ4A 2IXSA 3DKYA 3K4LA 4PJMA 3AKZA 3FU3A 4MKTA 4OOFA 4BXFA 4FCAA 3VVMA 4DPRA 3EUHC 3F9KA 1LDKB 3ZCOA 4LUPA 2V7FA 3R0IA 1SQMA 4QMEA 3CZKA 4NQWB 2R7UA 3DPLC 1BOBA 1YX3A 3LSKA 1BR1A 1WJAA 5FROA 4BU2A 4AICA 2RQQA 4XMTA 3VVLA 3K4KA 4LIUA 2QKMB 3OS1A 2ELJA 4DJAA 2CUJA 3L2RA 3OYCA 2IS4A 2PJRA 3HOSA 1HA8A 3DKXA 2GOMA 2IS1A 4E7LA 1MW2A 1BR2A 4B44A 3L2VA 3FUFA 3BLYA 4NNJA 2QJ1A 2BOLA 5CPRB 2JD2A 3S3NA 2C5ZA 3OYIA 4XMVA 2QVWA 4XN9A 4XNBA 3B2XA 1X1AA 4E6KG 1JVSA 5DYFA 4HNUA 3CJQB 3S93A 4XLFA 4Q4EA 1SFKA 3W2AA 3K4CA 1TZLA 2RJIA 4BEHB 4OOEA 3FUHA 4B3XA 4YELA 2V9KA 4J01A 4XO3A 2VQLA 4OAYA 3CIAA 2MFZA 2RREA 3N05A 3UCQA 2BW3A 2Q1ZB 2JCVA 4QUOA 4PFOA 3IIEA 1D1AA 2RNGA 3FKJA 4PJNA 3UR3C 1DGWY 2K9LA 4FASD 4XQFA 3CZLA 5EV7A 4XKCA 4CCNA 1YX5A 3S8PA 4LIVA 3VWBA 1V5EA 1K6YA 3HOTA 1Q0LA 3CP2A 3AL0C 2IS6A 4PSWA 4QHPA 2LH9A 4GRIA 4PJJA 4XLHA 2IGOA 3TL4X 3LSHA 3VYUB 3JT1A 3ZHYA 1Y56A 2KQRA 3L2UA 4BE2A 3OYKA 3I3LA 3ZR8X 3CHQA 1MMGA 3S3OA 3DTKA 2OUMA 1N78A 3A1YA 1T1RA 4DOZA 2LC2A 2QKLB 2R7TA 3A4CA 4ZX5A 4CCKA 4XR6A 2BVLA 3SEQA 4AR9A 2Y1FA 3PUBA 2LBFB 2XC7A 2CMPA 3TMOA 1P9QC 2X6YA 4CCOA 1D0YA 1WJDA 3I9V2 1WJBA 1GLNA 4XL9A 3MMYB 2FFLA 1WFXA 2HVSA 2CV2A 3J7AY 3PNVA 2IS2A 1MW3A 3OYHA 3ZHZA 3FUIA 3FUEA 3FTSA 3EBGA 3FBNB 3DTEA 3FUNA 3PFYA 2KLOA 3C2HA 2HDWA 2VB6A 2PL5A 2Y1CA 4XMWA 2R7VA 5FWQA 5LFAA 2R7QA 4ZW8A 3FH7A 1X4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNF A;  5HLT A;  5HNH A; 
#chains in the Genus database with same CATH topology
 1VTN C;  4HV5 A;  3OY9 A;  4O5V A;  1HKS A;  2JA5 J;  2GM4 A;  4XRS A;  2Z1D A;  2UWM A;  2HTJ A;  2KRC A;  3I64 A;  2V6C A;  2OJE D;  4A3D J;  2EA2 A;  3FU6 A;  2J5O A;  1S72 I;  2EIN H;  3GTL J;  1O7L A;  2L7Z A;  3ELK A;  1R36 A;  1AA7 A;  1V3F A;  2F4I A;  2JPC A;  3ZQG A;  3FUD A;  2IJL A;  4PDK A;  5IT9 Z;  1HST A;  4K5M A;  4FT8 A;  1PVE A;  4C3J J;  3WTS C;  3QJX A;  3JRC A;  1OCO H;  5TIS C;  5E79 C;  3DP7 A;  2VKE A;  3FKI J;  3GWZ A;  3LST A;  3A01 B;  3CCS I;  1E0E A;  1HKT A;  5FLX K;  3HXL A;  3WE3 A;  2V4J C;  1IXC A;  3KLO A;  2P0W A;  3HHH A;  2JD1 A;  3MKY B;  1Z1D A;  4B4C A;  3SYT A;  5F0F A;  4GO1 A;  5J40 A;  2CGP A;  3RPU D;  1IF1 A;  1W1W E;  2CQK A;  1IN7 A;  3UER A;  5JVT A;  1UJ8 A;  2NAZ A;  1ONV A;  5GAE J;  1K78 A;  4GAE A;  3UEQ A;  2KIM A;  1X19 A;  3CUQ C;  2L9N A;  5L3G A;  1I6X A;  3LNQ A;  5A2Q K;  3Q43 A;  2DU9 A;  1ODD A;  2OTL I;  3ABT A;  3C7J A;  4YFN F;  1ZTR A;  3JSP A;  2E5N A;  3GO5 A;  4BQQ A;  1QNT A;  4QPE A;  2WA0 A;  5E1W A;  1J9I A;  2EQR A;  4LFU A;  5CQG A;  1P6R A;  4M3F A;  3RZD J;  1YO5 C;  3VYT B;  2VKH A;  2BHY A;  2JT1 A;  2R7R A;  2ZXG A;  2O3F A;  1PUF A;  1WJC A;  2O7G A;  4OIO F;  4UVC A;  2KP6 A;  1YRN A;  4R5T A;  2KL4 A;  4RGU A;  3WG7 H;  1POG A;  4Q4Z F;  2CS3 A;  4M6Y A;  1SMY F;  3BQY A;  4BE1 A;  3LSP A;  3KEY A;  4LG3 A;  1KZH A;  5J6X A;  5E1X A;  1D8K A;  1MSE C;  2K4J A;  3QWL A;  2W25 A;  4A3G J;  3FHN A;  1Y1W J;  1A31 A;  3OSF A;  3BTI A;  3Q5F A;  4ZQH A;  4KIG A;  5L3F A;  3G1M A;  3HC7 A;  2H8W A;  5DUI A;  1YIJ I;  1P4W A;  2D1H A;  4ZQT A;  1JKP C;  4Y67 A;  3FHE A;  2GIV A;  1QHG A;  3GTQ J;  1HLV A;  2K02 A;  3ANL A;  1RPW A;  1ZRD A;  4E7S A;  4UV8 A;  4XMZ A;  3FXR A;  1D5Y A;  2MLK A;  4U88 A;  1ZR2 A;  3JRI A;  2L9V A;  2DOE A;  3C1D A;  4BQA A;  1LE8 B;  2GA1 A;  1W36 C;  5H6R A;  2A5W A;  1TT5 B;  3S3M A;  5FD6 A;  2ID6 A;  4RB3 C;  4ASN A;  3QP6 A;  2NNN A;  3C3W A;  3DEW A;  2ZKZ A;  1PYV A;  2LG4 A;  2VKV A;  5J1Y A;  2A5Y B;  3LAP A;  4ENK A;  1RRJ A;  3CXB A;  2FF4 A;  3JR9 A;  2W1O A;  3B3B A;  3HM5 A;  1X1B A;  4EAT A;  1FEX A;  5C3E J;  4I6Z A;  1BI0 A;  3JRG A;  4ZYD A;  3WTX C;  2DMP A;  1BIB A;  2RDP A;  4AM3 A;  5GAG J;  4L9J A;  3IRQ A;  2GBY A;  4XOP A;  2I5U A;  3OL4 A;  4JK1 X;  1GHC A;  2A61 A;  2R7O A;  3CJN A;  3WGG A;  1PDN C;  1MVY A;  1RNL A;  3BPV A;  4U7B A;  1ZGW A;  3KZY A;  1WZ2 A;  2E5Z A;  3U21 A;  4M73 A;  1D5V A;  2PFB A;  4XO5 A;  1TT0 A;  2LKP A;  1ZRF A;  2W57 A;  2XAF A;  3FMQ A;  1IAW A;  2CQN A;  4EM0 B;  4DYC A;  1W0U A;  2GWR A;  3SZG A;  3VB2 A;  4OIQ F;  1T08 B;  2CQQ A;  2LR8 A;  3E6C C;  4FQG A;  4BJ5 C;  2HKO A;  2MAB A;  1UZC A;  1FSE A;  3H9J A;  1MDM A;  2VT2 A;  1E3P A;  5HOD A;  2A05 A;  3VOD A;  3A06 A;  1CF7 A;  5JFR A;  4QPO A;  4JX6 A;  2DJN A;  2QZ8 A;  4E7Z A;  1U3E M;  1G59 A;  2WAQ A;  2IPQ X;  3OR2 C;  5F1J A;  1P2F A;  3PFI A;  1XN7 A;  2HI3 A;  2L54 A;  3E5Q A;  4HST A;  4BJ6 C;  4L5E A;  4AU7 A;  1S46 A;  3BR2 A;  2IEK A;  5BPP A;  1N75 A;  2LP0 A;  1G3Y A;  1JUS A;  1Z3X A;  3DLA A;  1U5T C;  3ZQC A;  2A6T A;  3NAR A;  4J3B A;  3DCF A;  2QUF A;  3ZGK A;  4NC7 A;  2PX9 A;  5DLL A;  1T1S A;  3ZRG A;  3CC4 I;  1VQ7 I;  2ZXH A;  1I50 J;  1LEA A;  4Y33 A;  3ABL H;  3T0Y A;  2GZW A;  5C4J J;  2R59 A;  4RMN A;  2VBW A;  2Z16 A;  4BDY A;  1VQ8 I;  3H9Q A;  4A3M J;  4UUS B;  1R1U A;  5EGO B;  2AXT C;  1FSH A;  2W7N A;  1Q0Q A;  4IVN A;  2LK2 A;  2MYS A;  3M1E A;  2XHK A;  1A6Q A;  2HYG D;  1ZQ3 P;  1KYW A;  1HF0 A;  4KUM A;  4EGY A;  3A2K A;  2HWV A;  3CHS A;  4B09 A;  4IHV A;  4IHY A;  2FQ3 A;  4GYG A;  1JKQ C;  2FUG 2;  5FFZ A;  3AL0 B;  1S3J A;  1IUF A;  3H5N A;  3DU6 A;  2K40 A;  3LA2 A;  2E71 A;  1XD7 A;  2M7B A;  5D5V B;  1DU6 A;  4BHP A;  2XGD A;  5IT9 K;  4OOI A;  2XQ0 A;  2ZBK A;  1PP8 F;  4AYS A;  3HBL A;  4XN5 A;  5IYB J;  4LD5 A;  1ZG3 A;  3FXU A;  1WJ5 A;  1WJF A;  5J8F A;  4BUP A;  1XGS A;  1U2W A;  3I56 I;  1ETO A;  3H3Z A;  5FD5 A;  2C82 A;  2R93 J;  4K5N A;  3E97 A;  4CH7 A;  3O3K A;  2JA2 A;  1XG1 A;  2PGG A;  1SD4 A;  1X3W B;  1E3O C;  1TNS A;  1APL C;  1QGP A;  2CUZ A;  2Y31 A;  4NC6 A;  1TW2 A;  2DQM A;  3W6K B;  3BWG A;  2W84 A;  4ABZ A;  5JC1 A;  5JR3 A;  1RP3 A;  2L01 A;  1OMI A;  1AKH B;  3CC7 I;  3MCZ A;  4FET A;  5HOO A;  5JMW A;  1DUX C;  5BPD A;  2JRT A;  2XAS A;  5EZH A;  1A35 A;  1LNW A;  4M9Z A;  2JA8 J;  5H20 A;  4A0X A;  4D9J A;  1Q1V A;  4GFB A;  1R0K A;  4L5J A;  4EMS A;  2XGC A;  3HB9 A;  3TKY A;  4DBR A;  3AAF A;  2LD5 A;  1WI3 A;  3VDX A;  2HQ5 A;  5F1R A;  2XF5 A;  3MKZ A;  1J7K A;  3QOP A;  4LG0 B;  1JUP A;  2WAF A;  1B72 B;  1R1V A;  4BHB A;  1WHU A;  3KPH A;  1OFC X;  1Y1V J;  4QWQ A;  5L3D A;  4JP0 A;  4AR1 A;  5JO0 A;  1R0L A;  1OR7 C;  2M7A A;  4ZX4 A;  2E60 A;  4M3E A;  3J7A O;  2HGC A;  4ZX6 A;  1T95 A;  1WJE A;  3GFJ A;  2VQC A;  4V2G A;  1E17 A;  1O4X A;  1H3L A;  1Z6R A;  2JSP A;  4LB6 B;  3VFZ A;  4GAA A;  1YE9 A;  1BW6 A;  1YQA A;  2CUE A;  3LQR A;  1FX7 A;  4XN0 A;  3CF2 A;  1B8I A;  3CJT B;  3DF8 A;  2R4G A;  3GTG J;  3EUK L;  4WWC A;  3RCO A;  1FZP B;  3QPS A;  4C2M J;  2COB A;  4I76 A;  4LK1 F;  2M2E A;  3K4B A;  1R6R A;  3FTZ A;  3GX4 X;  2O5R A;  2WAE A;  3HOZ J;  4AVZ A;  3PM1 A;  2O8K A;  3FU0 A;  1HW1 A;  1WH5 A;  3F8F A;  5FKN A;  5DCM B;  3BR1 A;  1P7J A;  1XPX A;  5DEQ A;  2CFO A;  3ASO H;  2ETH A;  4ZN6 A;  3NWT A;  1U0J A;  4FE4 A;  2KZV A;  4UUV A;  1VQP I;  5ILV A;  4PCQ A;  3B7U X;  5FRN A;  4CSW A;  3SJM A;  1WQ2 A;  4C9Y A;  4L9V A;  1R5G A;  1WPK A;  2M8E A;  2IP2 A;  3E1S A;  3HEF A;  1ZG1 A;  4OMY A;  2E19 A;  1G4D A;  2DMT A;  5M5Y J;  3DBR B;  2XF6 A;  1W5C C;  2M5W A;  4HLX A;  3H5A A;  2JRM A;  1YJ9 I;  3MVP A;  2KKO A;  2PJP A;  2TRT A;  3HOY J;  3J7Y J;  2BW3 B;  4J00 A;  3ABU A;  2F4O B;  3HOU J;  4DIQ A;  2JMW A;  3ZN1 A;  3IRR A;  4XON A;  4HLY A;  4KIS A;  4GXO A;  1R58 A;  1KYZ A;  2VJ4 A;  3KCC A;  2ZNZ A;  3DKY A;  3K4L A;  4MKT A;  2M45 A;  4UY8 I;  4UXN A;  1LDK B;  3ZCO A;  3QU3 A;  3R0I A;  1TTY A;  2A6H F;  3ABM H;  1XMA A;  2D2W A;  1EH8 A;  2BHZ A;  2FOW A;  3L1P A;  3BR3 A;  2GXG A;  3M8E A;  1BOB A;  1YX3 A;  3LSK A;  3T5X A;  4XMT A;  1JT0 A;  3K4K A;  3V7S A;  4DYR A;  1K83 J;  2QEN A;  3FWE A;  3TO6 A;  1HA8 A;  2EIK H;  3BT9 A;  3M7G A;  3HOS A;  2FML A;  2GOM A;  1KQ9 A;  3M4O J;  2FNA A;  1MW2 A;  3B73 A;  1ETK A;  5D6F A;  2ESH A;  2LF8 A;  2P6T A;  3GZ5 A;  3P9C A;  3ZQI A;  5C4X J;  2BOL A;  2EFW A;  5CPR B;  2JD2 A;  5L3B A;  3B6A A;  4XMV A;  4E6K G;  4KMU X;  5FKL A;  5GTI C;  5DYF A;  4HNU A;  2P7C B;  5KAI C;  4RBO A;  1FPQ A;  4OU0 A;  2HXO A;  2A68 F;  2OF7 A;  4LB5 A;  2OCE A;  3BPX A;  3DBH B;  1YW7 A;  2XGE A;  3HYI A;  2VQL A;  2XAG A;  3A01 A;  2ZXW H;  1R7J A;  2MGQ A;  2YU3 A;  3N05 A;  5IP9 J;  1VI0 A;  2KJB A;  2JJ7 A;  2JCV A;  4PFO A;  2KIQ A;  3TDU C;  2PN6 A;  4PJN A;  1FC3 A;  4W97 A;  2K9L A;  3GZ6 A;  4G7H F;  1OCC H;  3CZL A;  5ICE A;  1YX5 A;  3S8P A;  4P9U A;  3VWB A;  2ICW G;  1ON1 A;  1K6Y A;  4CZZ A;  2IS6 A;  3AL0 C;  3Q0V A;  2CRG A;  4N9I A;  3O6B B;  2LH9 A;  3BZC A;  4I0A A;  4XLH A;  3TL4 X;  3L2C A;  2XRO A;  3VYU B;  3S16 J;  1LEB A;  3JT1 A;  1Y56 A;  2KQR A;  3F22 A;  1R9T J;  3ZHY A;  2FEZ A;  2FBH A;  4BE2 A;  1IV6 A;  3FHZ A;  2CWE A;  1MMG A;  3FMS A;  1Z05 A;  1XGM A;  1HBX G;  1KU2 A;  2R7T A;  4XRS G;  4ZX5 A;  1VND A;  2RC4 A;  2XSD C;  4Q48 A;  3SEQ A;  2ADU A;  4EV0 A;  3LA7 A;  2XPW A;  2X6Y A;  1D0Y A;  3CCY A;  1SVL A;  1ZLJ A;  4MGR A;  3BRO A;  3RDI A;  2ELH A;  3CLO A;  4NDL A;  1WFX A;  3LQQ A;  2HR3 A;  2L4A A;  2IS2 A;  1OPC A;  4LMY A;  1ORK A;  3FUI A;  2JUC A;  3FUE A;  3A0H C;  3GCM A;  3I4N J;  1J2X A;  1GUU A;  1V54 H;  3C2H A;  4KDP A;  2Y1C A;  4G8X A;  2WC2 A;  5FO5 A;  4XMW A;  3AG4 H;  2MBF A;  4MQV A;  1EH7 A;  1VQK I;  2M8G X;  3E5X A;  4A5M A;  1IRX A;  4BXU A;  3SEZ A;  4J19 A;  4B3A A;  3HGY A;  2WV1 A;  1QHH D;  4CYC B;  1BL0 A;  5LHI A;  1FMV A;  2EIM H;  2F48 A;  3X2Q H;  3S1Q J;  3WQQ A;  3B2P A;  4HQE A;  4MHG A;  3L2Q A;  1U78 A;  3Q0U A;  4AYB A;  5LGT A;  4IQ4 A;  3R0A A;  2R70 A;  4MO7 A;  5FKO A;  3VSL A;  3IUO A;  3WTV C;  3DPU A;  3B6C A;  2K9N A;  3BR0 A;  1R4N B;  3OWT A;  3SDB A;  3WTW C;  2PBI A;  1OYI A;  3MD2 A;  4CIC A;  4XLE A;  1NH3 A;  1ETV A;  1XTA A;  5ICG A;  4MS6 A;  3G71 I;  1IG7 A;  1IRF A;  1MMA A;  3IH4 A;  3D1N I;  1ZKG A;  1LE8 A;  1TWG J;  3IAM 2;  4OIN F;  4ZTJ A;  1TWF J;  2JPB A;  1UFM A;  3QYF A;  3MKL A;  2XAH A;  4HW0 A;  1GDT A;  2ISY A;  4IXA A;  2KDZ A;  4HEA 2;  2L0K A;  3O8H A;  5E1Z B;  1SD6 A;  4YFX F;  4A0Y A;  4ETS A;  1SVO A;  2F5V A;  5ICF A;  2R7W A;  2NS0 A;  1RET A;  3A03 A;  3SZT A;  4D5F A;  1SAN A;  1DDN A;  2WB1 A;  3CP8 A;  1JHH A;  4WX9 A;  2P5K A;  1FTT A;  2TDX A;  1M1E B;  1U6G A;  1K7A A;  1HS6 A;  2BY2 A;  1XGN A;  1GT0 C;  1FY7 A;  2XPY A;  3IKT A;  1S8N A;  5HLI A;  2O6G E;  3P9K A;  2XPZ A;  2DOD A;  5KVR A;  3FXQ A;  2XGX A;  2K7L A;  3AFH A;  1H8A C;  2RVC A;  1BC8 C;  2X6X A;  2XAU A;  1BC7 C;  1MMD A;  1YG2 A;  1ZK8 A;  2XVC A;  3K4J A;  4LIT A;  2DPU A;  1RC9 A;  4ESF A;  2P7V B;  2FSW A;  3JW4 A;  1S9H A;  5LEK A;  2JCX A;  3OIQ A;  1TBX A;  4A6E A;  2M0C A;  4M3B A;  1XS9 A;  1D8J A;  3BJ6 A;  2EK5 A;  3DKW A;  2FBI A;  5F04 A;  3AU9 A;  1EA3 A;  1YS7 A;  2E1M C;  3C2B A;  4AR8 A;  2J5P A;  4KN7 X;  2HNH A;  1UST A;  3LMM A;  1HQC A;  1T0F A;  4N0B A;  4QLC U;  2BV6 A;  2VJ8 A;  2CO5 A;  2YSR A;  1SVM A;  3V4G A;  4XSZ F;  1Z21 A;  4RB1 A;  1JKO C;  1R00 A;  2B9S A;  2VON A;  2FD5 A;  3VEP A;  3JSO A;  3HKZ N;  5ED4 A;  3JTG A;  4JBA A;  4ZYA A;  1PJR A;  2DW4 A;  3PJR A;  2OC6 A;  3BJO A;  2LYC A;  1R23 A;  1I1S A;  4Q4I A;  2GAU A;  2Z5U A;  2K5C A;  1ONP A;  2V9V A;  4NUB A;  1XSX A;  5HVQ C;  1IC8 A;  4DZP A;  2P8T A;  1MJB A;  2VIX A;  1K61 A;  4XMY A;  4WK8 F;  1W7P A;  4WCG A;  3FTW A;  1H0M A;  3TW6 A;  3BZK A;  1T6S A;  1B9N A;  5JMP A;  4MFE A;  2LDU A;  4BDZ A;  4H4K C;  5AIP A;  2EIL H;  5F27 A;  3I4P A;  3BG7 A;  1MD0 A;  3TED A;  2IA2 A;  2VE9 A;  3IV5 A;  2YX4 A;  3OR1 C;  3GFI A;  3CME I;  3WTZ A;  3MZH A;  3EUA A;  2YX7 A;  1ONN A;  3CHP A;  1FBU A;  2CFX A;  3HPG A;  2ID3 A;  4MFD A;  5GAD J;  1JGI A;  3U9W A;  5DD4 A;  3BG6 A;  5BOX A;  1O3S A;  1OYW A;  3K69 A;  2M9H A;  1VFC A;  3HTS B;  1LFP A;  4K2E A;  3ECO A;  5CVI A;  1XC5 A;  4R8H A;  4L18 B;  1J5Y A;  5DM6 F;  1IJW C;  2ME6 A;  3K1P A;  2DI3 A;  4HAM A;  4RSY A;  3ZHX A;  4FIS A;  1B9M A;  3HOW J;  2ZJR F;  3NEU A;  1X2N A;  4LLN A;  3GVA A;  4ZDL A;  5K7F A;  3G3Z A;  3EET A;  3C2G A;  2DK8 A;  2LRE A;  1YHQ I;  3GTJ J;  1YW8 A;  2ZME A;  3D0S A;  2IAI A;  3OYL A;  2LVS A;  4M3D A;  1G6N A;  1ZS2 A;  4KT6 A;  5LGN A;  4M9S A;  1BBY A;  1ZN2 A;  4L2L A;  2Y0S A;  1AKH A;  4Y52 J;  4CHU A;  2PMZ A;  3JAM Z;  1BJZ A;  3V42 A;  1TNT A;  2W48 A;  4P55 A;  3R6S A;  4RAF A;  4D7N A;  1X1P A;  1P92 A;  1BIA A;  2JSC A;  1N25 A;  1G5A A;  4ITV A;  4IPA A;  1ULY A;  3GTP J;  1Y0U A;  2JD0 A;  5DD8 A;  5E20 A;  1FIP A;  2F5C A;  3ZQQ A;  2M1B A;  2WZG A;  3B7T A;  5GPA A;  1QPM A;  4PJL A;  4X0G A;  5KCM A;  4CUG A;  1B72 A;  4Z6Y A;  3HL2 A;  1ENH A;  2MG4 A;  1YW9 A;  2VI6 A;  4JX4 A;  4KN4 X;  1DGR M;  2OZ6 A;  3WU1 B;  2ELK A;  4UVB A;  4YG2 F;  3RAS A;  1Y0N A;  4DW6 A;  4FLR A;  1ZAO A;  3GFM A;  1V5F A;  2X4H A;  4A3J J;  3K70 D;  3K6G A;  2VXZ A;  2CW8 A;  4RB0 A;  3SZP A;  2ACJ A;  3PO3 J;  4F91 B;  5IP6 A;  1F36 A;  5K5O A;  4U0Y A;  4IO9 F;  3DXJ F;  3U1D A;  2E7W A;  4Y4R A;  4ZJZ A;  3OIP A;  1Y8Q B;  1X4P A;  3FK7 A;  1HW2 A;  3I59 B;  3ASN H;  4F55 A;  1UAA A;  4QIR A;  4X1E A;  2NRA C;  3TO9 A;  2V1N A;  2W82 A;  4OMZ A;  1VQM I;  3H3V K;  4Y17 A;  1S7E A;  4RLQ A;  2OAZ A;  2B7E A;  4BL0 B;  4JQF A;  1D1B A;  3M1C A;  4DYQ A;  4E7H A;  2UZK A;  2Q2E B;  2R72 A;  1Z9C A;  2DTR A;  3HRU A;  2MD5 A;  3GLX A;  5IT3 A;  5LLQ A;  5JHF A;  3QPL A;  3H9G A;  1JHF A;  5F64 A;  1R49 A;  4FE7 A;  2KIF A;  1JI8 A;  4G7O F;  3M07 A;  4RGR A;  4BKX A;  1ETX A;  4A12 A;  5DUL A;  2DA3 A;  3TP0 A;  3IL2 A;  3RTR A;  4N4O B;  3FTU A;  1SD5 A;  3FUJ A;  4CCJ A;  4S0H B;  4O3M A;  4XN4 A;  2QQ9 A;  2WV0 A;  3LFK A;  4PFP A;  2Y1E A;  3RZO J;  2LF7 A;  4XM3 A;  3DWL E;  3U2R A;  1L0O C;  3OYA A;  1QA6 A;  1O3R A;  1LPQ A;  2D5V A;  2HS5 A;  2LTP A;  4G9Y A;  4BHC A;  5LRS A;  4ZW7 A;  2P81 A;  4DQ2 A;  1UMQ A;  4ZZD A;  3GTK J;  2Y9Y A;  3CZ6 A;  3OS2 A;  4PSX A;  2TCT A;  1JE8 A;  2M3A A;  1DU0 A;  2FRH A;  3COA C;  3U1K A;  3PNY A;  5TGT A;  5HNF A;  1QVU A;  2ZJ2 A;  3TOA A;  4M6V A;  1RIO H;  3I4M J;  2WWY A;  3EPZ A;  1Q1H A;  2QF7 A;  5EG0 A;  1Y39 A;  2HYJ A;  2PI0 A;  4BNC A;  3EYY A;  3PSF A;  3ZQL A;  3DPT A;  3F8B A;  4B8X A;  2B0L A;  2X1E A;  5KHD A;  3JRB A;  1P7I A;  2HFH A;  3VSK A;  2NXN B;  2XF7 A;  3L00 A;  3OS0 A;  2JV7 A;  1Z77 A;  3TDZ C;  2STT A;  2QYO A;  3UKG A;  3W3C A;  2EPF A;  4XLP F;  1G3S A;  2H6B A;  5HLH A;  2Z3Y A;  5FKK A;  4P96 A;  4HPQ A;  2FXA A;  4A93 J;  4CCL A;  3LAJ A;  3A14 A;  2EV5 A;  2DA5 A;  3GUD A;  3CZE A;  3RJP A;  2FMY A;  2X0L A;  1FBQ A;  2DT6 A;  1MBK A;  3FIS A;  2GXA A;  4PVB A;  4HX8 A;  2DPD A;  4U87 A;  3MKW B;  4UNO A;  2R0Q C;  3FBI B;  3LFU A;  1TW3 A;  2Y9Z A;  4UB8 C;  1B6A A;  2R5Y A;  5GAH J;  4MIM A;  4V19 K;  4IF4 A;  5TRD A;  3I54 A;  2VXD A;  3G73 A;  4HQM A;  5LGU A;  3QAH A;  2H1L A;  2VKD A;  3DQV C;  3DEE A;  3EQL F;  1FTZ A;  3B37 A;  3M8J A;  4N9H A;  2FA5 A;  4BQN A;  2L7M P;  1XCV A;  3I53 A;  4XRF A;  4ZH4 F;  4PW4 A;  2IVM A;  2OQR A;  5HLT A;  3ZI0 A;  1VZ0 A;  3MAJ A;  2LKS A;  3RSN A;  1P4A A;  4FX0 A;  2R7S A;  4ZQG A;  3RIR A;  5KAF C;  1J59 A;  3MZY A;  4MEY F;  2HZT A;  1V4R A;  2DAO A;  2L7K A;  3ECH A;  4C2T A;  1UG2 A;  2BZT A;  2QA4 I;  2LLK A;  3CMA I;  4AIJ A;  2IXS A;  3R61 A;  1U8R A;  3FU3 A;  1I3A A;  4FCA A;  4DPR A;  1YS6 A;  3EUH C;  5EEA A;  2EIJ H;  2F2E A;  2V7F A;  2VBZ A;  4QME A;  2JTV A;  4NQW B;  2QEX I;  4A2U A;  4LJZ F;  2KFD A;  3QU6 A;  3JRA A;  5FRO A;  1BN5 A;  2QSF X;  4BU2 A;  1EJ9 A;  5E3L A;  2RQQ A;  3BTC A;  3ZMV A;  4LIU A;  2QKM B;  3HIF A;  4IOC F;  1JJ8 C;  1QZY A;  2ELJ A;  3CUQ A;  1JKR C;  4C3I J;  3BJA A;  3IH2 A;  4E7L A;  2R5Z B;  1BR2 A;  3L2V A;  3FUF A;  2VBY A;  2WTE A;  2QJ1 A;  4A3L J;  3WHB A;  1IN8 A;  1OQY A;  3S3N A;  1GV2 A;  2XAQ A;  3TP3 A;  2QVW A;  1JVS A;  3F72 A;  1JTX A;  2JK3 A;  3H92 A;  1WKM A;  2DMU A;  3CJQ B;  4XLF A;  2RJI A;  2E1N A;  1QVT A;  1TZL A;  1W7P D;  3K4C A;  5E3N A;  5DUK A;  4OOE A;  4B3X A;  1L3L A;  2CQ7 A;  2V9K A;  1AHD P;  3WHC A;  2QSG X;  2EZH A;  4J01 A;  4S04 A;  3CQZ J;  1Z91 A;  2K9Q A;  2Q1Z B;  1FBS A;  1D1A A;  3UR3 C;  4XQF A;  5KK1 A;  4FAS D;  5EV7 A;  3QPT A;  5FFX A;  3DBL B;  3KZZ A;  3CLQ A;  2FOK A;  5BQT A;  3CD6 I;  1K4T A;  2ZO4 A;  5IPA A;  3CP2 A;  3NRV A;  1VQ9 I;  1K4S A;  4QHP A;  3CCQ I;  4HA8 A;  3S2H J;  3L2U A;  3I3L A;  4LOC A;  2B63 J;  3KYD B;  2BGC A;  4A3K J;  3GEZ A;  1T1R A;  1RI7 A;  3A0B C;  2BXY A;  2YS9 A;  4CCK A;  3BG3 A;  2BVL A;  3PUB A;  3HRM A;  3WG9 A;  2GXB A;  1JXS A;  2OZU A;  5CVV A;  1P9Q C;  4AD9 A;  4CCO A;  3Q9S A;  1AOY A;  1RUN A;  2QBY B;  1GLN A;  4KIF A;  5CVU A;  1FOK A;  1FP1 D;  2FFL A;  4WXC A;  1MZB A;  3BDD A;  3ESW B;  4Q47 A;  3ZMU A;  2CV2 A;  3ERE D;  1IUY A;  1RES A;  2H94 A;  1EF4 A;  2OBP A;  3LOC A;  5F0H A;  3QPH A;  3FTS A;  3V8K A;  3EBG A;  3FBN B;  1K78 B;  1LFB A;  3QQA A;  5EF6 A;  1GXP A;  4HX4 A;  5B3S H;  2YU9 J;  1SEU A;  1XGO A;  2UXX A;  2PL5 A;  3S14 J;  4IRG A;  2R7V A;  2DA4 A;  4ZW8 A;  3FH7 A;  1X4O A;  3GF2 A;  2XKO A;  1Z7L A;  1MGT A;  2FX0 A;  1KGS A;  1SC5 A;  3NAU A;  2H8R A;  5D6E A;  2MSY A;  3HUG B;  1C0W A;  2X48 A;  4MEX F;  1B59 A;  2K86 A;  4ARF A;  4EM1 A;  1VQO I;  3LSM A;  2DQL A;  1PP7 U;  3VPR A;  5DS9 A;  1BI2 A;  4S05 A;  1ZAR A;  1H88 C;  4E70 A;  1PUF B;  4KIB A;  2MH9 A;  2HPI A;  5K7H A;  4XKW A;  4M71 A;  1N77 A;  3ZQF A;  1YRN B;  1DP3 A;  3FUM A;  4BBS J;  3OOP A;  2WPG A;  1MBH A;  2UXN A;  1R5I D;  3IC7 A;  3TGN A;  5H2F C;  1DPR A;  2O8X A;  2HVQ A;  4JND A;  1TQP A;  2UV1 A;  2HPT A;  2NS8 A;  3ZMZ A;  1YFH A;  3MN2 A;  4LK0 F;  5HS8 A;  2VJJ A;  4P9F A;  2FNP A;  2NOG A;  5GPC A;  3HOX J;  3R0J A;  2E1M B;  1UHS A;  1UEL B;  3AG2 H;  3FXK A;  5KNL A;  4ZC3 A;  4R5V A;  4R5X A;  1MJA A;  2K9S A;  3K2Z A;  3S1N J;  4P5O A;  2IGK A;  2HDD A;  2O7O A;  3J81 Z;  3DTI A;  4FX4 A;  1F1Z A;  2Q8K A;  4GGG A;  5IYC J;  3KFW X;  1LVK A;  1U5T A;  3K7A J;  2L4M A;  1NHA A;  2DLL A;  2LY2 A;  3OYG A;  4GCV A;  2ZSI B;  3CCM I;  1SAX A;  2BE5 F;  3C18 A;  1O57 A;  4RAY A;  1V55 H;  3FTV A;  4PK4 A;  4U7D A;  1YLF A;  2LOO A;  3RKY A;  3T8V A;  2VQG A;  1ETY A;  1IN4 A;  4Y6R A;  2MC3 A;  1FYK A;  5GP9 A;  1GVJ A;  3KYL A;  3RPU A;  5E8G A;  2EB7 A;  4Y3O A;  3EUH A;  1O3Q A;  2D1V A;  2L2O A;  1IO2 A;  4HX7 A;  2A7O A;  1MMN A;  2ZB9 A;  4WXD A;  2WAQ N;  1D0Z A;  4IHS A;  1J0R A;  3E6B A;  3K1M A;  4RGS A;  4IRI A;  2N8G A;  3GFL A;  3T1B A;  4ESJ A;  3OYM A;  5K5R A;  1Z7U A;  3WE2 A;  1WRJ A;  3DV8 A;  3K0L A;  1E3H A;  2KHM A;  1A6I A;  2VJ5 A;  4E7J A;  1KON A;  1RR8 C;  1ETW A;  3DLL F;  1HDP A;  1OKR A;  5EEG A;  2RAE A;  2CJJ A;  3WTT C;  5D8K B;  4WXH A;  2HPO A;  1CF7 B;  4XN2 A;  4CCM A;  1GXQ A;  5M5W J;  4IHX A;  2PG4 A;  1X3Z B;  3FIW A;  2LMD A;  3Q9V A;  2RKH A;  4RGX A;  2X85 A;  3VYR B;  4E4H A;  3J7Z I;  1FWZ A;  4RA2 A;  4QPQ A;  1YOV B;  1O7F A;  1FYM A;  1K5H A;  3CTA A;  2HQR A;  4CZC A;  2X1D A;  3IP4 B;  2JWT A;  1MW7 A;  3TW7 A;  4XKB A;  1FLI A;  3BZ6 A;  3BR6 A;  3PSI A;  1QZZ A;  4EJU A;  2QCO A;  3MQ0 A;  3K1N A;  1IV8 A;  2W24 A;  1JG9 A;  2GTQ A;  2E2H J;  1S5L C;  2NYX A;  5GTH C;  2PLY A;  1I5Z A;  3OYJ A;  5JLX A;  3VYS B;  3CF5 F;  4FLS A;  1D0X A;  3BTL A;  3S2W A;  1KQ0 A;  4MTD A;  3EDP A;  4XLC A;  1VQ6 I;  3LWF A;  1SC7 A;  5F08 A;  3GYH X;  1F9N A;  5K7Z A;  2EGH A;  1RZ4 A;  1QO0 D;  3GME A;  3OMY A;  3ML6 A;  4XK4 A;  3RC8 A;  5A2Q Z;  1R5H A;  3HG9 A;  4OIP F;  3KP5 A;  2DYS H;  2Q2E A;  1FP2 A;  2CW0 F;  1WVR A;  1J09 A;  2JUG A;  2X51 A;  3TQN A;  2L9S A;  2DT7 B;  3CDI A;  4ZQF A;  2EA4 A;  1OR7 A;  4RVB A;  3JRE A;  4AIK A;  2L3D A;  1T98 A;  2LY9 A;  4F92 B;  4B1R A;  2WY7 Q;  3B7S A;  1XSD A;  3Q0W A;  4BS9 A;  5M5X J;  4HSR A;  4RAZ A;  1JT6 A;  2M4G A;  4CGZ A;  2DYR H;  4IKF A;  2YR2 A;  2ZFU A;  4YIR X;  3N4M A;  4YII A;  1NG7 A;  3FDY A;  1REP C;  1TQM A;  2O03 A;  2Z9O A;  1TWA J;  2ZJP F;  2A07 F;  2XPU A;  1HXD A;  4LLL A;  4ZZL A;  3ZP5 A;  4HDV A;  1HCR A;  1MND A;  2I8D A;  4OIR F;  4A3B J;  1UHM A;  2VC1 A;  2K4B A;  5JI6 A;  3BCA A;  3HHG A;  3E6M A;  2ECB A;  5EYR A;  1H19 A;  4BAC A;  1ON2 A;  2VN2 A;  4KFC A;  4D1Q A;  5JBI A;  2K3F A;  5C44 J;  3HDD A;  3H35 A;  2Z99 A;  2V1X A;  1QU3 A;  1VQ4 I;  1TLH B;  2Z2S B;  3BG5 A;  3W6V A;  3L09 A;  4L9T A;  4I09 A;  2BYV E;  4I2O A;  4BJT A;  4HG2 A;  4A6D A;  5DTD A;  3GW2 A;  1X3U A;  1Z6T A;  5IY5 H;  2GLO A;  3F3X A;  5FLM J;  2DFE A;  4D0P A;  5J3L A;  1HDD C;  3BY6 A;  1ZH5 A;  3AUA A;  3FUK A;  2R7Q A;  1FIA A;  1OLT A;  3K4N A;  2ZSH B;  3CUO A;  4CO8 A;  2E35 A;  2Q0O A;  2MC4 A;  2HQA A;  4EJV A;  3F8M A;  3SQN A;  2MAP A;  1LQ1 A;  3KEO A;  4CXF A;  3OIO A;  1FYL A;  2DDB A;  3E0J B;  2O9L A;  4WF2 A;  1Y6I A;  4L0Z B;  2EZK A;  3FU5 A;  4IZZ A;  2VQH A;  3EYI A;  3PO2 J;  3SDG A;  5H6Q A;  4XND A;  2NS7 A;  3BOQ A;  3RPQ A;  2P5L C;  3RYP A;  3PIP F;  4Y6S A;  2I10 A;  2XRN A;  3K2A A;  4MTE A;  2PMU A;  2LKX A;  1B8I B;  5M3F J;  3WQS B;  2MAO A;  3V8L A;  3R4K A;  4BGD A;  2VC0 A;  3HZJ A;  2XB5 A;  3WGI A;  3L2W A;  1ACI A;  2OV7 A;  1J75 A;  3D5R C;  1WGX A;  2JCY A;  3OYD A;  2Y75 A;  2G7H A;  1QRY A;  3J81 K;  2CUF A;  2QQA A;  1W36 D;  4IJA A;  4B43 A;  4UUS A;  3BG9 A;  5EGO A;  1OCZ H;  3VOE A;  1VQN I;  2OCC H;  4IL6 C;  3Q3S A;  3H0D A;  2RQP A;  1H9G A;  4OWR B;  3OYE A;  1USS A;  2GIZ A;  2COM A;  1LB2 A;  3PNT A;  4A3F J;  5BS6 A;  5M3M J;  2JVG A;  3FX3 A;  3FXO A;  4NQW A;  2E2I J;  2XUB A;  1SFX A;  1OYY A;  3V8J A;  1X1C A;  2QQB A;  3HRT A;  4AC0 A;  5BMZ A;  2CV0 A;  4XN1 A;  1TWH J;  1RUO A;  3LL7 A;  4QIW N;  1A04 A;  4NHJ A;  2VPL A;  2DMN A;  4EQQ A;  5FRM A;  5B5E C;  2PQ8 A;  2EJR A;  4II3 A;  3JRF A;  2KRF A;  5D5U B;  1W5T A;  2MLG A;  3E5U A;  1T33 A;  1S7O A;  2X9D A;  5LBQ A;  1MIJ A;  2KRH A;  3I5U A;  3ZN0 A;  3RYR A;  4G6T B;  1IN5 A;  1IDY A;  2FJ1 A;  4RLF A;  2KDO A;  1TC3 C;  1YIT I;  1G2H A;  4M6X A;  1R22 A;  1T2K A;  3F21 A;  4I0B A;  2IT0 A;  1X3W A;  2V26 A;  3FXL A;  3H5R A;  4AWX B;  2R92 J;  3KP3 A;  3LSG A;  4QSH A;  4IX7 A;  4G7Z F;  3HGG A;  2HKX A;  3DU5 A;  2H1K A;  4BQO A;  3RC3 A;  4C30 A;  2IA1 A;  3WGH A;  3KED A;  1GVD A;  5FKM A;  2STW A;  4F52 A;  1YI2 I;  3D5L A;  3BQZ A;  2W4S A;  4G12 A;  4P1W A;  4HZF A;  2HOA A;  4DBQ A;  2DQ6 A;  3V7C A;  2JZY A;  2MD0 A;  3IAS 2;  4DNC A;  3CCR I;  3JTH A;  4B48 A;  1B4A A;  3IWF A;  2MH2 A;  1XMK A;  1SD7 A;  3W6J B;  4NB5 A;  5JHU A;  5CVJ A;  5EDN A;  1BM9 A;  4BH9 A;  4LG0 A;  3OV8 A;  2BEO A;  3S32 A;  2LNB A;  5AEN A;  1HKQ A;  3CES A;  4KP7 A;  1P4X A;  4L0Y B;  1Y8R B;  3JSZ A;  5JLW A;  2CQX A;  4ZDP A;  4IQJ A;  3G1L A;  3KP6 A;  4M3G A;  2QBY A;  3CZG A;  4XKV A;  4BXX J;  2OQG A;  3PL8 A;  4XLA A;  2Y1D A;  1IXR C;  2QM3 A;  4PGH A;  3H36 A;  2OTJ I;  3FM5 A;  4PJM A;  4ENJ A;  4EM2 A;  2HDC A;  4LUP A;  3FK6 A;  3CZK A;  3DPL C;  1BR1 A;  1WJA A;  1KU7 A;  3WOD F;  3VVL A;  5LRR A;  2GQQ A;  1FJL A;  3HUG A;  4ENN A;  3LSR A;  3ZPL A;  1FOY A;  2HOE A;  5DCM A;  4CYD A;  4RDU A;  2IS1 A;  2QLZ A;  1MSF C;  3O8G A;  2NVY J;  4I7H A;  5JVG F;  4DZJ A;  3BLY A;  5D8L B;  1DP7 P;  5CJ9 A;  3SXY A;  4AYB N;  2EV6 A;  4YIF A;  1IZ1 A;  1IXS B;  3OYI A;  3MEX A;  3BTJ A;  1X1A A;  2EBI A;  3ISP A;  4HF1 A;  2ME0 A;  4G6Q A;  4QTR A;  5J4V A;  1HW5 A;  1SFK A;  3W2A A;  3ROU A;  2VOP A;  4BEH B;  1ZGA A;  3CCU I;  1LJ9 A;  3F8N A;  4YEL A;  1K6O A;  4XO3 A;  1LFU P;  2ZXJ A;  2DTZ A;  2RRE A;  3GTM J;  3KEQ A;  2BW3 A;  5FGM A;  3UCQ A;  4QUO A;  3IIE A;  2RNG A;  1DGW Y;  4XKC A;  4CCN A;  1BI1 A;  2G0E A;  2R3S A;  4I01 A;  3HOT A;  1Q0L A;  1I1G A;  2DFF A;  4L9N A;  4PSW A;  3ZQH A;  4GRI A;  4XBF A;  2ZFW A;  4A5N A;  3LSH A;  3WTU C;  2CYY A;  4IRH A;  2RNJ A;  2WB1 N;  3ZR8 X;  2PEX A;  5K5Q A;  3S3O A;  4AIH A;  2L7F P;  3A1Y A;  2VOO A;  1IGN A;  1BJA A;  3LSJ A;  1QBJ A;  2LC2 A;  1MH3 A;  1TWC J;  3A4C A;  4M72 A;  4XR6 A;  2XB0 X;  1HC8 A;  1LDJ A;  4AR9 A;  2Y1F A;  1QZE A;  2LBF B;  3RKQ A;  1G3T A;  2XC7 A;  2CMP A;  4G94 A;  4EJT A;  1WJD A;  3JRD A;  4XL9 A;  2XIG A;  1T8I A;  3E7L A;  5J47 A;  4MNU A;  4AUX A;  2O0Y A;  3H1C A;  3J7A Y;  1MW3 A;  1R1T A;  3OYH A;  1BOA A;  3KZI C;  4XID A;  4M9X A;  4HV6 A;  2BXZ A;  2JA7 J;  3DTE A;  2ZC2 A;  1S6L A;  5HDG A;  3PFY A;  1SMT A;  2C6Y A;  2KLO A;  2DK5 A;  2VPR A;  1B1B A;  2DO7 A;  3MWM A;  4HBL A;  3SFZ A;  3QRF F;  4IOA F;  5FWQ A;  2OD5 A;  5LFA A;  2P6S A;  5CQE A;  2CH0 A;  4HNT A;  5E3O A;  2IGM A;  4XNF A;  2R7X A;  3BCB A;  2PJR B;  3HTU A;  3H0G J;  3O2P E;  3HRS A;  4XOT A;  1MW0 A;  4ZQE A;  1MBJ A;  4ZW5 A;  3G6E I;  4HF0 A;  3REO A;  4ANJ A;  1I39 A;  2CSO A;  3FZV A;  3NQO A;  4RB2 C;  2LRD A;  3KLN A;  3HW2 A;  2XRL A;  4EJW A;  1SFU A;  2ZCW A;  5FJ8 J;  2JQ7 A;  3S15 J;  3U9G A;  3P5J A;  4N4N B;  1E2X A;  2DFI A;  3CJR B;  1X3Z A;  3K9T A;  4ZW6 A;  3ONQ A;  5TJJ A;  3CCE I;  4PU2 A;  1IDZ A;  3PUU A;  3SFI A;  1NTC A;  1OIS A;  2F4M B;  3LA3 A;  5IYD J;  2KPM A;  2D45 A;  2V79 A;  1YJW I;  2M87 A;  3OYB A;  4LGW A;  2DA7 A;  2VJI A;  5J1R A;  5LEJ A;  4BE0 A;  5DV5 A;  4R7L A;  3FXJ A;  5BPI A;  4NBQ A;  5ILU A;  2DT5 A;  1DQU A;  4LLG F;  3J80 Z;  4A03 A;  3S1M J;  1T38 A;  5EEH A;  3WQR A;  1HSJ A;  2VAS A;  5J8C A;  5L3E A;  5E8I A;  2DOA A;  1XDS A;  3FM3 A;  4F3Q A;  6PAX A;  3G4S I;  1X2M A;  2EFP A;  3L7W A;  2ZJQ F;  4U0W A;  3KET A;  4IHW A;  1YIO A;  4D5C A;  9ANT A;  2HXI A;  2LY1 A;  2W85 A;  4CDG A;  4CYC A;  2CV1 A;  1W7P B;  1XMX A;  4RS8 A;  2ZNY A;  3K70 C;  4BAY A;  2IRF G;  4RCV A;  3AU8 A;  3GXO A;  1OJL A;  2DDA A;  3OL3 A;  3CO7 C;  2OPT A;  1LKX A;  3K10 A;  2NNY A;  4XMX A;  2F6C A;  3JAM K;  3I55 I;  1BA5 A;  4KIT B;  1EH6 A;  3G1O A;  1IRZ A;  3FTX A;  2BBY A;  1CQT A;  2YUS A;  2M4K A;  3QYB A;  2Z33 A;  1I27 A;  2HZD A;  2PMH A;  3HSR A;  1U8B A;  1ZEL A;  3OSG A;  2EZI A;  1HOM A;  3E3V A;  3KYC B;  4II2 A;  3TOB A;  2Y0S N;  4NC8 A;  4ZYG A;  2PMZ N;  2HU9 A;  3V7R A;  1MNE A;  3I58 A;  1OCT C;  4Y6P A;  4MLO A;  4XLN F;  2NVT J;  5DM7 F;  1H89 C;  3TBI A;  4UV9 A;  5B1A H;  3L9F A;  3WU2 C;  2AQF A;  1A36 A;  4Z2Y A;  1BI3 A;  1FMW A;  2DMQ A;  2ZME B;  3F6O A;  2DA1 A;  3KE2 A;  4XSX F;  5B1B H;  4ZTF A;  5HDK A;  2CG4 A;  1EKE A;  4K5O A;  3ZMS A;  4UHT A;  4ZW3 A;  2H09 A;  4R79 A;  1WWX A;  2DXI A;  2DA2 A;  4JX5 A;  5K1Y A;  3FH5 A;  3M9A A;  4Y15 A;  2AHQ A;  2XAJ A;  3I71 A;  1R4M B;  4HYE A;  1YTY A;  2A6E F;  4ESB A;  2K3P A;  2DOF A;  2E1O A;  4BY1 J;  1MH4 A;  1VF9 A;  2NOJ B;  3QYE A;  2HVR A;  3Q44 A;  2F5E A;  3GLL A;  3CHO A;  3HJE A;  5J1U A;  4FLO A;  4B47 A;  2ZXI A;  3IWZ A;  4K5L A;  4YFK F;  4XMU A;  1MBE A;  2XV4 S;  1U9O A;  4HDU A;  3CC2 I;  4XO4 A;  3EBI A;  4PJ0 C;  2XSJ C;  3GBG A;  1FOW A;  1GV5 A;  2R7F A;  3HSE A;  4KNY A;  4ZX3 A;  3CCL I;  4EEF G;  1LDD A;  1BR4 A;  4I98 B;  1RKW A;  2Y0M A;  3OYF A;  2NVU B;  4HF2 A;  4XNA A;  2XPV A;  5IOY A;  4D7M A;  3F23 A;  1STZ A;  2E2J J;  2HOT A;  1S29 A;  3W2V A;  5HNH A;  1JJ6 C;  2R7D A;  1MBG A;  3S2D J;  4XRM A;  1F43 A;  3F0C A;  1IRG A;  1ZYR F;  1TL8 A;  1OCP A;  1RR7 A;  2JN6 A;  2X6W A;  1MW1 A;  1QPI A;  2QWW A;  3BP8 A;  3CCJ I;  2AO9 A;  4X2U A;  2V9P A;  1DPU A;  2IGN A;  4YRV A;  3KX2 A;  3ZQ7 A;  5BNG A;  1O3T A;  2F5D A;  4PGG A;  5E17 F;  1KA8 A;  4ZYH A;  4F7Z A;  3HKZ A;  1W0T A;  5D4S A;  5HDN A;  3FH8 A;  2GOX B;  1D1C A;  4HOB A;  4KT5 C;  2EZL A;  3D5S C;  2NVX J;  4JOM A;  1MBF A;  1AWC A;  2DCE A;  3P7N A;  2EFQ A;  1ETQ A;  2MA3 A;  2JVH A;  4XIC A;  1NG6 A;  4ZDO A;  4A3C J;  2DQR A;  1I3Q J;  1WI9 A;  4O6J A;  2HQN A;  3HSF A;  4KYW A;  3RKW A;  3N97 A;  3JRH A;  3T8R A;  3K4M A;  3IHU A;  4RM2 A;  1FT9 A;  2Y48 A;  2ESN A;  2A3S A;  2V1D A;  4L5I A;  2XDV A;  1WSU A;  3E6D A;  3BR5 A;  4A69 C;  1XB4 A;  4F93 B;  1ZRC A;  3F6V A;  4HRI A;  2X1C A;  5IOZ A;  2NVQ J;  3HOV J;  1MKM A;  1T0F C;  1IN6 A;  5B66 C;  4X6A J;  3PUF A;  3QOD A;  2EV0 A;  1T39 A;  1KU9 A;  4E7I A;  1V5G A;  3RI4 A;  5CKT A;  4E7K A;  2HYF A;  1JTY A;  3PIO F;  2B61 A;  3CDH A;  3WTY C;  2L9R A;  4A3I J;  1ONO A;  1GW6 A;  1R71 A;  5EG0 B;  2P5V A;  1G3W A;  2E7X A;  1YYV A;  2PUS A;  1W5S A;  4ON0 A;  3ANM A;  4IHT A;  3QOE A;  1G8X A;  4I99 C;  3OYN A;  1MDM B;  1TP4 A;  3HPH A;  2M0M A;  4XN3 A;  4OAZ A;  3WU0 A;  2L5Q A;  3S1R J;  3B02 A;  1X1D A;  2FE3 A;  3ANN A;  3FUL A;  1FNN A;  3ERM A;  2MW8 A;  4RM3 A;  2VT3 A;  4MQ9 F;  3PQK A;  2HEO A;  4ZYE A;  2K27 A;  3J80 K;  1CGP A;  3BC8 A;  5F6F A;  1MNM C;  1ERD A;  3RKX A;  2CW7 A;  1F4K A;  3CO6 C;  2V1U A;  2VBX A;  5AIQ A;  5ILS A;  3OOU A;  4R1H A;  2VE8 A;  3UNG C;  4XN8 A;  2Y1G A;  3M3Y J;  3AG1 H;  3KP7 A;  1TQI A;  2QVO A;  2UUZ A;  4UB6 C;  4M74 A;  3RQ4 A;  2R5Y B;  2EWN A;  1SFO J;  1T56 A;  2EFO A;  2FQ4 A;  4A0Z A;  2P4W A;  1W4M A;  5LD2 C;  5FLX Z;  1SG7 A;  1NK3 P;  1UG0 A;  5HLG A;  2VUM J;  1XSV A;  1Z67 A;  2BVM A;  1S7A A;  4V2F A;  1UHW A;  2M30 A;  2KIU A;  2DN0 A;  3I59 A;  5L3C A;  4ENM A;  2X6O A;  4GYI A;  1XCB A;  4UUT A;  2ZME C;  1LUJ B;  2KJC A;  1VQ5 I;  2WBM A;  2KMU A;  1I6H J;  3KP2 A;  3DFG A;  3FXM A;  3NWS A;  2V6E A;  1ZLK A;  2DJI A;  4XOR A;  2K9M A;  3ZXS A;  5ERI A;  4C2U A;  2VOD A;  1JUM A;  2CU7 A;  5JNL A;  3ZOB A;  5IP7 J;  4W1U A;  3GTO J;  4BEH A;  4GDF A;  3CMY A;  4DGW B;  2WY8 Q;  5LHH A;  2WZF A;  4XN7 A;  2A69 F;  3LSI A;  3CUQ B;  1D3Y A;  5CYV A;  3R60 A;  2YPR A;  3CCV I;  4FLQ A;  5DCF A;  1Q0H A;  3W2W A;  2HPM A;  4KA4 A;  2W00 A;  1ZRE A;  4PUS A;  2Y2Z A;  5F0C A;  4AIC A;  2AQE A;  4BY7 J;  3JCU C;  2IA0 A;  2WAD A;  3CMM A;  4CA0 A;  2M34 A;  3H3U A;  2OU2 A;  3G2B A;  2QGU A;  3B7R L;  3FMR A;  4FHT A;  5JAZ A;  4K5P A;  4JYK A;  5HS9 A;  4KJZ A;  4YEJ A;  4C3H J;  2KT0 A;  3PQJ A;  2HOS A;  2QSH X;  5DYM A;  3CHR A;  5D5W B;  1Z3Y A;  1ZG5 A;  2BY3 A;  2LBF A;  5AON A;  2KZG A;  3RQI A;  3EBH A;  2VLA A;  1SAU A;  4TV7 A;  4FCY A;  2E34 A;  2VL8 A;  2QQ8 A;  4IEJ A;  3B34 A;  5D4R A;  4Y13 A;  2XKP A;  1A5J A;  4A3E J;  5CLS A;  4OOF A;  3VVM A;  2FBK A;  3AKZ A;  1U9N A;  4BXF A;  1UB9 A;  3F9K A;  1F5T A;  2DA6 A;  2F5F A;  2JA6 J;  1NK2 P;  4KIC A;  3SHF A;  1SQM A;  1Z0X A;  2H27 A;  3KIO A;  4U0V A;  2R7U A;  2Y30 A;  2L02 A;  5J4Y A;  1LVA A;  2GA2 A;  1SFE A;  3GZN B;  2LFB A;  2E1C A;  5HS7 A;  3OS1 A;  4EVI A;  1WH7 A;  4DJA A;  2CUJ A;  3L2R A;  2H6C A;  3OYC A;  2IS4 A;  2PJR A;  3CDL A;  3DKX A;  2R7Z J;  3T8T A;  2DFH A;  3M8F A;  2RGV A;  4RAG A;  4B44 A;  5CVR A;  1ZGJ A;  2EFN A;  4G6D A;  1X58 A;  2G7U A;  4NNJ A;  5FB2 A;  4FTH A;  4BBR J;  2Y69 H;  1AU7 A;  3ULQ B;  2KIS A;  2C5Z A;  1PUE E;  4XN9 A;  4XNB A;  5DDG A;  2EH3 A;  3B2X A;  1FOX A;  4Y7N J;  3S93 A;  4Q4E A;  3QP5 A;  5EJC A;  3FUH A;  3IH3 A;  1OCR H;  4PZJ A;  3MFK A;  3S17 J;  4OAY A;  3CIA A;  2E36 A;  2MFZ A;  2O61 A;  1MMS A;  1WCM J;  2ECC A;  3FKJ A;  3FTY A;  2DBB A;  1EV7 A;  1XX5 A;  3FF5 A;  1BW5 A;  3MZ8 A;  4LIV A;  5E18 F;  1VQL I;  1V5E A;  5D5X B;  4PJJ A;  2IGO A;  2HTS A;  1ZHF A;  3P9I A;  4KMF A;  3OYK A;  3AG3 H;  2AS5 F;  2G9W A;  3CHQ A;  2AXL A;  3ZMD A;  2BY1 A;  2OUM A;  3DTK A;  4EGZ A;  1N78 A;  4UVA A;  2BY0 A;  2LSO A;  2RV8 A;  3TO7 A;  4DOZ A;  2QKL B;  1KU3 A;  5ICC A;  2FU4 A;  3F8C A;  5LHG A;  1MJ9 A;  1XDU A;  4H0E A;  5FLV A;  1QQI A;  3TMO A;  4AVP A;  1YJN I;  3I9V 2;  1WJB A;  4BYY A;  2R5Z A;  4Q5S F;  3I0T A;  3MMY B;  1JGG A;  1UCR A;  5E3M A;  2RN7 A;  2HVS A;  1RKT A;  3PNV A;  2K85 A;  1H9T A;  3ZMT A;  3ZHZ A;  2IW5 A;  4I02 A;  1K79 A;  3IKV A;  3A02 A;  2OA4 A;  4AID A;  2IBD A;  3KP4 A;  1ZR4 A;  1JGS A;  4EJO A;  5EZG A;  3FUN A;  1ITY A;  2HDW A;  2VB6 A;  1IW7 F;  4HNV A;  2ISZ A;  1U5T B;  3DEU A;  1KQ8 A;  3ABK H; 
#chains in the Genus database with same CATH homology
 2CH0 A;  1IRX A;  1Z7L A;  3SEZ A;  3OY9 A;  1SC5 A;  4HNT A;  1QHH D;  3HUG B;  2IGM A;  2Z1D A;  1FMV A;  4XNF A;  3BCB A;  2UWM A;  2PJR B;  2R7X A;  3WQQ A;  2KRC A;  4ARF A;  4XOT A;  3B2P A;  3LSM A;  1MW0 A;  4ZQE A;  3L2Q A;  3FU6 A;  4AYB A;  4IQ4 A;  4ZW5 A;  2R70 A;  2HPI A;  3VSL A;  3IUO A;  4ANJ A;  3DPU A;  1AA7 A;  2F4I A;  4XKW A;  2LRD A;  1N77 A;  3FUD A;  3SDB A;  3OWT A;  1DP3 A;  4K5M A;  3FUM A;  3MD2 A;  4XLE A;  3QJX A;  2WPG A;  4N4N B;  3CJR B;  1X3Z A;  4MS6 A;  4ZW6 A;  3ONQ A;  1MMA A;  4PU2 A;  2HVQ A;  3PUU A;  4JND A;  2UV1 A;  2HPT A;  3IAM 2;  4ZTJ A;  2KPM A;  1E0E A;  3QYF A;  3HXL A;  2VJJ A;  2V4J C;  2P0W A;  2JD1 A;  3OYB A;  3MKY B;  4HEA 2;  2E1M B;  3SYT A;  1UEL B;  2VJI A;  5KNL A;  4BE0 A;  4R5V A;  4ZC3 A;  4R5X A;  2F5V A;  4R7L A;  2R7W A;  3RPU D;  4P5O A;  3UER A;  1DQU A;  2IGK A;  4A03 A;  3DTI A;  2WB1 A;  4GAE A;  3UEQ A;  3CP8 A;  3WQR A;  1X19 A;  2L9N A;  2VAS A;  3Q43 A;  2DOA A;  4F3Q A;  1LVK A;  1HS6 A;  2E5N A;  2XPY A;  4BQQ A;  2LY2 A;  3OYG A;  4QPE A;  2ZSI B;  2WA0 A;  2LY1 A;  2CV1 A;  2XPZ A;  3AFH A;  5CQG A;  4PK4 A;  3FTV A;  2X6X A;  2XAU A;  3K70 C;  3VYT B;  1MMD A;  2LOO A;  2VKH A;  4RCV A;  2R7R A;  3AU8 A;  2ZXG A;  3K4J A;  4LIT A;  1WJC A;  3T8V A;  2VQG A;  3OL3 A;  2O7G A;  1LKX A;  3K10 A;  4Y6R A;  2KP6 A;  1S9H A;  2JCX A;  3OIQ A;  4XMX A;  4R5T A;  2KL4 A;  2F6C A;  4KIT B;  3KYL A;  3FTX A;  2CS3 A;  4Y3O A;  2M4K A;  3QYB A;  2L2O A;  1EA3 A;  3AU9 A;  2E1M C;  2HZD A;  2A7O A;  4AR8 A;  1MMN A;  4BE1 A;  3KEY A;  1ZEL A;  4LG3 A;  3FTY A;  2HNH A;  1D0Z A;  3LMM A;  4II2 A;  3OYM A;  4NC8 A;  2VJ8 A;  2HU9 A;  3FHN A;  1MNE A;  2KHM A;  4Y6P A;  1Z21 A;  2VJ5 A;  4E7J A;  4MLO A;  1KON A;  4ZQH A;  3HC7 A;  3TBI A;  4ZQT A;  4Y67 A;  3FHE A;  2AQF A;  1QHG A;  2HPO A;  4ZYA A;  3ANL A;  1FMW A;  1PJR A;  3PJR A;  4XN2 A;  2OC6 A;  4ZTF A;  4CCM A;  4E7S A;  4XMZ A;  4Q4I A;  2LYC A;  4K5O A;  4ZW3 A;  4E4H A;  3VYR B;  2K5C A;  2X85 A;  4R79 A;  4NUB A;  1ONP A;  2DXI A;  5HVQ C;  3FH5 A;  1W36 C;  4QPQ A;  2A5W A;  2VIX A;  3FTW A;  4XMY A;  3S3M A;  1K5H A;  1PYV A;  2LG4 A;  2X1D A;  4CZC A;  5JMP A;  3IP4 B;  1MW7 A;  4BDZ A;  2K3P A;  2W1O A;  4H4K C;  4XKB A;  3B3B A;  1X1B A;  4EAT A;  2NOJ B;  3BG7 A;  3QYE A;  2HVR A;  3Q44 A;  3OR1 C;  3CHO A;  3PSI A;  2GTQ A;  3EUA A;  4FLO A;  4B47 A;  1JG9 A;  4XOP A;  3OL4 A;  1ONN A;  2ZXI A;  2R7O A;  3HPG A;  3CHP A;  4K5L A;  1JGI A;  4XMU A;  3U9W A;  1MVY A;  3BG6 A;  3OYJ A;  3VYS B;  4FLS A;  1D0X A;  4U7B A;  2E5Z A;  1LFP A;  3U21 A;  4XLC A;  4XO5 A;  4XO4 A;  2EGH A;  1TT0 A;  3OMY A;  4RSY A;  3EBI A;  3ZHX A;  3RC8 A;  3HG9 A;  2XSJ C;  3GBG A;  3SZG A;  4ZX3 A;  2JUG A;  1J09 A;  2X51 A;  2MAB A;  3H9J A;  2L9S A;  2DT7 B;  4ZDL A;  4BJ5 C;  4ZQF A;  4RVB A;  1OR7 A;  3C2G A;  4F92 B;  3A06 A;  3B7S A;  1BR4 A;  2LRE A;  2WY7 Q;  3OYF A;  4BS9 A;  4HSR A;  4QPO A;  4XNA A;  2M4G A;  3OYL A;  4E7Z A;  4IKF A;  1ZS2 A;  1G59 A;  2ZFU A;  3W2V A;  5HNH A;  2WAQ A;  4KT6 A;  3OR2 C;  1NG7 A;  3FDY A;  4L2L A;  2Y0S A;  2X6W A;  4HST A;  1MW1 A;  4BJ6 C;  2PMZ A;  3V42 A;  4AU7 A;  1S46 A;  5BPP A;  1N75 A;  4X2U A;  2IGN A;  4YRV A;  3KX2 A;  1G5A A;  4ITV A;  1MND A;  2I8D A;  3HKZ A;  1Z3X A;  3DLA A;  2JD0 A;  2A6T A;  3FH8 A;  4J3B A;  2GOX B;  3BCA A;  3ZGK A;  4NC7 A;  5DLL A;  1D1C A;  3ZQQ A;  1T1S A;  3ZRG A;  3D5S C;  2ZXH A;  1H19 A;  4JOM A;  2WZG A;  4BAC A;  3B7T A;  4PJL A;  4Y33 A;  4D1Q A;  3T0Y A;  4X0G A;  5JBI A;  5KCM A;  4CUG A;  2DCE A;  3H35 A;  1QU3 A;  2R59 A;  4RMN A;  3HL2 A;  2Z2S B;  2JVH A;  1DGR M;  2Z16 A;  4BDY A;  1NG6 A;  3H9Q A;  4ZDO A;  3RAS A;  4BJT A;  4FLR A;  4HG2 A;  1V5F A;  2W7N A;  1Q0Q A;  3K70 D;  3K4M A;  2MYS A;  3K6G A;  4RM2 A;  2VXZ A;  2CW8 A;  5CQE A;  2XDV A;  4F93 B;  4HRI A;  2X1C A;  4F91 B;  3A2K A;  3AUA A;  3FUK A;  3CHS A;  1OLT A;  1T0F C;  3K4N A;  2ZSH B;  3QOD A;  2FUG 2;  3AL0 B;  2MC4 A;  2HQA A;  4E7I A;  1V5G A;  5CKT A;  4Y4R A;  2MAP A;  3H5N A;  3DU6 A;  4ZJZ A;  4E7K A;  4CXF A;  2M7B A;  2B61 A;  3OIP A;  1X4P A;  1ONO A;  4F55 A;  1UAA A;  1GW6 A;  4QIR A;  2XQ0 A;  4AYS A;  2V1N A;  2W82 A;  3E0J B;  4XN5 A;  1Y6I A;  3FU5 A;  4IZZ A;  4RLQ A;  2VQH A;  2PUS A;  4BL0 B;  1WJ5 A;  1WJF A;  4JQF A;  1D1B A;  3M1C A;  4E7H A;  3ANM A;  4XND A;  2Q2E B;  4BUP A;  2R72 A;  3QOE A;  1G8X A;  4Y6S A;  3OYN A;  2C82 A;  3HPH A;  2M0M A;  4XN3 A;  4K5N A;  3WQS B;  4CH7 A;  4OAZ A;  2MAO A;  5JHF A;  2L5Q A;  4BGD A;  2JA2 A;  2PGG A;  3H9G A;  1X1D A;  3FUL A;  3ANN A;  3L2W A;  2CUZ A;  1JI8 A;  2OV7 A;  4RM3 A;  3D5R C;  2DQM A;  2JCY A;  4BKX A;  3OYD A;  5DUL A;  5JC1 A;  3RTR A;  4N4O B;  3BC8 A;  3FTU A;  1RP3 A;  1W36 D;  1ERD A;  3FUJ A;  2CW7 A;  4B43 A;  4CCJ A;  5HOO A;  4FET A;  4XN4 A;  5JMW A;  3OOU A;  4PFP A;  3UNG C;  3H0D A;  4OWR B;  3OYE A;  2Y1E A;  4XN8 A;  2Y1G A;  4XM3 A;  3DWL E;  4D9J A;  1R0K A;  3OYA A;  2UUZ A;  3PNT A;  3RQ4 A;  2JVG A;  4ZW7 A;  4NQW A;  5LD2 C;  4DBR A;  1X1C A;  2CV0 A;  1SG7 A;  3CZ6 A;  3VDX A;  3MKZ A;  4XN1 A;  2XF5 A;  3LL7 A;  4PSX A;  3OS2 A;  2M3A A;  1UG0 A;  2VPL A;  5FRM A;  2WAF A;  2BVM A;  4II3 A;  3PNY A;  5TGT A;  5HNF A;  4AR1 A;  5JO0 A;  3EPZ A;  1R0L A;  1OR7 C;  2M7A A;  4ZX4 A;  2E60 A;  4ZX6 A;  2KRH A;  3PSF A;  1T95 A;  1WJE A;  3DPT A;  2VQC A;  2WBM A;  2JSP A;  4G6T B;  2KMU A;  2X1E A;  1H3L A;  5KHD A;  4GAA A;  1YE9 A;  3NWS A;  2V6E A;  4XN0 A;  3VSK A;  3OS0 A;  3CF2 A;  2DJI A;  2XF7 A;  2K9M A;  4RLF A;  2KDO A;  4XOR A;  2JV7 A;  3ZXS A;  4C2U A;  2R4G A;  5JNL A;  3EUK L;  4BEH A;  3W3C A;  3RCO A;  1X3W A;  2V26 A;  4DGW B;  2WY8 Q;  3H5R A;  3LSG A;  4IX7 A;  3K4B A;  1R6R A;  3DU5 A;  3FTZ A;  2O5R A;  2WAE A;  4HPQ A;  4AVZ A;  2WZF A;  4BQO A;  4XN7 A;  3FU0 A;  3RC3 A;  4CCL A;  3LSI A;  4C30 A;  3KED A;  3A14 A;  3CZE A;  4F52 A;  3D5L A;  2W4S A;  4FLQ A;  2DT6 A;  1Q0H A;  2CFO A;  4P1W A;  3W2W A;  4PVB A;  2HPM A;  2W00 A;  4ZN6 A;  3NWT A;  4PUS A;  1U0J A;  4U87 A;  4DBQ A;  3MKW B;  3FBI B;  2KZV A;  3LFU A;  2DQ6 A;  2MD0 A;  3IAS 2;  2AQE A;  4B48 A;  2WAD A;  3CMM A;  4CA0 A;  3B7U X;  2VXD A;  3G2B A;  4CSW A;  5FRN A;  3B7R L;  4C9Y A;  5JAZ A;  4K5P A;  3E1S A;  2VKD A;  4KJZ A;  4YEJ A;  3DQV C;  3DEE A;  3B37 A;  3M8J A;  2XF6 A;  4BQN A;  3S32 A;  5AEN A;  3H5A A;  3CES A;  3CHR A;  4KP7 A;  1Z3Y A;  4PW4 A;  3JSZ A;  2LBF A;  5HLT A;  3ZI0 A;  1VZ0 A;  3RSN A;  2BW3 B;  4J00 A;  4ZDP A;  4IQJ A;  2R7S A;  3EBH A;  4ZQG A;  2VLA A;  1SAU A;  3CZG A;  4XKV A;  4DIQ A;  2VL8 A;  3PL8 A;  4XLA A;  2L7K A;  4XON A;  4KIS A;  2Y1D A;  4C2T A;  3B34 A;  2VJ4 A;  2IXS A;  3DKY A;  3K4L A;  4PJM A;  3AKZ A;  3FU3 A;  4MKT A;  4OOF A;  4BXF A;  4FCA A;  3VVM A;  4DPR A;  3EUH C;  3F9K A;  1LDK B;  3ZCO A;  4LUP A;  2V7F A;  3R0I A;  1SQM A;  4QME A;  3CZK A;  4NQW B;  2R7U A;  3DPL C;  1BOB A;  1YX3 A;  3LSK A;  1BR1 A;  1WJA A;  5FRO A;  4BU2 A;  4AIC A;  2RQQ A;  4XMT A;  3VVL A;  3K4K A;  4LIU A;  2QKM B;  3OS1 A;  2ELJ A;  4DJA A;  2CUJ A;  3L2R A;  3OYC A;  2IS4 A;  2PJR A;  3HOS A;  1HA8 A;  3DKX A;  2GOM A;  2IS1 A;  4E7L A;  1MW2 A;  1BR2 A;  4B44 A;  3L2V A;  3FUF A;  3BLY A;  4NNJ A;  2QJ1 A;  2BOL A;  5CPR B;  2JD2 A;  3S3N A;  2C5Z A;  3OYI A;  4XMV A;  2QVW A;  4XN9 A;  4XNB A;  3B2X A;  1X1A A;  4E6K G;  1JVS A;  5DYF A;  4HNU A;  3CJQ B;  3S93 A;  4XLF A;  4Q4E A;  1SFK A;  3W2A A;  3K4C A;  1TZL A;  2RJI A;  4BEH B;  4OOE A;  3FUH A;  4B3X A;  4YEL A;  2V9K A;  4J01 A;  4XO3 A;  2VQL A;  4OAY A;  3CIA A;  2MFZ A;  2RRE A;  3N05 A;  3UCQ A;  2BW3 A;  2Q1Z B;  2JCV A;  4QUO A;  4PFO A;  3IIE A;  1D1A A;  2RNG A;  3FKJ A;  4PJN A;  3UR3 C;  1DGW Y;  2K9L A;  4FAS D;  4XQF A;  3CZL A;  5EV7 A;  4XKC A;  4CCN A;  1YX5 A;  3S8P A;  4LIV A;  3VWB A;  1V5E A;  1K6Y A;  3HOT A;  1Q0L A;  3CP2 A;  3AL0 C;  2IS6 A;  4PSW A;  4QHP A;  2LH9 A;  4GRI A;  4PJJ A;  4XLH A;  2IGO A;  3TL4 X;  3LSH A;  3VYU B;  3JT1 A;  3ZHY A;  1Y56 A;  2KQR A;  3L2U A;  4BE2 A;  3OYK A;  3I3L A;  3ZR8 X;  3CHQ A;  1MMG A;  3S3O A;  3DTK A;  2OUM A;  1N78 A;  3A1Y A;  1T1R A;  4DOZ A;  2LC2 A;  2QKL B;  2R7T A;  3A4C A;  4ZX5 A;  4CCK A;  4XR6 A;  2BVL A;  3SEQ A;  4AR9 A;  2Y1F A;  3PUB A;  2LBF B;  2XC7 A;  2CMP A;  3TMO A;  1P9Q C;  2X6Y A;  4CCO A;  1D0Y A;  1WJD A;  3I9V 2;  1WJB A;  1GLN A;  4XL9 A;  3MMY B;  2FFL A;  1WFX A;  2HVS A;  2CV2 A;  3J7A Y;  3PNV A;  2IS2 A;  1MW3 A;  3OYH A;  3ZHZ A;  3FUI A;  3FUE A;  3FTS A;  3EBG A;  3FBN B;  3DTE A;  3FUN A;  3PFY A;  2KLO A;  3C2H A;  2HDW A;  2VB6 A;  2PL5 A;  2Y1C A;  4XMW A;  2R7V A;  5FWQ A;  5LFA A;  2R7Q A;  4ZW8 A;  3FH7 A;  1X4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...