2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
5HNFA 2VLAA 5HNHA 5HLTA
chains in the Genus database with same CATH superfamily
4Z6YA 3HOZJ 1YS6A 1SAUA 1JJ6C 2PBIA 3FXRA 3QJXA 5DULA 3PSFA 4TV7A 2FNAA 4A3DJ 3IP4B 3J80Z 4ZZLA 4QIWN 3Q43A 4B4CA 2H1KA 1D0YA 2X4HA 1IUYA 2NXNB 4HQEA 3I4MJ 3DBRB 4ZW3A 1VQ8I 1OMIA 1R23A 1RC9A 2M2EA 2XV4S 2AS5F 2WAFA 1VQLI 5L3GA 3E5XA 4G6QA 4X6AJ 3BR1A 3TP0A 4AIJA 2XGDA 1X3WA 4HLXA 2BW3B 1BL0A 3BCBA 2JK3A 2M87A 3U1DA 5J8CA 2QZ8A 1B1BA 2RQQA 2OJED 3I59A 2VT3A 3WODF 3G71I 2WY7Q 4EJUA 2OZ6A 1S7OA 2K9LA 4GAAA 1JVSA 2HGCA 3QQAA 4L0YB 4QUOA 1Q1HA 4UXNA 3KEOA 3VVLA 3CP2A 1SD4A 1D8KA 3ECOA 3LAPA 4A93J 2XF6A 3TOBA 4CYCB 2DDBA 5EYRA 4DQ2A 2Z33A 2EIKH 3LWFA 2VIXA 3P5JA 4M3DA 3S3MA 3HSEA 4QIRA 1OQYA 2Z5UA 1X58A 4XNFA 2R70A 3IRQA 3H3VK 2WBMA 3UKGA 5CLSA 4RCVA 3V8LA 1TWFJ 4LLGF 1X1CA 1Z7LA 3H35A 3K4NA 2R72A 2ELHA 3FTUA 1OCOH 2HYGD 2HVQA 3PUUA 4Q4ZF 3BQYA 4KP7A 1EF4A 1A36A 2PEXA 3ZPLA 2G9WA 2KRCA 5J1YA 3HTUA 2H09A 5FJ8J 2HOTA 4Y4RA 1RUOA 4G7ZF 5KAIC 2NVYJ 3K4BA 3F6OA 5L3FA 2JSCA 4RB0A 2XAJA 3MQ0A 2ZMEB 4AR8A 2EWNA 3BR3A 2DOFA 2RNGA 2ISZA 2W24A 2ZSIB 5FLXK 3CCYA 1YQAA 1UFMA 2Q8KA 3D5RC 3Q44A 4XSZF 1ZGWA 3ZP5A 2P81A 1ETXA 2LBFA 1R71A 3A14A 1XSVA 2Y1DA 1NK2P 4ZW5A 1AKHA 3QU6A 3AFHA 5JBIA 5CKTA 1B6AA 2L7MP 3G3ZA 3W6KB 3FULA 4FX4A 4OWRB 2O03A 4M74A 1PYVA 3KP5A 1I5ZA 2ETHA 2DU9A 2O7OA 2YSRA 2EA4A 3AAFA 3OS0A 4IRIA 3L2VA 3WU2C 3T8VA 2CQNA 1ZTRA 4XLCA 2MC4A 3JCUC 4ZQTA 4A3KJ 3BJ6A 3RSNA 5FKNA 4KICA 2A6TA 2CWEA 1JG9A 1ZN2A 1S3JA 1A04A 5CPRB 3F23A 1R5GA 4UVBA 2MGQA 2Z2SB 2FU4A 3LA2A 2IA0A 3H3UA 2A6EF 2FF4A 2VN2A 2QLZA 4RMNA 4UUTA 2CV1A 2FBKA 3HJEA 2YU9J 3JSOA 4XN1A 3BY6A 2K27A 5K1YA 2OV7A 2JCVA 1BBYA 4XO3A 4PVBA 3SQNA 2PQ8A 4XR6A 2JSPA 4ZQEA 4DIQA 2COBA 1VI0A 3ERMA 4D7MA 1CF7B 3OSGA 2Z99A 2DQLA 4ENNA 5K7HA 3WU1B 2EFPA 1YW8A 5DS9A 1MKMA 2KDZA 2AHQA 1GXQA 1DU0A 2XPYA 2K4BA 3QPLA 5KHDA 3J81Z 4ENJA 4C2UA 4NBQA 3PNYA 4B3XA 3OYJA 4I2OA 1GV5A 2CMPA 3HRUA 2M0CA 2PN6A 1IAWA 3HEFA 1S7AA 4XRSA 1WH7A 4JK1X 3J7ZI 2ZC2A 2F4IA 5F0FA 2QA4I 1FOKA 2NS8A 1LFPA 4Q4EA 1ZH5A 2BOLA 3FBNB 1WGXA 3CIAA 3D0SA 3BG6A 2PMUA 1MMSA 2ZFUA 3Q3SA 3QYBA 4RGSA 2R0QC 1WJEA 2XSDC 4LB5A 3K10A 1ZK8A 1H89C 2JD2A 2WV0A 1ZYRF 2W57A 2JD1A 1IXSB 3HUGB 4N0BA 1W0TA 1HBXG 2JA2A 4Y67A 2ECCA 2E1MB 4LFUA 3SDBA 1HW5A 1X2NA 1TWCJ 2DT6A 2VE8A 1A5JA 3QU3A 5BPDA 1PP7U 3FH5A 2Y48A 5LD2C 2QWWA 3GF2A 2MABA 3L9FA 3RCOA 2Q1ZB 4BKXA 2BY2A 2FFLA 1M1EB 2GIVA 3K4MA 4IF4A 2JRMA 4ON0A 2QUFA 3OIQA 4HX4A 1IG7A 5CVVA 4AIHA 5EGOB 3L2RA 2WPGA 3F6VA 5JMPA 3DU5A 4DW6A 4FCYA 1R4MB 4R1HA 3F0CA 1FSEA 4RGUA 1MJBA 2Y9ZA 4UV8A 2CQKA 1R5HA 4C3JJ 2JMWA 4RGXA 3DBLB 3GMEA 5TJJA 3JSPA 3ZQCA 2QSHX 3OR2C 4M9ZA 1ETWA 3AL0B 1DUXC 2M8GX 2IW5A 2XC7A 1K7AA 5F0CA 3L00A 2LF8A 3IH2A 4B3AA 2DPUA 4WWCA 2WA0A 1ZG3A 4EQQA 4L9JA 3D5SC 2QVOA 3BG3A 1W7PA 3AG4H 3DP7A 2LRDA 3R0IA 2V6CA 4QLCU 2JUGA 1D1BA 2M34A 3KFWX 2VQLA 4KA4A 4XLAA 1ZGJA 3NARA 4F55A 2Z1DA 1GDTA 3FMQA 3ZMTA 1LDDA 1Z05A 4E7ZA 1ZQ3P 2DLLA 4LGWA 2DDAA 1REPC 3TEDA 3KZIC 2L9SA 4WXDA 2OUMA 2DOAA 2XAUA 1Z3XA 2OQGA 2PG4A 2PMZA 1U5TC 4EMSA 2C5ZA 1FZPB 3EBGA 2E2IJ 1F9NA 4L9VA 1OISA 2CQQA 1MGTA 2VC1A 4C3HJ 3ZHZA 1BN5A 2K9MA 4IRGA 3W6JB 2BYVE 1Q0QA 3ANMA 4UNOA 3FM5A 2MFZA 5D6EA 3FDYA 1F5TA 3FX3A 1W5CC 2BY0A 2QKLB 1Z1DA 2KT0A 3ZQQA 1S7EA 3BR2A 1TLHB 2DO7A 2WTEA 2VONA 1MBKA 2OQRA 5HLIA 3ZN0A 3J7AY 5E1WA 1GXPA 4BY7J 3GUDA 3LSMA 4Y6PA 4HG2A 5AIQA 5IT9K 2YUSA 5LRRA 4A3FJ 1SD7A 3I64A 3K0LA 4Y3OA 1VFCA 3WG7H 1FYLA 1ZREA 2E5NA 1F1ZA 1JUSA 1Z91A 4KN7X 4IHWA 2IVMA 2F5VA 1BI0A 3TDUC 4XN9A 4UB8C 4XKBA 4YIFA 4Y33A 3ASNH 4JX5A 1QVUA 3FUEA 2NVXJ 3HYIA 1U3EM 2LD5A 1IN6A 2RGVA 1BW6A 2KQRA 5K7ZA 1YIJI 3VYSB 1KA8A 2NVTJ 2ID3A 2F5FA 2DA1A 1W36D 1RP3A 4A03A 5JR3A 2ZMEC 4LOCA 2R7VA 2DFEA 1MJ9A 1MIJA 1GV2A 1I6XA 1FIAA 2CFXA 2ZNZA 1HC8A 1X3ZA 3C2HA 1WI3A 3CCSI 3CQZJ 1DP7P 3F8FA 3O2PE 4JX6A 2K86A 4AC0A 4IQJA 3KZZA 4E7HA 1QHGA 2QEXI 1OR7C 3EUAA 5BOXA 5HVQC 1YJ9I 2W1OA 3VDXA 3BROA 3BDDA 3GFIA 3GTJJ 3HRTA 4E7LA 1ZARA 4KISA 4CCOA 5LGTA 1QZYA 3L2UA 2H8WA 4CSWA 2E1NA 3JRGA 4B1RA 3CZGA 2OF7A 2JTVA 5D5UB 1KQ9A 5E1ZB 1K6OA 5CJ9A 2FQ4A 2HXOA 2COMA 2EGHA 5DCFA 4XONA 4MS6A 3EUHC 2A69F 4XKCA 4O6JA 3SFIA 3T8RA 1V5FA 4P1WA 4ZQHA 3CZKA 4EJTA 5L3EA 4D9JA 2F6CA 4RB2C 3WTSC 5BMZA 2IGMA 2Y69H 4RAGA 1MW0A 2KIMA 2QSFX 2C6YA 5J1RA 1IJWC 5IT3A 2CH0A 3CHQA 2BGCA 5F1JA 4E7KA 4MTDA 2CFOA 3M8FA 3WQRA 4D0PA 1MMNA 5FRNA 3GCMA 2KDOA 3EYIA 2M1BA 2P5KA 3IHUA 4EGYA 2LREA 2HWVA 3O6BB 4QPOA 1HF0A 4MEYF 3GLXA 3DKWA 3H9JA 5K5RA 2MH9A 3PFYA 4DOZA 1GW6A 5ICEA 1T33A 3RPUD 4RS8A 3OYMA 3OYDA 2XAQA 4W1UA 1WJ5A 3PIOF 4FE4A 4CCLA 4DBRA 5K7FA 1Z77A 2GXGA 2R5ZB 5JNLA 5ERIA 1LNWA 4BQNA 2PX9A 2HS5A 4OU0A 1LE8A 2JA7J 2CUZA 3WU0A 1L3LA 1AWCA 2FMLA 2K02A 2VL8A 5KVRA 4M3BA 3FTSA 4U7BA 3FKJA 3K4JA 5JVTA 2IGNA 3BR0A 4KNYA 5JO0A 3FU6A 1EKEA 4OIPF 4AR9A 3FUKA 3OYHA 2OCCH 4JYKA 1PUFA 3B7TA 2L5QA 5DM7F 5TRDA 2OA4A 5IYBJ 3TGNA 2NOJB 1WJBA 2E1MC 2PGGA 2X1DA 1V5EA 1WWXA 1XMAA 3OOUA 2X51A 1FSHA 2VOOA 2KKOA 3DPUA 4CXFA 1Z6RA 1VQMI 4Q47A 4R5XA 5TISC 1XGOA 3R60A 2KMUA 1O3RA 3CC4I 4N9HA 3GZ6A 5LHGA 1YRNB 1IN5A 3MZYA 2E2HJ 4MQVA 2N8GA 5M3FJ 2EB7A 3QYFA 1S9HA 1ZRFA 2A05A 1TWGJ 2WZFA 1ITYA 2A6HF 3FXMA 3MAJA 4AIDA 3QOPA 4QHPA 4PFPA 3IIEA 1D1AA 3HGGA 1NTCA 4RGRA 5HOOA 1D0XA 4UY8I 3MKWB 1P6RA 4M72A 2HYJA 3QRFF 2WWYA 4RB1A 2JPCA 4BJ6C 4AWXB 4P55A 3A2KA 4ZTJA 1QO0D 5FGMA 4OIOF 2RJIA 2RQPA 3CJTB 3FXJA 3MD2A 3ONQA 3M1EA 3P7NA 2JJ7A 1CQTA 1MSFC 3NAUA 4ZYGA 3CO7C 2HDCA 1FC3A 4ABZA 5EEGA 1TT5B 3BZKA 1MMAA 5K5QA 5E18F 2E60A 3MZHA 2WB1N 2PI0A 3S1MJ 3CHSA 2LR8A 3JTHA 1BJAA 4BE1A 4QWQA 2HNHA 5FWQA 2P6SA 5J4YA 2IS4A 5F1RA 4C2MJ 2EBIA 4A3JJ 2ADUA 1W1WE 1FIPA 2W48A 2Z3YA 3CUOA 3QP6A 1WFXA 4MIMA 4LG0A 4ESFA 4F3QA 4ZDPA 2K7LA 3K1PA 1WSUA 2CG4A 3TO6A 3BJAA 3TOAA 2NRAC 4PJNA 1O3SA 4XBFA 1ONOA 1ETYA 4F7ZA 1T95A 3MN2A 5FFZA 2VJJA 2XGCA 1T0FC 2OPTA 4A3CJ 5DYMA 3DCFA 2EFQA 2ICWG 2VXDA 4BBSJ 4LD5A 3QODA 4CZCA 2P0WA 1BJZA 3CZLA 4QSHA 2VQCA 2I10A 2R7OA 2Y30A 4MFEA 2HXIA 1H8AC 4AVPA 5K5OA 3SHFA 3PUFA 3WHCA 2DQ6A 4K5NA 2Y0SN 1D0ZA 4ARFA 1Q0HA 3AG2H 2B7EA 4AUXA 1A31A 2JUCA 3DFGA 4X0GA 1OYIA 1POGA 4BXUA 1MBEA 2VXZA 2O3FA 4JQFA 5LEKA 1VQPI 1HA8A 1I50J 3DBHB 5E79C 1AOYA 1MJAA 2EZKA 2V1NA 2W82A 3GTMJ 2R4GA 5LHHA 4LB6B 1X1AA 3ZOBA 5ILSA 2HYFA 3WTTC 3G2BA 5EZGA 1C0WA 1IC8A 2DFFA 3N4MA 1R1TA 2DN0A 2PFBA 2VJIA 3FHEA 1JHFA 3GTKJ 2FE3A 2DTRA 5JLXA 1UJ8A 4FX0A 3V7CA 2HFHA 4G7HF 5D5VB 3ABLH 4L9NA 2XAGA 5E3OA 4CO8A 5JI6A 3GXOA 4MLOA 3D1NI 5DYFA 1KQ0A 2FMYA 4XLHA 5ICGA 3K70D 4AYBN 1JUMA 2E36A 3FTWA 4M6YA 5LFAA 4KT5C 2FRHA 5HLGA 3DTEA 1S46A 4HA8A 1QHHD 1BIBA 3IH3A 2JD0A 3TDZC 3J80K 1H88C 2R7QA 2VC0A 3ZN1A 2XHKA 3BP8A 1P9QC 3V4GA 1RKWA 2XF5A 1MW7A 3AG3H 4XLEA 3K2AA 3T0YA 1AHDP 4XLFA 4IJAA 1E0EA 5J4VA 3A03A 1R4NB 3I53A 4A6EA 1U5TA 2RAEA 4A3GJ 1FYMA 1ZRCA 2DMTA 5E3LA 4U0WA 2JCXA 2O8KA 5JHFA 3ZI0A 3PQJA 4BAYA 2L7KA 2QQBA 2BW3A 1TW2A 1RR7A 2DFIA 5F27A 5FKKA 4E4HA 2DBBA 3IC7A 5IY5H 2NVQJ 2KRFA 4XOPA 1Y0NA 3OYAA 2ZXIA 2PL5A 3MKLA 1FBUA 5BS6A 1IO2A 4A0YA 1R36A 1STZA 1GT0C 4XLNF 3ASOH 1HCRA 4JNDA 1FY7A 2BE5F 2G7UA 5KAFC 3ESWB 5FLMJ 1D8JA 1HDPA 1R0LA 5J6XA 2M45A 2DA5A 1R1VA 4B48A 1SFOJ 4F92B 3RPQA 1HQCA 3H92A 3QP5A 2KL4A 1JI8A 4EM2A 3ABTA 3DEUA 3OWTA 3RYPA 4G94A 2MSYA 4DYRA 2X6YA 1UB9A 2L7FP 1OYWA 4I99C 4ESBA 4BE2A 1APLC 4EJOA 5B5EC 1RIOH 2O0YA 2E7XA 5FKMA 5M5XJ 2UXXA 1MW3A 2HPOA 2B0LA 3E97A 3I58A 1KGSA 4BY1J 4XN2A 2BVMA 1T1SA 2EV0A 4R7LA 2DT5A 1X1BA 1EJ9A 4K5OA 1FMVA 3QAHA 4CZZA 3S16J 1B9NA 1MDMA 5HNFA 2AXLA 2I8DA 5DCMB 1SC7A 2R7XA 2GA1A 4XO4A 2VLAA 3EBHA 5B3SH 2O61A 4XRSG 4HX7A 4BEHB 3ANLA 1MBHA 2KIUA 1RRJA 2KISA 1Y1WJ 2EA2A 2X6OA 4XKVA 1TQPA 1OCPA 1Z0XA 2BHZA 4IHSA 4V2GA 1B8IB 1MMGA 2FEZA 4F91B 1LEBA 3T8TA 2M7AA 2A5YB 3ANNA 3QWLA 1FX7A 1OR7A 3RPUA 4L5EA 3FHNA 3EBIA 5ILVA 4XICA 2FA5A 1ZLJA 4C30A 1WHUA 4ZC3A 4EM0B 2CYYA 3U21A 1MBJA 2FUG2 2M8EA 4LG3A 2NVUB 3RI4A 3CMYA 1I3QJ 1OCZH 1YO5C 4K5LA 4XN5A 3HKZN 3H36A 3FU5A 2O9LA 5GAEJ 2JT1A 3FBIB 3KEQA 3EUHA 4HF2A 4KIFA 1FP2A 1T56A 3FWEA 5H6RA 3GTQJ 2CUJA 2HQAA 2DODA 3RKXA 5D8LB 5EEAA 2M7BA 2V79A 3GO5A 3ELKA 3TW6A 2WZGA 3FUJA 4XN4A 4AIKA 3CJQB 5AONA 2L01A 1JT0A 4XMVA 3DU6A 5IPAA 1FJLA 3HSRA 1MD0A 3I59B 2VPLA 2R7DA 3JSZA 3FMSA 4LIUA 3O8GA 3OYEA 1GLNA 3QPTA 1OCCH 4Y7NJ 1UG0A 2AXTC 3KYCB 4YEJA 3WTYC 2LK2A 3BJOA 1N25A 1MZBA 1X1PA 1ETKA 3OL3A 1T1RA 1ZR4A 1X19A 3JRFA 1YI2I 2KHMA 3CMEI 4YIIA 3RKQA 5FB2A 3ZMUA 1JGSA 2GXBA 4LK1F 4OIRF 4XNAA 3Q0VA 1R22A 5M5YJ 3JTGA 1MNDA 3CZ6A 3IUOA 2IP2A 3A0BC 2CQXA 1IRFA 1G3TA 2J5OA 4OOEA 3J81K 4G6DA 4A69C 3B6AA 2LP0A 2HPTA 4MTEA 4S0HB 3BLYA 3S1QJ 3HTSB 4GAEA 2WB1A 5H20A 4W97A 2KZGA 2GQQA 2R93J 2Y0MA 5HDGA 1R5ID 2JV7A 3CDIA 1LJ9A 3OV8A 3KP4A 4ZX5A 3HUGA 1P2FA 2VJ5A 1B59A 3F21A 1A6QA 3KYDB 1SMTA 3M8JA 3ZRGA 2JRTA 1ZELA 3GLLA 3NQOA 2GWRA 3PNVA 3O3KA 2DA7A 4IEJA 5J3LA 2V1UA 1BR1A 4AICA 1XMXA 4DYQA 4IHTA 3SZGA 2ZB9A 2RKHA 2IA2A 2E5ZA 1SVMA 2R7FA 1KU7A 4DJAA 1BA5A 1TC3C 1D5VA 4IOAF 5LEJA 1ZLKA 1T6SA 3Q9SA 1SAXA 2DA6A 2L4MA 2TDXA 1OPCA 1IRXA 1ONNA 1JHHA 3MMYB 4I0BA 3RDIA 3OY9A 3FU0A 2DPDA 3IKVA 4MFDA 3I71A 2QQ8A 1QZEA 4IQ4A 1R9TJ 4RAZA 3RYRA 3KYLA 2GLOA 3ZCOA 4U0VA 4IZZA 5ICCA 4HF0A 2Y0SA 2EK5A 4BS9A 1LFUP 3T1BA 2A7OA 3J7YJ 2XRLA 3LNQA 1XCVA 3UNGC 4H0EA 2DAOA 1FWZA 2NS7A 3CO6C 3B7SA 5HODA 3S93A 5DD8A 4HV5A 5BNGA 1P4WA 3ZQIA 3K1NA 4GGGA 3L09A 4M9SA 3FM3A 4PGHA 5ED4A 1Z21A 2LKPA 1K6YA 3CCMI 1U78A 1N77A 2X1EA 3ZQLA 3HW2A 4V19K 2CUFA 4NNJA 2RNJA 4D5FA 3CHPA 1OJLA 2IPQX 1V55H 3BTLA 4ITVA 1DGRM 5B1BH 4FLOA 3BPVA 1HW1A 1OLTA 3SFZA 1MH3A 1IN8A 2NS0A 2XGXA 4WF2A 2W85A 2X1CA 3RJPA 2IJLA 2VKHA 1IV6A 3QPHA 2PUSA 3IWFA 1R0KA 2QGUA 2RREA 3CP8A 3P9KA 2XGEA 3BTCA 4XL9A 1T0FA 3ABMH 2LTPA 4MHGA 1SMYF 4AYBA 1TL8A 3OYFA 1YHQI 1DDNA 1USTA 2ZXHA 4LIVA 3S32A 1U8BA 2HEOA 4KYWA 4Y52J 2JVGA 4I01A 1XD7A 4NQWA 4S04A 3BTJA 2L9VA 3FUIA 2K9SA 2R7RA 3JREA 1B4AA 1OCRH 3DWLE 4DZJA 1PP8F 4X1EA 1SFXA 3S17J 3CHRA 1LKXA 4E7SA 2XKPA 2LFBA 3S1RJ 4ZX6A 1S72I 4AR1A 2ESHA 2W84A 4IKFA 4LLNA 2O8XA 3U2RA 2FXAA 1QBJA 4BXXJ 2OTLI 5C4XJ 2HDWA 1VQ5I 2EV5A 2M5WA 3FKIJ 5F0HA 4P96A 1MBGA 3JRAA 4R5TA 4PGGA 5J40A 3AKZA 1R7JA 1NG6A 1LEAA 4NDLA 2HU9A 2JVHA 4YFNF 1VQ6I 2MLGA 3EYYA 1FT9A 2WAEA 2AQEA 3B2XA 2Y75A 2XB0X 2BZTA 3LSGA 3M3YJ 2CJJA 3OYIA 1ZRDA 4ZW6A 3KZYA 4MQ9F 2FD5A 3G1MA 5EF6A 2K5CA 1XPXA 2DJNA 2DMUA 3OOPA 1U9OA 5JFRA 1P7IA 4GYGA 3V7SA 4BL0B 4KFCA 3BT9A 2BHYA 2RV8A 2R5YB 1E17A 3JT1A 3WE2A 1SC5A 5L3BA 3H0GJ 2ESNA 2IBDA 3KLOA 3PIPF 4YRVA 1VQOI 3DLAA 2EFNA 1UELB 2FOWA 3R4KA 3VWBA 3GTGJ 4OINF 2HQ5A 4RBOA 5FD5A 4XMXA 2F2EA 3HOYJ 2BXZA 3WHBA 5EG0B 4II2A 3JRHA 4AYSA 3HDDA 3CF5F 2QBYB 4CYDA 2DMNA 4XMZA 4H4KC 4A0XA 1J59A 3FUNA 1JXSA 4G9YA 2WAQN 2LF7A 2E19A 3I4PA 3F9KA 3C18A 1G5AA 2B9SA 3B2PA 5AIPA 2NNYA 5IP7J 2XAFA 4PJJA 3GVAA 2R59A 1DPRA 3VSKA 4ESJA 2P5VA 3JAMZ 3W6VA 1KQ8A 2KIQA 1JGIA 1RNLA 4IRHA 1K61A 5IOZA 1V3FA 3I4NJ 5D5WB 4LUPA 3H9GA 2LDUA 3HKZA 4CUGA 2EFWA 4K2EA 4C3IJ 4Q4IA 4CA0A 1Y6IA 3OYCA 3LMMA 4CH7A 1YS7A 4MNUA 5L3DA 1QQIA 1JE8A 3RKYA 3F8BA 2CU7A 3UCQA 5DUKA 2PJRA 1L0OC 2Y1EA 2M9HA 2EILH 3QPSA 3RC8A 1MSEC 2AQFA 1P7JA 4ENKA 1VTNC 5B1AH 3IL2A 3HC7A 1YG2A 4M3EA 2D1VA 3GTLJ 2DI3A 2GOXB 5EV7A 1YX5A 3VVMA 4M3GA 4L18B 1USSA 2V9VA 4L0ZB 5JVGF 5B66C 4U88A 2P7CB 5BPIA 3C7JA 2VI6A 1O7FA 4IVNA 5LBQA 5H2FC 2G7HA 4HBLA 2V4JC 1F36A 3BC8A 5GPAA 3VFZA 1ZG5A 2QKMB 5KCMA 1LDKB 2L9NA 1XCBA 1WVRA 1X3ZB 3DQVC 1BOAA 5E20A 4RDUA 3O8HA 1MH4A 4NC6A 4XRMA 4ZTFA 4PSXA 3DPTA 4GYIA 5DV5A 2JQ7A 4P9UA 3CC7I 1GHCA 2WADA 3BG7A 4EATA 4EGZA 3B37A 3FXUA 2DCEA 2OZUA 1T8IA 1VQNI 3BG5A 3GBGA 3H5NA 1N75A 4WCGA 4BYYA 5H6QA 5HS7A 3M4OJ 4XNBA 1WH5A 4DNCA 2K3PA 3ML6A 3HG9A 3W3CA 4ZDLA 4ZW8A 3CMAI 2OTJI 4IL6C 2XB5A 3E7LA 2GA2A 2KRHA 3H5AA 4KMUX 1SFUA 3CZEA 3UEQA 5KNLA 3NWTA 1IF1A 2P6TA 1H0MA 3FXKA 2X48A 5E1XA 3CHOA 4OAYA 4FLQA 2LOOA 2A68F 1J0RA 1JKPC 3FUMA 1I1SA 2A07F 4L9TA 4HNTA 1IXCA 2Y1FA 2K9QA 1Y0UA 1U2WA 2ZCWA 2P7VB 2ELJA 5CYVA 1TQMA 1WKMA 3BTIA 4OIQF 3HRSA 3UERA 5CVJA 3K9TA 3DKXA 4E7JA 3ZHXA 2YX7A 4ZYAA 2GAUA 1DPUA 1FMWA 3WTUC 4I7HA 2NNNA 2QENA 3GTPJ 4J19A 5BPPA 5E8GA 4IX7A 2FX0A 2OBPA 1DP3A 1JUPA 2NYXA 3K7AJ 1R58A 1RPWA 3FXLA 1ACIA 2D45A 2JWTA 3S14J 2KZVA 3AL0C 3LSKA 4GRIA 1MNEA 1GUUA 2IA1A 2B61A 1XTAA 4A3IJ 3R0AA 1K5HA 2ZJRF 4IHYA 1SEUA 1UHWA 2EQRA 3SEZA 2XPVA 4L5JA 4RB3C 3CJNA 4D5CA 1SFKA 3WE3A 1D1CA 2VBZA 1RUNA 1BI3A 2DXIA 1LUJB 4DPRA 1K4SA 5DDGA 3ABUA 1XDUA 3G1LA 1K78B 1J75A 2E2JJ 2XPZA 2BVLA 3HOVJ 1N78A 4BXFA 3KLNA 1ONVA 1U9NA 1SVOA 4JP0A 4WK8F 1YYVA 5IOYA 2HR3A 5FKLA 2L2OA 1UCRA 2CSOA 3FH7A 1J5YA 3MCZA 2R3SA 3TMOA 2K9NA 3GEZA 4UV9A 4BUPA 4I6ZA 5CVRA 2OU2A 3P9CA 2EZLA 1P4XA 3PL8A 4FHTA 4ETSA 5DUIA 2MD5A 2Y31A 3ISPA 3CLOA 3I3LA 1HOMA 2HKOA 3N05A 4XORA 5DEQA 1U8RA 3OR1C 1FEXA 4ZYEA 2UUZA 2YPRA 4IHVA 2JPBA 2A5WA 1O7LA 3M1CA 3V8KA 1FNNA 2CGPA 4R8HA 1RESA 2LSOA 1B72B 4K5MA 3TBIA 4HRIA 3Q0WA 3E0JB 4UHTA 4FASD 2FQ3A 5BQTA 2X6WA 2LY9A 5C4JJ 4U87A 4A0ZA 5EZHA 3ZMVA 5E17F 2ZFWA 3EPZA 2Y1GA 1XSXA 1YLFA 2LMDA 3JW4A 4FISA 3CXBA 5HLHA 2MG4A 3CD6I 3FUHA 3KP7A 2XPUA 3TL4X 5A2QZ 4PDKA 2EFOA 5EJCA 4RSYA 3G6EI 2DJIA 4G12A 4HNVA 1OFCX 2HQRA 2W25A 2VE9A 3IRRA 1R49A 4PJLA 4B8XA 3ERED 3B02A 5IP6A 1KZHA 1MW1A 5FD6A 1IZ1A 4UUSA 4XRFA 4QTRA 2DA3A 3EETA 4CCMA 1ODDA 2ECBA 4Y15A 4U0YA 1JGGA 1G3WA 4MKTA 1WJFA 4HLYA 2CQ7A 2CW7A 2YS9A 2R7ZJ 3A06A 2HI3A 1VQ9I 1TP4A 5C3EJ 1D5YA 3GFJA 3I0TA 3KP2A 2O5RA 2WC2A 4HOBA 3CJRB 2OC6A 1TWHJ 3A01B 2GZWA 3FUDA 4C9YA 4RLFA 1ETOA 5GAGJ 4R79A 3S2DJ 3U9WA 2HOEA 3L2WA 2UV1A 1K79A 2MA3A 4BDZA 2IRFG 3BZ6A 4N9IA 3RTRA 4A5NA 4PCQA 1FOWA 4GCVA 3WG9A 4GFBA 3E5QA 2XF7A 3MKYB 2FBIA 5DTDA 2MAOA 2QQAA 4L5IA 3MWMA 1HSJA 4XLPF 2D2WA 2L0KA 4ZX4A 2IS6A 4P5OA 2DA4A 4OMYA 4FCAA 4K5PA 4YFKF 1WJDA 2WAQA 3RQIA 4OMZA 5FRMA 5IYDJ 4XMTA 1WRJA 1RKTA 4HDVA 2H27A 5L3CA 3DXJF 3F8MA 4FT8A 4KT6A 2MW8A 2UZKA 1RETA 3J7AO 1XC5A 1X3UA 1P4AA 3GFMA 4XN7A 4UB6C 2L9RA 1FP1D 1YW7A 3OS2A 1V4RA 2MBFA 4BEHA 4OAZA 1XMKA 4QPEA 4ASNA 1Y8QB 1YW9A 4CYCA 2L7ZA 3CUQB 2YX4A 4D7NA 2IXSA 5KK1A 1B8IA 2QSGX 1SD5A 5HDNA 2QM3A 1S5LC 2Z9OA 2YR2A 2E71A 3W2WA 3LSRA 1XDSA 5GADJ 4XO5A 3K6GA 3V42A 2M4GA 1ZS2A 3CLQA 1RR8C 2EZIA 3FH8A 4XKWA 2Q2EB 4HSTA 2QVWA 2FBHA 4ZYHA 1EH7A 3AUAA 3I56I 4M71A 2Y1CA 1ETQA 2GIZA 4ZDOA 2L3DA 1VF9A 5E3NA 1MW2A 4KUMA 2CUEA 2ZXGA 2ZMEA 2ZNYA 2CS3A 4A3MJ 1O57A 3LSHA 1U5TB 2QYOA 4YFXF 3AU9A 1FTTA 3KP3A 3VYUB 5DLLA 2ZXWH 2X9DA 5JHUA 2XPWA 1O3QA 2CW0F 3DPLC 1MBFA 5F64A 1UAAA 4Q5SF 3C2BA 4WXHA 3REOA 2H1LA 2VT2A 4ZH4F 3LA3A 4I98B 3RC3A 2HVSA 2DA2A 3OSFA 5D8KB 4I02A 3K4LA 3V8JA 4HF1A 2X85A 4M73A 4ZJZA 2V26A 3AU8A 2A3SA 3OIOA 5DD4A 3VSLA 2JA6J 2V9PA 2L02A 4NB5A 3LOCA 2V9KA 1K4TA 5FO5A 5ILUA 2KLOA 3TO9A 4EJVA 3FK6A 3HOSA 3CCUI 5D6FA 3TQNA 3M9AA 3CCVI 4BHPA 4IO9F 1OYYA 3D5LA 1T08B 3ZQFA 1X3WB 4A12A 5EDNA 4EM1A 3AG1H 5FLVA 1Z3YA 1BR2A 5LGNA 3C3WA 3K1MA 1IN4A 2XQ0A 1MDMB 3S8PA 1FPQA 4B43A 3DV8A 4HV6A 4HYEA 2HVRA 2VQGA 2RVCA 5FROA 2HPMA 4E70A 4XK4A 4MO7A 1CF7A 3CF2A 2XROA 1LFBA 3DEWA 2ZJPF 2STTA 1LVAA 1Z9CA 1FOXA 3ZHYA 3CDLA 3HBLA 3LL7A 4BHBA 4RVBA 2GBYA 5GAHJ 1XS9A 2EH3A 1J7KA 3MKZA 2ZO4A 3E6BA 4HEA2 4UVCA 3CCJI 3G73A 3HL2A 1QA6A 5JMWA 2K85A 3ZQGA 1KU2A 2NOGA 3K69A 3M8EA 4G8XA 3GYHX 4M6VA 1JKRC 4UUVA 5F08A 3BZCA 2RDPA 4D1QA 5J8FA 2XDVA 1TW3A 1UZCA 1Z6TA 5D4RA 5FLXZ 1KONA 1WI9A 1XGSA 1FBSA 3DF8A 3FISA 3H1CA 2XAHA 3GWZA 3U1KA 4BQOA 3S15J 4A3EJ 3F8CA 1PJRA 2MH2A 4M6XA 4LLLA 3SZTA 2R7WA 2GOMA 4NHJA 1ZG1A 3WGHA 1YJWI 3HHGA 3PNTA 4KIGA 3GZ5A 4HZFA 3K4KA 1X1DA 3H9QA 3BR6A 2KIFA 2BBYA 1FBQA 2H6BA 2LBFB 4CCKA 5EGOA 2VPRA 1TZLA 5D5XB 3HSFA 4OOIA 3ZMSA 5JLWA 3F22A 3B34A 3U9GA 1AKHB 3ECHA 4EV0A 2F5CA 2P4WA 3LA7A 3FMRA 4XM3A 2CV0A 4Y6SA 1G3YA 3FZVA 4N4NB 2JA8J 1W5TA 1WCMJ 1FTZA 4PU2A 2ME6A 4OOFA 2STWA 4ZYDA 3L7WA 3OL4A 2HKXA 3I5UA 3HGYA 3VODA 2R92J 2M3AA 1AA7A 2DTZA 1YE9A 2VKDA 1T98A 5HS9A 3E1SA 5E8IA 2ZBKA 3NWSA 3GFLA 3WTVC 3ZR8X 1HKQA 1ZKGA 2M4KA 1Q0LA 2L4AA 4MEXF 1IDYA 2KJCA 4GDFA 3PO3J 2DMPA 4QPQA 3HOXJ 3Q5FA 1VZ0A 3H5RA 2BV6A 2YU3A 3OYGA 4ZW7A 4JOMA 4I09A 2HPIA 4RAFA 3HOTA 2BEOA 2J5PA 4XQFA 2B63J 1S6LA 3BCAA 1ERDA 3B3BA 2ZXJA 2L54A 2W00A 3H0DA 2XUBA 2BY1A 4XMWA 3CC2I 1HKTA 4XMYA 1WJCA 1H3LA 1J2XA 3H3ZA 1WQ2A 1ZGAA 2X6XA 1XG1A 3E3VA 4II3A 4ZQGA 3FF5A 3COAC 5JAZA 1UHSA 3F3XA 1G6NA 4NUBA 3KP6A 1G8XA 2F5EA 2FNPA 1FLIA 3C2GA 2E35A 3E6CC 2HOSA 2IAIA 2EIJH 1I3AA 4KITB 1YOVB 3OYNA 4J3BA 3WGGA 4Y17A 3PM1A 4HPQA 3CTAA 1G59A 3FTVA 2VBWA 1TNSA 1XB4A 1DGWY 2XVCA 2W4SA 4CCNA 4S05A 3OYKA 5IYCJ 4KMFA 5AENA 4ENMA 1OKRA 4PK4A 2F48A 3CUQC 3HOWJ 1DU6A 3TO7A 3ULQB 3SDGA 3HXLA 4IPAA 1W5SA 4HDUA 1ULYA 3WGIA 3FIWA 4LJZF 4NC8A 3DLLF 2ME0A 4FE7A 3CCRI 4Z2YA 3SJMA 2ID6A 2CRGA 1MMDA 1RZ4A 4NC7A 2HDDA 3MVPA 3B7RL 2F5DA 3FK7A 2IGKA 2R5YA 5DM6F 2HTSA 2E7WA 2DYRH 3M07A 1MVYA 3LAJA 3F8NA 3LQQA 4F52A 1QPIA 2CV2A 3SYTA 2K40A 1H19A 1F4KA 3OYBA 4HQMA 4O3MA 2LY1A 3IAS2 2KFDA 4MGRA 5M5WJ 4DYCA 4XMUA 2CO5A 1BIAA 3RASA 5FKOA 4LK0F 1O4XA 3PJRA 1VQKI 5EG0A 1W36C 4AVZA 2QBYA 1HW2A 2V1XA 1YITI 2FSWA 2D1HA 1R6RA 3M7GA 1EH8A 3ROUA 3GZNB 4BQAA 1H9GA 3FTYA 2HQNA 4JX4A 2OD5A 2RC4A 1XN7A 1Y56A 2P5LC 4PW4A 3IAM2 1SD6A 1W7PB 4DBQA 5HS8A 4XN0A 3RKWA 3TP3A 4NQWB 2XKOA 1YFHA 1QNTA 1BR4A 4CGZA 1IXRC 3JAMK 3F72A 3EQLF 4RAYA 5D4SA 1E3OC 3MEXA 1XSDA 4Y13A 1GVJA 3WTXC 2C82A 1R00A 4G6TB 2O7GA 1I27A 1JKQC 3MFKA 1J9IA 2M30A 1WZ2A 4ZQFA 3E6DA 3EUKL 1GVDA 5CVIA 3S1NJ 2MYSA 1HXDA 3E6MA 4EEFG 2HTJA 2H8RA 4BBRJ 3RZOJ 3JRBA 2Y2ZA 2EINH 2VKEA 3LFUA 3VOEA 1PVEA 2QF7A 4KJZA 1ZR2A 1UG2A 3L2CA 3WQQA 3WTWC 1BM9A 3OIPA 3C1DA 2K4JA 4EVIA 5JC1A 2DQMA 1SQMA 3KPHA 3EDPA 2F4OB 3JRIA 1ENHA 5IT9Z 2Y9YA 1FOYA 1W4MA 4J01A 3A0HC 4KDPA 1TWAJ 4CDGA 3P9IA 2NAZA 2EPFA 1O3TA 4WX9A 4FQGA 4A3LJ 2XSJC 4M9XA 3JRCA 4C2TA 2G0EA 4E7IA 3LSTA 2R5ZA 2I5UA 1I39A 1WJAA 2ELKA 2E1CA 1BOBA 3HPHA 4HSRA 1A6IA 4YIRX 2WY8Q 3I54A 1IRZA 1QZZA 2EZHA 1Y39A 1IW7F 1HLVA 3DKYA 1S8NA 2EJRA 3KX2A 2VOPA 4CHUA 4IXAA 3QYEA 3JR9A 4G7OF 3SEQA 1R1UA 2OAZA 4XN3A 4GO1A 2E1OA 2X0LA 1VQ7I 3HHHA 1LVKA 3LSIA 4R5VA 1K83J 1LDJA 3X2QH 5HNHA 1SVLA 3RZDJ 5F04A 2VBYA 2P8TA 1NK3P 2VJ4A 4A6DA 4GXOA 4QMEA 3VB2A 5EEHA 1YRNA 4B09A 1ORKA 4AM3A 2R7SA 2XRNA 2VB6A 2ZJ2A 5FFXA 2EV6A 3HRMA 5IP9J 3KIOA 3GTOJ 2RN7A 4BACA 2QQ9A 2GTQA 3OS1A 1G4DA 1XGNA 2MD0A 2AO9A 5GTIC 3KETA 4ZZDA 2O6GE 1G2HA 4Q48A 1V54H 1FYKA 1T2KA 1XX5A 4BHCA 1BC7C 3ZGKA 3K4CA 5ICFA 2VBXA 3B6CA 3BOQA 3V7RA 2JA5J 3DTIA 5C44J 3CCQI 1LPQA 3IWZA 4BE0A 2PJRB 1D3YA 4KN4X 4AU7A 4ZN6A 4HW0A 3Q0UA 4I0AA 3LFKA 2MC3A 3R61A 3E5UA 5CQGA 1IV8A 1RI7A 3BR5A 4A3BJ 1QU3A 4FLSA 2W7NA 2EIMH 5J47A 1TQIA 4BJ5C 1BC8C 1QVTA 2DYSH 1I1GA 1U6GA 3R6SA 3ZMDA 3QOEA 4UVAA 2Z16A 4L2LA 2ISYA 2DT7B 4BU2A 1K78A 2LYCA 2OCEA 3HZJA 2LKSA 3SZPA 1X4OA 2FOKA 2KPMA 4O5VA 2QCOA 3BWGA 4BH9A 2MAPA 2UXNA 3DTKA 3FXQA 4FTHA 1IGNA 5TGTA 4BQQA 3ZQ7A 2DK5A 2Q0OA 1ZHFA 3HOUJ 3KEYA 2VODA 3LSPA 3G1OA 1EA3A 3ABKH 3PUBA 1BW5A 1QGPA 5J1UA 1LE8B 1JJ8C 1IUFA 3IH4A 1E2XA 1Q1VA 3L2QA 2IS2A 3CCLI 2IEKA 1HSTA 2VASA 2GXAA 6PAXA 2PMHA 3BQZA 3S3NA 3R0JA 1PUFB 4XNDA 4B44A 4RM2A 1IN7A 4E6KG 3WTZA 2MLKA 1F43A 2BY3A 4ZX3A 5CQEA 1B72A 3ZQHA 2LLKA 2VJ8A 4RLQA 4PJMA 2DK8A 5LHIA 1BI2A 5E3MA 3CCEI 3SXYA 2ZKZA 4HX8A 2ZSHB 3S2WA 3TW7A 3FTZA 3CESA 1H9TA 3K2ZA 1PDNC 1QPMA 1Z7UA 4EJWA 1LQ1A 3A02A 2PJPA 1AU7A 3PQKA 3T5XA 3OYLA 2K3FA 4PUSA 2IT0A 2LC2A 1S29A 4KIBA 3TKYA 1KYWA 3ZMZA 3Q9VA 2XIGA 2LVSA 2JCYA 2VKVA 3A1YA 5A2QK 1PUEE 1BI1A 1CGPA 4P9FA 4J00A 4BJTA 1SG7A 1X2MA 1P92A 1Z67A 1YTYA 3HM5A 4JBAA 5M3MJ 4XIDA 4IHXA 2TRTA 1WPKA 3HPGA 5LRSA 2M0MA 2D5VA 1ONPA 5GTHC 1T38A 2CW8A 1QRYA 4HAMA 5GP9A 4HNUA 3HB9A 5HLTA 1TTYA 2DQRA 2TCTA 3JRDA 2JN6A 4FETA 1E3HA 1T39A 2JZYA 4YG2F 3A01A 1J09A 3PO2J 4F93B 1NH3A 2DOEA 3FTXA 4YELA 3K70C 1YX3A 1VQ4I 3PFIA 4N4OB 1KU3A 3IV5A 1UMQA 3CMMA 3NRVA 4XN8A 1W0UA 2HOAA 5GPCA 2PLYA 3B73A 4V2FA 3KCCA 3L1PA 3WQSB 3G4SI 2R7TA 1OCTC 4LG0B 1ON1A 3FUFA 3FXOA 4BDYA 1G3SA 1JT6A 1SFEA 2VQHA 3VYRB 1YJNI 1HS6A 4AD9A 3OMYA 1EH6A 4Y6RA 4I76A 2ZJQF 3S3OA 2F4MB 2HZDA 4PSWA 4CICA 2R7UA 1TNTA 3LSJA 4DZPA 3CDHA 1SANA 1XGMA 2LKXA 3FU3A 4U7DA 5LLQA 1EV7A 1IRGA 2H6CA 1I6HJ 3VPRA 2LH9A 3GX4X 1HKSA 3A4CA 3BG9A 4XSXF 5F6FA 3W2AA 9ANTA 1HDDC 2V7FA 3HIFA 4DGWB 3RQ4A 4PZJA 4LMYA 2HZTA 2DMQA 2IS1A 1VNDA 4CCJA 4A5MA 1V5GA 3GW2A 2XASA 3KE2A 3CUQA 4PFOA 3FHZA 1X4PA 3N97A 1E3PA 3S2HJ 1ZAOA 2FJ1A 1W7PD 2DFHA 1NG7A 2KP6A 1KYZA 2UWMA 2GM4A 1TT0A 4M3FA 2DW4A 1ETVA 1UHMA 1YIOA 2BXYA 3KEDA 4LITA 1JTYA 3I9V2 1ON2A 4XOTA 3NEUA 1LB2A 2Q2EA 4RM3A 5CVUA 1A35A 2LG4A 2E34A 2LY2A 5LGUA 1JKOC 2IGOA 1Y8RB 1KU9A 2V1DA 3B7UX 2KJBA 2H94A 3VEPA 5HDKA 3UR3C 4BNCA 4BGDA 1B9MA 4B47A 4FLRA 4PJ0C 4X2UA 5DCMA 1IDZA 1Y1VJ 3BPXA 3RIRA 1DQUA 4WXCA 2WV1A 2V6EA 4A2UA 1U0JA 2A61A 2LNBA 4UUSB 3W2VA 2ACJA 2VUMJ 1JTXA 3LQRA 3ZXSA 1TBXA 4RA2A 3MZ8A 4ANJA 1NHAA 2PMZN 3I55I 3PSIA 4IOCF 1MNMC 3VYTB 3DEEA 3IKTA 2QJ1A
chains in the Genus database with same CATH topology
4XMXA 4XM3A 2CV0A 2RJIA 4Y6SA 1SAUA 3ONQA 3MD2A 4II2A 3QJXA 5DULA 4AYSA 3PSFA 4N4NB 4PU2A 4XMZA 3IP4B 4H4KC 4OOFA 3FUNA 3Q43A 3OL4A 1D0YA 1MMAA 2E60A 2M3AA 1AA7A 3F9KA 1G5AA 1YE9A 2VKDA 3B2PA 3CHSA 3E1SA 4ZW3A 4BE1A 4PJJA 2R59A 2HNHA 5FWQA 3NWSA 2WAFA 3VSKA 2IS4A 3ZR8X 2M4KA 1Q0LA 4FLRA 4QPQA 1VZ0A 1WFXA 3H5RA 4F3QA 3OYGA 4ZDPA 4ZW7A 4LUPA 4JOMA 1X3WA 3H9GA 3HKZA 4CUGA 2BW3B 2HPIA 4Q4IA 3BCBA 4CA0A 1Y6IA 3HOTA 4PJNA 2RQQA 3OYCA 3LMMA 4XQFA 4CH7A 2WY7Q 1ONOA 3BCAA 1ERDA 1T95A 2K9LA 3B3BA 2VJJA 1JVSA 2W00A 1T0FC 4GAAA 3H0DA 3UCQA 2PJRA 4QUOA 4XMWA 2Y1EA 4XMYA 3VVLA 3RC8A 3CP2A 1WJCA 2VXDA 1H3LA 2AQFA 3QODA 2XF6A 4CZCA 2P0WA 2X6XA 3HC7A 4II3A 4ZQGA 3CZLA 2GOXB 5EV7A 2VIXA 1YX5A 4NUBA 3VVMA 3S3MA 2VQCA 2R7OA 5JAZA 4QIRA 1G8XA 4XNFA 2R70A 3C2GA 2WBMA 2DQ6A 4K5NA 4RCVA 1D0ZA 4KITB 1Q0HA 4ARFA 3OYNA 4J3BA 1X1CA 1Z7LA 2V4JC 3BC8A 3H35A 3K4NA 2R72A 2QKMB 3FTUA 4HPQA 1G59A 5KCMA 3FTVA 1LDKB 2HVQA 3PUUA 2L9NA 1DGWY 4X0GA 3DQVC 2W4SA 4KP7A 4CCNA 2VXZA 3OYKA 2KRCA 4JQFA 1HA8A 4ZTFA 5AENA 4PSXA 4PK4A 4Y4RA 2V1NA 3DPTA 2W82A 3K4BA 2R4GA 3HXLA 4AR8A 1X1AA 2WADA 3BG7A 4EATA 3B37A 2DCEA 2RNGA 4NC8A 2ZSIB 3GBGA 3G2BA 1MMDA 1N75A 3H5NA 4NC7A 3B7RL 4XNBA 2IGKA 1MVYA 2K3PA 3HG9A 3W3CA 3D5RC 2VJIA 4ZDLA 4F52A 2CV2A 3FHEA 3Q44A 4ZW8A 3SYTA 1H19A 3OYBA 3H5AA 3CZEA 2KRHA 2LBFA 2LY1A 3IAS2 3UEQA 3A14A 5KNLA 2Y1DA 4XMUA 3RASA 3NWTA 4ZW5A 3CHOA 3AFHA 5JBIA 5CKTA 3PJRA 5DYFA 4MLOA 4OAYA 3FULA 4FLQA 2LOOA 4OWRB 4XLHA 1W36C 1PYVA 4AVZA 3K70D 3FTWA 5LFAA 3OS0A 3FUMA 3DTEA 4HNTA 3L2VA 1S46A 3T8VA 1QHHD 2Y1FA 4XLCA 1R6RA 2MC4A 2JD0A 4ZQTA 3RSNA 2ELJA 3FTYA 2R7QA 2A6TA 1JG9A 3UERA 5CPRB 1P9QC 3DKXA 1Y56A 2XF5A 1MW7A 4XLEA 4E7JA 4ZYAA 3T0YA 3ZHXA 4PW4A 3IAM2 1FMWA 2Z2SB 4XLFA 4DBQA 1E0EA 4XN0A 4RMNA 4NQWB 2CV1A 1BR4A 5BPPA 4XN1A 4IX7A 2JCXA 5JHFA 1DP3A 3ZI0A 2L7KA 2OV7A 2JCVA 2BW3A 2KZVA 3AL0C 2C82A 4XO3A 2O7GA 4G6TB 3LSKA 4PVBA 4GRIA 4E4HA 1MNEA 4XR6A 4XOPA 2JSPA 2B61A 4ZQEA 4DIQA 4ZQFA 3EUKL 3OYAA 1K5HA 2ZXIA 2PL5A 2MYSA 3SEZA 4JNDA 3LFUA 1SFKA 2XPYA 1D1CA 1R0LA 5KHDA 4C2UA 4KJZA 2DXIA 3PNYA 4B3XA 3OYJA 4DPRA 2CMPA 4B48A 3WQQA 4F92B 2XPZA 3OIPA 2BVLA 1N78A 2KL4A 2F4IA 4BXFA 1JI8A 5JC1A 2DQMA 1SQMA 1LFPA 3OWTA 4Q4EA 2BOLA 3FBNB 2X6YA 3CIAA 2L2OA 3BG6A 4BE2A 2ZFUA 3QYBA 2HPOA 3FH7A 1MW3A 1WJEA 3TMOA 4XN2A 3K10A 4J01A 2JD2A 4BUPA 2BVMA 1T1SA 4R7LA 1X1BA 4K5OA 2JD1A 3HUGB 1FMVA 2JA2A 4Y67A 5HNFA 2I8DA 3PL8A 2E1MB 2XSJC 3SDBA 2R7XA 4XO4A 2VLAA 3EBHA 4C2TA 2DT6A 4BEHB 4E7IA 3FH5A 3ANLA 1WJAA 3I3LA 5LD2C 1BOBA 3RCOA 2MABA 3N05A 4BKXA 2Q1ZB 3HPHA 4HSRA 4XORA 2WY8Q 2FFLA 3K4MA 3OIQA 3OR1C 4XKVA 3DKYA 2UUZA 3KX2A 2A5WA 3M1CA 3L2RA 2WPGA 1MMGA 5JMPA 3DU5A 4K5MA 3QYEA 3TBIA 4F91B 4HRIA 3SEQA 2M7AA 4XN3A 3E0JB 3ANNA 4FASD 1OR7A 3FHNA 2X6WA 3EBIA 1LVKA 3LSIA 4C30A 4R5VA 4U87A 4ZC3A 3EPZA 5HNHA 2Y1GA 3U21A 3OR2C 2FUG2 2VJ4A 4LG3A 4QMEA 3AL0B 3FUHA 4XN5A 4K5LA 3TL4X 2XC7A 3FU5A 4RSYA 2DJIA 2R7SA 3FBIB 2VB6A 4PJLA 2WA0A 2CUJA 4BACA 2HQAA 2GTQA 1MW1A 3D5SC 3OS1A 2M7BA 2MD0A 2WZGA 3FUJA 4XN4A 2LRDA 3CJQB 3R0IA 2JUGA 4CCMA 3DU6A 4XMVA 1D1BA 4MKTA 1WJFA 2VPLA 2VQLA 3K4CA 4XLAA 3ZGKA 4LIUA 2CW7A 4F55A 2Z1DA 3A06A 3JSZA 3DTIA 3OYEA 1GLNA 4E7ZA 1UG0A 4YEJA 2O5RA 4BE0A 2PJRB 4AU7A 3CJRB 4ZN6A 3OL3A 2OC6A 1T1RA 1X19A 2L9SA 2OUMA 2KHMA 4RLFA 5CQGA 4C9YA 3FUDA 1QU3A 4FLSA 2DOAA 2XAUA 2W7NA 1Z3XA 4R79A 2PMZA 3U9WA 2C5ZA 4BJ5C 2UV1A 3L2WA 3EBGA 4BDZA 3RTRA 4XNAA 3QOEA 1MNDA 2K9MA 3CZ6A 3ZHZA 2Z16A 1Q0QA 3IUOA 4L2LA 3ANMA 2XF7A 3MKYB 2MAOA 2DT7B 2MFZA 3FDYA 4BU2A 2LYCA 4OOEA 2QKLB 1X4OA 4ZX4A 2IS6A 4P5OA 3ZQQA 2HPTA 2KPMA 4FCAA 4K5PA 1WJDA 2WAQA 2MAPA 3BLYA 3DTKA 5FRMA 4GAEA 2WB1A 4XMTA 5TGTA 3J7AY 4BQQA 3LSMA 4Y6PA 3KEYA 2JV7A 4HG2A 4KT6A 4Y3OA 1JGIA 4ZX5A 2E5NA 1EA3A 4XN7A 2VJ5A 3PUBA 2F5VA 4XN9A 3OS2A 3L2QA 3M8JA 3ZRGA 3PNVA 1ZELA 2IS2A 4BEHA 4AICA 1BR1A 4XKBA 2VASA 4OAZA 4Y33A 4QPEA 3SZGA 2E5ZA 3S3NA 3FUEA 4XNDA 4B44A 4RM2A 2IXSA 2KQRA 4DJAA 4E6KG 4ZX3A 3VYSB 5CQEA 2VJ8A 1W36D 4RLQA 1RP3A 3W2WA 4PJMA 4A03A 1IRXA 1ONNA 2R7VA 4XO5A 3K6GA 3MMYB 3OY9A 3V42A 2M4GA 3FU0A 1ZS2A 2ZSHB 3FH8A 4XKWA 3FTZA 2Q2EB 3CESA 4HSTA 2QVWA 4IQ4A 1X3ZA 3KYLA 3C2HA 2Y1CA 3AUAA 3ZCOA 4IZZA 4ZDOA 3OYLA 2Y0SA 4PUSA 2LC2A 4BS9A 2A7OA 1MW2A 4IQJA 4E7HA 1QHGA 2ZXGA 3UNGC 1OR7C 3EUAA 5HVQC 2W1OA 3VDXA 4E7LA 2JCYA 2CS3A 3A1YA 3B7SA 4KISA 3LSHA 4CCOA 3L2UA 3AU9A 4J00A 3VYUB 3S93A 4BJTA 4CSWA 1SG7A 3CZGA 5DLLA 3HPGA 1ONPA 2M0MA 1Z21A 1N77A 1K6YA 2EGHA 2CW8A 2X1EA 4HNUA 3DPLC 4NNJA 5HLTA 1UAAA 4XONA 3CHPA 3EUHC 4MS6A 4ITVA 4FETA 1DGRM 4XKCA 4ZQHA 1V5FA 4P1WA 2HVSA 4FLOA 3RC3A 1OLTA 3K4LA 3CZKA 4D9JA 2F6CA 2X85A 1MW0A 2IGMA 2V26A 4ZJZA 1J09A 3AU8A 3VSLA 4F93B 3FTXA 4YELA 2X1CA 3K70C 2VKHA 2PUSA 1YX3A 2CH0A 3CHQA 4E7KA 4N4OB 2V9KA 3CMMA 1R0KA 2RREA 3CP8A 2CFOA 4XN8A 2KLOA 3WQRA 3HOSA 1MMNA 5FRNA 4XL9A 2KDOA 3WQSB 4AYBA 2R7TA 3D5LA 3OYFA 3FUFA 4BDYA 2LREA 2ZXHA 4LIVA 2VQHA 3S32A 3VYRB 1HS6A 2JVGA 4QPOA 4NQWA 3OMYA 4Y6RA 3H9JA 1Z3YA 3FUIA 1BR2A 3PFYA 3S3OA 4DOZA 2R7RA 3DWLE 2HZDA 1GW6A 2XQ0A 4PSWA 3S8PA 3RPUD 2R7UA 4B43A 3OYMA 3CHRA 1LKXA 4E7SA 3OYDA 3FU3A 1WJ5A 2HVRA 4CCLA 4DBRA 2VQGA 5JNLA 5FROA 4ZX6A 2HPMA 2LH9A 4BQNA 3A4CA 4AR1A 3W2AA 4IKFA 2CUZA 3CF2A 2V7FA 2VL8A 3FTSA 4DGWB 2HDWA 3RQ4A 4U7BA 3FKJA 3K4JA 3ZHYA 2IGNA 3LL7A 5JO0A 4RVBA 3FU6A 2IS1A 4CCJA 4AR9A 3FUKA 3OYHA 1V5GA 4PFOA 3MKZA 3B7TA 2L5QA 1X4PA 4R5TA 4HEA2 5JMWA 2NOJB 3HL2A 1WJBA 2E1MC 3AKZA 2PGGA 1NG7A 1V5EA 2KP6A 2X1DA 1NG6A 3OOUA 2X51A 1TT0A 2HU9A 2UWMA 2JVHA 3DPUA 3KEDA 4CXFA 2WAEA 4LITA 2AQEA 4R5XA 3I9V2 3B2XA 2KMUA 4XOTA 4D1QA 3LSGA 4RM3A 2XDVA 3OYIA 2LG4A 2LY2A 4ZW6A 2IGOA 3B7UX 1KONA 2K5CA 3QYFA 4BQOA 1S9HA 3UR3C 4BGDA 4B47A 2WZFA 4X2UA 1PJRA 2R7WA 4BL0B 2GOMA 1DQUA 2V6EA 4QHPA 3JT1A 4PFPA 1SC5A 1U0JA 3PNTA 1D1AA 3IIEA 3W2VA 3K4KA 1X1DA 1D0XA 3ZXSA 3H9QA 5HOOA 3MKWB 4YRVA 4ANJA 3DLAA 2LBFB 4CCKA 1TZLA 4BJ6C 1UELB 3PSIA 3VYTB 3VWBA 3B34A 3A2KA 3DEEA 4ZTJA 2QJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNF A;  2VLA A;  5HNH A;  5HLT A; 
#chains in the Genus database with same CATH topology
 4Z6Y A;  3HOZ J;  1YS6 A;  1SAU A;  1JJ6 C;  2PBI A;  3FXR A;  3QJX A;  5DUL A;  3PSF A;  4TV7 A;  2FNA A;  4A3D J;  3IP4 B;  3J80 Z;  4ZZL A;  4QIW N;  3Q43 A;  4B4C A;  2H1K A;  1D0Y A;  2X4H A;  1IUY A;  2NXN B;  4HQE A;  3I4M J;  3DBR B;  4ZW3 A;  1VQ8 I;  1OMI A;  1R23 A;  1RC9 A;  2M2E A;  2XV4 S;  2AS5 F;  2WAF A;  1VQL I;  5L3G A;  3E5X A;  4G6Q A;  4X6A J;  3BR1 A;  3TP0 A;  4AIJ A;  2XGD A;  1X3W A;  4HLX A;  2BW3 B;  1BL0 A;  3BCB A;  2JK3 A;  2M87 A;  3U1D A;  5J8C A;  2QZ8 A;  1B1B A;  2RQQ A;  2OJE D;  3I59 A;  2VT3 A;  3WOD F;  3G71 I;  2WY7 Q;  4EJU A;  2OZ6 A;  1S7O A;  2K9L A;  4GAA A;  1JVS A;  2HGC A;  3QQA A;  4L0Y B;  4QUO A;  1Q1H A;  4UXN A;  3KEO A;  3VVL A;  3CP2 A;  1SD4 A;  1D8K A;  3ECO A;  3LAP A;  4A93 J;  2XF6 A;  3TOB A;  4CYC B;  2DDB A;  5EYR A;  4DQ2 A;  2Z33 A;  2EIK H;  3LWF A;  2VIX A;  3P5J A;  4M3D A;  3S3M A;  3HSE A;  4QIR A;  1OQY A;  2Z5U A;  1X58 A;  4XNF A;  2R70 A;  3IRQ A;  3H3V K;  2WBM A;  3UKG A;  5CLS A;  4RCV A;  3V8L A;  1TWF J;  4LLG F;  1X1C A;  1Z7L A;  3H35 A;  3K4N A;  2R72 A;  2ELH A;  3FTU A;  1OCO H;  2HYG D;  2HVQ A;  3PUU A;  4Q4Z F;  3BQY A;  4KP7 A;  1EF4 A;  1A36 A;  2PEX A;  3ZPL A;  2G9W A;  2KRC A;  5J1Y A;  3HTU A;  2H09 A;  5FJ8 J;  2HOT A;  4Y4R A;  1RUO A;  4G7Z F;  5KAI C;  2NVY J;  3K4B A;  3F6O A;  5L3F A;  2JSC A;  4RB0 A;  2XAJ A;  3MQ0 A;  2ZME B;  4AR8 A;  2EWN A;  3BR3 A;  2DOF A;  2RNG A;  2ISZ A;  2W24 A;  2ZSI B;  5FLX K;  3CCY A;  1YQA A;  1UFM A;  2Q8K A;  3D5R C;  3Q44 A;  4XSZ F;  1ZGW A;  3ZP5 A;  2P81 A;  1ETX A;  2LBF A;  1R71 A;  3A14 A;  1XSV A;  2Y1D A;  1NK2 P;  4ZW5 A;  1AKH A;  3QU6 A;  3AFH A;  5JBI A;  5CKT A;  1B6A A;  2L7M P;  3G3Z A;  3W6K B;  3FUL A;  4FX4 A;  4OWR B;  2O03 A;  4M74 A;  1PYV A;  3KP5 A;  1I5Z A;  2ETH A;  2DU9 A;  2O7O A;  2YSR A;  2EA4 A;  3AAF A;  3OS0 A;  4IRI A;  3L2V A;  3WU2 C;  3T8V A;  2CQN A;  1ZTR A;  4XLC A;  2MC4 A;  3JCU C;  4ZQT A;  4A3K J;  3BJ6 A;  3RSN A;  5FKN A;  4KIC A;  2A6T A;  2CWE A;  1JG9 A;  1ZN2 A;  1S3J A;  1A04 A;  5CPR B;  3F23 A;  1R5G A;  4UVB A;  2MGQ A;  2Z2S B;  2FU4 A;  3LA2 A;  2IA0 A;  3H3U A;  2A6E F;  2FF4 A;  2VN2 A;  2QLZ A;  4RMN A;  4UUT A;  2CV1 A;  2FBK A;  3HJE A;  2YU9 J;  3JSO A;  4XN1 A;  3BY6 A;  2K27 A;  5K1Y A;  2OV7 A;  2JCV A;  1BBY A;  4XO3 A;  4PVB A;  3SQN A;  2PQ8 A;  4XR6 A;  2JSP A;  4ZQE A;  4DIQ A;  2COB A;  1VI0 A;  3ERM A;  4D7M A;  1CF7 B;  3OSG A;  2Z99 A;  2DQL A;  4ENN A;  5K7H A;  3WU1 B;  2EFP A;  1YW8 A;  5DS9 A;  1MKM A;  2KDZ A;  2AHQ A;  1GXQ A;  1DU0 A;  2XPY A;  2K4B A;  3QPL A;  5KHD A;  3J81 Z;  4ENJ A;  4C2U A;  4NBQ A;  3PNY A;  4B3X A;  3OYJ A;  4I2O A;  1GV5 A;  2CMP A;  3HRU A;  2M0C A;  2PN6 A;  1IAW A;  3HEF A;  1S7A A;  4XRS A;  1WH7 A;  4JK1 X;  3J7Z I;  2ZC2 A;  2F4I A;  5F0F A;  2QA4 I;  1FOK A;  2NS8 A;  1LFP A;  4Q4E A;  1ZH5 A;  2BOL A;  3FBN B;  1WGX A;  3CIA A;  3D0S A;  3BG6 A;  2PMU A;  1MMS A;  2ZFU A;  3Q3S A;  3QYB A;  4RGS A;  2R0Q C;  1WJE A;  2XSD C;  4LB5 A;  3K10 A;  1ZK8 A;  1H89 C;  2JD2 A;  2WV0 A;  1ZYR F;  2W57 A;  2JD1 A;  1IXS B;  3HUG B;  4N0B A;  1W0T A;  1HBX G;  2JA2 A;  4Y67 A;  2ECC A;  2E1M B;  4LFU A;  3SDB A;  1HW5 A;  1X2N A;  1TWC J;  2DT6 A;  2VE8 A;  1A5J A;  3QU3 A;  5BPD A;  1PP7 U;  3FH5 A;  2Y48 A;  5LD2 C;  2QWW A;  3GF2 A;  2MAB A;  3L9F A;  3RCO A;  2Q1Z B;  4BKX A;  2BY2 A;  2FFL A;  1M1E B;  2GIV A;  3K4M A;  4IF4 A;  2JRM A;  4ON0 A;  2QUF A;  3OIQ A;  4HX4 A;  1IG7 A;  5CVV A;  4AIH A;  5EGO B;  3L2R A;  2WPG A;  3F6V A;  5JMP A;  3DU5 A;  4DW6 A;  4FCY A;  1R4M B;  4R1H A;  3F0C A;  1FSE A;  4RGU A;  1MJB A;  2Y9Z A;  4UV8 A;  2CQK A;  1R5H A;  4C3J J;  2JMW A;  4RGX A;  3DBL B;  3GME A;  5TJJ A;  3JSP A;  3ZQC A;  2QSH X;  3OR2 C;  4M9Z A;  1ETW A;  3AL0 B;  1DUX C;  2M8G X;  2IW5 A;  2XC7 A;  1K7A A;  5F0C A;  3L00 A;  2LF8 A;  3IH2 A;  4B3A A;  2DPU A;  4WWC A;  2WA0 A;  1ZG3 A;  4EQQ A;  4L9J A;  3D5S C;  2QVO A;  3BG3 A;  1W7P A;  3AG4 H;  3DP7 A;  2LRD A;  3R0I A;  2V6C A;  4QLC U;  2JUG A;  1D1B A;  2M34 A;  3KFW X;  2VQL A;  4KA4 A;  4XLA A;  1ZGJ A;  3NAR A;  4F55 A;  2Z1D A;  1GDT A;  3FMQ A;  3ZMT A;  1LDD A;  1Z05 A;  4E7Z A;  1ZQ3 P;  2DLL A;  4LGW A;  2DDA A;  1REP C;  3TED A;  3KZI C;  2L9S A;  4WXD A;  2OUM A;  2DOA A;  2XAU A;  1Z3X A;  2OQG A;  2PG4 A;  2PMZ A;  1U5T C;  4EMS A;  2C5Z A;  1FZP B;  3EBG A;  2E2I J;  1F9N A;  4L9V A;  1OIS A;  2CQQ A;  1MGT A;  2VC1 A;  4C3H J;  3ZHZ A;  1BN5 A;  2K9M A;  4IRG A;  3W6J B;  2BYV E;  1Q0Q A;  3ANM A;  4UNO A;  3FM5 A;  2MFZ A;  5D6E A;  3FDY A;  1F5T A;  3FX3 A;  1W5C C;  2BY0 A;  2QKL B;  1Z1D A;  2KT0 A;  3ZQQ A;  1S7E A;  3BR2 A;  1TLH B;  2DO7 A;  2WTE A;  2VON A;  1MBK A;  2OQR A;  5HLI A;  3ZN0 A;  3J7A Y;  5E1W A;  1GXP A;  4BY7 J;  3GUD A;  3LSM A;  4Y6P A;  4HG2 A;  5AIQ A;  5IT9 K;  2YUS A;  5LRR A;  4A3F J;  1SD7 A;  3I64 A;  3K0L A;  4Y3O A;  1VFC A;  3WG7 H;  1FYL A;  1ZRE A;  2E5N A;  1F1Z A;  1JUS A;  1Z91 A;  4KN7 X;  4IHW A;  2IVM A;  2F5V A;  1BI0 A;  3TDU C;  4XN9 A;  4UB8 C;  4XKB A;  4YIF A;  4Y33 A;  3ASN H;  4JX5 A;  1QVU A;  3FUE A;  2NVX J;  3HYI A;  1U3E M;  2LD5 A;  1IN6 A;  2RGV A;  1BW6 A;  2KQR A;  5K7Z A;  1YIJ I;  3VYS B;  1KA8 A;  2NVT J;  2ID3 A;  2F5F A;  2DA1 A;  1W36 D;  1RP3 A;  4A03 A;  5JR3 A;  2ZME C;  4LOC A;  2R7V A;  2DFE A;  1MJ9 A;  1MIJ A;  1GV2 A;  1I6X A;  1FIA A;  2CFX A;  2ZNZ A;  1HC8 A;  1X3Z A;  3C2H A;  1WI3 A;  3CCS I;  3CQZ J;  1DP7 P;  3F8F A;  3O2P E;  4JX6 A;  2K86 A;  4AC0 A;  4IQJ A;  3KZZ A;  4E7H A;  1QHG A;  2QEX I;  1OR7 C;  3EUA A;  5BOX A;  5HVQ C;  1YJ9 I;  2W1O A;  3VDX A;  3BRO A;  3BDD A;  3GFI A;  3GTJ J;  3HRT A;  4E7L A;  1ZAR A;  4KIS A;  4CCO A;  5LGT A;  1QZY A;  3L2U A;  2H8W A;  4CSW A;  2E1N A;  3JRG A;  4B1R A;  3CZG A;  2OF7 A;  2JTV A;  5D5U B;  1KQ9 A;  5E1Z B;  1K6O A;  5CJ9 A;  2FQ4 A;  2HXO A;  2COM A;  2EGH A;  5DCF A;  4XON A;  4MS6 A;  3EUH C;  2A69 F;  4XKC A;  4O6J A;  3SFI A;  3T8R A;  1V5F A;  4P1W A;  4ZQH A;  3CZK A;  4EJT A;  5L3E A;  4D9J A;  2F6C A;  4RB2 C;  3WTS C;  5BMZ A;  2IGM A;  2Y69 H;  4RAG A;  1MW0 A;  2KIM A;  2QSF X;  2C6Y A;  5J1R A;  1IJW C;  5IT3 A;  2CH0 A;  3CHQ A;  2BGC A;  5F1J A;  4E7K A;  4MTD A;  2CFO A;  3M8F A;  3WQR A;  4D0P A;  1MMN A;  5FRN A;  3GCM A;  2KDO A;  3EYI A;  2M1B A;  2P5K A;  3IHU A;  4EGY A;  2LRE A;  2HWV A;  3O6B B;  4QPO A;  1HF0 A;  4MEY F;  3GLX A;  3DKW A;  3H9J A;  5K5R A;  2MH9 A;  3PFY A;  4DOZ A;  1GW6 A;  5ICE A;  1T33 A;  3RPU D;  4RS8 A;  3OYM A;  3OYD A;  2XAQ A;  4W1U A;  1WJ5 A;  3PIO F;  4FE4 A;  4CCL A;  4DBR A;  5K7F A;  1Z77 A;  2GXG A;  2R5Z B;  5JNL A;  5ERI A;  1LNW A;  4BQN A;  2PX9 A;  2HS5 A;  4OU0 A;  1LE8 A;  2JA7 J;  2CUZ A;  3WU0 A;  1L3L A;  1AWC A;  2FML A;  2K02 A;  2VL8 A;  5KVR A;  4M3B A;  3FTS A;  4U7B A;  3FKJ A;  3K4J A;  5JVT A;  2IGN A;  3BR0 A;  4KNY A;  5JO0 A;  3FU6 A;  1EKE A;  4OIP F;  4AR9 A;  3FUK A;  3OYH A;  2OCC H;  4JYK A;  1PUF A;  3B7T A;  2L5Q A;  5DM7 F;  5TRD A;  2OA4 A;  5IYB J;  3TGN A;  2NOJ B;  1WJB A;  2E1M C;  2PGG A;  2X1D A;  1V5E A;  1WWX A;  1XMA A;  3OOU A;  2X51 A;  1FSH A;  2VOO A;  2KKO A;  3DPU A;  4CXF A;  1Z6R A;  1VQM I;  4Q47 A;  4R5X A;  5TIS C;  1XGO A;  3R60 A;  2KMU A;  1O3R A;  3CC4 I;  4N9H A;  3GZ6 A;  5LHG A;  1YRN B;  1IN5 A;  3MZY A;  2E2H J;  4MQV A;  2N8G A;  5M3F J;  2EB7 A;  3QYF A;  1S9H A;  1ZRF A;  2A05 A;  1TWG J;  2WZF A;  1ITY A;  2A6H F;  3FXM A;  3MAJ A;  4AID A;  3QOP A;  4QHP A;  4PFP A;  3IIE A;  1D1A A;  3HGG A;  1NTC A;  4RGR A;  5HOO A;  1D0X A;  4UY8 I;  3MKW B;  1P6R A;  4M72 A;  2HYJ A;  3QRF F;  2WWY A;  4RB1 A;  2JPC A;  4BJ6 C;  4AWX B;  4P55 A;  3A2K A;  4ZTJ A;  1QO0 D;  5FGM A;  4OIO F;  2RJI A;  2RQP A;  3CJT B;  3FXJ A;  3MD2 A;  3ONQ A;  3M1E A;  3P7N A;  2JJ7 A;  1CQT A;  1MSF C;  3NAU A;  4ZYG A;  3CO7 C;  2HDC A;  1FC3 A;  4ABZ A;  5EEG A;  1TT5 B;  3BZK A;  1MMA A;  5K5Q A;  5E18 F;  2E60 A;  3MZH A;  2WB1 N;  2PI0 A;  3S1M J;  3CHS A;  2LR8 A;  3JTH A;  1BJA A;  4BE1 A;  4QWQ A;  2HNH A;  5FWQ A;  2P6S A;  5J4Y A;  2IS4 A;  5F1R A;  4C2M J;  2EBI A;  4A3J J;  2ADU A;  1W1W E;  1FIP A;  2W48 A;  2Z3Y A;  3CUO A;  3QP6 A;  1WFX A;  4MIM A;  4LG0 A;  4ESF A;  4F3Q A;  4ZDP A;  2K7L A;  3K1P A;  1WSU A;  2CG4 A;  3TO6 A;  3BJA A;  3TOA A;  2NRA C;  4PJN A;  1O3S A;  4XBF A;  1ONO A;  1ETY A;  4F7Z A;  1T95 A;  3MN2 A;  5FFZ A;  2VJJ A;  2XGC A;  1T0F C;  2OPT A;  4A3C J;  5DYM A;  3DCF A;  2EFQ A;  2ICW G;  2VXD A;  4BBS J;  4LD5 A;  3QOD A;  4CZC A;  2P0W A;  1BJZ A;  3CZL A;  4QSH A;  2VQC A;  2I10 A;  2R7O A;  2Y30 A;  4MFE A;  2HXI A;  1H8A C;  4AVP A;  5K5O A;  3SHF A;  3PUF A;  3WHC A;  2DQ6 A;  4K5N A;  2Y0S N;  1D0Z A;  4ARF A;  1Q0H A;  3AG2 H;  2B7E A;  4AUX A;  1A31 A;  2JUC A;  3DFG A;  4X0G A;  1OYI A;  1POG A;  4BXU A;  1MBE A;  2VXZ A;  2O3F A;  4JQF A;  5LEK A;  1VQP I;  1HA8 A;  1I50 J;  3DBH B;  5E79 C;  1AOY A;  1MJA A;  2EZK A;  2V1N A;  2W82 A;  3GTM J;  2R4G A;  5LHH A;  4LB6 B;  1X1A A;  3ZOB A;  5ILS A;  2HYF A;  3WTT C;  3G2B A;  5EZG A;  1C0W A;  1IC8 A;  2DFF A;  3N4M A;  1R1T A;  2DN0 A;  2PFB A;  2VJI A;  3FHE A;  1JHF A;  3GTK J;  2FE3 A;  2DTR A;  5JLX A;  1UJ8 A;  4FX0 A;  3V7C A;  2HFH A;  4G7H F;  5D5V B;  3ABL H;  4L9N A;  2XAG A;  5E3O A;  4CO8 A;  5JI6 A;  3GXO A;  4MLO A;  3D1N I;  5DYF A;  1KQ0 A;  2FMY A;  4XLH A;  5ICG A;  3K70 D;  4AYB N;  1JUM A;  2E36 A;  3FTW A;  4M6Y A;  5LFA A;  4KT5 C;  2FRH A;  5HLG A;  3DTE A;  1S46 A;  4HA8 A;  1QHH D;  1BIB A;  3IH3 A;  2JD0 A;  3TDZ C;  3J80 K;  1H88 C;  2R7Q A;  2VC0 A;  3ZN1 A;  2XHK A;  3BP8 A;  1P9Q C;  3V4G A;  1RKW A;  2XF5 A;  1MW7 A;  3AG3 H;  4XLE A;  3K2A A;  3T0Y A;  1AHD P;  4XLF A;  4IJA A;  1E0E A;  5J4V A;  3A03 A;  1R4N B;  3I53 A;  4A6E A;  1U5T A;  2RAE A;  4A3G J;  1FYM A;  1ZRC A;  2DMT A;  5E3L A;  4U0W A;  2JCX A;  2O8K A;  5JHF A;  3ZI0 A;  3PQJ A;  4BAY A;  2L7K A;  2QQB A;  2BW3 A;  1TW2 A;  1RR7 A;  2DFI A;  5F27 A;  5FKK A;  4E4H A;  2DBB A;  3IC7 A;  5IY5 H;  2NVQ J;  2KRF A;  4XOP A;  1Y0N A;  3OYA A;  2ZXI A;  2PL5 A;  3MKL A;  1FBU A;  5BS6 A;  1IO2 A;  4A0Y A;  1R36 A;  1STZ A;  1GT0 C;  4XLN F;  3ASO H;  1HCR A;  4JND A;  1FY7 A;  2BE5 F;  2G7U A;  5KAF C;  3ESW B;  5FLM J;  1D8J A;  1HDP A;  1R0L A;  5J6X A;  2M45 A;  2DA5 A;  1R1V A;  4B48 A;  1SFO J;  4F92 B;  3RPQ A;  1HQC A;  3H92 A;  3QP5 A;  2KL4 A;  1JI8 A;  4EM2 A;  3ABT A;  3DEU A;  3OWT A;  3RYP A;  4G94 A;  2MSY A;  4DYR A;  2X6Y A;  1UB9 A;  2L7F P;  1OYW A;  4I99 C;  4ESB A;  4BE2 A;  1APL C;  4EJO A;  5B5E C;  1RIO H;  2O0Y A;  2E7X A;  5FKM A;  5M5X J;  2UXX A;  1MW3 A;  2HPO A;  2B0L A;  3E97 A;  3I58 A;  1KGS A;  4BY1 J;  4XN2 A;  2BVM A;  1T1S A;  2EV0 A;  4R7L A;  2DT5 A;  1X1B A;  1EJ9 A;  4K5O A;  1FMV A;  3QAH A;  4CZZ A;  3S16 J;  1B9N A;  1MDM A;  5HNF A;  2AXL A;  2I8D A;  5DCM B;  1SC7 A;  2R7X A;  2GA1 A;  4XO4 A;  2VLA A;  3EBH A;  5B3S H;  2O61 A;  4XRS G;  4HX7 A;  4BEH B;  3ANL A;  1MBH A;  2KIU A;  1RRJ A;  2KIS A;  1Y1W J;  2EA2 A;  2X6O A;  4XKV A;  1TQP A;  1OCP A;  1Z0X A;  2BHZ A;  4IHS A;  4V2G A;  1B8I B;  1MMG A;  2FEZ A;  4F91 B;  1LEB A;  3T8T A;  2M7A A;  2A5Y B;  3ANN A;  3QWL A;  1FX7 A;  1OR7 A;  3RPU A;  4L5E A;  3FHN A;  3EBI A;  5ILV A;  4XIC A;  2FA5 A;  1ZLJ A;  4C30 A;  1WHU A;  4ZC3 A;  4EM0 B;  2CYY A;  3U21 A;  1MBJ A;  2FUG 2;  2M8E A;  4LG3 A;  2NVU B;  3RI4 A;  3CMY A;  1I3Q J;  1OCZ H;  1YO5 C;  4K5L A;  4XN5 A;  3HKZ N;  3H36 A;  3FU5 A;  2O9L A;  5GAE J;  2JT1 A;  3FBI B;  3KEQ A;  3EUH A;  4HF2 A;  4KIF A;  1FP2 A;  1T56 A;  3FWE A;  5H6R A;  3GTQ J;  2CUJ A;  2HQA A;  2DOD A;  3RKX A;  5D8L B;  5EEA A;  2M7B A;  2V79 A;  3GO5 A;  3ELK A;  3TW6 A;  2WZG A;  3FUJ A;  4XN4 A;  4AIK A;  3CJQ B;  5AON A;  2L01 A;  1JT0 A;  4XMV A;  3DU6 A;  5IPA A;  1FJL A;  3HSR A;  1MD0 A;  3I59 B;  2VPL A;  2R7D A;  3JSZ A;  3FMS A;  4LIU A;  3O8G A;  3OYE A;  1GLN A;  3QPT A;  1OCC H;  4Y7N J;  1UG0 A;  2AXT C;  3KYC B;  4YEJ A;  3WTY C;  2LK2 A;  3BJO A;  1N25 A;  1MZB A;  1X1P A;  1ETK A;  3OL3 A;  1T1R A;  1ZR4 A;  1X19 A;  3JRF A;  1YI2 I;  2KHM A;  3CME I;  4YII A;  3RKQ A;  5FB2 A;  3ZMU A;  1JGS A;  2GXB A;  4LK1 F;  4OIR F;  4XNA A;  3Q0V A;  1R22 A;  5M5Y J;  3JTG A;  1MND A;  3CZ6 A;  3IUO A;  2IP2 A;  3A0B C;  2CQX A;  1IRF A;  1G3T A;  2J5O A;  4OOE A;  3J81 K;  4G6D A;  4A69 C;  3B6A A;  2LP0 A;  2HPT A;  4MTE A;  4S0H B;  3BLY A;  3S1Q J;  3HTS B;  4GAE A;  2WB1 A;  5H20 A;  4W97 A;  2KZG A;  2GQQ A;  2R93 J;  2Y0M A;  5HDG A;  1R5I D;  2JV7 A;  3CDI A;  1LJ9 A;  3OV8 A;  3KP4 A;  4ZX5 A;  3HUG A;  1P2F A;  2VJ5 A;  1B59 A;  3F21 A;  1A6Q A;  3KYD B;  1SMT A;  3M8J A;  3ZRG A;  2JRT A;  1ZEL A;  3GLL A;  3NQO A;  2GWR A;  3PNV A;  3O3K A;  2DA7 A;  4IEJ A;  5J3L A;  2V1U A;  1BR1 A;  4AIC A;  1XMX A;  4DYQ A;  4IHT A;  3SZG A;  2ZB9 A;  2RKH A;  2IA2 A;  2E5Z A;  1SVM A;  2R7F A;  1KU7 A;  4DJA A;  1BA5 A;  1TC3 C;  1D5V A;  4IOA F;  5LEJ A;  1ZLK A;  1T6S A;  3Q9S A;  1SAX A;  2DA6 A;  2L4M A;  2TDX A;  1OPC A;  1IRX A;  1ONN A;  1JHH A;  3MMY B;  4I0B A;  3RDI A;  3OY9 A;  3FU0 A;  2DPD A;  3IKV A;  4MFD A;  3I71 A;  2QQ8 A;  1QZE A;  4IQ4 A;  1R9T J;  4RAZ A;  3RYR A;  3KYL A;  2GLO A;  3ZCO A;  4U0V A;  4IZZ A;  5ICC A;  4HF0 A;  2Y0S A;  2EK5 A;  4BS9 A;  1LFU P;  3T1B A;  2A7O A;  3J7Y J;  2XRL A;  3LNQ A;  1XCV A;  3UNG C;  4H0E A;  2DAO A;  1FWZ A;  2NS7 A;  3CO6 C;  3B7S A;  5HOD A;  3S93 A;  5DD8 A;  4HV5 A;  5BNG A;  1P4W A;  3ZQI A;  3K1N A;  4GGG A;  3L09 A;  4M9S A;  3FM3 A;  4PGH A;  5ED4 A;  1Z21 A;  2LKP A;  1K6Y A;  3CCM I;  1U78 A;  1N77 A;  2X1E A;  3ZQL A;  3HW2 A;  4V19 K;  2CUF A;  4NNJ A;  2RNJ A;  4D5F A;  3CHP A;  1OJL A;  2IPQ X;  1V55 H;  3BTL A;  4ITV A;  1DGR M;  5B1B H;  4FLO A;  3BPV A;  1HW1 A;  1OLT A;  3SFZ A;  1MH3 A;  1IN8 A;  2NS0 A;  2XGX A;  4WF2 A;  2W85 A;  2X1C A;  3RJP A;  2IJL A;  2VKH A;  1IV6 A;  3QPH A;  2PUS A;  3IWF A;  1R0K A;  2QGU A;  2RRE A;  3CP8 A;  3P9K A;  2XGE A;  3BTC A;  4XL9 A;  1T0F A;  3ABM H;  2LTP A;  4MHG A;  1SMY F;  4AYB A;  1TL8 A;  3OYF A;  1YHQ I;  1DDN A;  1UST A;  2ZXH A;  4LIV A;  3S32 A;  1U8B A;  2HEO A;  4KYW A;  4Y52 J;  2JVG A;  4I01 A;  1XD7 A;  4NQW A;  4S04 A;  3BTJ A;  2L9V A;  3FUI A;  2K9S A;  2R7R A;  3JRE A;  1B4A A;  1OCR H;  3DWL E;  4DZJ A;  1PP8 F;  4X1E A;  1SFX A;  3S17 J;  3CHR A;  1LKX A;  4E7S A;  2XKP A;  2LFB A;  3S1R J;  4ZX6 A;  1S72 I;  4AR1 A;  2ESH A;  2W84 A;  4IKF A;  4LLN A;  2O8X A;  3U2R A;  2FXA A;  1QBJ A;  4BXX J;  2OTL I;  5C4X J;  2HDW A;  1VQ5 I;  2EV5 A;  2M5W A;  3FKI J;  5F0H A;  4P96 A;  1MBG A;  3JRA A;  4R5T A;  4PGG A;  5J40 A;  3AKZ A;  1R7J A;  1NG6 A;  1LEA A;  4NDL A;  2HU9 A;  2JVH A;  4YFN F;  1VQ6 I;  2MLG A;  3EYY A;  1FT9 A;  2WAE A;  2AQE A;  3B2X A;  2Y75 A;  2XB0 X;  2BZT A;  3LSG A;  3M3Y J;  2CJJ A;  3OYI A;  1ZRD A;  4ZW6 A;  3KZY A;  4MQ9 F;  2FD5 A;  3G1M A;  5EF6 A;  2K5C A;  1XPX A;  2DJN A;  2DMU A;  3OOP A;  1U9O A;  5JFR A;  1P7I A;  4GYG A;  3V7S A;  4BL0 B;  4KFC A;  3BT9 A;  2BHY A;  2RV8 A;  2R5Y B;  1E17 A;  3JT1 A;  3WE2 A;  1SC5 A;  5L3B A;  3H0G J;  2ESN A;  2IBD A;  3KLO A;  3PIP F;  4YRV A;  1VQO I;  3DLA A;  2EFN A;  1UEL B;  2FOW A;  3R4K A;  3VWB A;  3GTG J;  4OIN F;  2HQ5 A;  4RBO A;  5FD5 A;  4XMX A;  2F2E A;  3HOY J;  2BXZ A;  3WHB A;  5EG0 B;  4II2 A;  3JRH A;  4AYS A;  3HDD A;  3CF5 F;  2QBY B;  4CYD A;  2DMN A;  4XMZ A;  4H4K C;  4A0X A;  1J59 A;  3FUN A;  1JXS A;  4G9Y A;  2WAQ N;  2LF7 A;  2E19 A;  3I4P A;  3F9K A;  3C18 A;  1G5A A;  2B9S A;  3B2P A;  5AIP A;  2NNY A;  5IP7 J;  2XAF A;  4PJJ A;  3GVA A;  2R59 A;  1DPR A;  3VSK A;  4ESJ A;  2P5V A;  3JAM Z;  3W6V A;  1KQ8 A;  2KIQ A;  1JGI A;  1RNL A;  4IRH A;  1K61 A;  5IOZ A;  1V3F A;  3I4N J;  5D5W B;  4LUP A;  3H9G A;  2LDU A;  3HKZ A;  4CUG A;  2EFW A;  4K2E A;  4C3I J;  4Q4I A;  4CA0 A;  1Y6I A;  3OYC A;  3LMM A;  4CH7 A;  1YS7 A;  4MNU A;  5L3D A;  1QQI A;  1JE8 A;  3RKY A;  3F8B A;  2CU7 A;  3UCQ A;  5DUK A;  2PJR A;  1L0O C;  2Y1E A;  2M9H A;  2EIL H;  3QPS A;  3RC8 A;  1MSE C;  2AQF A;  1P7J A;  4ENK A;  1VTN C;  5B1A H;  3IL2 A;  3HC7 A;  1YG2 A;  4M3E A;  2D1V A;  3GTL J;  2DI3 A;  2GOX B;  5EV7 A;  1YX5 A;  3VVM A;  4M3G A;  4L18 B;  1USS A;  2V9V A;  4L0Z B;  5JVG F;  5B66 C;  4U88 A;  2P7C B;  5BPI A;  3C7J A;  2VI6 A;  1O7F A;  4IVN A;  5LBQ A;  5H2F C;  2G7H A;  4HBL A;  2V4J C;  1F36 A;  3BC8 A;  5GPA A;  3VFZ A;  1ZG5 A;  2QKM B;  5KCM A;  1LDK B;  2L9N A;  1XCB A;  1WVR A;  1X3Z B;  3DQV C;  1BOA A;  5E20 A;  4RDU A;  3O8H A;  1MH4 A;  4NC6 A;  4XRM A;  4ZTF A;  4PSX A;  3DPT A;  4GYI A;  5DV5 A;  2JQ7 A;  4P9U A;  3CC7 I;  1GHC A;  2WAD A;  3BG7 A;  4EAT A;  4EGZ A;  3B37 A;  3FXU A;  2DCE A;  2OZU A;  1T8I A;  1VQN I;  3BG5 A;  3GBG A;  3H5N A;  1N75 A;  4WCG A;  4BYY A;  5H6Q A;  5HS7 A;  3M4O J;  4XNB A;  1WH5 A;  4DNC A;  2K3P A;  3ML6 A;  3HG9 A;  3W3C A;  4ZDL A;  4ZW8 A;  3CMA I;  2OTJ I;  4IL6 C;  2XB5 A;  3E7L A;  2GA2 A;  2KRH A;  3H5A A;  4KMU X;  1SFU A;  3CZE A;  3UEQ A;  5KNL A;  3NWT A;  1IF1 A;  2P6T A;  1H0M A;  3FXK A;  2X48 A;  5E1X A;  3CHO A;  4OAY A;  4FLQ A;  2LOO A;  2A68 F;  1J0R A;  1JKP C;  3FUM A;  1I1S A;  2A07 F;  4L9T A;  4HNT A;  1IXC A;  2Y1F A;  2K9Q A;  1Y0U A;  1U2W A;  2ZCW A;  2P7V B;  2ELJ A;  5CYV A;  1TQM A;  1WKM A;  3BTI A;  4OIQ F;  3HRS A;  3UER A;  5CVJ A;  3K9T A;  3DKX A;  4E7J A;  3ZHX A;  2YX7 A;  4ZYA A;  2GAU A;  1DPU A;  1FMW A;  3WTU C;  4I7H A;  2NNN A;  2QEN A;  3GTP J;  4J19 A;  5BPP A;  5E8G A;  4IX7 A;  2FX0 A;  2OBP A;  1DP3 A;  1JUP A;  2NYX A;  3K7A J;  1R58 A;  1RPW A;  3FXL A;  1ACI A;  2D45 A;  2JWT A;  3S14 J;  2KZV A;  3AL0 C;  3LSK A;  4GRI A;  1MNE A;  1GUU A;  2IA1 A;  2B61 A;  1XTA A;  4A3I J;  3R0A A;  1K5H A;  2ZJR F;  4IHY A;  1SEU A;  1UHW A;  2EQR A;  3SEZ A;  2XPV A;  4L5J A;  4RB3 C;  3CJN A;  4D5C A;  1SFK A;  3WE3 A;  1D1C A;  2VBZ A;  1RUN A;  1BI3 A;  2DXI A;  1LUJ B;  4DPR A;  1K4S A;  5DDG A;  3ABU A;  1XDU A;  3G1L A;  1K78 B;  1J75 A;  2E2J J;  2XPZ A;  2BVL A;  3HOV J;  1N78 A;  4BXF A;  3KLN A;  1ONV A;  1U9N A;  1SVO A;  4JP0 A;  4WK8 F;  1YYV A;  5IOY A;  2HR3 A;  5FKL A;  2L2O A;  1UCR A;  2CSO A;  3FH7 A;  1J5Y A;  3MCZ A;  2R3S A;  3TMO A;  2K9N A;  3GEZ A;  4UV9 A;  4BUP A;  4I6Z A;  5CVR A;  2OU2 A;  3P9C A;  2EZL A;  1P4X A;  3PL8 A;  4FHT A;  4ETS A;  5DUI A;  2MD5 A;  2Y31 A;  3ISP A;  3CLO A;  3I3L A;  1HOM A;  2HKO A;  3N05 A;  4XOR A;  5DEQ A;  1U8R A;  3OR1 C;  1FEX A;  4ZYE A;  2UUZ A;  2YPR A;  4IHV A;  2JPB A;  2A5W A;  1O7L A;  3M1C A;  3V8K A;  1FNN A;  2CGP A;  4R8H A;  1RES A;  2LSO A;  1B72 B;  4K5M A;  3TBI A;  4HRI A;  3Q0W A;  3E0J B;  4UHT A;  4FAS D;  2FQ3 A;  5BQT A;  2X6W A;  2LY9 A;  5C4J J;  4U87 A;  4A0Z A;  5EZH A;  3ZMV A;  5E17 F;  2ZFW A;  3EPZ A;  2Y1G A;  1XSX A;  1YLF A;  2LMD A;  3JW4 A;  4FIS A;  3CXB A;  5HLH A;  2MG4 A;  3CD6 I;  3FUH A;  3KP7 A;  2XPU A;  3TL4 X;  5A2Q Z;  4PDK A;  2EFO A;  5EJC A;  4RSY A;  3G6E I;  2DJI A;  4G12 A;  4HNV A;  1OFC X;  2HQR A;  2W25 A;  2VE9 A;  3IRR A;  1R49 A;  4PJL A;  4B8X A;  3ERE D;  3B02 A;  5IP6 A;  1KZH A;  1MW1 A;  5FD6 A;  1IZ1 A;  4UUS A;  4XRF A;  4QTR A;  2DA3 A;  3EET A;  4CCM A;  1ODD A;  2ECB A;  4Y15 A;  4U0Y A;  1JGG A;  1G3W A;  4MKT A;  1WJF A;  4HLY A;  2CQ7 A;  2CW7 A;  2YS9 A;  2R7Z J;  3A06 A;  2HI3 A;  1VQ9 I;  1TP4 A;  5C3E J;  1D5Y A;  3GFJ A;  3I0T A;  3KP2 A;  2O5R A;  2WC2 A;  4HOB A;  3CJR B;  2OC6 A;  1TWH J;  3A01 B;  2GZW A;  3FUD A;  4C9Y A;  4RLF A;  1ETO A;  5GAG J;  4R79 A;  3S2D J;  3U9W A;  2HOE A;  3L2W A;  2UV1 A;  1K79 A;  2MA3 A;  4BDZ A;  2IRF G;  3BZ6 A;  4N9I A;  3RTR A;  4A5N A;  4PCQ A;  1FOW A;  4GCV A;  3WG9 A;  4GFB A;  3E5Q A;  2XF7 A;  3MKY B;  2FBI A;  5DTD A;  2MAO A;  2QQA A;  4L5I A;  3MWM A;  1HSJ A;  4XLP F;  2D2W A;  2L0K A;  4ZX4 A;  2IS6 A;  4P5O A;  2DA4 A;  4OMY A;  4FCA A;  4K5P A;  4YFK F;  1WJD A;  2WAQ A;  3RQI A;  4OMZ A;  5FRM A;  5IYD J;  4XMT A;  1WRJ A;  1RKT A;  4HDV A;  2H27 A;  5L3C A;  3DXJ F;  3F8M A;  4FT8 A;  4KT6 A;  2MW8 A;  2UZK A;  1RET A;  3J7A O;  1XC5 A;  1X3U A;  1P4A A;  3GFM A;  4XN7 A;  4UB6 C;  2L9R A;  1FP1 D;  1YW7 A;  3OS2 A;  1V4R A;  2MBF A;  4BEH A;  4OAZ A;  1XMK A;  4QPE A;  4ASN A;  1Y8Q B;  1YW9 A;  4CYC A;  2L7Z A;  3CUQ B;  2YX4 A;  4D7N A;  2IXS A;  5KK1 A;  1B8I A;  2QSG X;  1SD5 A;  5HDN A;  2QM3 A;  1S5L C;  2Z9O A;  2YR2 A;  2E71 A;  3W2W A;  3LSR A;  1XDS A;  5GAD J;  4XO5 A;  3K6G A;  3V42 A;  2M4G A;  1ZS2 A;  3CLQ A;  1RR8 C;  2EZI A;  3FH8 A;  4XKW A;  2Q2E B;  4HST A;  2QVW A;  2FBH A;  4ZYH A;  1EH7 A;  3AUA A;  3I56 I;  4M71 A;  2Y1C A;  1ETQ A;  2GIZ A;  4ZDO A;  2L3D A;  1VF9 A;  5E3N A;  1MW2 A;  4KUM A;  2CUE A;  2ZXG A;  2ZME A;  2ZNY A;  2CS3 A;  4A3M J;  1O57 A;  3LSH A;  1U5T B;  2QYO A;  4YFX F;  3AU9 A;  1FTT A;  3KP3 A;  3VYU B;  5DLL A;  2ZXW H;  2X9D A;  5JHU A;  2XPW A;  1O3Q A;  2CW0 F;  3DPL C;  1MBF A;  5F64 A;  1UAA A;  4Q5S F;  3C2B A;  4WXH A;  3REO A;  2H1L A;  2VT2 A;  4ZH4 F;  3LA3 A;  4I98 B;  3RC3 A;  2HVS A;  2DA2 A;  3OSF A;  5D8K B;  4I02 A;  3K4L A;  3V8J A;  4HF1 A;  2X85 A;  4M73 A;  4ZJZ A;  2V26 A;  3AU8 A;  2A3S A;  3OIO A;  5DD4 A;  3VSL A;  2JA6 J;  2V9P A;  2L02 A;  4NB5 A;  3LOC A;  2V9K A;  1K4T A;  5FO5 A;  5ILU A;  2KLO A;  3TO9 A;  4EJV A;  3FK6 A;  3HOS A;  3CCU I;  5D6F A;  3TQN A;  3M9A A;  3CCV I;  4BHP A;  4IO9 F;  1OYY A;  3D5L A;  1T08 B;  3ZQF A;  1X3W B;  4A12 A;  5EDN A;  4EM1 A;  3AG1 H;  5FLV A;  1Z3Y A;  1BR2 A;  5LGN A;  3C3W A;  3K1M A;  1IN4 A;  2XQ0 A;  1MDM B;  3S8P A;  1FPQ A;  4B43 A;  3DV8 A;  4HV6 A;  4HYE A;  2HVR A;  2VQG A;  2RVC A;  5FRO A;  2HPM A;  4E70 A;  4XK4 A;  4MO7 A;  1CF7 A;  3CF2 A;  2XRO A;  1LFB A;  3DEW A;  2ZJP F;  2STT A;  1LVA A;  1Z9C A;  1FOX A;  3ZHY A;  3CDL A;  3HBL A;  3LL7 A;  4BHB A;  4RVB A;  2GBY A;  5GAH J;  1XS9 A;  2EH3 A;  1J7K A;  3MKZ A;  2ZO4 A;  3E6B A;  4HEA 2;  4UVC A;  3CCJ I;  3G73 A;  3HL2 A;  1QA6 A;  5JMW A;  2K85 A;  3ZQG A;  1KU2 A;  2NOG A;  3K69 A;  3M8E A;  4G8X A;  3GYH X;  4M6V A;  1JKR C;  4UUV A;  5F08 A;  3BZC A;  2RDP A;  4D1Q A;  5J8F A;  2XDV A;  1TW3 A;  1UZC A;  1Z6T A;  5D4R A;  5FLX Z;  1KON A;  1WI9 A;  1XGS A;  1FBS A;  3DF8 A;  3FIS A;  3H1C A;  2XAH A;  3GWZ A;  3U1K A;  4BQO A;  3S15 J;  4A3E J;  3F8C A;  1PJR A;  2MH2 A;  4M6X A;  4LLL A;  3SZT A;  2R7W A;  2GOM A;  4NHJ A;  1ZG1 A;  3WGH A;  1YJW I;  3HHG A;  3PNT A;  4KIG A;  3GZ5 A;  4HZF A;  3K4K A;  1X1D A;  3H9Q A;  3BR6 A;  2KIF A;  2BBY A;  1FBQ A;  2H6B A;  2LBF B;  4CCK A;  5EGO A;  2VPR A;  1TZL A;  5D5X B;  3HSF A;  4OOI A;  3ZMS A;  5JLW A;  3F22 A;  3B34 A;  3U9G A;  1AKH B;  3ECH A;  4EV0 A;  2F5C A;  2P4W A;  3LA7 A;  3FMR A;  4XM3 A;  2CV0 A;  4Y6S A;  1G3Y A;  3FZV A;  4N4N B;  2JA8 J;  1W5T A;  1WCM J;  1FTZ A;  4PU2 A;  2ME6 A;  4OOF A;  2STW A;  4ZYD A;  3L7W A;  3OL4 A;  2HKX A;  3I5U A;  3HGY A;  3VOD A;  2R92 J;  2M3A A;  1AA7 A;  2DTZ A;  1YE9 A;  2VKD A;  1T98 A;  5HS9 A;  3E1S A;  5E8I A;  2ZBK A;  3NWS A;  3GFL A;  3WTV C;  3ZR8 X;  1HKQ A;  1ZKG A;  2M4K A;  1Q0L A;  2L4A A;  4MEX F;  1IDY A;  2KJC A;  4GDF A;  3PO3 J;  2DMP A;  4QPQ A;  3HOX J;  3Q5F A;  1VZ0 A;  3H5R A;  2BV6 A;  2YU3 A;  3OYG A;  4ZW7 A;  4JOM A;  4I09 A;  2HPI A;  4RAF A;  3HOT A;  2BEO A;  2J5P A;  4XQF A;  2B63 J;  1S6L A;  3BCA A;  1ERD A;  3B3B A;  2ZXJ A;  2L54 A;  2W00 A;  3H0D A;  2XUB A;  2BY1 A;  4XMW A;  3CC2 I;  1HKT A;  4XMY A;  1WJC A;  1H3L A;  1J2X A;  3H3Z A;  1WQ2 A;  1ZGA A;  2X6X A;  1XG1 A;  3E3V A;  4II3 A;  4ZQG A;  3FF5 A;  3COA C;  5JAZ A;  1UHS A;  3F3X A;  1G6N A;  4NUB A;  3KP6 A;  1G8X A;  2F5E A;  2FNP A;  1FLI A;  3C2G A;  2E35 A;  3E6C C;  2HOS A;  2IAI A;  2EIJ H;  1I3A A;  4KIT B;  1YOV B;  3OYN A;  4J3B A;  3WGG A;  4Y17 A;  3PM1 A;  4HPQ A;  3CTA A;  1G59 A;  3FTV A;  2VBW A;  1TNS A;  1XB4 A;  1DGW Y;  2XVC A;  2W4S A;  4CCN A;  4S05 A;  3OYK A;  5IYC J;  4KMF A;  5AEN A;  4ENM A;  1OKR A;  4PK4 A;  2F48 A;  3CUQ C;  3HOW J;  1DU6 A;  3TO7 A;  3ULQ B;  3SDG A;  3HXL A;  4IPA A;  1W5S A;  4HDU A;  1ULY A;  3WGI A;  3FIW A;  4LJZ F;  4NC8 A;  3DLL F;  2ME0 A;  4FE7 A;  3CCR I;  4Z2Y A;  3SJM A;  2ID6 A;  2CRG A;  1MMD A;  1RZ4 A;  4NC7 A;  2HDD A;  3MVP A;  3B7R L;  2F5D A;  3FK7 A;  2IGK A;  2R5Y A;  5DM6 F;  2HTS A;  2E7W A;  2DYR H;  3M07 A;  1MVY A;  3LAJ A;  3F8N A;  3LQQ A;  4F52 A;  1QPI A;  2CV2 A;  3SYT A;  2K40 A;  1H19 A;  1F4K A;  3OYB A;  4HQM A;  4O3M A;  2LY1 A;  3IAS 2;  2KFD A;  4MGR A;  5M5W J;  4DYC A;  4XMU A;  2CO5 A;  1BIA A;  3RAS A;  5FKO A;  4LK0 F;  1O4X A;  3PJR A;  1VQK I;  5EG0 A;  1W36 C;  4AVZ A;  2QBY A;  1HW2 A;  2V1X A;  1YIT I;  2FSW A;  2D1H A;  1R6R A;  3M7G A;  1EH8 A;  3ROU A;  3GZN B;  4BQA A;  1H9G A;  3FTY A;  2HQN A;  4JX4 A;  2OD5 A;  2RC4 A;  1XN7 A;  1Y56 A;  2P5L C;  4PW4 A;  3IAM 2;  1SD6 A;  1W7P B;  4DBQ A;  5HS8 A;  4XN0 A;  3RKW A;  3TP3 A;  4NQW B;  2XKO A;  1YFH A;  1QNT A;  1BR4 A;  4CGZ A;  1IXR C;  3JAM K;  3F72 A;  3EQL F;  4RAY A;  5D4S A;  1E3O C;  3MEX A;  1XSD A;  4Y13 A;  1GVJ A;  3WTX C;  2C82 A;  1R00 A;  4G6T B;  2O7G A;  1I27 A;  1JKQ C;  3MFK A;  1J9I A;  2M30 A;  1WZ2 A;  4ZQF A;  3E6D A;  3EUK L;  1GVD A;  5CVI A;  3S1N J;  2MYS A;  1HXD A;  3E6M A;  4EEF G;  2HTJ A;  2H8R A;  4BBR J;  3RZO J;  3JRB A;  2Y2Z A;  2EIN H;  2VKE A;  3LFU A;  3VOE A;  1PVE A;  2QF7 A;  4KJZ A;  1ZR2 A;  1UG2 A;  3L2C A;  3WQQ A;  3WTW C;  1BM9 A;  3OIP A;  3C1D A;  2K4J A;  4EVI A;  5JC1 A;  2DQM A;  1SQM A;  3KPH A;  3EDP A;  2F4O B;  3JRI A;  1ENH A;  5IT9 Z;  2Y9Y A;  1FOY A;  1W4M A;  4J01 A;  3A0H C;  4KDP A;  1TWA J;  4CDG A;  3P9I A;  2NAZ A;  2EPF A;  1O3T A;  4WX9 A;  4FQG A;  4A3L J;  2XSJ C;  4M9X A;  3JRC A;  4C2T A;  2G0E A;  4E7I A;  3LST A;  2R5Z A;  2I5U A;  1I39 A;  1WJA A;  2ELK A;  2E1C A;  1BOB A;  3HPH A;  4HSR A;  1A6I A;  4YIR X;  2WY8 Q;  3I54 A;  1IRZ A;  1QZZ A;  2EZH A;  1Y39 A;  1IW7 F;  1HLV A;  3DKY A;  1S8N A;  2EJR A;  3KX2 A;  2VOP A;  4CHU A;  4IXA A;  3QYE A;  3JR9 A;  4G7O F;  3SEQ A;  1R1U A;  2OAZ A;  4XN3 A;  4GO1 A;  2E1O A;  2X0L A;  1VQ7 I;  3HHH A;  1LVK A;  3LSI A;  4R5V A;  1K83 J;  1LDJ A;  3X2Q H;  5HNH A;  1SVL A;  3RZD J;  5F04 A;  2VBY A;  2P8T A;  1NK3 P;  2VJ4 A;  4A6D A;  4GXO A;  4QME A;  3VB2 A;  5EEH A;  1YRN A;  4B09 A;  1ORK A;  4AM3 A;  2R7S A;  2XRN A;  2VB6 A;  2ZJ2 A;  5FFX A;  2EV6 A;  3HRM A;  5IP9 J;  3KIO A;  3GTO J;  2RN7 A;  4BAC A;  2QQ9 A;  2GTQ A;  3OS1 A;  1G4D A;  1XGN A;  2MD0 A;  2AO9 A;  5GTI C;  3KET A;  4ZZD A;  2O6G E;  1G2H A;  4Q48 A;  1V54 H;  1FYK A;  1T2K A;  1XX5 A;  4BHC A;  1BC7 C;  3ZGK A;  3K4C A;  5ICF A;  2VBX A;  3B6C A;  3BOQ A;  3V7R A;  2JA5 J;  3DTI A;  5C44 J;  3CCQ I;  1LPQ A;  3IWZ A;  4BE0 A;  2PJR B;  1D3Y A;  4KN4 X;  4AU7 A;  4ZN6 A;  4HW0 A;  3Q0U A;  4I0A A;  3LFK A;  2MC3 A;  3R61 A;  3E5U A;  5CQG A;  1IV8 A;  1RI7 A;  3BR5 A;  4A3B J;  1QU3 A;  4FLS A;  2W7N A;  2EIM H;  5J47 A;  1TQI A;  4BJ5 C;  1BC8 C;  1QVT A;  2DYS H;  1I1G A;  1U6G A;  3R6S A;  3ZMD A;  3QOE A;  4UVA A;  2Z16 A;  4L2L A;  2ISY A;  2DT7 B;  4BU2 A;  1K78 A;  2LYC A;  2OCE A;  3HZJ A;  2LKS A;  3SZP A;  1X4O A;  2FOK A;  2KPM A;  4O5V A;  2QCO A;  3BWG A;  4BH9 A;  2MAP A;  2UXN A;  3DTK A;  3FXQ A;  4FTH A;  1IGN A;  5TGT A;  4BQQ A;  3ZQ7 A;  2DK5 A;  2Q0O A;  1ZHF A;  3HOU J;  3KEY A;  2VOD A;  3LSP A;  3G1O A;  1EA3 A;  3ABK H;  3PUB A;  1BW5 A;  1QGP A;  5J1U A;  1LE8 B;  1JJ8 C;  1IUF A;  3IH4 A;  1E2X A;  1Q1V A;  3L2Q A;  2IS2 A;  3CCL I;  2IEK A;  1HST A;  2VAS A;  2GXA A;  6PAX A;  2PMH A;  3BQZ A;  3S3N A;  3R0J A;  1PUF B;  4XND A;  4B44 A;  4RM2 A;  1IN7 A;  4E6K G;  3WTZ A;  2MLK A;  1F43 A;  2BY3 A;  4ZX3 A;  5CQE A;  1B72 A;  3ZQH A;  2LLK A;  2VJ8 A;  4RLQ A;  4PJM A;  2DK8 A;  5LHI A;  1BI2 A;  5E3M A;  3CCE I;  3SXY A;  2ZKZ A;  4HX8 A;  2ZSH B;  3S2W A;  3TW7 A;  3FTZ A;  3CES A;  1H9T A;  3K2Z A;  1PDN C;  1QPM A;  1Z7U A;  4EJW A;  1LQ1 A;  3A02 A;  2PJP A;  1AU7 A;  3PQK A;  3T5X A;  3OYL A;  2K3F A;  4PUS A;  2IT0 A;  2LC2 A;  1S29 A;  4KIB A;  3TKY A;  1KYW A;  3ZMZ A;  3Q9V A;  2XIG A;  2LVS A;  2JCY A;  2VKV A;  3A1Y A;  5A2Q K;  1PUE E;  1BI1 A;  1CGP A;  4P9F A;  4J00 A;  4BJT A;  1SG7 A;  1X2M A;  1P92 A;  1Z67 A;  1YTY A;  3HM5 A;  4JBA A;  5M3M J;  4XID A;  4IHX A;  2TRT A;  1WPK A;  3HPG A;  5LRS A;  2M0M A;  2D5V A;  1ONP A;  5GTH C;  1T38 A;  2CW8 A;  1QRY A;  4HAM A;  5GP9 A;  4HNU A;  3HB9 A;  5HLT A;  1TTY A;  2DQR A;  2TCT A;  3JRD A;  2JN6 A;  4FET A;  1E3H A;  1T39 A;  2JZY A;  4YG2 F;  3A01 A;  1J09 A;  3PO2 J;  4F93 B;  1NH3 A;  2DOE A;  3FTX A;  4YEL A;  3K70 C;  1YX3 A;  1VQ4 I;  3PFI A;  4N4O B;  1KU3 A;  3IV5 A;  1UMQ A;  3CMM A;  3NRV A;  4XN8 A;  1W0U A;  2HOA A;  5GPC A;  2PLY A;  3B73 A;  4V2F A;  3KCC A;  3L1P A;  3WQS B;  3G4S I;  2R7T A;  1OCT C;  4LG0 B;  1ON1 A;  3FUF A;  3FXO A;  4BDY A;  1G3S A;  1JT6 A;  1SFE A;  2VQH A;  3VYR B;  1YJN I;  1HS6 A;  4AD9 A;  3OMY A;  1EH6 A;  4Y6R A;  4I76 A;  2ZJQ F;  3S3O A;  2F4M B;  2HZD A;  4PSW A;  4CIC A;  2R7U A;  1TNT A;  3LSJ A;  4DZP A;  3CDH A;  1SAN A;  1XGM A;  2LKX A;  3FU3 A;  4U7D A;  5LLQ A;  1EV7 A;  1IRG A;  2H6C A;  1I6H J;  3VPR A;  2LH9 A;  3GX4 X;  1HKS A;  3A4C A;  3BG9 A;  4XSX F;  5F6F A;  3W2A A;  9ANT A;  1HDD C;  2V7F A;  3HIF A;  4DGW B;  3RQ4 A;  4PZJ A;  4LMY A;  2HZT A;  2DMQ A;  2IS1 A;  1VND A;  4CCJ A;  4A5M A;  1V5G A;  3GW2 A;  2XAS A;  3KE2 A;  3CUQ A;  4PFO A;  3FHZ A;  1X4P A;  3N97 A;  1E3P A;  3S2H J;  1ZAO A;  2FJ1 A;  1W7P D;  2DFH A;  1NG7 A;  2KP6 A;  1KYZ A;  2UWM A;  2GM4 A;  1TT0 A;  4M3F A;  2DW4 A;  1ETV A;  1UHM A;  1YIO A;  2BXY A;  3KED A;  4LIT A;  1JTY A;  3I9V 2;  1ON2 A;  4XOT A;  3NEU A;  1LB2 A;  2Q2E A;  4RM3 A;  5CVU A;  1A35 A;  2LG4 A;  2E34 A;  2LY2 A;  5LGU A;  1JKO C;  2IGO A;  1Y8R B;  1KU9 A;  2V1D A;  3B7U X;  2KJB A;  2H94 A;  3VEP A;  5HDK A;  3UR3 C;  4BNC A;  4BGD A;  1B9M A;  4B47 A;  4FLR A;  4PJ0 C;  4X2U A;  5DCM A;  1IDZ A;  1Y1V J;  3BPX A;  3RIR A;  1DQU A;  4WXC A;  2WV1 A;  2V6E A;  4A2U A;  1U0J A;  2A61 A;  2LNB A;  4UUS B;  3W2V A;  2ACJ A;  2VUM J;  1JTX A;  3LQR A;  3ZXS A;  1TBX A;  4RA2 A;  3MZ8 A;  4ANJ A;  1NHA A;  2PMZ N;  3I55 I;  3PSI A;  4IOC F;  1MNM C;  3VYT B;  3DEE A;  3IKT A;  2QJ1 A; 
#chains in the Genus database with same CATH homology
 4XMX A;  4XM3 A;  2CV0 A;  2RJI A;  4Y6S A;  1SAU A;  3ONQ A;  3MD2 A;  4II2 A;  3QJX A;  5DUL A;  4AYS A;  3PSF A;  4N4N B;  4PU2 A;  4XMZ A;  3IP4 B;  4H4K C;  4OOF A;  3FUN A;  3Q43 A;  3OL4 A;  1D0Y A;  1MMA A;  2E60 A;  2M3A A;  1AA7 A;  3F9K A;  1G5A A;  1YE9 A;  2VKD A;  3B2P A;  3CHS A;  3E1S A;  4ZW3 A;  4BE1 A;  4PJJ A;  2R59 A;  2HNH A;  5FWQ A;  3NWS A;  2WAF A;  3VSK A;  2IS4 A;  3ZR8 X;  2M4K A;  1Q0L A;  4FLR A;  4QPQ A;  1VZ0 A;  1WFX A;  3H5R A;  4F3Q A;  3OYG A;  4ZDP A;  4ZW7 A;  4LUP A;  4JOM A;  1X3W A;  3H9G A;  3HKZ A;  4CUG A;  2BW3 B;  2HPI A;  4Q4I A;  3BCB A;  4CA0 A;  1Y6I A;  3HOT A;  4PJN A;  2RQQ A;  3OYC A;  3LMM A;  4XQF A;  4CH7 A;  2WY7 Q;  1ONO A;  3BCA A;  1ERD A;  1T95 A;  2K9L A;  3B3B A;  2VJJ A;  1JVS A;  2W00 A;  1T0F C;  4GAA A;  3H0D A;  3UCQ A;  2PJR A;  4QUO A;  4XMW A;  2Y1E A;  4XMY A;  3VVL A;  3RC8 A;  3CP2 A;  1WJC A;  2VXD A;  1H3L A;  2AQF A;  3QOD A;  2XF6 A;  4CZC A;  2P0W A;  2X6X A;  3HC7 A;  4II3 A;  4ZQG A;  3CZL A;  2GOX B;  5EV7 A;  2VIX A;  1YX5 A;  4NUB A;  3VVM A;  3S3M A;  2VQC A;  2R7O A;  5JAZ A;  4QIR A;  1G8X A;  4XNF A;  2R70 A;  3C2G A;  2WBM A;  2DQ6 A;  4K5N A;  4RCV A;  1D0Z A;  4KIT B;  1Q0H A;  4ARF A;  3OYN A;  4J3B A;  1X1C A;  1Z7L A;  2V4J C;  3BC8 A;  3H35 A;  3K4N A;  2R72 A;  2QKM B;  3FTU A;  4HPQ A;  1G59 A;  5KCM A;  3FTV A;  1LDK B;  2HVQ A;  3PUU A;  2L9N A;  1DGW Y;  4X0G A;  3DQV C;  2W4S A;  4KP7 A;  4CCN A;  2VXZ A;  3OYK A;  2KRC A;  4JQF A;  1HA8 A;  4ZTF A;  5AEN A;  4PSX A;  4PK4 A;  4Y4R A;  2V1N A;  3DPT A;  2W82 A;  3K4B A;  2R4G A;  3HXL A;  4AR8 A;  1X1A A;  2WAD A;  3BG7 A;  4EAT A;  3B37 A;  2DCE A;  2RNG A;  4NC8 A;  2ZSI B;  3GBG A;  3G2B A;  1MMD A;  1N75 A;  3H5N A;  4NC7 A;  3B7R L;  4XNB A;  2IGK A;  1MVY A;  2K3P A;  3HG9 A;  3W3C A;  3D5R C;  2VJI A;  4ZDL A;  4F52 A;  2CV2 A;  3FHE A;  3Q44 A;  4ZW8 A;  3SYT A;  1H19 A;  3OYB A;  3H5A A;  3CZE A;  2KRH A;  2LBF A;  2LY1 A;  3IAS 2;  3UEQ A;  3A14 A;  5KNL A;  2Y1D A;  4XMU A;  3RAS A;  3NWT A;  4ZW5 A;  3CHO A;  3AFH A;  5JBI A;  5CKT A;  3PJR A;  5DYF A;  4MLO A;  4OAY A;  3FUL A;  4FLQ A;  2LOO A;  4OWR B;  4XLH A;  1W36 C;  1PYV A;  4AVZ A;  3K70 D;  3FTW A;  5LFA A;  3OS0 A;  3FUM A;  3DTE A;  4HNT A;  3L2V A;  1S46 A;  3T8V A;  1QHH D;  2Y1F A;  4XLC A;  1R6R A;  2MC4 A;  2JD0 A;  4ZQT A;  3RSN A;  2ELJ A;  3FTY A;  2R7Q A;  2A6T A;  1JG9 A;  3UER A;  5CPR B;  1P9Q C;  3DKX A;  1Y56 A;  2XF5 A;  1MW7 A;  4XLE A;  4E7J A;  4ZYA A;  3T0Y A;  3ZHX A;  4PW4 A;  3IAM 2;  1FMW A;  2Z2S B;  4XLF A;  4DBQ A;  1E0E A;  4XN0 A;  4RMN A;  4NQW B;  2CV1 A;  1BR4 A;  5BPP A;  4XN1 A;  4IX7 A;  2JCX A;  5JHF A;  1DP3 A;  3ZI0 A;  2L7K A;  2OV7 A;  2JCV A;  2BW3 A;  2KZV A;  3AL0 C;  2C82 A;  4XO3 A;  2O7G A;  4G6T B;  3LSK A;  4PVB A;  4GRI A;  4E4H A;  1MNE A;  4XR6 A;  4XOP A;  2JSP A;  2B61 A;  4ZQE A;  4DIQ A;  4ZQF A;  3EUK L;  3OYA A;  1K5H A;  2ZXI A;  2PL5 A;  2MYS A;  3SEZ A;  4JND A;  3LFU A;  1SFK A;  2XPY A;  1D1C A;  1R0L A;  5KHD A;  4C2U A;  4KJZ A;  2DXI A;  3PNY A;  4B3X A;  3OYJ A;  4DPR A;  2CMP A;  4B48 A;  3WQQ A;  4F92 B;  2XPZ A;  3OIP A;  2BVL A;  1N78 A;  2KL4 A;  2F4I A;  4BXF A;  1JI8 A;  5JC1 A;  2DQM A;  1SQM A;  1LFP A;  3OWT A;  4Q4E A;  2BOL A;  3FBN B;  2X6Y A;  3CIA A;  2L2O A;  3BG6 A;  4BE2 A;  2ZFU A;  3QYB A;  2HPO A;  3FH7 A;  1MW3 A;  1WJE A;  3TMO A;  4XN2 A;  3K10 A;  4J01 A;  2JD2 A;  4BUP A;  2BVM A;  1T1S A;  4R7L A;  1X1B A;  4K5O A;  2JD1 A;  3HUG B;  1FMV A;  2JA2 A;  4Y67 A;  5HNF A;  2I8D A;  3PL8 A;  2E1M B;  2XSJ C;  3SDB A;  2R7X A;  4XO4 A;  2VLA A;  3EBH A;  4C2T A;  2DT6 A;  4BEH B;  4E7I A;  3FH5 A;  3ANL A;  1WJA A;  3I3L A;  5LD2 C;  1BOB A;  3RCO A;  2MAB A;  3N05 A;  4BKX A;  2Q1Z B;  3HPH A;  4HSR A;  4XOR A;  2WY8 Q;  2FFL A;  3K4M A;  3OIQ A;  3OR1 C;  4XKV A;  3DKY A;  2UUZ A;  3KX2 A;  2A5W A;  3M1C A;  3L2R A;  2WPG A;  1MMG A;  5JMP A;  3DU5 A;  4K5M A;  3QYE A;  3TBI A;  4F91 B;  4HRI A;  3SEQ A;  2M7A A;  4XN3 A;  3E0J B;  3ANN A;  4FAS D;  1OR7 A;  3FHN A;  2X6W A;  3EBI A;  1LVK A;  3LSI A;  4C30 A;  4R5V A;  4U87 A;  4ZC3 A;  3EPZ A;  5HNH A;  2Y1G A;  3U21 A;  3OR2 C;  2FUG 2;  2VJ4 A;  4LG3 A;  4QME A;  3AL0 B;  3FUH A;  4XN5 A;  4K5L A;  3TL4 X;  2XC7 A;  3FU5 A;  4RSY A;  2DJI A;  2R7S A;  3FBI B;  2VB6 A;  4PJL A;  2WA0 A;  2CUJ A;  4BAC A;  2HQA A;  2GTQ A;  1MW1 A;  3D5S C;  3OS1 A;  2M7B A;  2MD0 A;  2WZG A;  3FUJ A;  4XN4 A;  2LRD A;  3CJQ B;  3R0I A;  2JUG A;  4CCM A;  3DU6 A;  4XMV A;  1D1B A;  4MKT A;  1WJF A;  2VPL A;  2VQL A;  3K4C A;  4XLA A;  3ZGK A;  4LIU A;  2CW7 A;  4F55 A;  2Z1D A;  3A06 A;  3JSZ A;  3DTI A;  3OYE A;  1GLN A;  4E7Z A;  1UG0 A;  4YEJ A;  2O5R A;  4BE0 A;  2PJR B;  4AU7 A;  3CJR B;  4ZN6 A;  3OL3 A;  2OC6 A;  1T1R A;  1X19 A;  2L9S A;  2OUM A;  2KHM A;  4RLF A;  5CQG A;  4C9Y A;  3FUD A;  1QU3 A;  4FLS A;  2DOA A;  2XAU A;  2W7N A;  1Z3X A;  4R79 A;  2PMZ A;  3U9W A;  2C5Z A;  4BJ5 C;  2UV1 A;  3L2W A;  3EBG A;  4BDZ A;  3RTR A;  4XNA A;  3QOE A;  1MND A;  2K9M A;  3CZ6 A;  3ZHZ A;  2Z16 A;  1Q0Q A;  3IUO A;  4L2L A;  3ANM A;  2XF7 A;  3MKY B;  2MAO A;  2DT7 B;  2MFZ A;  3FDY A;  4BU2 A;  2LYC A;  4OOE A;  2QKL B;  1X4O A;  4ZX4 A;  2IS6 A;  4P5O A;  3ZQQ A;  2HPT A;  2KPM A;  4FCA A;  4K5P A;  1WJD A;  2WAQ A;  2MAP A;  3BLY A;  3DTK A;  5FRM A;  4GAE A;  2WB1 A;  4XMT A;  5TGT A;  3J7A Y;  4BQQ A;  3LSM A;  4Y6P A;  3KEY A;  2JV7 A;  4HG2 A;  4KT6 A;  4Y3O A;  1JGI A;  4ZX5 A;  2E5N A;  1EA3 A;  4XN7 A;  2VJ5 A;  3PUB A;  2F5V A;  4XN9 A;  3OS2 A;  3L2Q A;  3M8J A;  3ZRG A;  3PNV A;  1ZEL A;  2IS2 A;  4BEH A;  4AIC A;  1BR1 A;  4XKB A;  2VAS A;  4OAZ A;  4Y33 A;  4QPE A;  3SZG A;  2E5Z A;  3S3N A;  3FUE A;  4XND A;  4B44 A;  4RM2 A;  2IXS A;  2KQR A;  4DJA A;  4E6K G;  4ZX3 A;  3VYS B;  5CQE A;  2VJ8 A;  1W36 D;  4RLQ A;  1RP3 A;  3W2W A;  4PJM A;  4A03 A;  1IRX A;  1ONN A;  2R7V A;  4XO5 A;  3K6G A;  3MMY B;  3OY9 A;  3V42 A;  2M4G A;  3FU0 A;  1ZS2 A;  2ZSH B;  3FH8 A;  4XKW A;  3FTZ A;  2Q2E B;  3CES A;  4HST A;  2QVW A;  4IQ4 A;  1X3Z A;  3KYL A;  3C2H A;  2Y1C A;  3AUA A;  3ZCO A;  4IZZ A;  4ZDO A;  3OYL A;  2Y0S A;  4PUS A;  2LC2 A;  4BS9 A;  2A7O A;  1MW2 A;  4IQJ A;  4E7H A;  1QHG A;  2ZXG A;  3UNG C;  1OR7 C;  3EUA A;  5HVQ C;  2W1O A;  3VDX A;  4E7L A;  2JCY A;  2CS3 A;  3A1Y A;  3B7S A;  4KIS A;  3LSH A;  4CCO A;  3L2U A;  3AU9 A;  4J00 A;  3VYU B;  3S93 A;  4BJT A;  4CSW A;  1SG7 A;  3CZG A;  5DLL A;  3HPG A;  1ONP A;  2M0M A;  1Z21 A;  1N77 A;  1K6Y A;  2EGH A;  2CW8 A;  2X1E A;  4HNU A;  3DPL C;  4NNJ A;  5HLT A;  1UAA A;  4XON A;  3CHP A;  3EUH C;  4MS6 A;  4ITV A;  4FET A;  1DGR M;  4XKC A;  4ZQH A;  1V5F A;  4P1W A;  2HVS A;  4FLO A;  3RC3 A;  1OLT A;  3K4L A;  3CZK A;  4D9J A;  2F6C A;  2X85 A;  1MW0 A;  2IGM A;  2V26 A;  4ZJZ A;  1J09 A;  3AU8 A;  3VSL A;  4F93 B;  3FTX A;  4YEL A;  2X1C A;  3K70 C;  2VKH A;  2PUS A;  1YX3 A;  2CH0 A;  3CHQ A;  4E7K A;  4N4O B;  2V9K A;  3CMM A;  1R0K A;  2RRE A;  3CP8 A;  2CFO A;  4XN8 A;  2KLO A;  3WQR A;  3HOS A;  1MMN A;  5FRN A;  4XL9 A;  2KDO A;  3WQS B;  4AYB A;  2R7T A;  3D5L A;  3OYF A;  3FUF A;  4BDY A;  2LRE A;  2ZXH A;  4LIV A;  2VQH A;  3S32 A;  3VYR B;  1HS6 A;  2JVG A;  4QPO A;  4NQW A;  3OMY A;  4Y6R A;  3H9J A;  1Z3Y A;  3FUI A;  1BR2 A;  3PFY A;  3S3O A;  4DOZ A;  2R7R A;  3DWL E;  2HZD A;  1GW6 A;  2XQ0 A;  4PSW A;  3S8P A;  3RPU D;  2R7U A;  4B43 A;  3OYM A;  3CHR A;  1LKX A;  4E7S A;  3OYD A;  3FU3 A;  1WJ5 A;  2HVR A;  4CCL A;  4DBR A;  2VQG A;  5JNL A;  5FRO A;  4ZX6 A;  2HPM A;  2LH9 A;  4BQN A;  3A4C A;  4AR1 A;  3W2A A;  4IKF A;  2CUZ A;  3CF2 A;  2V7F A;  2VL8 A;  3FTS A;  4DGW B;  2HDW A;  3RQ4 A;  4U7B A;  3FKJ A;  3K4J A;  3ZHY A;  2IGN A;  3LL7 A;  5JO0 A;  4RVB A;  3FU6 A;  2IS1 A;  4CCJ A;  4AR9 A;  3FUK A;  3OYH A;  1V5G A;  4PFO A;  3MKZ A;  3B7T A;  2L5Q A;  1X4P A;  4R5T A;  4HEA 2;  5JMW A;  2NOJ B;  3HL2 A;  1WJB A;  2E1M C;  3AKZ A;  2PGG A;  1NG7 A;  1V5E A;  2KP6 A;  2X1D A;  1NG6 A;  3OOU A;  2X51 A;  1TT0 A;  2HU9 A;  2UWM A;  2JVH A;  3DPU A;  3KED A;  4CXF A;  2WAE A;  4LIT A;  2AQE A;  4R5X A;  3I9V 2;  3B2X A;  2KMU A;  4XOT A;  4D1Q A;  3LSG A;  4RM3 A;  2XDV A;  3OYI A;  2LG4 A;  2LY2 A;  4ZW6 A;  2IGO A;  3B7U X;  1KON A;  2K5C A;  3QYF A;  4BQO A;  1S9H A;  3UR3 C;  4BGD A;  4B47 A;  2WZF A;  4X2U A;  1PJR A;  2R7W A;  4BL0 B;  2GOM A;  1DQU A;  2V6E A;  4QHP A;  3JT1 A;  4PFP A;  1SC5 A;  1U0J A;  3PNT A;  1D1A A;  3IIE A;  3W2V A;  3K4K A;  1X1D A;  1D0X A;  3ZXS A;  3H9Q A;  5HOO A;  3MKW B;  4YRV A;  4ANJ A;  3DLA A;  2LBF B;  4CCK A;  1TZL A;  4BJ6 C;  1UEL B;  3PSI A;  3VYT B;  3VWB A;  3B34 A;  3A2K A;  3DEE A;  4ZTJ A;  2QJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...