2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
b'MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
5HNHA 5HLTA 5HNFA 2VLAA
chains in the Genus database with same CATH superfamily
2F4OB 2IJLA 3HPGA 4FHTA 3EBIA 1ZTRA 1T1SA 3A02A 3BJ6A 2R5ZB 3CDLA 3GFJA 4IRGA 4UVAA 4M9ZA 4DW6A 4Q5SF 4Y33A 4XN1A 4F7ZA 4L5EA 4EEFG 3MAJA 2FA5A 3EBHA 4CYCA 1SVMA 2DYSH 2JPCA 1DDNA 5JLWA 3LA7A 1ZELA 1YE9A 5ERIA 4XN8A 1H0MA 1UMQA 1VI0A 1X3WB 4HDUA 3JRAA 4AWXB 3V7RA 2IRFG 2ZXGA 2GOMA 5C4XJ 4XRSA 2DT7B 3HRUA 2Y1FA 1Y8QB 2BXYA 1U9OA 3C18A 1BOBA 2R4GA 4G6TB 5B66C 1IDYA 2MFZA 5CJ9A 4BH9A 4OIRF 4BXFA 4L9JA 1O7FA 2QQ9A 2BHZA 2EIKH 2ZCWA 3WE3A 4EVIA 2NVQJ 1Y8RB 4GFBA 1R23A 5B1BH 2JVGA 1SAUA 1D1BA 1USTA 2B7EA 5E1WA 3WGIA 1K78B 2QLZA 3FUDA 3J7YJ 2QYOA 1O57A 3FHZA 4KICA 4A0YA 1MSFC 4EJUA 1ZYRF 5FO5A 4BBRJ 5DYMA 2JA2A 2QQ8A 1WH7A 1HC8A 1LUJB 2NVUB 5BPDA 1A6QA 3RKXA 5KK1A 2EFWA 1H88C 2IS1A 3L9FA 1S6LA 2FSWA 1Z1DA 1TNSA 1B4AA 4KUMA 1D3YA 5CPRB 2WTEA 2IBDA 2ZXJA 4XM3A 2JJ7A 4EGZA 4GAEA 3H0DA 3K4KA 2HOEA 3CJQB 1IGNA 3KIOA 2GIZA 3QPLA 3N05A 4UHTA 2F48A 1POGA 3K1NA 3LFUA 1BM9A 1RRJA 4QPOA 2EV6A 2XF7A 4HSRA 4DPRA 1U5TB 5JR3A 5HODA 1YFHA 1U2WA 2L01A 4PK4A 3VSLA 1VQPI 1JJ8C 3ABUA 1Y56A 4IHSA 2M2EA 2M9HA 2YX4A 3K1PA 3AG4H 3HZJA 3WHBA 2O03A 3OV8A 3BG7A 1YW9A 2AXTC 2W1OA 4MLOA 1BW5A 2HVRA 1DU6A 2Z1DA 3UKGA 4QPEA 5F0HA 2P81A 3K70D 1KU3A 4EQQA 1R36A 1Z05A 1JGSA 1Z7UA 5DTDA 1XSDA 2F4IA 4Y52J 2MYSA 3H5AA 3JR9A 2C82A 4A93J 4DOZA 4QHPA 3H36A 1KQ9A 1T56A 4FISA 3ZCOA 2JPBA 1B9NA 1ETQA 2LBFA 3F21A 4MQVA 3O2PE 3U2RA 1GUUA 3BPXA 2K9MA 4QLCU 1JG9A 4YIFA 2H8RA 3BQZA 1TWHJ 5ILVA 2VQLA 2G9WA 2OU2A 4DZJA 2DA2A 4HX8A 2LRDA 2L9VA 1HLVA 3J81K 2IT0A 3IWZA 3JSOA 4XRFA 1ACIA 1R1UA 3PQJA 4V19K 4M74A 2XAQA 1BI1A 1D8KA 4XONA 1I27A 3QP5A 1FTZA 2O7GA 4Y7NJ 2OCCH 4XSXF 1H9GA 1X1PA 1VQLI 1B6AA 2EJRA 2X6XA 4A3IJ 4AICA 3GTPJ 1T1RA 2DQMA 3F3XA 3BR6A 2E60A 3BR5A 2E34A 2W24A 4XOTA 1I3QJ 4X1EA 5HLIA 2XASA 1IZ1A 4EMSA 1WJBA 2QVWA 3QJXA 2XC7A 2JUCA 2DT6A 3K0LA 3WU2C 4DGWB 2R5ZA 5TISC 2E1MC 1WI9A 1ZK8A 2QQAA 5HDNA 3ECOA 4BXXJ 5K5QA 1HCRA 4MS6A 4HLYA 3BR2A 2WAQA 2V26A 2CQQA 2FBHA 3CCUI 2XGEA 3W3CA 5L3DA 4FX4A 4YEJA 3E3VA 2Z2SB 3C2GA 2E5NA 2Z9OA 4AM3A 1QNTA 3DPUA 4HSTA 2W7NA 3ML6A 5M3MJ 4O3MA 2JUGA 3CJNA 3MZHA 4XK4A 1GXPA 2HPOA 2PGGA 1R5ID 4UNOA 3RQIA 4RLFA 3B3BA 1J09A 2E2JJ 2Y48A 5BQTA 5JAZA 3LA3A 1M1EB 2W25A 1IXCA 2WAEA 2PBIA 1G2HA 3BOQA 2VJIA 1LVKA 2VL8A 3B02A 2CW0F 3QRFF 3ZRGA 2R7VA 2BOLA 4C9YA 5LEKA 2A07F 4XMTA 4F92B 1Z21A 1DP7P 3S16J 1K78A 3CCQI 1E2XA 4RGUA 5KCMA 1JE8A 1L3LA 4RCVA 4QUOA 1JGGA 4BJ6C 1AU7A 1XSVA 3Q0UA 5IOZA 1JGIA 3A4CA 1YOVB 3DTKA 2GA2A 2VOOA 2G0EA 4RM2A 4XORA 3RKQA 3V8KA 5JMPA 2HEOA 3K2ZA 5DD4A 1BC7C 4GAAA 4X2UA 1BJZA 2XKOA 4JYKA 2EIMH 5J4YA 2I10A 3BTLA 4FETA 2MSYA 3JSZA 4PDKA 2J5PA 3HRSA 3BWGA 3IH4A 1FBUA 2H1LA 3BCBA 4M71A 5DS9A 3ZPLA 3H3VK 1S7OA 2P7CB 2NS8A 1R1VA 2GXGA 1V3FA 3HKZA 3K6GA 5D4SA 3FUKA 1A04A 2IA2A 4RLQA 3I4MJ 4DNCA 1JXSA 1YX3A 2HKOA 2XSJC 1ZR2A 5EGOB 3PUUA 3P9KA 1OMIA 1BA5A 2V9VA 3EDPA 5B3SH 5E3NA 3W2VA 1FMVA 2EZHA 3GZ5A 4IHXA 2DA4A 3S3NA 2FJ1A 4L5IA 2BXZA 4OMZA 3HEFA 5HS8A 4ZW5A 1RP3A 1HXDA 2VT3A 2NOJB 3LSPA 4KN4X 4CCNA 1TWAJ 2HZDA 1U5TA 2ZBKA 4CUGA 5B5EC 2FD5A 5CVIA 4CZCA 2MLGA 3ZHZA 4UUTA 1QVUA 4CCLA 5DCFA 4DBRA 3BT9A 5KHDA 3KEQA 4I0AA 3OL3A 4H4KC 3RJPA 2D2WA 2XB0X 3H5NA 4C3JJ 1ZRCA 3GTOJ 2Y9YA 1FJLA 5F6FA 3IRQA 3K4MA 5J1RA 4BXUA 1ZHFA 2XUBA 4A5MA 3FF5A 3JRBA 4KT6A 3CCLI 3NEUA 2KIMA 1MJAA 4HNTA 1LEBA 4ANJA 4JX4A 2BVLA 4P9FA 3JAMK 3HOXJ 4J19A 1R1TA 3BG3A 3FDYA 5B1AH 2YPRA 1XTAA 4I09A 4M3GA 1JUSA 2ISYA 4HG2A 4D9JA 1ETOA 4UB8C 2L9NA 1HKTA 1VQ7I 1MGTA 3BR0A 4UUSA 2H8WA 3CQZJ 1DGRM 3CO7C 3TOBA 2E1NA 5J8CA 3M8JA 4XRMA 4B4CA 3MKZA 1HW2A 4LK1F 3CJTB 3IIEA 1TW3A 3FXUA 4OU0A 1JT0A 5FFZA 4FLSA 1RZ4A 1Z0XA 4MNUA 4BS9A 1T38A 1ONNA 4RAYA 3BP8A 4W1UA 5CQGA 1MW1A 5CVRA 2KRCA 2PMHA 3MVPA 2ZMEC 4PCQA 3T5XA 5HLGA 1VQNI 5LRSA 3CHOA 3B6CA 2VQHA 3K9TA 2BVMA 1CQTA 1QQIA 2VKDA 1LE8A 4XNBA 4BYYA 3RC8A 2EFNA 1IN7A 2DA5A 2DOFA 2B9SA 4G7OF 3TO7A 2MW8A 2LREA 3PIOF 1J5YA 4BHPA 5EV7A 5IYDJ 5HLHA 4QIRA 5HVQC 2E7XA 5CVUA 2FRHA 2DPUA 3TDZC 3A01B 4A3CJ 1Q0QA 3S1QJ 1G3SA 1S3JA 2HWVA 2FU4A 3KP6A 4L0ZB 4LLNA 2DMQA 2XKPA 3KLNA 4FE7A 3FXQA 1VFCA 2V7FA 2R92J 3TL4X 5K7FA 2VOPA 3Q5FA 4DIQA 4KDPA 2VASA 4A3GJ 1G5AA 5EYRA 2PMUA 1FY7A 3PIPF 3K4CA 1TTYA 3IWFA 3CCJI 3S17J 2IGMA 3HTSB 2VQGA 3RYRA 1EKEA 3WTSC 4XMXA 2R5YA 1IJWC 1OCRH 4OAZA 5F0FA 2RDPA 4E7HA 3CZLA 3I5UA 1VQ9I 2DA6A 1JKRC 3EYYA 2CW8A 4A3LJ 1GLNA 3LSMA 3HC7A 3TKYA 1JVSA 2JT1A 3U9GA 3G2BA 5AENA 2R72A 1HQCA 3GVAA 4M73A 5ILUA 4PU2A 1E3HA 3ABKH 4ZW8A 1V4RA 3GEZA 3R0AA 4PJMA 1B8IB 1W7PB 4U7BA 4JP0A 4ENNA 1WFXA 1LKXA 2O6GE 2VBZA 1MNMC 2FBIA 2XPVA 2ZSHB 4QSHA 4AIDA 2BYVE 4CH7A 1X1CA 4XQFA 2UUZA 5L3EA 2IXSA 3HB9A 4NC7A 3MKYB 1KQ0A 3OYHA 5FLXZ 3SEQA 2EA4A 2M45A 4A3JJ 2Y69H 2VPRA 3Q9VA 1N77A 1SFXA 1V54H 2Q2EB 3AG3H 4GRIA 3MD2A 4IJAA 3TBIA 5EZHA 4DYRA 5EGOA 3MEXA 3FISA 3PSIA 4E7JA 4ZQEA 3GUDA 4ZW7A 3M7GA 2RC4A 4NC6A 1N25A 3T1BA 3HKZN 3FUHA 1W1WE 3BCAA 1YO5C 3JT1A 2HVSA 2HQRA 3CZEA 1B1BA 4Y15A 2LG4A 1QZYA 2E2IJ 4GXOA 2R7UA 2CUJA 2STTA 3FH8A 3KEOA 3SZTA 1OCOH 4YFXF 1D1CA 1BI2A 2VQCA 3TGNA 3REOA 5LD2C 4O6JA 5M5XJ 3K2AA 4XO4A 1I1SA 5EJCA 4C3IJ 3HYIA 1MVYA 4OOFA 1WZ2A 5K1YA 2BGCA 4XIDA 3I53A 2XF6A 4R7LA 3KZYA 3B2XA 4YELA 1BC8C 3OYEA 4RMNA 4DYQA 3RDIA 2A6HF 2M8EA 1QPMA 1WJ5A 2VJ8A 5F1RA 1MW2A 2ETHA 2K7LA 2UXXA 2CS3A 4PJ0C 3GTGJ 2IA0A 1P4WA 2CO5A 2CWEA 3CTAA 3FZVA 1FT9A 1IRFA 4PJNA 5FLMJ 5DCMB 4PGGA 4BQQA 2OQRA 3ASOH 2VXDA 5DDGA 3B7UX 2RNJA 3K10A 2VBYA 2LKSA 3WTVC 1YLFA 4M6VA 2HU9A 3J80Z 3RC3A 3E6DA 2Y75A 1KZHA 4XBFA 2KZGA 3GLXA 3R4KA 3KEDA 1UELB 2L0KA 5JBIA 1IN5A 3WTTC 1F43A 1S7AA 1JHHA 4FX0A 1LDKB 3ESWB 2X51A 5D4RA 2ECCA 2FXAA 2H09A 3PQKA 3OSGA 2QZ8A 4K5OA 2O9LA 4WF2A 1E0EA 1SFOJ 2FOKA 5D8KB 1B59A 3QWLA 4PW4A 2WZGA 2UXNA 3TW7A 1IRGA 4HLXA 5K5RA 3H9JA 2JCYA 4Y6SA 2EH3A 3R6SA 4R79A 3FK6A 3FXOA 1G6NA 2RV8A 4ZW3A 1YS7A 2L4AA 2V6EA 3HDDA 4M9SA 1S9HA 4Y13A 5HS9A 4A5NA 4Y6RA 2CUZA 3H35A 5DV5A 3GTJJ 2RGVA 3MZ8A 4HF1A 1HW5A 1S8NA 1KGSA 4IKFA 3FTUA 2XAHA 4J3BA 3ZOBA 3CF5F 3DWLE 2GBYA 3A01A 2DFHA 4ZX3A 2DOEA 4CZZA 2OUMA 4ENKA 3OY9A 4M3BA 3S3MA 3P5JA 1RETA 2EQRA 3CLQA 1P7IA 3CMAI 4RGXA 3F0CA 1MW0A 3BQYA 4CCJA 1PUEE 4MTEA 1ZARA 2M87A 2G7UA 2HPIA 3IC7A 3KE2A 1YRNA 4F3QA 5IP7J 3S14J 2X48A 2IGKA 3TEDA 3OYLA 3RPUA 4WXCA 3OYJA 5JC1A 3MWMA 1YHQI 2F5CA 1U9NA 4S04A 1IXSB 4NC8A 3G4SI 2M4GA 1XS9A 2X1CA 4PFOA 2VE9A 1RKWA 2VONA 1R4MB 1YIOA 3C2HA 4XO3A 3Q0VA 3FHEA 3QYEA 4Y67A 2TCTA 3WQRA 3DPLC 3C2BA 2ME6A 5FKLA 3D5SC 2PX9A 3C3WA 5F08A 2VJ4A 5J4VA 5BPPA 2DA7A 4MFDA 1SMYF 3FUFA 2R7DA 4A3EJ 3KEYA 2JQ7A 2R7RA 1YYVA 3VFZA 1OPCA 2QCOA 1W7PA 4UB6C 4YFKF 1B8IA 4KJZA 3HIFA 4LJZF 3RSNA 2LD5A 2FOWA 2QWWA 2WC2A 2LBFB 3ROUA 3H3UA 3WTXC 1PDNC 3LSJA 1FIPA 3HOUJ 4DQ2A 2XAUA 1R5HA 1I50J 2QA4I 3J7AO 3K4NA 3CXBA 3HGYA 1Z67A 4E6KG 1CF7B 2LY1A 4XO5A 4BQOA 1XGMA 2JA6J 2D1VA 2IVMA 4LG0B 1O3RA 5F1JA 2Q2EA 3P9CA 2EINH 2QENA 5ICEA 3IKVA 1QGPA 2E36A 5J40A 4ZZLA 2HPMA 5DUIA 1TWGJ 1YS6A 3QPHA 3SYTA 3C1DA 2ZMEB 3VPRA 2K9QA 1BI0A 4E4HA 4BNCA 1BJAA 1BIBA 2ELHA 2WWYA 3HOVJ 2P5KA 3F8CA 4LUPA 1E17A 4ESFA 2CSOA 2OF7A 2OJED 3W6VA 3KYDB 4AVPA 2AS5F 3SFIA 1TNTA 3W2AA 4JNDA 1ONPA 5FD5A 3ZMUA 2WBMA 2Q8KA 5LGTA 2P7VB 1F36A 3H3ZA 3ZHYA 4LLGF 1JI8A 2WAFA 3HG9A 5EF6A 3V7SA 4U87A 2M0MA 5L3BA 4KP7A 4E7SA 3LMMA 1ZG1A 1FNNA 3T8TA 3FTVA 3I55I 1SD5A 3ZMVA 3L2WA 2BY1A 3EBGA 2BW3B 1O4XA 5ED4A 3WHCA 1SFKA 4D7MA 3JRDA 4HW0A 2L9RA 1FSEA 3D0SA 5DCMA 5LGUA 4CXFA 2OV7A 3PNTA 4FQGA 4BE2A 1RC9A 4PVBA 3FTWA 3VYUB 4IHYA 2PUSA 1WJCA 2LKXA 1YJ9I 4I6ZA 1K83J 3GCMA 3UNGC 1NH3A 1LDDA 3IH2A 2XV4S 3DEUA 3B2PA 1TWFJ 3M07A 2DODA 2DO7A 1OCZH 1MNDA 3BG5A 3I71A 3F9KA 4RB2C 1J59A 3S2HJ 5J8FA 2W84A 2JZYA 1FOKA 4HPQA 1VNDA 1MMGA 2KLOA 1G4DA 4O5VA 2K85A 2STWA 3CO6C 3BJAA 1GW6A 5EG0B 1XSXA 1FSHA 3HSRA 2DPDA 2MH9A 2IAIA 3LQRA 1T0FC 2KT0A 4ZQFA 4Z2YA 3ZMZA 4S05A 1TZLA 3TDUC 2CV2A 2J5OA 3G1LA 1SANA 1XGSA 1ENHA 3QPTA 1TW2A 3L00A 3QU6A 2R7SA 1YG2A 3HUGB 4PJJA 3WODF 2XHKA 4C3HJ 3WTYC 2HKXA 4L5JA 3EQLF 3CC7I 1V5FA 3GFMA 1U8BA 1XC5A 3TMOA 2DTRA 1OYYA 4A3DJ 3FMSA 1B9MA 1Z7LA 2CYYA 2EA2A 2JMWA 2NYXA 4MIMA 4P9UA 1HBXG 4R5TA 2XAJA 4L18B 3CZKA 5BNGA 4K2EA 3ZN1A 4OIOF 2FQ3A 2KFDA 3VVMA 5F0CA 2E2HJ 3K1MA 2CH0A 2CRGA 3ERMA 4ZYEA 1TLHB 2BHYA 3GTLJ 1HDDC 1X4PA 4XLNF 3VWBA 4U0YA 2QGUA 4ZYGA 1R7JA 4IVNA 1A31A 5J1YA 4N0BA 2YR2A 2K86A 4V2FA 4BY7J 5FJ8J 5CVJA 2YU3A 4HQMA 3OYGA 1RI7A 1ZQ3P 1ZGJA 2EBIA 5KAIC 3FK7A 2ZNZA 2BBYA 4ZW6A 2ACJA 2ZB9A 4XN2A 1IUFA 4RBOA 3IV5A 2ZXHA 4A3FJ 4JQFA 2F5VA 1FC3A 4C2UA 4II3A 4XLPF 3BZKA 3MN2A 5C44J 3OS0A 5M3FJ 2CV1A 2VKVA 1PUFB 4OOEA 4GYGA 3F6OA 2MD5A 5ILSA 2LKPA 2EZIA 4UUSB 3GTQJ 2L7FP 1CF7A 4OMYA 2Y1GA 2RNGA 1QRYA 2XPUA 4P55A 1P4AA 4LG0A 4EATA 3EUHC 4ZH4F 2VT2A 1TT0A 4M3FA 1KQ8A 1P7JA 3ERED 2W4SA 2LY2A 1FP2A 3G1OA 2EWNA 4Q47A 3BG9A 1Z9CA 3F8MA 5TGTA 5JFRA 1IG7A 1O7LA 2ZMEA 3R60A 5AONA 3E5UA 3R0IA 4AYSA 2HFHA 5C4JJ 3PFIA 1LE8B 3HRMA 4A69C 2L2OA 1K4TA 2L4MA 2PG4A 4BJ5C 2LP0A 2MC4A 4D1QA 1J9IA 2VE8A 5JNLA 1P9QC 1R22A 3BDDA 3FIWA 5DM6F 3NAUA 4UV9A 1C0WA 4AR9A 3GFLA 3RQ4A 2JA7J 5E8GA 4I01A 1MBKA 1Y1VJ 4RDUA 2K9SA 1XGNA 3S15J 1XCVA 3M9AA 1K5HA 1X1AA 5E1ZB 1J75A 4XICA 2PFBA 4R5XA 2A05A 1JTXA 2VC0A 3Q43A 2K4BA 5M5WJ 4HV6A 1XX5A 5HNFA 1YQAA 1Q0LA 1MJBA 1T98A 2AQEA 3S32A 5DUKA 3VOEA 1FYKA 2BW3A 2Y30A 1A6IA 4MEYF 3HHGA 2FE3A 1YI2I 1NHAA 1RR8C 3U21A 4IPAA 2R5YB 2XRNA 4G6DA 4QMEA 4UY8I 3IRRA 4ENJA 1W36D 2HOTA 4BHBA 2XVCA 4LB5A 2DAOA 4GDFA 2M3AA 3M8FA 5EEHA 2ME0A 3L1PA 1YJNI 1KA8A 2DW4A 2F5DA 4N9HA 1ZKGA 1XN7A 2EV5A 1IC8A 3ZP5A 1R4NB 4Y6PA 2FMYA 1ITYA 5ICCA 3FMRA 1IF1A 1KYWA 2F4MB 1X3UA 1GT0C 1NTCA 3A03A 1X1BA 2HYFA 5D5VB 5EG0A 3GTMJ 4ARFA 3BY6A 2H6CA 3JCUC 3S8PA 1WWXA 3LAJA 4R5VA 2ID3A 2OBPA 4XOPA 2Z5UA 1DPUA 3EUKL 1QVTA 1X3ZB 2HS5A 3LAPA 2ADUA 2BZTA 2KMUA 3AFHA 1GDTA 3Q44A 3HGGA 1ZLKA 1F4KA 2GIVA 3GWZA 1FIAA 4XKCA 2R7TA 3FMQA 1FOXA 1ETYA 3SDBA 1ONOA 2QJ1A 3AU9A 2X6YA 2M0CA 1EH8A 5K5OA 3HUGA 1FOYA 1SC7A 4V2GA 5FD6A 1HSJA 3DBHB 4XRSG 3E7LA 3R61A 3HOYJ 5K7ZA 1H19A 5ICFA 2ZJQF 2VKEA 2QF7A 4IOCF 1ON2A 1LFUP 4XN4A 1IV6A 3FUMA 2G7HA 1FBSA 3F22A 1YW8A 5KVRA 2VI6A 2KJCA 2WY7Q 1Q1HA 4KMUX 3DTIA 3OS1A 3FTXA 4XNAA 5FLXK 1MBFA 2HYJA 1JKOC 2DQLA 4C30A 2KDOA 2CG4A 2V1DA 1YIJI 3LSKA 3FUJA 4AUXA 3RPUD 3CMEI 4KT5C 3FXMA 1IN8A 2EK5A 4RS8A 2NS7A 1UG2A 2JSCA 3M1EA 2W82A 3LSIA 2XPZA 2RKHA 1F1ZA 3FWEA 3FU5A 1LFPA 2ESNA 2B63J 4XLEA 2X1EA 4I0BA 5F64A 2A69F 2ZJPF 2BY2A 4HZFA 2LF8A 4QWQA 3GZNB 4KIFA 4BQAA 4B3AA 2A5WA 3QP6A 2O8KA 4JX6A 5FRMA 1J2XA 1JHFA 3ASNH 4NNJA 4WX9A 2LSOA 4ESBA 1P2FA 3FUEA 4XN5A 2VJ5A 1QA6A 1OKRA 1W7PD 1HSTA 4B3XA 3L2RA 4CCOA 1K79A 4XNDA 5EEAA 4B09A 5E3OA 3WU0A 3M4OJ 1PUFA 4QTRA 4G12A 1SAXA 1FLIA 3IUOA 4KITB 2BY0A 3LL7A 4M3DA 1HW1A 3PNVA 4FLRA 1D8JA 1YTYA 4RGRA 1LB2A 1AOYA 3BLYA 3Q9SA 5BOXA 4IRIA 3ZQ7A 1TQIA 4AD9A 1V5EA 3DEEA 4OINF 4WXHA 1Q0HA 3FH5A 2V4JC 3O3KA 4S0HB 1GXQA 1X2NA 1VQ5I 1XD7A 5IP6A 1QZZA 5FKOA 4FT8A 3WGGA 4UV8A 3J80K 1EV7A 3FXKA 4BBSJ 3IH3A 4R8HA 2EZKA 1XMKA 1U8RA 2VJJA 2CUEA 2DQRA 4PGHA 1APLC 2K4JA 2Y0MA 3JRGA 1NG7A 2M30A 4OWRB 2B0LA 4A12A 5JHUA 1T08B 2HQ5A 2PMZA 3OIQA 2DMNA 4KYWA 3T8VA 1BR2A 2QSHX 1CGPA 3DF8A 1LFBA 3FX3A 3AG2H 2P6SA 5JI6A 4HV5A 5M5YJ 1YRNB 3M1CA 2XB5A 2A68F 4LK0F 4KIGA 4NBQA 5D5WB 4ZC3A 4IHWA 3FKJA 2JCXA 2O5RA 4UVBA 1WJEA 3ISPA 5HDGA 2JRTA 2JK3A 3UERA 2XGCA 2FFLA 1ETXA 3CCSI 2MC3A 5JVTA 4BQNA 1U6GA 4KNYA 4ZJZA 3PNYA 1G59A 4Q48A 1U78A 4L9VA 5J47A 4ZX6A 2WB1N 5KNLA 3D1NI 1UHMA 1ZAOA 3GX4X 5EDNA 3EUAA 5TRDA 1P6RA 1ETVA 3HHHA 4G7HF 2UWMA 3JREA 4PUSA 4AR8A 2UZKA 1JKQC 3MQ0A 1ODDA 2HGCA 2DFIA 3I4PA 4B1RA 1SFUA 1VQ6I 1X3ZA 1V5GA 1W5CC 4BJTA 1MJ9A 1WVRA 5E8IA 3LOCA 3RZOJ 3I4NJ 3FXLA 2LH9A 1BL0A 2CQXA 4XNFA 4Z6YA 4LFUA 3HJEA 3OYDA 3CLOA 1OYWA 3CCVI 3FM5A 1SD7A 2H6BA 3VYRB 4G94A 3FU6A 4I76A 4EJWA 2RJIA 3AG1H 4XMWA 2KRHA 2L7MP 2VBWA 3HXLA 1RNLA 3SEZA 4BL0B 3CUOA 3DEWA 3CCYA 4I98B 3CJRB 1HF0A 1MIJA 3DLAA 5GAHJ 2K40A 3J7AY 3WGHA 3MMYB 4F55A 5CQEA 2F5EA 5HS7A 2M1BA 1GHCA 5A2QK 2E35A 2E1MB 2L5QA 3SQNA 4Q4ZF 3V8LA 1FWZA 4Y4RA 4C2TA 2MA3A 3CD6I 4RB0A 2NS0A 4EM1A 1K61A 2OD5A 4LLLA 3GO5A 4A03A 2O8XA 3BJOA 2VODA 3QYBA 2JD1A 5K7HA 3BTJA 2YSRA 3V8JA 5GTHC 2DK8A 5L3FA 1OR7C 2R3SA 3G1MA 3LSTA 5HLTA 3KYLA 2JD2A 3F72A 1VTNC 2DJNA 2EIJH 2JD0A 4IX7A 4XLAA 3ZQQA 1LDJA 4CYDA 3ZQHA 3DBRB 1I5ZA 5E1XA 4CICA 2MLKA 2XIGA 3RIRA 1EF4A 3F8FA 4UXNA 3CF2A 4ZDOA 4F93B 3KP4A 2DN0A 3HSFA 4HEA2 2W85A 3JW4A 1SVLA 4LG3A 5JVGF 1MBHA 1WH5A 1PVEA 4H0EA 5D5XB 2BY3A 5ICGA 2YS9A 3OSFA 1Y39A 1OCTC 4CCKA 4L0YB 5FRNA 1MW7A 4BAYA 2DFFA 3WG7H 3PUFA 5HNHA 2M4KA 3ZQCA 3TQNA 3ZN0A 3DPTA 4LB6B 4YFNF 4U88A 4ZN6A 5DYFA 2V79A 3TP0A 1PJRA 1W5SA 2LMDA 5BPIA 2V1NA 4EJTA 2MD0A 2HR3A 2GZWA 1SVOA 3SFZA 3GZ6A 3KP2A 2W00A 2RAEA 2EV0A 3E6MA 5TJJA 5GTIC 3DFGA 3LA2A 1T0FA 3FU3A 4XSZF 2VC1A 3HOZJ 4XMVA 3A14A 2L02A 3KZIC 3FHNA 1F9NA 2N8GA 2Q1ZB 1MSEC 4Y17A 3FXJA 3X2QH 3S1RJ 1SEUA 1JUPA 3O8GA 2DI3A 4D0PA 1XCBA 2P8TA 1HOMA 3LSGA 3WG9A 3S93A 2Y31A 4LITA 4IZZA 3JSPA 3DKYA 2QM3A 1IW7F 4IQ4A 1KU2A 3PJRA 2PMZN 2ZJRF 2Y0SA 1O3TA 1X19A 1EH6A 2KIUA 3LSRA 1VQ4I 3KYCB 2AO9A 1VZ0A 3OIPA 1IN6A 2GWRA 3WTZA 2A5YB 3I0TA 5J6XA 1K6OA 2HDWA 5LHGA 2WZFA 1Q1VA 3HOWJ 2MBFA 5D5UB 4YIRX 4KN7X 3CHRA 5DULA 3ELKA 3ABTA 2DA3A 2WV0A 2GM4A 4J01A 4XLHA 2OZ6A 1TQMA 2P5LC 2MG4A 2JTVA 3FTZA 2DCEA 5FB2A 1SD6A 3HOTA 2DJIA 1H89C 2OZUA 1PP8F 3DP7A 2XAFA 1Z91A 3MKLA 3CUQC 2V1UA 1HS6A 1Z77A 3VSKA 4EM0B 3K70C 3W2WA 1LEAA 3CC4I 3NWTA 3FU0A 5H20A 4OIPF 1KU9A 4TV7A 2OCEA 5IT3A 3CCEI 4N4OB 1T6SA 4U0WA 4BY1J 2OC6A 3AAFA 3QODA 3RTRA 2LNBA 1WGXA 2XRLA 3A0HC 1XG1A 4XN0A 2K02A 2DTZA 3BG6A 4HRIA 4BDZA 1WHUA 3OOPA 3EUHA 3E1SA 2O7OA 3OYCA 3OWTA 1QZEA 4CDGA 5DEQA 4RAGA 3KP5A 1AKHB 3MZYA 1FPQA 4LIUA 4BEHB 4E7ZA 2O3FA 2M7AA 4KMFA 2B61A 3OIOA 4IRHA 2K5CA 3K69A 3WU1B 2MABA 2NVYJ 1ETKA 2RQQA 1B72A 3GYHX 4A3MJ 3HPHA 1STZA 4KA4A 5DM7F 2E19A 3ANMA 5FKMA 1A35A 1RPWA 1WJAA 2KP6A 3B73A 4EJVA 1BR4A 1PYVA 3JRCA 1S72I 1WJDA 4D7NA 1AWCA 4ZQTA 5E3LA 5FKKA 2VN2A 3UR3C 2KZVA 3V42A 2XPYA 4A2UA 5LHHA 4G8XA 1E3PA 1T95A 3IAM2 3JRHA 3CZ6A 2HDDA 2WPGA 3H0GJ 2Y9ZA 4ABZA 2I8DA 3HW2A 3Q3SA 2ZJ2A 2K27A 1N75A 3RPQA 3TP3A 4B47A 3CC2I 2LFBA 4MGRA 2XQ0A 1LPQA 3WQSB 4L2LA 4XN3A 5LLQA 1BBYA 4PZJA 5F27A 5J1UA 3JRIA 3L2QA 2IGOA 1BOAA 2GOXB 1P4XA 2CQ7A 5E17F 2LK2A 4FCAA 1MKMA 1TP4A 2EB7A 4LGWA 4B48A 3OS2A 4G7ZF 2OTLI 3OR2C 4RAZA 1W5TA 3ZXSA 1JUMA 3ZMTA 2ID6A 1BW6A 3VODA 3COAC 4I7HA 3QQAA 5DD8A 3W6JB 2IEKA 3DU6A 1A36A 2CQNA 3I64A 4B43A 2CJJA 4E70A 4A3KJ 1W36C 4G9YA 2A61A 2HTJA 1NK2P 3FTSA 2HI3A 3KX2A 2P6TA 2FX0A 4M9XA 2IP2A 2FBKA 1FMWA 3VB2A 1O3QA 1LNWA 2VB6A 5LEJA 3P7NA 2CU7A 3RKYA 5HDKA 4CO8A 1R49A 4XMUA 1X4OA 1XDUA 1IUYA 1USSA 5IP9J 2E1CA 4P1WA 6PAXA 1ON1A 4IQJA 3C7JA 2GTQA 4M6XA 5IYBJ 2DU9A 2DFEA 3A2KA 4ZX4A 4BE0A 3CHSA 4WXDA 5CKTA 2X85A 2ZXWH 3CMYA 4BHCA 1XMAA 2R70A 1FYMA 3B6AA 3E5QA 3TO6A 2CQKA 3RYPA 4L9NA 2HOSA 2NAZA 1WKMA 4PJLA 2VLAA 1UAAA 2L54A 2ZSIB 3GFIA 5FFXA 4DJAA 5LBQA 1FYLA 1RR7A 1EH7A 3U1DA 3LWFA 1ZR4A 2WA0A 4WCGA 2TRTA 4RAFA 3PM1A 2F5FA 3OYIA 3AL0C 3HOSA 3DKXA 1JT6A 3G71I 4ENMA 4HNUA 4ZX5A 2HZTA 3H92A 1VQMI 3ZQIA 4HDVA 2DDAA 3UEQA 1PP7U 2XF5A 2E5ZA 2Y0SN 4RGSA 2PJRB 3FBIB 5EEGA 1S29A 1TWCJ 2HVQA 1VF9A 1QBJA 2K9LA 4YRVA 2ESHA 4HBLA 4KFCA 1ZH5A 1UZCA 1FZPB 4FLOA 2R0QC 4MKTA 2HPTA 1IXRC 4FTHA 4XN7A 4ESJA 2R7XA 4IF4A 5EZGA 4DYCA 2EPFA 3L2CA 3H9GA 3S1MJ 2LVSA 4BGDA 5DLLA 3PL8A 2V9KA 1JTYA 2HOAA 1MD0A 1GVDA 2RN7A 1N78A 1WJFA 2YX7A 4NB5A 2V6CA 2JSPA 1BI3A 2R7OA 3EYIA 1ZN2A 2ECBA 3HSEA 4RM3A 4W97A 4DBQA 3IL2A 4ZYAA 2D45A 4ZTFA 2VXZA 2COMA 1G8XA 3ZR8X 3PFYA 3OYMA 5J3LA 1Z6TA 2GLOA 1Y0UA 1ZLJA 2Z33A 3CDIA 1K7AA 1Y6IA 1IN4A 2GAUA 4HX4A 3OOUA 5IT9Z 1XDSA 1ZG3A 3L09A 2A6TA 5CYVA 5FGMA 3J7ZI 5FKNA 1WQ2A 2OQGA 1SQMA 5H6QA 1Z3YA 1T2KA 3F23A 2XDVA 1U3EM 1AKHA 2Z99A 1GV2A 2IGNA 5IPAA 4BEHA 4AC0A 1T33A 3MFKA 1LJ9A 4D5FA 1MH3A 3K7AJ 4LD5A 4ZDLA 5FROA 3VEPA 3VYTB 3V4GA 3CZGA 3WTUC 1IRXA 2HQAA 2NNYA 3B37A 2EILH 2ISZA 2C5ZA 4XMZA 2P0WA 2QBYB 1XB4A 1D1AA 2KIFA 2ZXIA 2H1KA 3ZGKA 2R59A 5E18F 4IO9F 1SFEA 3DQVC 3NARA 4M3EA 4A0ZA 2FQ4A 2ZC2A 3E6CC 3LQQA 2O61A 5JMWA 1EA3A 1IRZA 5D6EA 2TDXA 3L2VA 1Y1WJ 1ZGAA 2KQRA 2L9SA 2QVOA 1MH4A 1UG0A 2C6YA 3SJMA 1GV5A 2E1OA 2Z3YA 3DCFA 3L2UA 1G3TA 2OTJI 2YUSA 2JCVA 3SXYA 3D5RC 3OYNA 4ZQHA 1MBEA 1X58A 4JK1X 3H9QA 4OAYA 1W0TA 1MW3A 3JTHA 3JTGA 4IL6C 2WB1A 3BR1A 2X6WA 4A3BJ 5E20A 2DMPA 2HTSA 4EGYA 1J0RA 3ONQA 2DQ6A 3EETA 4P5OA 1Z3XA 1VQ8I 2E71A 3BZCA 2H27A 1X3WA 4K5NA 1FP1D 3HRTA 3B34A 3WE2A 1OCPA 4K5MA 1O3SA 1K4SA 3F6VA 4AU7A 4ON0A 3OYAA 3KP7A 3U1KA 4I99C 1IO2A 2BE5F 5BS6A 3DTEA 2GA1A 3CUQB 3U9WA 2OA4A 9ANTA 3DBLB 4EM2A 1WI3A 1MMSA 3CP2A 3DLLF 4CA0A 3A0BC 4AIHA 4IXAA 4BE1A 1OCCH 1TQPA 4I02A 3ZMDA 4PSWA 2DMUA 1WPKA 3DXJF 4ZDPA 4R1HA 2VIXA 2JWTA 3H1CA 2RQPA 4E7IA 4K5LA 1FTTA 2CGPA 3ABMH 2FNPA 1VQOI 2D5VA 2IS6A 3M8EA 1BIAA 1QHGA 2LDUA 3S2DJ 3FBNB 1KONA 5E79C 1U0JA 1D5VA 3CHQA 1UHWA 1HKSA 2QUFA 1YITI 4XR6A 2EGHA 4HA8A 3CCMI 2JA8J 4YIIA 2PQ8A 2MAPA 4PFPA 2DXIA 2A6EF 1R0KA 3CESA 4ZQGA 2PL5A 3BTIA 3PO3J 4L9TA 2QSGX 1BR1A 3FTYA 3HBLA 2VKHA 1MZBA 4HF0A 2IPQX 3SZGA 4E7KA 3ANNA 2Y1EA 2PJRA 3AU8A 4CHUA 2DDBA 4YG2F 5LRRA 3KFWX 2JVHA 1D0YA 3M3YJ 3ZQLA 2LYCA 1MBJA 2K9NA 4ZYHA 1IV8A 1DU0A 4JBAA 3FH7A 3B7TA 1MMAA 2CW7A 1GVJA 4HF2A 4ASNA 1DPRA 2HXIA 1RUOA 3K4JA 3LFKA 2FUG2 1TC3C 4FCYA 1FBQA 1UB9A 3QYFA 3KPHA 1XPXA 2MH2A 1OR7A 3HM5A 1ZRDA 3T0YA 1UJ8A 3D5LA 2IS2A 1P92A 1K6YA 4XN9A 2COBA 1OLTA 2CV0A 3J81Z 4UUVA 1FEXA 3ECHA 5JO0A 3IKTA 1Y0NA 4LMYA 2KHMA 3SDGA 2O0YA 2Z16A 3BC8A 1ZREA 1D0XA 3I9V2 4E7LA 3QU3A 2NXNB 1ONVA 2ZNYA 3BROA 4WK8F 2IA1A 1BN5A 2EFOA 2EZLA 4XKWA 1G3WA 1DP3A 1SG7A 1T39A 5IY5H 2PJPA 3CIAA 3OYKA 2V1XA 1I6XA 4HX7A 3S2WA 3DV8A 2LOOA 1R5GA 2ICWG 2QBYA 4KIBA 2NOGA 5D6FA 1SMTA 4FLQA 2XROA 4PSXA 1SD4A 5L3CA 4CGZA 3GXOA 3CCRI 2EFPA 2LTPA 1EJ9A 3BPVA 3OL4A 3FXRA 4AYBA 1RKTA 3SZPA 2Q0OA 3FKIJ 3LNQA 2HQNA 2R93J 1H3LA 5IOYA 5LHIA 3IAS2 4UVCA 2M7BA 3N4MA 5JLXA 3I59B 4M6YA 3I58A 3GMEA 3G3ZA 3I56I 4BDYA 2QEXI 3AUAA 4N4NB 5H2FC 1OISA 3AL0B 2FF4A 2DK5A 1ZG5A 2GQQA 1ULYA 4A6DA 2HNHA 4MO7A 2LR8A 2X6OA 3CP8A 2R7WA 1HDPA 2HDCA 2FMLA 2NRAC 1MDMB 2KKOA 4MEXF 1MNEA 2CUFA 3HTUA 1JJ6C 1I6HJ 2WAQN 3ZI0A 1X1DA 5E3MA 3PSFA 1J7KA 2XPWA 3Q0WA 3RCOA 4KISA 3K4BA 2XGXA 3CUQA 3TW6A 4NQWB 1JKPC 3GTKJ 3GF2A 1E3OC 3A1YA 4NHJA 4Q4IA 5GPAA 3VDXA 4BU2A 2A3SA 4B8XA 3FUIA 3O6BB 2M5WA 2EFQA 1DGWY 3I54A 4QPQA 1T8IA 5AIQA 4GGGA 2A7OA 2QSFX 1S7EA 2W48A 2DBBA 4G6QA 4HQEA 2M8GX 1LQ1A 1KYZA 4RA2A 5GAEJ 4EJOA 2FEZA 1XMXA 4OOIA 3WTWC 3KZZA 4X6AJ 3ZQGA 3ULQB 2DYRH 5C3EJ 2CFOA 1REPC 2KL4A 1RESA 2RVCA 1ZS2A 1UFMA 1AA7A 2VUMJ 5GADJ 1ORKA 4CCMA 1R71A 3F8BA 4CSWA 3F8NA 4WWCA 4II2A 2LF7A 4Y3OA 3MCZA 1B72B 4AIJA 4K5PA 1XGOA 4A0XA 5LFAA 3S3OA 2VBXA 5D8LB 4BACA 4JOMA 2L3DA 3W6KB 1NK3P 2JRMA 2L7KA 2F2EA 4FASD 1TT5B 1QPIA 3A06A 4DZPA 2P5VA 3B7SA 3DU5A 2OPTA 2L7ZA 1FX7A 4IEJA 2GXAA 1R6RA 2KJBA 4Q4EA 1L0OC 1WCMJ 2PLYA 3IHUA 5CLSA 5CVVA 1U5TC 2KISA 2GXBA 2I5UA 2BV6A 3GW2A 3OMYA 4IHTA 3JAMZ 1S5LC 3E97A 3KCCA 2X1DA 2ZFUA 3B7RL 3FULA 2X4HA 4B44A 1ZGWA 5KAFC 4MQ9F 4XLFA 3S1NJ 4CYCB 4MHGA 2QKLB 1HKQA 2IS4A 2MGQA 1QU3A 4AVZA 5GAGJ 4RB3C 1WSUA 5JHFA 1LVAA 3OR1C 2R7ZJ 4GO1A 2JA5J 3O8HA 1RIOH 4RVBA 4GYIA 3ZHXA 3WQQA 1YX5A 3MKWB 1D0ZA 2P4WA 4IOAF 2DT5A 4C2MJ 1W4MA 1VQKI 3G73A 1R0LA 4QIWN 4RSYA 2IW5A 3SHFA 1R58A 3BR3A 3CDHA 2X0LA 1TBXA 3CHPA 1KU7A 2QKMB 2Y1DA 3NQOA 1UHSA 2CMPA 2E7WA 4IHVA 4BUPA 5FLVA 2VPLA 1ERDA 1FOWA 2PEXA 4EV0A 4F52A 2JN6A 3IP4B 4HNVA 2XSDC 4LIVA 1QO0D 4F91B 4HAMA 2XGDA 1TL8A 3FM3A 5HOOA 2XAGA 3ZMSA 3I3LA 1Z6RA 1F5TA 3RKWA 1IDZA 1SC5A 5GPCA 4ZZDA 2K3PA 4NDLA 1IAWA 3L7WA 3RI4A 5IYCJ 4HYEA 5GP9A 3T8RA 3KETA 2DLLA 2F6CA 2MAOA 3QOPA 1NG6A 4P96A 2UV1A 1R9TJ 2KPMA 2M34A 2W57A 2HXOA 1D5YA 4MFEA 4N9IA 1DQUA 2LC2A 3I59A 4AYBN 2Y1CA 5FWQA 2AHQA 2DMTA 3V7CA 5BMZA 1MBGA 3QPSA 4A6EA 2WADA 5L3GA 1DUXC 4ITVA 4ZTJA 3NWSA 3H5RA 3TO9A 3K4LA 1OFCX 2AXLA 3GLLA 2HYGD 3ZQFA 4BKXA 2NVXJ 1R00A 3RZDJ 1UCRA 1MDMA 4D5CA 2PN6A 3QOEA 3ABLH 3JRFA 4AR1A 4XKBA 4XLCA 1YJWI 4GCVA 2AQFA 2FNAA 4U0VA 4OIQF 3E5XA 4XL9A 1H9TA 1OQYA 3KP3A 1AHDP 1ETWA 1WRJA 2RREA 5F04A 2KDZA 3VYSB 4NQWA 2WV1A 2ELJA 1MMNA 1YW7A 3EPZA 4HOBA 3OYFA 2R7QA 1RUNA 4J00A 2YU9J 2CFXA 2K3FA 2NVTJ 3FUNA 2DOAA 1I1GA 3BZ6A 4M72A 4LOCA 3HL2A 1QHHD 5AIPA 2LLKA 2DA1A 1X2MA 3AKZA 2NNNA 1S46A 2KIQA 1V55H 4MTDA 3RASA 1G3YA 3OYBA 3ANLA 2ELKA 2ZO4A 3R0JA 4X0GA 3BTCA 4JX5A 5LGNA 3N97A 4XMYA 4RB1A 2PI0A 2KRFA 2H94A 4FE4A 1HA8A 2QQBA 3DKWA 3KLOA 3QAHA 3LSHA 3G6EI 3UCQA 2LY9A 2WY8Q 3PO2J 4XKVA 1W0UA 4I2OA 1I3AA 1OYIA 1OJLA 2X9DA 2V9PA 3E0JB 1H8AC 3P9IA 2R7FA 4ZYDA 4ETSA 5A2QZ 2Y2ZA 2JV7A 5IT9K 2ZKZA 1ZRFA 4NUBA 1MMDA 1I39A 1A5JA 2BEOA 3VVLA 2ZFWA 4AIKA 4U7DA 2D1HA 3E6BA 3NRVA 3PUBA 3TOAA 3CMMA 3GBGA 5H6RA 2OAZA
chains in the Genus database with same CATH topology
2C5ZA 2CS3A 3HPGA 4XMZA 3EBIA 2P0WA 3BLYA 1T1SA 1D1AA 2ZXIA 4PJNA 1V5EA 3DEEA 3ZGKA 2R59A 4BQQA 1Q0HA 3FH5A 2V4JC 3DQVC 2VXDA 5JMWA 4XN1A 4Y33A 3B7UX 1EA3A 3K10A 3RC3A 2HU9A 3EBHA 3L2VA 2KQRA 2L9SA 3KEDA 1UELB 1YE9A 1ZELA 1UG0A 4XN8A 5JBIA 3L2UA 1LDKB 2VJJA 2X51A 2JCVA 3D5RC 2ZXGA 3OYNA 4K5OA 2GOMA 4ZQHA 1E0EA 2DT7B 2Y1FA 1NG7A 4G6TB 3H9QA 4OWRB 1BOBA 2R4GA 4OAYA 2WZGA 1MW3A 4PW4A 2MFZA 2PMZA 2WB1A 2X6WA 3OIQA 4BXFA 3H9JA 2JCYA 4Y6SA 3T8VA 4R79A 1BR2A 3ONQA 4ZW3A 2DQ6A 2V6EA 3M1CA 4P5OA 1Z3XA 2JVGA 1SAUA 1S9HA 1D1BA 1X3WA 2CUZA 4K5NA 3H35A 4Y6RA 3B34A 4ZC3A 3FUDA 3FKJA 2JCXA 4K5MA 3FTUA 4IKFA 2O5RA 4J3BA 1WJEA 4AU7A 3DWLE 3OYAA 3DTEA 3U9WA 4ZX3A 2OUMA 3UERA 3OY9A 3S3MA 2FFLA 2JA2A 3CP2A 1MW0A 4CA0A 4CCJA 4BQNA 4ZJZA 2HPIA 3PNYA 4BE1A 1G59A 2IS1A 4F3QA 4ZX6A 5KNLA 2IGKA 4PSWA 3OYLA 4ZDPA 5CPRB 2VIXA 3EUAA 4XM3A 3OYJA 4GAEA 3H0DA 4E7IA 5JC1A 4K5LA 3K4KA 3CJQB 4NC8A 2M4GA 2UWMA 2X1CA 2IS6A 4PFOA 3N05A 4PUSA 1QHGA 3C2HA 4XO3A 3FHEA 4AR8A 3FBNB 3QYEA 4Y67A 3LFUA 3WQRA 3DPLC 1KONA 1X3ZA 1V5GA 4QPOA 1U0JA 2XF7A 3CHQA 4HSRA 3D5SC 4DPRA 4BJTA 4XR6A 2VJ4A 4PK4A 3VSLA 2EGHA 5BPPA 1Y56A 3FUFA 2MAPA 3KEYA 4PFPA 2R7RA 2DXIA 1R0KA 3CESA 4ZQGA 4KJZA 2PL5A 2LH9A 3RSNA 1BR1A 4XNFA 3BG7A 3FTYA 3OYDA 2VKHA 2LBFB 3SZGA 3ANNA 2W1OA 4E7KA 4MLOA 2Y1EA 2PJRA 3AU8A 3VYRB 2HVRA 2Z1DA 2XAUA 3FU6A 2JVHA 4QPEA 3K70D 1D0YA 2RJIA 4XMWA 2KRHA 2LYCA 3K4NA 3HXLA 2F4IA 3SEZA 4BL0B 4E6KG 2MYSA 2LY1A 3B7TA 1MMAA 2CW7A 3H5AA 2C82A 3FH7A 4XO5A 4BQOA 4DOZA 3CJRB 4QHPA 3K4JA 3DLAA 2FUG2 3J7AY 3MMYB 3ZCOA 4F55A 5CQEA 3QYFA 2HPMA 1OR7A 2E1MB 2L5QA 2LBFA 3SYTA 3T0YA 3D5LA 4Y4RA 2IS2A 4C2TA 2K9MA 4E4HA 1K6YA 1JG9A 4XN9A 1OLTA 2VQLA 2CV0A 4A03A 4LUPA 2LRDA 3QYBA 2JD1A 5JO0A 2KHMA 2Z16A 1OR7C 3BC8A 3KYLA 5HLTA 3W2AA 2JD2A 1D0XA 3I9V2 4XONA 4E7LA 1ONPA 4IX7A 2WBMA 4XLAA 3ZQQA 2JD0A 4JNDA 3ZHYA 2O7GA 1JI8A 2WAFA 3HG9A 4U87A 2M0MA 3CF2A 4ZDOA 4KP7A 4F93B 4E7SA 3LMMA 2X6XA 4AICA 4XKWA 4HEA2 1T1RA 3FTVA 1DP3A 2DQMA 3L2WA 1SG7A 4LG3A 3CIAA 2E60A 3OYKA 4XOTA 3EBGA 2BW3B 1WJBA 2LOOA 2QVWA 3QJXA 2XC7A 1SFKA 4CCKA 2DT6A 4DGWB 5FRNA 1MW7A 2E1MC 4FLQA 4PSXA 5HNHA 2M4KA 2OV7A 3PNTA 4BE2A 3DPTA 4PVBA 4CXFA 3FTWA 4MS6A 3VYUB 4ZN6A 5DYFA 2PUSA 1PJRA 2WAQA 2V1NA 1WJCA 2MD0A 2V26A 3OL4A 4AYBA 3W3CA 2W00A 4YEJA 2Z2SB 3C2GA 2E5NA 3UNGC 3DPUA 3B2PA 4HSTA 2W7NA 1H3LA 3IAS2 3FU3A 2M7BA 1MNDA 4BDYA 4XMVA 3A14A 2JUGA 3F9KA 3AUAA 4N4NB 2PGGA 3FHNA 4HPQA 2HPOA 1MMGA 2KLOA 2Q1ZB 4RLFA 3B3BA 3AL0B 1J09A 1GW6A 5JAZA 3LSGA 2HNHA 3CP8A 2WAEA 4LITA 3S93A 2R7WA 4IZZA 2VJIA 1LVKA 2VL8A 3DKYA 1T0FC 4ZQFA 4IQ4A 3ZRGA 2R7VA 2BOLA 4C9YA 4XMTA 1MNEA 4F92B 1Z21A 1TZLA 3PJRA 2CV2A 2Y0SA 3ZI0A 1X1DA 1X19A 3PSFA 5KCMA 4RCVA 4QUOA 2R7SA 3HUGB 1VZ0A 3OIPA 4PJJA 3RCOA 4BJ6C 4KISA 1JGIA 3K4BA 3A4CA 2HDWA 3DTKA 2WZFA 4NQWB 1V5FA 3CHRA 5DULA 3TMOA 4RM2A 4XORA 3A1YA 5JMPA 4Q4IA 4BU2A 3VDXA 4GAAA 4J01A 4X2UA 4XLHA 1Z7LA 4R5TA 3FUIA 3FTZA 1DGWY 2DCEA 4QPQA 4FETA 2A7OA 3CZKA 3JSZA 3HOTA 2DJIA 3VVMA 3BCBA 2CH0A 3HKZA 3K6GA 1HS6A 3FUKA 3VSKA 4RLQA 1YX3A 3K70C 2XSJC 1X4PA 3VWBA 3W2WA 3PUUA 3W2VA 1FMVA 3NWTA 3FU0A 2CFOA 3S3NA 2KL4A 1ZS2A 1AA7A 4N4OB 4ZW5A 1RP3A 4CCMA 3OYGA 4CSWA 2NOJB 4II2A 2OC6A 4CCNA 4Y3OA 2HZDA 3QODA 3RTRA 4K5PA 4ZW6A 4XN2A 4CUGA 5LFAA 3S3OA 4XN0A 4BACA 4JOMA 2ZXHA 3BG6A 4CZCA 4HRIA 4BDZA 4JQFA 2F5VA 3ZHZA 2L7KA 4II3A 4CCLA 4FASD 4C2UA 3E1SA 3A06A 4DBRA 3OYCA 3B7SA 3OWTA 5KHDA 3OS0A 3DU5A 2CV1A 3OL3A 4H4KC 4OOEA 1R6RA 3H5NA 4LIUA 4BEHB 4E7ZA 4Q4EA 2M7AA 2B61A 2K5CA 3K4MA 2MABA 2RQQA 2Y1GA 2RNGA 4KT6A 3HPHA 3OMYA 4EATA 3EUHC 4HNTA 1TT0A 3ANMA 4ANJA 2W4SA 1WJAA 2BVLA 2KP6A 2LY2A 1BR4A 1PYVA 2X1DA 2ZFUA 3B7RL 3FULA 3FDYA 1WJDA 4B44A 5TGTA 4ZQTA 4HG2A 3UR3C 4D9JA 4XLFA 2KZVA 3R0IA 2L9NA 3V42A 4AYSA 2QKLB 2IS4A 1QU3A 2XPYA 1DGRM 2L2OA 4AVZA 4BJ5C 3M8JA 1T95A 5JHFA 3IAM2 2MC4A 3OR1C 3CZ6A 4D1QA 3MKZA 2WPGA 5JNLA 1P9QC 3IIEA 2I8DA 1N75A 4FLSA 4B47A 4RVBA 4BS9A 3WQQA 3ZHXA 1ONNA 4AR9A 2XQ0A 3WQSB 1YX5A 3RQ4A 3MKWB 4L2LA 1D0ZA 4XN3A 5CQGA 1MW1A 2KRCA 3L2QA 2IGOA 3CHOA 1K5HA 1X1AA 2GOXB 1R0LA 4RSYA 2VQHA 4R5XA 2BVMA 4FCAA 2VKDA 3CHPA 2QKMB 4B48A 2Y1DA 3OS2A 3Q43A 2CMPA 2VPLA 4XNBA 4BUPA 3RC8A 3OR2C 5HNFA 1ERDA 3ZXSA 1Q0LA 2AQEA 3S32A 2LREA 3IP4B 4F52A 2BW3A 5EV7A 4QIRA 4LIVA 5HVQC 4F91B 3DU6A 5HOOA 4B43A 1W36C 3I3LA 3U21A 3FTSA 1Q0QA 1SC5A 3KX2A 2K3PA 4QMEA 1FMWA 1W36D 2VB6A 2F6CA 2MAOA 1NG6A 2M3AA 4XMUA 1X4OA 2UV1A 2KPMA 2V7FA 3TL4X 1DQUA 2LC2A 4DIQA 4P1WA 2GTQA 4IQJA 4Y6PA 2Y1CA 5FWQA 2VASA 3A2KA 1G5AA 4ZX4A 4BE0A 3K4CA 3CHSA 2IGMA 5CKTA 2VQGA 2X85A 2R70A 4XMXA 1X1BA 2WADA 4OAZA 4ARFA 4ITVA 4E7HA 4ZTJA 3NWSA 3H5RA 3S8PA 3K4LA 3CZLA 4R5VA 4XOPA 2CW8A 1GLNA 4PJLA 2VLAA 1UAAA 3LSMA 3HC7A 4BKXA 3EUKL 2ZSIB 1JVSA 5AENA 2KMUA 3AFHA 3G2BA 4DJAA 2R72A 3QOEA 3Q44A 4PU2A 4AR1A 4XKCA 2WA0A 4XKBA 4XLCA 2R7TA 4ZW8A 3SDBA 3OYIA 3AL0C 1ONOA 2QJ1A 4PJMA 2AQFA 2X6YA 3DKXA 3HOSA 3AU9A 4HNUA 4ZX5A 4XL9A 4U7BA 2RREA 3UEQA 1WFXA 1LKXA 3VYSB 4NQWA 2XF5A 2E5ZA 2ELJA 2PJRB 1MMNA 3FBIB 1H19A 2HVQA 2ZSHB 4XN4A 3EPZA 1X1CA 4CH7A 4XQFA 2UUZA 2K9LA 4YRVA 3OYFA 3FUMA 2IXSA 4NC7A 3MKYB 2WY7Q 3OYHA 3SEQA 2R7QA 4J00A 3DTIA 3OS1A 3FTXA 4FLOA 4XNAA 3FUNA 4MKTA 1N77A 2DOAA 2HPTA 2Q2EB 4C30A 4XN7A 2KDOA 3HL2A 4GRIA 1QHHD 2R7XA 3LSKA 3MD2A 3FUJA 3H9GA 3RPUD 3AKZA 3TBIA 4BGDA 1S46A 5DLLA 3PL8A 2V9KA 3RASA 3OYBA 3ANLA 1N78A 1WJFA 2W82A 3LSIA 4X0GA 2JSPA 3PSIA 4E7JA 2XPZA 2R7OA 4XMYA 3FU5A 4ZQEA 1LFPA 4ZW7A 4RM3A 4XLEA 2X1EA 4ZYAA 4DBQA 4ZTFA 3BCAA 1HA8A 2VXZA 3FUHA 3JT1A 2HVSA 1G8XA 3LSHA 3PFYA 3ZR8X 3OYMA 3CZEA 3UCQA 2WY8Q 4XKVA 2A5WA 2LG4A 3B37A 5FRMA 2R7UA 2CUJA 1Y6IA 4NNJA 3E0JB 3FH8A 3FUEA 3OOUA 4XN5A 1D1CA 2VJ5A 2A6TA 2VQCA 2JV7A 5LD2C 4B3XA 1SQMA 3L2RA 4CCOA 4XO4A 4XNDA 4NUBA 1Z3YA 1MMDA 1MVYA 4OOFA 2XDVA 2IGNA 3VVLA 4BEHA 2XF6A 4R7LA 3IUOA 3B2XA 4YELA 4KITB 4ZDLA 3PUBA 4RMNA 5FROA 3OYEA 3LL7A 3VYTB 3CZGA 1WJ5A 3CMMA 3PNVA 4FLRA 3GBGA 1IRXA 2HQAA 1MW2A 2VJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  5HLT A;  5HNF A;  2VLA A; 
#chains in the Genus database with same CATH topology
 2F4O B;  2IJL A;  3HPG A;  4FHT A;  3EBI A;  1ZTR A;  1T1S A;  3A02 A;  3BJ6 A;  2R5Z B;  3CDL A;  3GFJ A;  4IRG A;  4UVA A;  4M9Z A;  4DW6 A;  4Q5S F;  4Y33 A;  4XN1 A;  4F7Z A;  4L5E A;  4EEF G;  3MAJ A;  2FA5 A;  3EBH A;  4CYC A;  1SVM A;  2DYS H;  2JPC A;  1DDN A;  5JLW A;  3LA7 A;  1ZEL A;  1YE9 A;  5ERI A;  4XN8 A;  1H0M A;  1UMQ A;  1VI0 A;  1X3W B;  4HDU A;  3JRA A;  4AWX B;  3V7R A;  2IRF G;  2ZXG A;  2GOM A;  5C4X J;  4XRS A;  2DT7 B;  3HRU A;  2Y1F A;  1Y8Q B;  2BXY A;  1U9O A;  3C18 A;  1BOB A;  2R4G A;  4G6T B;  5B66 C;  1IDY A;  2MFZ A;  5CJ9 A;  4BH9 A;  4OIR F;  4BXF A;  4L9J A;  1O7F A;  2QQ9 A;  2BHZ A;  2EIK H;  2ZCW A;  3WE3 A;  4EVI A;  2NVQ J;  1Y8R B;  4GFB A;  1R23 A;  5B1B H;  2JVG A;  1SAU A;  1D1B A;  1UST A;  2B7E A;  5E1W A;  3WGI A;  1K78 B;  2QLZ A;  3FUD A;  3J7Y J;  2QYO A;  1O57 A;  3FHZ A;  4KIC A;  4A0Y A;  1MSF C;  4EJU A;  1ZYR F;  5FO5 A;  4BBR J;  5DYM A;  2JA2 A;  2QQ8 A;  1WH7 A;  1HC8 A;  1LUJ B;  2NVU B;  5BPD A;  1A6Q A;  3RKX A;  5KK1 A;  2EFW A;  1H88 C;  2IS1 A;  3L9F A;  1S6L A;  2FSW A;  1Z1D A;  1TNS A;  1B4A A;  4KUM A;  1D3Y A;  5CPR B;  2WTE A;  2IBD A;  2ZXJ A;  4XM3 A;  2JJ7 A;  4EGZ A;  4GAE A;  3H0D A;  3K4K A;  2HOE A;  3CJQ B;  1IGN A;  3KIO A;  2GIZ A;  3QPL A;  3N05 A;  4UHT A;  2F48 A;  1POG A;  3K1N A;  3LFU A;  1BM9 A;  1RRJ A;  4QPO A;  2EV6 A;  2XF7 A;  4HSR A;  4DPR A;  1U5T B;  5JR3 A;  5HOD A;  1YFH A;  1U2W A;  2L01 A;  4PK4 A;  3VSL A;  1VQP I;  1JJ8 C;  3ABU A;  1Y56 A;  4IHS A;  2M2E A;  2M9H A;  2YX4 A;  3K1P A;  3AG4 H;  3HZJ A;  3WHB A;  2O03 A;  3OV8 A;  3BG7 A;  1YW9 A;  2AXT C;  2W1O A;  4MLO A;  1BW5 A;  2HVR A;  1DU6 A;  2Z1D A;  3UKG A;  4QPE A;  5F0H A;  2P81 A;  3K70 D;  1KU3 A;  4EQQ A;  1R36 A;  1Z05 A;  1JGS A;  1Z7U A;  5DTD A;  1XSD A;  2F4I A;  4Y52 J;  2MYS A;  3H5A A;  3JR9 A;  2C82 A;  4A93 J;  4DOZ A;  4QHP A;  3H36 A;  1KQ9 A;  1T56 A;  4FIS A;  3ZCO A;  2JPB A;  1B9N A;  1ETQ A;  2LBF A;  3F21 A;  4MQV A;  3O2P E;  3U2R A;  1GUU A;  3BPX A;  2K9M A;  4QLC U;  1JG9 A;  4YIF A;  2H8R A;  3BQZ A;  1TWH J;  5ILV A;  2VQL A;  2G9W A;  2OU2 A;  4DZJ A;  2DA2 A;  4HX8 A;  2LRD A;  2L9V A;  1HLV A;  3J81 K;  2IT0 A;  3IWZ A;  3JSO A;  4XRF A;  1ACI A;  1R1U A;  3PQJ A;  4V19 K;  4M74 A;  2XAQ A;  1BI1 A;  1D8K A;  4XON A;  1I27 A;  3QP5 A;  1FTZ A;  2O7G A;  4Y7N J;  2OCC H;  4XSX F;  1H9G A;  1X1P A;  1VQL I;  1B6A A;  2EJR A;  2X6X A;  4A3I J;  4AIC A;  3GTP J;  1T1R A;  2DQM A;  3F3X A;  3BR6 A;  2E60 A;  3BR5 A;  2E34 A;  2W24 A;  4XOT A;  1I3Q J;  4X1E A;  5HLI A;  2XAS A;  1IZ1 A;  4EMS A;  1WJB A;  2QVW A;  3QJX A;  2XC7 A;  2JUC A;  2DT6 A;  3K0L A;  3WU2 C;  4DGW B;  2R5Z A;  5TIS C;  2E1M C;  1WI9 A;  1ZK8 A;  2QQA A;  5HDN A;  3ECO A;  4BXX J;  5K5Q A;  1HCR A;  4MS6 A;  4HLY A;  3BR2 A;  2WAQ A;  2V26 A;  2CQQ A;  2FBH A;  3CCU I;  2XGE A;  3W3C A;  5L3D A;  4FX4 A;  4YEJ A;  3E3V A;  2Z2S B;  3C2G A;  2E5N A;  2Z9O A;  4AM3 A;  1QNT A;  3DPU A;  4HST A;  2W7N A;  3ML6 A;  5M3M J;  4O3M A;  2JUG A;  3CJN A;  3MZH A;  4XK4 A;  1GXP A;  2HPO A;  2PGG A;  1R5I D;  4UNO A;  3RQI A;  4RLF A;  3B3B A;  1J09 A;  2E2J J;  2Y48 A;  5BQT A;  5JAZ A;  3LA3 A;  1M1E B;  2W25 A;  1IXC A;  2WAE A;  2PBI A;  1G2H A;  3BOQ A;  2VJI A;  1LVK A;  2VL8 A;  3B02 A;  2CW0 F;  3QRF F;  3ZRG A;  2R7V A;  2BOL A;  4C9Y A;  5LEK A;  2A07 F;  4XMT A;  4F92 B;  1Z21 A;  1DP7 P;  3S16 J;  1K78 A;  3CCQ I;  1E2X A;  4RGU A;  5KCM A;  1JE8 A;  1L3L A;  4RCV A;  4QUO A;  1JGG A;  4BJ6 C;  1AU7 A;  1XSV A;  3Q0U A;  5IOZ A;  1JGI A;  3A4C A;  1YOV B;  3DTK A;  2GA2 A;  2VOO A;  2G0E A;  4RM2 A;  4XOR A;  3RKQ A;  3V8K A;  5JMP A;  2HEO A;  3K2Z A;  5DD4 A;  1BC7 C;  4GAA A;  4X2U A;  1BJZ A;  2XKO A;  4JYK A;  2EIM H;  5J4Y A;  2I10 A;  3BTL A;  4FET A;  2MSY A;  3JSZ A;  4PDK A;  2J5P A;  3HRS A;  3BWG A;  3IH4 A;  1FBU A;  2H1L A;  3BCB A;  4M71 A;  5DS9 A;  3ZPL A;  3H3V K;  1S7O A;  2P7C B;  2NS8 A;  1R1V A;  2GXG A;  1V3F A;  3HKZ A;  3K6G A;  5D4S A;  3FUK A;  1A04 A;  2IA2 A;  4RLQ A;  3I4M J;  4DNC A;  1JXS A;  1YX3 A;  2HKO A;  2XSJ C;  1ZR2 A;  5EGO B;  3PUU A;  3P9K A;  1OMI A;  1BA5 A;  2V9V A;  3EDP A;  5B3S H;  5E3N A;  3W2V A;  1FMV A;  2EZH A;  3GZ5 A;  4IHX A;  2DA4 A;  3S3N A;  2FJ1 A;  4L5I A;  2BXZ A;  4OMZ A;  3HEF A;  5HS8 A;  4ZW5 A;  1RP3 A;  1HXD A;  2VT3 A;  2NOJ B;  3LSP A;  4KN4 X;  4CCN A;  1TWA J;  2HZD A;  1U5T A;  2ZBK A;  4CUG A;  5B5E C;  2FD5 A;  5CVI A;  4CZC A;  2MLG A;  3ZHZ A;  4UUT A;  1QVU A;  4CCL A;  5DCF A;  4DBR A;  3BT9 A;  5KHD A;  3KEQ A;  4I0A A;  3OL3 A;  4H4K C;  3RJP A;  2D2W A;  2XB0 X;  3H5N A;  4C3J J;  1ZRC A;  3GTO J;  2Y9Y A;  1FJL A;  5F6F A;  3IRQ A;  3K4M A;  5J1R A;  4BXU A;  1ZHF A;  2XUB A;  4A5M A;  3FF5 A;  3JRB A;  4KT6 A;  3CCL I;  3NEU A;  2KIM A;  1MJA A;  4HNT A;  1LEB A;  4ANJ A;  4JX4 A;  2BVL A;  4P9F A;  3JAM K;  3HOX J;  4J19 A;  1R1T A;  3BG3 A;  3FDY A;  5B1A H;  2YPR A;  1XTA A;  4I09 A;  4M3G A;  1JUS A;  2ISY A;  4HG2 A;  4D9J A;  1ETO A;  4UB8 C;  2L9N A;  1HKT A;  1VQ7 I;  1MGT A;  3BR0 A;  4UUS A;  2H8W A;  3CQZ J;  1DGR M;  3CO7 C;  3TOB A;  2E1N A;  5J8C A;  3M8J A;  4XRM A;  4B4C A;  3MKZ A;  1HW2 A;  4LK1 F;  3CJT B;  3IIE A;  1TW3 A;  3FXU A;  4OU0 A;  1JT0 A;  5FFZ A;  4FLS A;  1RZ4 A;  1Z0X A;  4MNU A;  4BS9 A;  1T38 A;  1ONN A;  4RAY A;  3BP8 A;  4W1U A;  5CQG A;  1MW1 A;  5CVR A;  2KRC A;  2PMH A;  3MVP A;  2ZME C;  4PCQ A;  3T5X A;  5HLG A;  1VQN I;  5LRS A;  3CHO A;  3B6C A;  2VQH A;  3K9T A;  2BVM A;  1CQT A;  1QQI A;  2VKD A;  1LE8 A;  4XNB A;  4BYY A;  3RC8 A;  2EFN A;  1IN7 A;  2DA5 A;  2DOF A;  2B9S A;  4G7O F;  3TO7 A;  2MW8 A;  2LRE A;  3PIO F;  1J5Y A;  4BHP A;  5EV7 A;  5IYD J;  5HLH A;  4QIR A;  5HVQ C;  2E7X A;  5CVU A;  2FRH A;  2DPU A;  3TDZ C;  3A01 B;  4A3C J;  1Q0Q A;  3S1Q J;  1G3S A;  1S3J A;  2HWV A;  2FU4 A;  3KP6 A;  4L0Z B;  4LLN A;  2DMQ A;  2XKP A;  3KLN A;  4FE7 A;  3FXQ A;  1VFC A;  2V7F A;  2R92 J;  3TL4 X;  5K7F A;  2VOP A;  3Q5F A;  4DIQ A;  4KDP A;  2VAS A;  4A3G J;  1G5A A;  5EYR A;  2PMU A;  1FY7 A;  3PIP F;  3K4C A;  1TTY A;  3IWF A;  3CCJ I;  3S17 J;  2IGM A;  3HTS B;  2VQG A;  3RYR A;  1EKE A;  3WTS C;  4XMX A;  2R5Y A;  1IJW C;  1OCR H;  4OAZ A;  5F0F A;  2RDP A;  4E7H A;  3CZL A;  3I5U A;  1VQ9 I;  2DA6 A;  1JKR C;  3EYY A;  2CW8 A;  4A3L J;  1GLN A;  3LSM A;  3HC7 A;  3TKY A;  1JVS A;  2JT1 A;  3U9G A;  3G2B A;  5AEN A;  2R72 A;  1HQC A;  3GVA A;  4M73 A;  5ILU A;  4PU2 A;  1E3H A;  3ABK H;  4ZW8 A;  1V4R A;  3GEZ A;  3R0A A;  4PJM A;  1B8I B;  1W7P B;  4U7B A;  4JP0 A;  4ENN A;  1WFX A;  1LKX A;  2O6G E;  2VBZ A;  1MNM C;  2FBI A;  2XPV A;  2ZSH B;  4QSH A;  4AID A;  2BYV E;  4CH7 A;  1X1C A;  4XQF A;  2UUZ A;  5L3E A;  2IXS A;  3HB9 A;  4NC7 A;  3MKY B;  1KQ0 A;  3OYH A;  5FLX Z;  3SEQ A;  2EA4 A;  2M45 A;  4A3J J;  2Y69 H;  2VPR A;  3Q9V A;  1N77 A;  1SFX A;  1V54 H;  2Q2E B;  3AG3 H;  4GRI A;  3MD2 A;  4IJA A;  3TBI A;  5EZH A;  4DYR A;  5EGO A;  3MEX A;  3FIS A;  3PSI A;  4E7J A;  4ZQE A;  3GUD A;  4ZW7 A;  3M7G A;  2RC4 A;  4NC6 A;  1N25 A;  3T1B A;  3HKZ N;  3FUH A;  1W1W E;  3BCA A;  1YO5 C;  3JT1 A;  2HVS A;  2HQR A;  3CZE A;  1B1B A;  4Y15 A;  2LG4 A;  1QZY A;  2E2I J;  4GXO A;  2R7U A;  2CUJ A;  2STT A;  3FH8 A;  3KEO A;  3SZT A;  1OCO H;  4YFX F;  1D1C A;  1BI2 A;  2VQC A;  3TGN A;  3REO A;  5LD2 C;  4O6J A;  5M5X J;  3K2A A;  4XO4 A;  1I1S A;  5EJC A;  4C3I J;  3HYI A;  1MVY A;  4OOF A;  1WZ2 A;  5K1Y A;  2BGC A;  4XID A;  3I53 A;  2XF6 A;  4R7L A;  3KZY A;  3B2X A;  4YEL A;  1BC8 C;  3OYE A;  4RMN A;  4DYQ A;  3RDI A;  2A6H F;  2M8E A;  1QPM A;  1WJ5 A;  2VJ8 A;  5F1R A;  1MW2 A;  2ETH A;  2K7L A;  2UXX A;  2CS3 A;  4PJ0 C;  3GTG J;  2IA0 A;  1P4W A;  2CO5 A;  2CWE A;  3CTA A;  3FZV A;  1FT9 A;  1IRF A;  4PJN A;  5FLM J;  5DCM B;  4PGG A;  4BQQ A;  2OQR A;  3ASO H;  2VXD A;  5DDG A;  3B7U X;  2RNJ A;  3K10 A;  2VBY A;  2LKS A;  3WTV C;  1YLF A;  4M6V A;  2HU9 A;  3J80 Z;  3RC3 A;  3E6D A;  2Y75 A;  1KZH A;  4XBF A;  2KZG A;  3GLX A;  3R4K A;  3KED A;  1UEL B;  2L0K A;  5JBI A;  1IN5 A;  3WTT C;  1F43 A;  1S7A A;  1JHH A;  4FX0 A;  1LDK B;  3ESW B;  2X51 A;  5D4R A;  2ECC A;  2FXA A;  2H09 A;  3PQK A;  3OSG A;  2QZ8 A;  4K5O A;  2O9L A;  4WF2 A;  1E0E A;  1SFO J;  2FOK A;  5D8K B;  1B59 A;  3QWL A;  4PW4 A;  2WZG A;  2UXN A;  3TW7 A;  1IRG A;  4HLX A;  5K5R A;  3H9J A;  2JCY A;  4Y6S A;  2EH3 A;  3R6S A;  4R79 A;  3FK6 A;  3FXO A;  1G6N A;  2RV8 A;  4ZW3 A;  1YS7 A;  2L4A A;  2V6E A;  3HDD A;  4M9S A;  1S9H A;  4Y13 A;  5HS9 A;  4A5N A;  4Y6R A;  2CUZ A;  3H35 A;  5DV5 A;  3GTJ J;  2RGV A;  3MZ8 A;  4HF1 A;  1HW5 A;  1S8N A;  1KGS A;  4IKF A;  3FTU A;  2XAH A;  4J3B A;  3ZOB A;  3CF5 F;  3DWL E;  2GBY A;  3A01 A;  2DFH A;  4ZX3 A;  2DOE A;  4CZZ A;  2OUM A;  4ENK A;  3OY9 A;  4M3B A;  3S3M A;  3P5J A;  1RET A;  2EQR A;  3CLQ A;  1P7I A;  3CMA I;  4RGX A;  3F0C A;  1MW0 A;  3BQY A;  4CCJ A;  1PUE E;  4MTE A;  1ZAR A;  2M87 A;  2G7U A;  2HPI A;  3IC7 A;  3KE2 A;  1YRN A;  4F3Q A;  5IP7 J;  3S14 J;  2X48 A;  2IGK A;  3TED A;  3OYL A;  3RPU A;  4WXC A;  3OYJ A;  5JC1 A;  3MWM A;  1YHQ I;  2F5C A;  1U9N A;  4S04 A;  1IXS B;  4NC8 A;  3G4S I;  2M4G A;  1XS9 A;  2X1C A;  4PFO A;  2VE9 A;  1RKW A;  2VON A;  1R4M B;  1YIO A;  3C2H A;  4XO3 A;  3Q0V A;  3FHE A;  3QYE A;  4Y67 A;  2TCT A;  3WQR A;  3DPL C;  3C2B A;  2ME6 A;  5FKL A;  3D5S C;  2PX9 A;  3C3W A;  5F08 A;  2VJ4 A;  5J4V A;  5BPP A;  2DA7 A;  4MFD A;  1SMY F;  3FUF A;  2R7D A;  4A3E J;  3KEY A;  2JQ7 A;  2R7R A;  1YYV A;  3VFZ A;  1OPC A;  2QCO A;  1W7P A;  4UB6 C;  4YFK F;  1B8I A;  4KJZ A;  3HIF A;  4LJZ F;  3RSN A;  2LD5 A;  2FOW A;  2QWW A;  2WC2 A;  2LBF B;  3ROU A;  3H3U A;  3WTX C;  1PDN C;  3LSJ A;  1FIP A;  3HOU J;  4DQ2 A;  2XAU A;  1R5H A;  1I50 J;  2QA4 I;  3J7A O;  3K4N A;  3CXB A;  3HGY A;  1Z67 A;  4E6K G;  1CF7 B;  2LY1 A;  4XO5 A;  4BQO A;  1XGM A;  2JA6 J;  2D1V A;  2IVM A;  4LG0 B;  1O3R A;  5F1J A;  2Q2E A;  3P9C A;  2EIN H;  2QEN A;  5ICE A;  3IKV A;  1QGP A;  2E36 A;  5J40 A;  4ZZL A;  2HPM A;  5DUI A;  1TWG J;  1YS6 A;  3QPH A;  3SYT A;  3C1D A;  2ZME B;  3VPR A;  2K9Q A;  1BI0 A;  4E4H A;  4BNC A;  1BJA A;  1BIB A;  2ELH A;  2WWY A;  3HOV J;  2P5K A;  3F8C A;  4LUP A;  1E17 A;  4ESF A;  2CSO A;  2OF7 A;  2OJE D;  3W6V A;  3KYD B;  4AVP A;  2AS5 F;  3SFI A;  1TNT A;  3W2A A;  4JND A;  1ONP A;  5FD5 A;  3ZMU A;  2WBM A;  2Q8K A;  5LGT A;  2P7V B;  1F36 A;  3H3Z A;  3ZHY A;  4LLG F;  1JI8 A;  2WAF A;  3HG9 A;  5EF6 A;  3V7S A;  4U87 A;  2M0M A;  5L3B A;  4KP7 A;  4E7S A;  3LMM A;  1ZG1 A;  1FNN A;  3T8T A;  3FTV A;  3I55 I;  1SD5 A;  3ZMV A;  3L2W A;  2BY1 A;  3EBG A;  2BW3 B;  1O4X A;  5ED4 A;  3WHC A;  1SFK A;  4D7M A;  3JRD A;  4HW0 A;  2L9R A;  1FSE A;  3D0S A;  5DCM A;  5LGU A;  4CXF A;  2OV7 A;  3PNT A;  4FQG A;  4BE2 A;  1RC9 A;  4PVB A;  3FTW A;  3VYU B;  4IHY A;  2PUS A;  1WJC A;  2LKX A;  1YJ9 I;  4I6Z A;  1K83 J;  3GCM A;  3UNG C;  1NH3 A;  1LDD A;  3IH2 A;  2XV4 S;  3DEU A;  3B2P A;  1TWF J;  3M07 A;  2DOD A;  2DO7 A;  1OCZ H;  1MND A;  3BG5 A;  3I71 A;  3F9K A;  4RB2 C;  1J59 A;  3S2H J;  5J8F A;  2W84 A;  2JZY A;  1FOK A;  4HPQ A;  1VND A;  1MMG A;  2KLO A;  1G4D A;  4O5V A;  2K85 A;  2STW A;  3CO6 C;  3BJA A;  1GW6 A;  5EG0 B;  1XSX A;  1FSH A;  3HSR A;  2DPD A;  2MH9 A;  2IAI A;  3LQR A;  1T0F C;  2KT0 A;  4ZQF A;  4Z2Y A;  3ZMZ A;  4S05 A;  1TZL A;  3TDU C;  2CV2 A;  2J5O A;  3G1L A;  1SAN A;  1XGS A;  1ENH A;  3QPT A;  1TW2 A;  3L00 A;  3QU6 A;  2R7S A;  1YG2 A;  3HUG B;  4PJJ A;  3WOD F;  2XHK A;  4C3H J;  3WTY C;  2HKX A;  4L5J A;  3EQL F;  3CC7 I;  1V5F A;  3GFM A;  1U8B A;  1XC5 A;  3TMO A;  2DTR A;  1OYY A;  4A3D J;  3FMS A;  1B9M A;  1Z7L A;  2CYY A;  2EA2 A;  2JMW A;  2NYX A;  4MIM A;  4P9U A;  1HBX G;  4R5T A;  2XAJ A;  4L18 B;  3CZK A;  5BNG A;  4K2E A;  3ZN1 A;  4OIO F;  2FQ3 A;  2KFD A;  3VVM A;  5F0C A;  2E2H J;  3K1M A;  2CH0 A;  2CRG A;  3ERM A;  4ZYE A;  1TLH B;  2BHY A;  3GTL J;  1HDD C;  1X4P A;  4XLN F;  3VWB A;  4U0Y A;  2QGU A;  4ZYG A;  1R7J A;  4IVN A;  1A31 A;  5J1Y A;  4N0B A;  2YR2 A;  2K86 A;  4V2F A;  4BY7 J;  5FJ8 J;  5CVJ A;  2YU3 A;  4HQM A;  3OYG A;  1RI7 A;  1ZQ3 P;  1ZGJ A;  2EBI A;  5KAI C;  3FK7 A;  2ZNZ A;  2BBY A;  4ZW6 A;  2ACJ A;  2ZB9 A;  4XN2 A;  1IUF A;  4RBO A;  3IV5 A;  2ZXH A;  4A3F J;  4JQF A;  2F5V A;  1FC3 A;  4C2U A;  4II3 A;  4XLP F;  3BZK A;  3MN2 A;  5C44 J;  3OS0 A;  5M3F J;  2CV1 A;  2VKV A;  1PUF B;  4OOE A;  4GYG A;  3F6O A;  2MD5 A;  5ILS A;  2LKP A;  2EZI A;  4UUS B;  3GTQ J;  2L7F P;  1CF7 A;  4OMY A;  2Y1G A;  2RNG A;  1QRY A;  2XPU A;  4P55 A;  1P4A A;  4LG0 A;  4EAT A;  3EUH C;  4ZH4 F;  2VT2 A;  1TT0 A;  4M3F A;  1KQ8 A;  1P7J A;  3ERE D;  2W4S A;  2LY2 A;  1FP2 A;  3G1O A;  2EWN A;  4Q47 A;  3BG9 A;  1Z9C A;  3F8M A;  5TGT A;  5JFR A;  1IG7 A;  1O7L A;  2ZME A;  3R60 A;  5AON A;  3E5U A;  3R0I A;  4AYS A;  2HFH A;  5C4J J;  3PFI A;  1LE8 B;  3HRM A;  4A69 C;  2L2O A;  1K4T A;  2L4M A;  2PG4 A;  4BJ5 C;  2LP0 A;  2MC4 A;  4D1Q A;  1J9I A;  2VE8 A;  5JNL A;  1P9Q C;  1R22 A;  3BDD A;  3FIW A;  5DM6 F;  3NAU A;  4UV9 A;  1C0W A;  4AR9 A;  3GFL A;  3RQ4 A;  2JA7 J;  5E8G A;  4I01 A;  1MBK A;  1Y1V J;  4RDU A;  2K9S A;  1XGN A;  3S15 J;  1XCV A;  3M9A A;  1K5H A;  1X1A A;  5E1Z B;  1J75 A;  4XIC A;  2PFB A;  4R5X A;  2A05 A;  1JTX A;  2VC0 A;  3Q43 A;  2K4B A;  5M5W J;  4HV6 A;  1XX5 A;  5HNF A;  1YQA A;  1Q0L A;  1MJB A;  1T98 A;  2AQE A;  3S32 A;  5DUK A;  3VOE A;  1FYK A;  2BW3 A;  2Y30 A;  1A6I A;  4MEY F;  3HHG A;  2FE3 A;  1YI2 I;  1NHA A;  1RR8 C;  3U21 A;  4IPA A;  2R5Y B;  2XRN A;  4G6D A;  4QME A;  4UY8 I;  3IRR A;  4ENJ A;  1W36 D;  2HOT A;  4BHB A;  2XVC A;  4LB5 A;  2DAO A;  4GDF A;  2M3A A;  3M8F A;  5EEH A;  2ME0 A;  3L1P A;  1YJN I;  1KA8 A;  2DW4 A;  2F5D A;  4N9H A;  1ZKG A;  1XN7 A;  2EV5 A;  1IC8 A;  3ZP5 A;  1R4N B;  4Y6P A;  2FMY A;  1ITY A;  5ICC A;  3FMR A;  1IF1 A;  1KYW A;  2F4M B;  1X3U A;  1GT0 C;  1NTC A;  3A03 A;  1X1B A;  2HYF A;  5D5V B;  5EG0 A;  3GTM J;  4ARF A;  3BY6 A;  2H6C A;  3JCU C;  3S8P A;  1WWX A;  3LAJ A;  4R5V A;  2ID3 A;  2OBP A;  4XOP A;  2Z5U A;  1DPU A;  3EUK L;  1QVT A;  1X3Z B;  2HS5 A;  3LAP A;  2ADU A;  2BZT A;  2KMU A;  3AFH A;  1GDT A;  3Q44 A;  3HGG A;  1ZLK A;  1F4K A;  2GIV A;  3GWZ A;  1FIA A;  4XKC A;  2R7T A;  3FMQ A;  1FOX A;  1ETY A;  3SDB A;  1ONO A;  2QJ1 A;  3AU9 A;  2X6Y A;  2M0C A;  1EH8 A;  5K5O A;  3HUG A;  1FOY A;  1SC7 A;  4V2G A;  5FD6 A;  1HSJ A;  3DBH B;  4XRS G;  3E7L A;  3R61 A;  3HOY J;  5K7Z A;  1H19 A;  5ICF A;  2ZJQ F;  2VKE A;  2QF7 A;  4IOC F;  1ON2 A;  1LFU P;  4XN4 A;  1IV6 A;  3FUM A;  2G7H A;  1FBS A;  3F22 A;  1YW8 A;  5KVR A;  2VI6 A;  2KJC A;  2WY7 Q;  1Q1H A;  4KMU X;  3DTI A;  3OS1 A;  3FTX A;  4XNA A;  5FLX K;  1MBF A;  2HYJ A;  1JKO C;  2DQL A;  4C30 A;  2KDO A;  2CG4 A;  2V1D A;  1YIJ I;  3LSK A;  3FUJ A;  4AUX A;  3RPU D;  3CME I;  4KT5 C;  3FXM A;  1IN8 A;  2EK5 A;  4RS8 A;  2NS7 A;  1UG2 A;  2JSC A;  3M1E A;  2W82 A;  3LSI A;  2XPZ A;  2RKH A;  1F1Z A;  3FWE A;  3FU5 A;  1LFP A;  2ESN A;  2B63 J;  4XLE A;  2X1E A;  4I0B A;  5F64 A;  2A69 F;  2ZJP F;  2BY2 A;  4HZF A;  2LF8 A;  4QWQ A;  3GZN B;  4KIF A;  4BQA A;  4B3A A;  2A5W A;  3QP6 A;  2O8K A;  4JX6 A;  5FRM A;  1J2X A;  1JHF A;  3ASN H;  4NNJ A;  4WX9 A;  2LSO A;  4ESB A;  1P2F A;  3FUE A;  4XN5 A;  2VJ5 A;  1QA6 A;  1OKR A;  1W7P D;  1HST A;  4B3X A;  3L2R A;  4CCO A;  1K79 A;  4XND A;  5EEA A;  4B09 A;  5E3O A;  3WU0 A;  3M4O J;  1PUF A;  4QTR A;  4G12 A;  1SAX A;  1FLI A;  3IUO A;  4KIT B;  2BY0 A;  3LL7 A;  4M3D A;  1HW1 A;  3PNV A;  4FLR A;  1D8J A;  1YTY A;  4RGR A;  1LB2 A;  1AOY A;  3BLY A;  3Q9S A;  5BOX A;  4IRI A;  3ZQ7 A;  1TQI A;  4AD9 A;  1V5E A;  3DEE A;  4OIN F;  4WXH A;  1Q0H A;  3FH5 A;  2V4J C;  3O3K A;  4S0H B;  1GXQ A;  1X2N A;  1VQ5 I;  1XD7 A;  5IP6 A;  1QZZ A;  5FKO A;  4FT8 A;  3WGG A;  4UV8 A;  3J80 K;  1EV7 A;  3FXK A;  4BBS J;  3IH3 A;  4R8H A;  2EZK A;  1XMK A;  1U8R A;  2VJJ A;  2CUE A;  2DQR A;  4PGH A;  1APL C;  2K4J A;  2Y0M A;  3JRG A;  1NG7 A;  2M30 A;  4OWR B;  2B0L A;  4A12 A;  5JHU A;  1T08 B;  2HQ5 A;  2PMZ A;  3OIQ A;  2DMN A;  4KYW A;  3T8V A;  1BR2 A;  2QSH X;  1CGP A;  3DF8 A;  1LFB A;  3FX3 A;  3AG2 H;  2P6S A;  5JI6 A;  4HV5 A;  5M5Y J;  1YRN B;  3M1C A;  2XB5 A;  2A68 F;  4LK0 F;  4KIG A;  4NBQ A;  5D5W B;  4ZC3 A;  4IHW A;  3FKJ A;  2JCX A;  2O5R A;  4UVB A;  1WJE A;  3ISP A;  5HDG A;  2JRT A;  2JK3 A;  3UER A;  2XGC A;  2FFL A;  1ETX A;  3CCS I;  2MC3 A;  5JVT A;  4BQN A;  1U6G A;  4KNY A;  4ZJZ A;  3PNY A;  1G59 A;  4Q48 A;  1U78 A;  4L9V A;  5J47 A;  4ZX6 A;  2WB1 N;  5KNL A;  3D1N I;  1UHM A;  1ZAO A;  3GX4 X;  5EDN A;  3EUA A;  5TRD A;  1P6R A;  1ETV A;  3HHH A;  4G7H F;  2UWM A;  3JRE A;  4PUS A;  4AR8 A;  2UZK A;  1JKQ C;  3MQ0 A;  1ODD A;  2HGC A;  2DFI A;  3I4P A;  4B1R A;  1SFU A;  1VQ6 I;  1X3Z A;  1V5G A;  1W5C C;  4BJT A;  1MJ9 A;  1WVR A;  5E8I A;  3LOC A;  3RZO J;  3I4N J;  3FXL A;  2LH9 A;  1BL0 A;  2CQX A;  4XNF A;  4Z6Y A;  4LFU A;  3HJE A;  3OYD A;  3CLO A;  1OYW A;  3CCV I;  3FM5 A;  1SD7 A;  2H6B A;  3VYR B;  4G94 A;  3FU6 A;  4I76 A;  4EJW A;  2RJI A;  3AG1 H;  4XMW A;  2KRH A;  2L7M P;  2VBW A;  3HXL A;  1RNL A;  3SEZ A;  4BL0 B;  3CUO A;  3DEW A;  3CCY A;  4I98 B;  3CJR B;  1HF0 A;  1MIJ A;  3DLA A;  5GAH J;  2K40 A;  3J7A Y;  3WGH A;  3MMY B;  4F55 A;  5CQE A;  2F5E A;  5HS7 A;  2M1B A;  1GHC A;  5A2Q K;  2E35 A;  2E1M B;  2L5Q A;  3SQN A;  4Q4Z F;  3V8L A;  1FWZ A;  4Y4R A;  4C2T A;  2MA3 A;  3CD6 I;  4RB0 A;  2NS0 A;  4EM1 A;  1K61 A;  2OD5 A;  4LLL A;  3GO5 A;  4A03 A;  2O8X A;  3BJO A;  2VOD A;  3QYB A;  2JD1 A;  5K7H A;  3BTJ A;  2YSR A;  3V8J A;  5GTH C;  2DK8 A;  5L3F A;  1OR7 C;  2R3S A;  3G1M A;  3LST A;  5HLT A;  3KYL A;  2JD2 A;  3F72 A;  1VTN C;  2DJN A;  2EIJ H;  2JD0 A;  4IX7 A;  4XLA A;  3ZQQ A;  1LDJ A;  4CYD A;  3ZQH A;  3DBR B;  1I5Z A;  5E1X A;  4CIC A;  2MLK A;  2XIG A;  3RIR A;  1EF4 A;  3F8F A;  4UXN A;  3CF2 A;  4ZDO A;  4F93 B;  3KP4 A;  2DN0 A;  3HSF A;  4HEA 2;  2W85 A;  3JW4 A;  1SVL A;  4LG3 A;  5JVG F;  1MBH A;  1WH5 A;  1PVE A;  4H0E A;  5D5X B;  2BY3 A;  5ICG A;  2YS9 A;  3OSF A;  1Y39 A;  1OCT C;  4CCK A;  4L0Y B;  5FRN A;  1MW7 A;  4BAY A;  2DFF A;  3WG7 H;  3PUF A;  5HNH A;  2M4K A;  3ZQC A;  3TQN A;  3ZN0 A;  3DPT A;  4LB6 B;  4YFN F;  4U88 A;  4ZN6 A;  5DYF A;  2V79 A;  3TP0 A;  1PJR A;  1W5S A;  2LMD A;  5BPI A;  2V1N A;  4EJT A;  2MD0 A;  2HR3 A;  2GZW A;  1SVO A;  3SFZ A;  3GZ6 A;  3KP2 A;  2W00 A;  2RAE A;  2EV0 A;  3E6M A;  5TJJ A;  5GTI C;  3DFG A;  3LA2 A;  1T0F A;  3FU3 A;  4XSZ F;  2VC1 A;  3HOZ J;  4XMV A;  3A14 A;  2L02 A;  3KZI C;  3FHN A;  1F9N A;  2N8G A;  2Q1Z B;  1MSE C;  4Y17 A;  3FXJ A;  3X2Q H;  3S1R J;  1SEU A;  1JUP A;  3O8G A;  2DI3 A;  4D0P A;  1XCB A;  2P8T A;  1HOM A;  3LSG A;  3WG9 A;  3S93 A;  2Y31 A;  4LIT A;  4IZZ A;  3JSP A;  3DKY A;  2QM3 A;  1IW7 F;  4IQ4 A;  1KU2 A;  3PJR A;  2PMZ N;  2ZJR F;  2Y0S A;  1O3T A;  1X19 A;  1EH6 A;  2KIU A;  3LSR A;  1VQ4 I;  3KYC B;  2AO9 A;  1VZ0 A;  3OIP A;  1IN6 A;  2GWR A;  3WTZ A;  2A5Y B;  3I0T A;  5J6X A;  1K6O A;  2HDW A;  5LHG A;  2WZF A;  1Q1V A;  3HOW J;  2MBF A;  5D5U B;  4YIR X;  4KN7 X;  3CHR A;  5DUL A;  3ELK A;  3ABT A;  2DA3 A;  2WV0 A;  2GM4 A;  4J01 A;  4XLH A;  2OZ6 A;  1TQM A;  2P5L C;  2MG4 A;  2JTV A;  3FTZ A;  2DCE A;  5FB2 A;  1SD6 A;  3HOT A;  2DJI A;  1H89 C;  2OZU A;  1PP8 F;  3DP7 A;  2XAF A;  1Z91 A;  3MKL A;  3CUQ C;  2V1U A;  1HS6 A;  1Z77 A;  3VSK A;  4EM0 B;  3K70 C;  3W2W A;  1LEA A;  3CC4 I;  3NWT A;  3FU0 A;  5H20 A;  4OIP F;  1KU9 A;  4TV7 A;  2OCE A;  5IT3 A;  3CCE I;  4N4O B;  1T6S A;  4U0W A;  4BY1 J;  2OC6 A;  3AAF A;  3QOD A;  3RTR A;  2LNB A;  1WGX A;  2XRL A;  3A0H C;  1XG1 A;  4XN0 A;  2K02 A;  2DTZ A;  3BG6 A;  4HRI A;  4BDZ A;  1WHU A;  3OOP A;  3EUH A;  3E1S A;  2O7O A;  3OYC A;  3OWT A;  1QZE A;  4CDG A;  5DEQ A;  4RAG A;  3KP5 A;  1AKH B;  3MZY A;  1FPQ A;  4LIU A;  4BEH B;  4E7Z A;  2O3F A;  2M7A A;  4KMF A;  2B61 A;  3OIO A;  4IRH A;  2K5C A;  3K69 A;  3WU1 B;  2MAB A;  2NVY J;  1ETK A;  2RQQ A;  1B72 A;  3GYH X;  4A3M J;  3HPH A;  1STZ A;  4KA4 A;  5DM7 F;  2E19 A;  3ANM A;  5FKM A;  1A35 A;  1RPW A;  1WJA A;  2KP6 A;  3B73 A;  4EJV A;  1BR4 A;  1PYV A;  3JRC A;  1S72 I;  1WJD A;  4D7N A;  1AWC A;  4ZQT A;  5E3L A;  5FKK A;  2VN2 A;  3UR3 C;  2KZV A;  3V42 A;  2XPY A;  4A2U A;  5LHH A;  4G8X A;  1E3P A;  1T95 A;  3IAM 2;  3JRH A;  3CZ6 A;  2HDD A;  2WPG A;  3H0G J;  2Y9Z A;  4ABZ A;  2I8D A;  3HW2 A;  3Q3S A;  2ZJ2 A;  2K27 A;  1N75 A;  3RPQ A;  3TP3 A;  4B47 A;  3CC2 I;  2LFB A;  4MGR A;  2XQ0 A;  1LPQ A;  3WQS B;  4L2L A;  4XN3 A;  5LLQ A;  1BBY A;  4PZJ A;  5F27 A;  5J1U A;  3JRI A;  3L2Q A;  2IGO A;  1BOA A;  2GOX B;  1P4X A;  2CQ7 A;  5E17 F;  2LK2 A;  4FCA A;  1MKM A;  1TP4 A;  2EB7 A;  4LGW A;  4B48 A;  3OS2 A;  4G7Z F;  2OTL I;  3OR2 C;  4RAZ A;  1W5T A;  3ZXS A;  1JUM A;  3ZMT A;  2ID6 A;  1BW6 A;  3VOD A;  3COA C;  4I7H A;  3QQA A;  5DD8 A;  3W6J B;  2IEK A;  3DU6 A;  1A36 A;  2CQN A;  3I64 A;  4B43 A;  2CJJ A;  4E70 A;  4A3K J;  1W36 C;  4G9Y A;  2A61 A;  2HTJ A;  1NK2 P;  3FTS A;  2HI3 A;  3KX2 A;  2P6T A;  2FX0 A;  4M9X A;  2IP2 A;  2FBK A;  1FMW A;  3VB2 A;  1O3Q A;  1LNW A;  2VB6 A;  5LEJ A;  3P7N A;  2CU7 A;  3RKY A;  5HDK A;  4CO8 A;  1R49 A;  4XMU A;  1X4O A;  1XDU A;  1IUY A;  1USS A;  5IP9 J;  2E1C A;  4P1W A;  6PAX A;  1ON1 A;  4IQJ A;  3C7J A;  2GTQ A;  4M6X A;  5IYB J;  2DU9 A;  2DFE A;  3A2K A;  4ZX4 A;  4BE0 A;  3CHS A;  4WXD A;  5CKT A;  2X85 A;  2ZXW H;  3CMY A;  4BHC A;  1XMA A;  2R70 A;  1FYM A;  3B6A A;  3E5Q A;  3TO6 A;  2CQK A;  3RYP A;  4L9N A;  2HOS A;  2NAZ A;  1WKM A;  4PJL A;  2VLA A;  1UAA A;  2L54 A;  2ZSI B;  3GFI A;  5FFX A;  4DJA A;  5LBQ A;  1FYL A;  1RR7 A;  1EH7 A;  3U1D A;  3LWF A;  1ZR4 A;  2WA0 A;  4WCG A;  2TRT A;  4RAF A;  3PM1 A;  2F5F A;  3OYI A;  3AL0 C;  3HOS A;  3DKX A;  1JT6 A;  3G71 I;  4ENM A;  4HNU A;  4ZX5 A;  2HZT A;  3H92 A;  1VQM I;  3ZQI A;  4HDV A;  2DDA A;  3UEQ A;  1PP7 U;  2XF5 A;  2E5Z A;  2Y0S N;  4RGS A;  2PJR B;  3FBI B;  5EEG A;  1S29 A;  1TWC J;  2HVQ A;  1VF9 A;  1QBJ A;  2K9L A;  4YRV A;  2ESH A;  4HBL A;  4KFC A;  1ZH5 A;  1UZC A;  1FZP B;  4FLO A;  2R0Q C;  4MKT A;  2HPT A;  1IXR C;  4FTH A;  4XN7 A;  4ESJ A;  2R7X A;  4IF4 A;  5EZG A;  4DYC A;  2EPF A;  3L2C A;  3H9G A;  3S1M J;  2LVS A;  4BGD A;  5DLL A;  3PL8 A;  2V9K A;  1JTY A;  2HOA A;  1MD0 A;  1GVD A;  2RN7 A;  1N78 A;  1WJF A;  2YX7 A;  4NB5 A;  2V6C A;  2JSP A;  1BI3 A;  2R7O A;  3EYI A;  1ZN2 A;  2ECB A;  3HSE A;  4RM3 A;  4W97 A;  4DBQ A;  3IL2 A;  4ZYA A;  2D45 A;  4ZTF A;  2VXZ A;  2COM A;  1G8X A;  3ZR8 X;  3PFY A;  3OYM A;  5J3L A;  1Z6T A;  2GLO A;  1Y0U A;  1ZLJ A;  2Z33 A;  3CDI A;  1K7A A;  1Y6I A;  1IN4 A;  2GAU A;  4HX4 A;  3OOU A;  5IT9 Z;  1XDS A;  1ZG3 A;  3L09 A;  2A6T A;  5CYV A;  5FGM A;  3J7Z I;  5FKN A;  1WQ2 A;  2OQG A;  1SQM A;  5H6Q A;  1Z3Y A;  1T2K A;  3F23 A;  2XDV A;  1U3E M;  1AKH A;  2Z99 A;  1GV2 A;  2IGN A;  5IPA A;  4BEH A;  4AC0 A;  1T33 A;  3MFK A;  1LJ9 A;  4D5F A;  1MH3 A;  3K7A J;  4LD5 A;  4ZDL A;  5FRO A;  3VEP A;  3VYT B;  3V4G A;  3CZG A;  3WTU C;  1IRX A;  2HQA A;  2NNY A;  3B37 A;  2EIL H;  2ISZ A;  2C5Z A;  4XMZ A;  2P0W A;  2QBY B;  1XB4 A;  1D1A A;  2KIF A;  2ZXI A;  2H1K A;  3ZGK A;  2R59 A;  5E18 F;  4IO9 F;  1SFE A;  3DQV C;  3NAR A;  4M3E A;  4A0Z A;  2FQ4 A;  2ZC2 A;  3E6C C;  3LQQ A;  2O61 A;  5JMW A;  1EA3 A;  1IRZ A;  5D6E A;  2TDX A;  3L2V A;  1Y1W J;  1ZGA A;  2KQR A;  2L9S A;  2QVO A;  1MH4 A;  1UG0 A;  2C6Y A;  3SJM A;  1GV5 A;  2E1O A;  2Z3Y A;  3DCF A;  3L2U A;  1G3T A;  2OTJ I;  2YUS A;  2JCV A;  3SXY A;  3D5R C;  3OYN A;  4ZQH A;  1MBE A;  1X58 A;  4JK1 X;  3H9Q A;  4OAY A;  1W0T A;  1MW3 A;  3JTH A;  3JTG A;  4IL6 C;  2WB1 A;  3BR1 A;  2X6W A;  4A3B J;  5E20 A;  2DMP A;  2HTS A;  4EGY A;  1J0R A;  3ONQ A;  2DQ6 A;  3EET A;  4P5O A;  1Z3X A;  1VQ8 I;  2E71 A;  3BZC A;  2H27 A;  1X3W A;  4K5N A;  1FP1 D;  3HRT A;  3B34 A;  3WE2 A;  1OCP A;  4K5M A;  1O3S A;  1K4S A;  3F6V A;  4AU7 A;  4ON0 A;  3OYA A;  3KP7 A;  3U1K A;  4I99 C;  1IO2 A;  2BE5 F;  5BS6 A;  3DTE A;  2GA1 A;  3CUQ B;  3U9W A;  2OA4 A;  9ANT A;  3DBL B;  4EM2 A;  1WI3 A;  1MMS A;  3CP2 A;  3DLL F;  4CA0 A;  3A0B C;  4AIH A;  4IXA A;  4BE1 A;  1OCC H;  1TQP A;  4I02 A;  3ZMD A;  4PSW A;  2DMU A;  1WPK A;  3DXJ F;  4ZDP A;  4R1H A;  2VIX A;  2JWT A;  3H1C A;  2RQP A;  4E7I A;  4K5L A;  1FTT A;  2CGP A;  3ABM H;  2FNP A;  1VQO I;  2D5V A;  2IS6 A;  3M8E A;  1BIA A;  1QHG A;  2LDU A;  3S2D J;  3FBN B;  1KON A;  5E79 C;  1U0J A;  1D5V A;  3CHQ A;  1UHW A;  1HKS A;  2QUF A;  1YIT I;  4XR6 A;  2EGH A;  4HA8 A;  3CCM I;  2JA8 J;  4YII A;  2PQ8 A;  2MAP A;  4PFP A;  2DXI A;  2A6E F;  1R0K A;  3CES A;  4ZQG A;  2PL5 A;  3BTI A;  3PO3 J;  4L9T A;  2QSG X;  1BR1 A;  3FTY A;  3HBL A;  2VKH A;  1MZB A;  4HF0 A;  2IPQ X;  3SZG A;  4E7K A;  3ANN A;  2Y1E A;  2PJR A;  3AU8 A;  4CHU A;  2DDB A;  4YG2 F;  5LRR A;  3KFW X;  2JVH A;  1D0Y A;  3M3Y J;  3ZQL A;  2LYC A;  1MBJ A;  2K9N A;  4ZYH A;  1IV8 A;  1DU0 A;  4JBA A;  3FH7 A;  3B7T A;  1MMA A;  2CW7 A;  1GVJ A;  4HF2 A;  4ASN A;  1DPR A;  2HXI A;  1RUO A;  3K4J A;  3LFK A;  2FUG 2;  1TC3 C;  4FCY A;  1FBQ A;  1UB9 A;  3QYF A;  3KPH A;  1XPX A;  2MH2 A;  1OR7 A;  3HM5 A;  1ZRD A;  3T0Y A;  1UJ8 A;  3D5L A;  2IS2 A;  1P92 A;  1K6Y A;  4XN9 A;  2COB A;  1OLT A;  2CV0 A;  3J81 Z;  4UUV A;  1FEX A;  3ECH A;  5JO0 A;  3IKT A;  1Y0N A;  4LMY A;  2KHM A;  3SDG A;  2O0Y A;  2Z16 A;  3BC8 A;  1ZRE A;  1D0X A;  3I9V 2;  4E7L A;  3QU3 A;  2NXN B;  1ONV A;  2ZNY A;  3BRO A;  4WK8 F;  2IA1 A;  1BN5 A;  2EFO A;  2EZL A;  4XKW A;  1G3W A;  1DP3 A;  1SG7 A;  1T39 A;  5IY5 H;  2PJP A;  3CIA A;  3OYK A;  2V1X A;  1I6X A;  4HX7 A;  3S2W A;  3DV8 A;  2LOO A;  1R5G A;  2ICW G;  2QBY A;  4KIB A;  2NOG A;  5D6F A;  1SMT A;  4FLQ A;  2XRO A;  4PSX A;  1SD4 A;  5L3C A;  4CGZ A;  3GXO A;  3CCR I;  2EFP A;  2LTP A;  1EJ9 A;  3BPV A;  3OL4 A;  3FXR A;  4AYB A;  1RKT A;  3SZP A;  2Q0O A;  3FKI J;  3LNQ A;  2HQN A;  2R93 J;  1H3L A;  5IOY A;  5LHI A;  3IAS 2;  4UVC A;  2M7B A;  3N4M A;  5JLX A;  3I59 B;  4M6Y A;  3I58 A;  3GME A;  3G3Z A;  3I56 I;  4BDY A;  2QEX I;  3AUA A;  4N4N B;  5H2F C;  1OIS A;  3AL0 B;  2FF4 A;  2DK5 A;  1ZG5 A;  2GQQ A;  1ULY A;  4A6D A;  2HNH A;  4MO7 A;  2LR8 A;  2X6O A;  3CP8 A;  2R7W A;  1HDP A;  2HDC A;  2FML A;  2NRA C;  1MDM B;  2KKO A;  4MEX F;  1MNE A;  2CUF A;  3HTU A;  1JJ6 C;  1I6H J;  2WAQ N;  3ZI0 A;  1X1D A;  5E3M A;  3PSF A;  1J7K A;  2XPW A;  3Q0W A;  3RCO A;  4KIS A;  3K4B A;  2XGX A;  3CUQ A;  3TW6 A;  4NQW B;  1JKP C;  3GTK J;  3GF2 A;  1E3O C;  3A1Y A;  4NHJ A;  4Q4I A;  5GPA A;  3VDX A;  4BU2 A;  2A3S A;  4B8X A;  3FUI A;  3O6B B;  2M5W A;  2EFQ A;  1DGW Y;  3I54 A;  4QPQ A;  1T8I A;  5AIQ A;  4GGG A;  2A7O A;  2QSF X;  1S7E A;  2W48 A;  2DBB A;  4G6Q A;  4HQE A;  2M8G X;  1LQ1 A;  1KYZ A;  4RA2 A;  5GAE J;  4EJO A;  2FEZ A;  1XMX A;  4OOI A;  3WTW C;  3KZZ A;  4X6A J;  3ZQG A;  3ULQ B;  2DYR H;  5C3E J;  2CFO A;  1REP C;  2KL4 A;  1RES A;  2RVC A;  1ZS2 A;  1UFM A;  1AA7 A;  2VUM J;  5GAD J;  1ORK A;  4CCM A;  1R71 A;  3F8B A;  4CSW A;  3F8N A;  4WWC A;  4II2 A;  2LF7 A;  4Y3O A;  3MCZ A;  1B72 B;  4AIJ A;  4K5P A;  1XGO A;  4A0X A;  5LFA A;  3S3O A;  2VBX A;  5D8L B;  4BAC A;  4JOM A;  2L3D A;  3W6K B;  1NK3 P;  2JRM A;  2L7K A;  2F2E A;  4FAS D;  1TT5 B;  1QPI A;  3A06 A;  4DZP A;  2P5V A;  3B7S A;  3DU5 A;  2OPT A;  2L7Z A;  1FX7 A;  4IEJ A;  2GXA A;  1R6R A;  2KJB A;  4Q4E A;  1L0O C;  1WCM J;  2PLY A;  3IHU A;  5CLS A;  5CVV A;  1U5T C;  2KIS A;  2GXB A;  2I5U A;  2BV6 A;  3GW2 A;  3OMY A;  4IHT A;  3JAM Z;  1S5L C;  3E97 A;  3KCC A;  2X1D A;  2ZFU A;  3B7R L;  3FUL A;  2X4H A;  4B44 A;  1ZGW A;  5KAF C;  4MQ9 F;  4XLF A;  3S1N J;  4CYC B;  4MHG A;  2QKL B;  1HKQ A;  2IS4 A;  2MGQ A;  1QU3 A;  4AVZ A;  5GAG J;  4RB3 C;  1WSU A;  5JHF A;  1LVA A;  3OR1 C;  2R7Z J;  4GO1 A;  2JA5 J;  3O8H A;  1RIO H;  4RVB A;  4GYI A;  3ZHX A;  3WQQ A;  1YX5 A;  3MKW B;  1D0Z A;  2P4W A;  4IOA F;  2DT5 A;  4C2M J;  1W4M A;  1VQK I;  3G73 A;  1R0L A;  4QIW N;  4RSY A;  2IW5 A;  3SHF A;  1R58 A;  3BR3 A;  3CDH A;  2X0L A;  1TBX A;  3CHP A;  1KU7 A;  2QKM B;  2Y1D A;  3NQO A;  1UHS A;  2CMP A;  2E7W A;  4IHV A;  4BUP A;  5FLV A;  2VPL A;  1ERD A;  1FOW A;  2PEX A;  4EV0 A;  4F52 A;  2JN6 A;  3IP4 B;  4HNV A;  2XSD C;  4LIV A;  1QO0 D;  4F91 B;  4HAM A;  2XGD A;  1TL8 A;  3FM3 A;  5HOO A;  2XAG A;  3ZMS A;  3I3L A;  1Z6R A;  1F5T A;  3RKW A;  1IDZ A;  1SC5 A;  5GPC A;  4ZZD A;  2K3P A;  4NDL A;  1IAW A;  3L7W A;  3RI4 A;  5IYC J;  4HYE A;  5GP9 A;  3T8R A;  3KET A;  2DLL A;  2F6C A;  2MAO A;  3QOP A;  1NG6 A;  4P96 A;  2UV1 A;  1R9T J;  2KPM A;  2M34 A;  2W57 A;  2HXO A;  1D5Y A;  4MFE A;  4N9I A;  1DQU A;  2LC2 A;  3I59 A;  4AYB N;  2Y1C A;  5FWQ A;  2AHQ A;  2DMT A;  3V7C A;  5BMZ A;  1MBG A;  3QPS A;  4A6E A;  2WAD A;  5L3G A;  1DUX C;  4ITV A;  4ZTJ A;  3NWS A;  3H5R A;  3TO9 A;  3K4L A;  1OFC X;  2AXL A;  3GLL A;  2HYG D;  3ZQF A;  4BKX A;  2NVX J;  1R00 A;  3RZD J;  1UCR A;  1MDM A;  4D5C A;  2PN6 A;  3QOE A;  3ABL H;  3JRF A;  4AR1 A;  4XKB A;  4XLC A;  1YJW I;  4GCV A;  2AQF A;  2FNA A;  4U0V A;  4OIQ F;  3E5X A;  4XL9 A;  1H9T A;  1OQY A;  3KP3 A;  1AHD P;  1ETW A;  1WRJ A;  2RRE A;  5F04 A;  2KDZ A;  3VYS B;  4NQW A;  2WV1 A;  2ELJ A;  1MMN A;  1YW7 A;  3EPZ A;  4HOB A;  3OYF A;  2R7Q A;  1RUN A;  4J00 A;  2YU9 J;  2CFX A;  2K3F A;  2NVT J;  3FUN A;  2DOA A;  1I1G A;  3BZ6 A;  4M72 A;  4LOC A;  3HL2 A;  1QHH D;  5AIP A;  2LLK A;  2DA1 A;  1X2M A;  3AKZ A;  2NNN A;  1S46 A;  2KIQ A;  1V55 H;  4MTD A;  3RAS A;  1G3Y A;  3OYB A;  3ANL A;  2ELK A;  2ZO4 A;  3R0J A;  4X0G A;  3BTC A;  4JX5 A;  5LGN A;  3N97 A;  4XMY A;  4RB1 A;  2PI0 A;  2KRF A;  2H94 A;  4FE4 A;  1HA8 A;  2QQB A;  3DKW A;  3KLO A;  3QAH A;  3LSH A;  3G6E I;  3UCQ A;  2LY9 A;  2WY8 Q;  3PO2 J;  4XKV A;  1W0U A;  4I2O A;  1I3A A;  1OYI A;  1OJL A;  2X9D A;  2V9P A;  3E0J B;  1H8A C;  3P9I A;  2R7F A;  4ZYD A;  4ETS A;  5A2Q Z;  2Y2Z A;  2JV7 A;  5IT9 K;  2ZKZ A;  1ZRF A;  4NUB A;  1MMD A;  1I39 A;  1A5J A;  2BEO A;  3VVL A;  2ZFW A;  4AIK A;  4U7D A;  2D1H A;  3E6B A;  3NRV A;  3PUB A;  3TOA A;  3CMM A;  3GBG A;  5H6R A;  2OAZ A; 
#chains in the Genus database with same CATH homology
 2C5Z A;  2CS3 A;  3HPG A;  4XMZ A;  3EBI A;  2P0W A;  3BLY A;  1T1S A;  1D1A A;  2ZXI A;  4PJN A;  1V5E A;  3DEE A;  3ZGK A;  2R59 A;  4BQQ A;  1Q0H A;  3FH5 A;  2V4J C;  3DQV C;  2VXD A;  5JMW A;  4XN1 A;  4Y33 A;  3B7U X;  1EA3 A;  3K10 A;  3RC3 A;  2HU9 A;  3EBH A;  3L2V A;  2KQR A;  2L9S A;  3KED A;  1UEL B;  1YE9 A;  1ZEL A;  1UG0 A;  4XN8 A;  5JBI A;  3L2U A;  1LDK B;  2VJJ A;  2X51 A;  2JCV A;  3D5R C;  2ZXG A;  3OYN A;  4K5O A;  2GOM A;  4ZQH A;  1E0E A;  2DT7 B;  2Y1F A;  1NG7 A;  4G6T B;  3H9Q A;  4OWR B;  1BOB A;  2R4G A;  4OAY A;  2WZG A;  1MW3 A;  4PW4 A;  2MFZ A;  2PMZ A;  2WB1 A;  2X6W A;  3OIQ A;  4BXF A;  3H9J A;  2JCY A;  4Y6S A;  3T8V A;  4R79 A;  1BR2 A;  3ONQ A;  4ZW3 A;  2DQ6 A;  2V6E A;  3M1C A;  4P5O A;  1Z3X A;  2JVG A;  1SAU A;  1S9H A;  1D1B A;  1X3W A;  2CUZ A;  4K5N A;  3H35 A;  4Y6R A;  3B34 A;  4ZC3 A;  3FUD A;  3FKJ A;  2JCX A;  4K5M A;  3FTU A;  4IKF A;  2O5R A;  4J3B A;  1WJE A;  4AU7 A;  3DWL E;  3OYA A;  3DTE A;  3U9W A;  4ZX3 A;  2OUM A;  3UER A;  3OY9 A;  3S3M A;  2FFL A;  2JA2 A;  3CP2 A;  1MW0 A;  4CA0 A;  4CCJ A;  4BQN A;  4ZJZ A;  2HPI A;  3PNY A;  4BE1 A;  1G59 A;  2IS1 A;  4F3Q A;  4ZX6 A;  5KNL A;  2IGK A;  4PSW A;  3OYL A;  4ZDP A;  5CPR B;  2VIX A;  3EUA A;  4XM3 A;  3OYJ A;  4GAE A;  3H0D A;  4E7I A;  5JC1 A;  4K5L A;  3K4K A;  3CJQ B;  4NC8 A;  2M4G A;  2UWM A;  2X1C A;  2IS6 A;  4PFO A;  3N05 A;  4PUS A;  1QHG A;  3C2H A;  4XO3 A;  3FHE A;  4AR8 A;  3FBN B;  3QYE A;  4Y67 A;  3LFU A;  3WQR A;  3DPL C;  1KON A;  1X3Z A;  1V5G A;  4QPO A;  1U0J A;  2XF7 A;  3CHQ A;  4HSR A;  3D5S C;  4DPR A;  4BJT A;  4XR6 A;  2VJ4 A;  4PK4 A;  3VSL A;  2EGH A;  5BPP A;  1Y56 A;  3FUF A;  2MAP A;  3KEY A;  4PFP A;  2R7R A;  2DXI A;  1R0K A;  3CES A;  4ZQG A;  4KJZ A;  2PL5 A;  2LH9 A;  3RSN A;  1BR1 A;  4XNF A;  3BG7 A;  3FTY A;  3OYD A;  2VKH A;  2LBF B;  3SZG A;  3ANN A;  2W1O A;  4E7K A;  4MLO A;  2Y1E A;  2PJR A;  3AU8 A;  3VYR B;  2HVR A;  2Z1D A;  2XAU A;  3FU6 A;  2JVH A;  4QPE A;  3K70 D;  1D0Y A;  2RJI A;  4XMW A;  2KRH A;  2LYC A;  3K4N A;  3HXL A;  2F4I A;  3SEZ A;  4BL0 B;  4E6K G;  2MYS A;  2LY1 A;  3B7T A;  1MMA A;  2CW7 A;  3H5A A;  2C82 A;  3FH7 A;  4XO5 A;  4BQO A;  4DOZ A;  3CJR B;  4QHP A;  3K4J A;  3DLA A;  2FUG 2;  3J7A Y;  3MMY B;  3ZCO A;  4F55 A;  5CQE A;  3QYF A;  2HPM A;  1OR7 A;  2E1M B;  2L5Q A;  2LBF A;  3SYT A;  3T0Y A;  3D5L A;  4Y4R A;  2IS2 A;  4C2T A;  2K9M A;  4E4H A;  1K6Y A;  1JG9 A;  4XN9 A;  1OLT A;  2VQL A;  2CV0 A;  4A03 A;  4LUP A;  2LRD A;  3QYB A;  2JD1 A;  5JO0 A;  2KHM A;  2Z16 A;  1OR7 C;  3BC8 A;  3KYL A;  5HLT A;  3W2A A;  2JD2 A;  1D0X A;  3I9V 2;  4XON A;  4E7L A;  1ONP A;  4IX7 A;  2WBM A;  4XLA A;  3ZQQ A;  2JD0 A;  4JND A;  3ZHY A;  2O7G A;  1JI8 A;  2WAF A;  3HG9 A;  4U87 A;  2M0M A;  3CF2 A;  4ZDO A;  4KP7 A;  4F93 B;  4E7S A;  3LMM A;  2X6X A;  4AIC A;  4XKW A;  4HEA 2;  1T1R A;  3FTV A;  1DP3 A;  2DQM A;  3L2W A;  1SG7 A;  4LG3 A;  3CIA A;  2E60 A;  3OYK A;  4XOT A;  3EBG A;  2BW3 B;  1WJB A;  2LOO A;  2QVW A;  3QJX A;  2XC7 A;  1SFK A;  4CCK A;  2DT6 A;  4DGW B;  5FRN A;  1MW7 A;  2E1M C;  4FLQ A;  4PSX A;  5HNH A;  2M4K A;  2OV7 A;  3PNT A;  4BE2 A;  3DPT A;  4PVB A;  4CXF A;  3FTW A;  4MS6 A;  3VYU B;  4ZN6 A;  5DYF A;  2PUS A;  1PJR A;  2WAQ A;  2V1N A;  1WJC A;  2MD0 A;  2V26 A;  3OL4 A;  4AYB A;  3W3C A;  2W00 A;  4YEJ A;  2Z2S B;  3C2G A;  2E5N A;  3UNG C;  3DPU A;  3B2P A;  4HST A;  2W7N A;  1H3L A;  3IAS 2;  3FU3 A;  2M7B A;  1MND A;  4BDY A;  4XMV A;  3A14 A;  2JUG A;  3F9K A;  3AUA A;  4N4N B;  2PGG A;  3FHN A;  4HPQ A;  2HPO A;  1MMG A;  2KLO A;  2Q1Z B;  4RLF A;  3B3B A;  3AL0 B;  1J09 A;  1GW6 A;  5JAZ A;  3LSG A;  2HNH A;  3CP8 A;  2WAE A;  4LIT A;  3S93 A;  2R7W A;  4IZZ A;  2VJI A;  1LVK A;  2VL8 A;  3DKY A;  1T0F C;  4ZQF A;  4IQ4 A;  3ZRG A;  2R7V A;  2BOL A;  4C9Y A;  4XMT A;  1MNE A;  4F92 B;  1Z21 A;  1TZL A;  3PJR A;  2CV2 A;  2Y0S A;  3ZI0 A;  1X1D A;  1X19 A;  3PSF A;  5KCM A;  4RCV A;  4QUO A;  2R7S A;  3HUG B;  1VZ0 A;  3OIP A;  4PJJ A;  3RCO A;  4BJ6 C;  4KIS A;  1JGI A;  3K4B A;  3A4C A;  2HDW A;  3DTK A;  2WZF A;  4NQW B;  1V5F A;  3CHR A;  5DUL A;  3TMO A;  4RM2 A;  4XOR A;  3A1Y A;  5JMP A;  4Q4I A;  4BU2 A;  3VDX A;  4GAA A;  4J01 A;  4X2U A;  4XLH A;  1Z7L A;  4R5T A;  3FUI A;  3FTZ A;  1DGW Y;  2DCE A;  4QPQ A;  4FET A;  2A7O A;  3CZK A;  3JSZ A;  3HOT A;  2DJI A;  3VVM A;  3BCB A;  2CH0 A;  3HKZ A;  3K6G A;  1HS6 A;  3FUK A;  3VSK A;  4RLQ A;  1YX3 A;  3K70 C;  2XSJ C;  1X4P A;  3VWB A;  3W2W A;  3PUU A;  3W2V A;  1FMV A;  3NWT A;  3FU0 A;  2CFO A;  3S3N A;  2KL4 A;  1ZS2 A;  1AA7 A;  4N4O B;  4ZW5 A;  1RP3 A;  4CCM A;  3OYG A;  4CSW A;  2NOJ B;  4II2 A;  2OC6 A;  4CCN A;  4Y3O A;  2HZD A;  3QOD A;  3RTR A;  4K5P A;  4ZW6 A;  4XN2 A;  4CUG A;  5LFA A;  3S3O A;  4XN0 A;  4BAC A;  4JOM A;  2ZXH A;  3BG6 A;  4CZC A;  4HRI A;  4BDZ A;  4JQF A;  2F5V A;  3ZHZ A;  2L7K A;  4II3 A;  4CCL A;  4FAS D;  4C2U A;  3E1S A;  3A06 A;  4DBR A;  3OYC A;  3B7S A;  3OWT A;  5KHD A;  3OS0 A;  3DU5 A;  2CV1 A;  3OL3 A;  4H4K C;  4OOE A;  1R6R A;  3H5N A;  4LIU A;  4BEH B;  4E7Z A;  4Q4E A;  2M7A A;  2B61 A;  2K5C A;  3K4M A;  2MAB A;  2RQQ A;  2Y1G A;  2RNG A;  4KT6 A;  3HPH A;  3OMY A;  4EAT A;  3EUH C;  4HNT A;  1TT0 A;  3ANM A;  4ANJ A;  2W4S A;  1WJA A;  2BVL A;  2KP6 A;  2LY2 A;  1BR4 A;  1PYV A;  2X1D A;  2ZFU A;  3B7R L;  3FUL A;  3FDY A;  1WJD A;  4B44 A;  5TGT A;  4ZQT A;  4HG2 A;  3UR3 C;  4D9J A;  4XLF A;  2KZV A;  3R0I A;  2L9N A;  3V42 A;  4AYS A;  2QKL B;  2IS4 A;  1QU3 A;  2XPY A;  1DGR M;  2L2O A;  4AVZ A;  4BJ5 C;  3M8J A;  1T95 A;  5JHF A;  3IAM 2;  2MC4 A;  3OR1 C;  3CZ6 A;  4D1Q A;  3MKZ A;  2WPG A;  5JNL A;  1P9Q C;  3IIE A;  2I8D A;  1N75 A;  4FLS A;  4B47 A;  4RVB A;  4BS9 A;  3WQQ A;  3ZHX A;  1ONN A;  4AR9 A;  2XQ0 A;  3WQS B;  1YX5 A;  3RQ4 A;  3MKW B;  4L2L A;  1D0Z A;  4XN3 A;  5CQG A;  1MW1 A;  2KRC A;  3L2Q A;  2IGO A;  3CHO A;  1K5H A;  1X1A A;  2GOX B;  1R0L A;  4RSY A;  2VQH A;  4R5X A;  2BVM A;  4FCA A;  2VKD A;  3CHP A;  2QKM B;  4B48 A;  2Y1D A;  3OS2 A;  3Q43 A;  2CMP A;  2VPL A;  4XNB A;  4BUP A;  3RC8 A;  3OR2 C;  5HNF A;  1ERD A;  3ZXS A;  1Q0L A;  2AQE A;  3S32 A;  2LRE A;  3IP4 B;  4F52 A;  2BW3 A;  5EV7 A;  4QIR A;  4LIV A;  5HVQ C;  4F91 B;  3DU6 A;  5HOO A;  4B43 A;  1W36 C;  3I3L A;  3U21 A;  3FTS A;  1Q0Q A;  1SC5 A;  3KX2 A;  2K3P A;  4QME A;  1FMW A;  1W36 D;  2VB6 A;  2F6C A;  2MAO A;  1NG6 A;  2M3A A;  4XMU A;  1X4O A;  2UV1 A;  2KPM A;  2V7F A;  3TL4 X;  1DQU A;  2LC2 A;  4DIQ A;  4P1W A;  2GTQ A;  4IQJ A;  4Y6P A;  2Y1C A;  5FWQ A;  2VAS A;  3A2K A;  1G5A A;  4ZX4 A;  4BE0 A;  3K4C A;  3CHS A;  2IGM A;  5CKT A;  2VQG A;  2X85 A;  2R70 A;  4XMX A;  1X1B A;  2WAD A;  4OAZ A;  4ARF A;  4ITV A;  4E7H A;  4ZTJ A;  3NWS A;  3H5R A;  3S8P A;  3K4L A;  3CZL A;  4R5V A;  4XOP A;  2CW8 A;  1GLN A;  4PJL A;  2VLA A;  1UAA A;  3LSM A;  3HC7 A;  4BKX A;  3EUK L;  2ZSI B;  1JVS A;  5AEN A;  2KMU A;  3AFH A;  3G2B A;  4DJA A;  2R72 A;  3QOE A;  3Q44 A;  4PU2 A;  4AR1 A;  4XKC A;  2WA0 A;  4XKB A;  4XLC A;  2R7T A;  4ZW8 A;  3SDB A;  3OYI A;  3AL0 C;  1ONO A;  2QJ1 A;  4PJM A;  2AQF A;  2X6Y A;  3DKX A;  3HOS A;  3AU9 A;  4HNU A;  4ZX5 A;  4XL9 A;  4U7B A;  2RRE A;  3UEQ A;  1WFX A;  1LKX A;  3VYS B;  4NQW A;  2XF5 A;  2E5Z A;  2ELJ A;  2PJR B;  1MMN A;  3FBI B;  1H19 A;  2HVQ A;  2ZSH B;  4XN4 A;  3EPZ A;  1X1C A;  4CH7 A;  4XQF A;  2UUZ A;  2K9L A;  4YRV A;  3OYF A;  3FUM A;  2IXS A;  4NC7 A;  3MKY B;  2WY7 Q;  3OYH A;  3SEQ A;  2R7Q A;  4J00 A;  3DTI A;  3OS1 A;  3FTX A;  4FLO A;  4XNA A;  3FUN A;  4MKT A;  1N77 A;  2DOA A;  2HPT A;  2Q2E B;  4C30 A;  4XN7 A;  2KDO A;  3HL2 A;  4GRI A;  1QHH D;  2R7X A;  3LSK A;  3MD2 A;  3FUJ A;  3H9G A;  3RPU D;  3AKZ A;  3TBI A;  4BGD A;  1S46 A;  5DLL A;  3PL8 A;  2V9K A;  3RAS A;  3OYB A;  3ANL A;  1N78 A;  1WJF A;  2W82 A;  3LSI A;  4X0G A;  2JSP A;  3PSI A;  4E7J A;  2XPZ A;  2R7O A;  4XMY A;  3FU5 A;  4ZQE A;  1LFP A;  4ZW7 A;  4RM3 A;  4XLE A;  2X1E A;  4ZYA A;  4DBQ A;  4ZTF A;  3BCA A;  1HA8 A;  2VXZ A;  3FUH A;  3JT1 A;  2HVS A;  1G8X A;  3LSH A;  3PFY A;  3ZR8 X;  3OYM A;  3CZE A;  3UCQ A;  2WY8 Q;  4XKV A;  2A5W A;  2LG4 A;  3B37 A;  5FRM A;  2R7U A;  2CUJ A;  1Y6I A;  4NNJ A;  3E0J B;  3FH8 A;  3FUE A;  3OOU A;  4XN5 A;  1D1C A;  2VJ5 A;  2A6T A;  2VQC A;  2JV7 A;  5LD2 C;  4B3X A;  1SQM A;  3L2R A;  4CCO A;  4XO4 A;  4XND A;  4NUB A;  1Z3Y A;  1MMD A;  1MVY A;  4OOF A;  2XDV A;  2IGN A;  3VVL A;  4BEH A;  2XF6 A;  4R7L A;  3IUO A;  3B2X A;  4YEL A;  4KIT B;  4ZDL A;  3PUB A;  4RMN A;  5FRO A;  3OYE A;  3LL7 A;  3VYT B;  3CZG A;  1WJ5 A;  3CMM A;  3PNV A;  4FLR A;  3GBG A;  1IRX A;  2HQA A;  1MW2 A;  2VJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...