2MAOA

Nmr structure of region 2 of e. coli sigmae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords RNA polymerase sigma factor
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2maoA00
4Y6PA 2Y1DA 1Q0LA 2C82A 4CXFA 3WQRA 1MVYA 1SC5A 2JCXA 4ZQGA 1R0KA 3AUAA 3ZHYA 4AICA 1JG9A 3CZGA 3CZEA 3ANMA 1R0LA 4FLSA 5JAZA 4GAEA 3UEQA 2Y1FA 1T1SA 3A06A 1OR7A 1ONOA 4Y6SA 2Y1EA 2JD1A 4ZQFA 3A14A 4FLQA 3ANNA 3IIEA 3T0YA 3UERA 1ONPA 2O7GA 3AU9A 1MW2A 2WPGA 4LUPA 4OOFA 4ZQHA 4Y6RA 4A03A 5JC1A 3ZI0A 3CZLA 3UCQA 2JD2A 5JO0A 2MAPA 1JGIA 2JD0A 1JVSA 1T1RA 4Y67A 1ZS2A 2EGHA 4FLRA 5JMWA 1MW1A 3WQQA 1H3LA 4NQWA 1MW3A 2Y1GA 5JNLA 5JMPA 3R0IA 5DULA 1ONNA 1Q0QA 2JCYA 3ZHXA 2Y1CA 1G5AA 4ZN6A 3RASA 4FLOA 4KP7A 3ZHZA 4OOEA 2JCVA 4ZQEA 1Q0HA 2MAOA 1RP3A 1K5HA 3AU8A 3WQSB 1MW0A 4RCVA 3ANLA 4AYSA 1S46A 5JBIA 3CZKA
chains in the Genus database with same CATH superfamily
2HPOA 4Y6PA 4XN1A 3JSZA 5EV7A 2Y1DA 1Q0LA 2C82A 3EBHA 4ZW5A 4CXFA 4K5OA 4J3BA 2QJ1A 3JT1A 4MKTA 3WQRA 1MVYA 1SC5A 2JCXA 3CHRA 4ZQGA 1R0KA 3AUAA 3ZHYA 4AICA 5BPPA 3FH5A 5DYFA 1JG9A 3CZGA 1GW6A 3ANMA 1R0LA 3CZEA 3FH7A 2DQMA 2B61A 3EBGA 4FLSA 4XN2A 5JAZA 3CHSA 4GAEA 3UEQA 4K5PA 2Y1FA 4R5VA 1T1SA 4ZW6A 3FUMA 3B2XA 4ZW8A 3FTZA 3A06A 1OR7A 1ONOA 4Y6SA 2Y1EA 4XN5A 3QJXA 3VVMA 2JD1A 3U9WA 2JV7A 1H19A 4ZQFA 2VJ8A 3A14A 3FUHA 4QPEA 3T8VA 2DQ6A 4FLQA 1SQMA 4AR9A 4XMWA 4XN9A 4XNAA 3ANNA 3IIEA 4BKXA 3FULA 4ZX4A 3CHOA 3T0YA 1ONPA 3UERA 2O7GA 3AU9A 3FTUA 1MW2A 4K5NA 2WPGA 3FTXA 4QHPA 5HLTA 4LUPA 2PGGA 3FH8A 3B7RL 3HW2A 3KEDA 4OOFA 4ZX5A 4RVBA 4PU2A 3CIAA 4ZX3A 4R5TA 4ZQHA 3B3BA 3EBIA 3Q43A 3B7UX 3FU5A 4Y6RA 2HPTA 4A03A 3B2PA 4PVBA 2C5ZA 5JC1A 3ZI0A 4XMZA 3CZLA 4XNDA 3UCQA 2A7OA 4QMEA 2WZGA 2JD2A 4R5XA 4QIRA 4XMXA 2RJIA 4MS6A 2R70A 4XNBA 1HS6A 5JO0A 4XO5A 3B7TA 3FU6A 4AR1A 5FWQA 2MAPA 3B7SA 4XO3A 4ZW7A 3FTVA 4XMTA 2XQ0A 4Q4IA 3FUIA 3RC3A 1JGIA 2JD0A 3FUJA 4AR8A 1JVSA 1T1RA 1ZS2A 1X3ZA 2EGHA 4FLRA 4Y67A 5JMWA 3FU3A 1MW1A 3WQQA 1H3LA 2ZXGA 4NQWA 4XO4A 2QVWA 1MW3A 2Y1GA 5JNLA 3CXBA 5JMPA 3FUFA 3R0IA 5DULA 4L2LA 1ONNA 1Q0QA 2JCYA 3ZHXA 4ZX6A 4GAAA 4ZQTA 3FTWA 2Y1CA 3FU0A 1G5AA 4K5LA 4X2UA 4ZN6A 5HNHA 4FCAA 3RASA 4DPRA 2XPYA 3B37A 3FUDA 4XN8A 5HNFA 4FLOA 1X3WA 4KP7A 2GTQA 4ARFA 5AENA 1SG7A 4R7LA 4XMUA 3FUEA 4XN7A 4XMVA 3FUNA 2PL5A 4XN4A 3ZHZA 2XPZA 3CHQA 3Q44A 4RSYA 5DLLA 2PUSA 2R59A 3FUKA 4OOEA 2JCVA 2FFLA 3FTYA 4ZQEA 3PUUA 2R72A 3FTSA 4K5MA 1Q0HA 2MAOA 3FHEA 1RP3A 1K5HA 3AU8A 2WZFA 4Q4EA 3RC8A 3WQSB 1MW0A 4PW4A 4RCVA 3VVLA 3ANLA 3CHPA 2VLAA 4ZW3A 4AYSA 1S46A 5JBIA 3B34A 3CZKA 4QUOA 4JNDA
chains in the Genus database with same CATH topology
2HPOA 4Y6PA 4XN1A 3JSZA 5EV7A 2Y1DA 1Q0LA 2C82A 3EBHA 4ZW5A 4CXFA 4K5OA 4J3BA 2QJ1A 3JT1A 4MKTA 3WQRA 1MVYA 1SC5A 2JCXA 3CHRA 4ZQGA 1R0KA 3AUAA 3ZHYA 4AICA 5BPPA 3FH5A 5DYFA 1JG9A 3CZGA 1GW6A 3ANMA 1R0LA 3CZEA 3FH7A 2DQMA 2B61A 3EBGA 4FLSA 4XN2A 5JAZA 3CHSA 4GAEA 3UEQA 4K5PA 2Y1FA 4R5VA 1T1SA 4ZW6A 3FUMA 3B2XA 4ZW8A 3FTZA 3A06A 1OR7A 1ONOA 4Y6SA 2Y1EA 4XN5A 3QJXA 3VVMA 2JD1A 3U9WA 2JV7A 1H19A 4ZQFA 2VJ8A 3A14A 3FUHA 4QPEA 3T8VA 2DQ6A 4FLQA 1SQMA 4AR9A 4XMWA 4XN9A 4XNAA 3ANNA 3IIEA 4BKXA 3FULA 4ZX4A 3CHOA 3T0YA 1ONPA 3UERA 2O7GA 3AU9A 3FTUA 1MW2A 4K5NA 2WPGA 3FTXA 4QHPA 5HLTA 4LUPA 2PGGA 3FH8A 3B7RL 3KEDA 4OOFA 4ZX5A 4RVBA 4PU2A 3CIAA 4ZX3A 4R5TA 4ZQHA 3B3BA 3EBIA 3Q43A 3B7UX 3FU5A 4Y6RA 2HPTA 4A03A 3B2PA 4PVBA 2C5ZA 5JC1A 3ZI0A 4XMZA 3CZLA 4XNDA 3UCQA 2A7OA 4QMEA 2WZGA 2JD2A 4R5XA 4QIRA 4XMXA 2RJIA 4MS6A 2R70A 4XNBA 1HS6A 5JO0A 4XO5A 3B7TA 3FU6A 4AR1A 5FWQA 2MAPA 3B7SA 4XO3A 4ZW7A 3FTVA 4XMTA 2XQ0A 4Q4IA 3FUIA 3RC3A 1JGIA 2JD0A 3FUJA 4AR8A 1JVSA 1T1RA 1ZS2A 1X3ZA 2EGHA 4FLRA 4Y67A 5JMWA 3FU3A 1MW1A 3WQQA 1H3LA 2ZXGA 4NQWA 4XO4A 2QVWA 1MW3A 2Y1GA 5JNLA 5JMPA 3FUFA 3R0IA 5DULA 4L2LA 1ONNA 1Q0QA 2JCYA 3ZHXA 4ZX6A 4GAAA 4ZQTA 3FTWA 2Y1CA 3FU0A 1G5AA 4K5LA 4X2UA 4ZN6A 5HNHA 4FCAA 3RASA 4DPRA 2XPYA 3B37A 3FUDA 4XN8A 5HNFA 4FLOA 1X3WA 4KP7A 2GTQA 4ARFA 5AENA 1SG7A 4R7LA 4XMUA 3FUEA 4XN7A 4XMVA 3FUNA 2PL5A 4XN4A 3ZHZA 2XPZA 3CHQA 3Q44A 4RSYA 5DLLA 2PUSA 2R59A 3FUKA 4OOEA 2JCVA 2FFLA 3FTYA 4ZQEA 3PUUA 2R72A 3FTSA 4K5MA 1Q0HA 2MAOA 3FHEA 1RP3A 1K5HA 3AU8A 2WZFA 4Q4EA 3RC8A 3WQSB 1MW0A 4PW4A 4RCVA 3VVLA 3ANLA 3CHPA 2VLAA 4ZW3A 4AYSA 1S46A 5JBIA 3B34A 3CZKA 4QUOA 4JNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6P A;  2Y1D A;  1Q0L A;  2C82 A;  4CXF A;  3WQR A;  1MVY A;  1SC5 A;  2JCX A;  4ZQG A;  1R0K A;  3AUA A;  3ZHY A;  4AIC A;  1JG9 A;  3CZG A;  3CZE A;  3ANM A;  1R0L A;  4FLS A;  5JAZ A;  4GAE A;  3UEQ A;  2Y1F A;  1T1S A;  3A06 A;  1OR7 A;  1ONO A;  4Y6S A;  2Y1E A;  2JD1 A;  4ZQF A;  3A14 A;  4FLQ A;  3ANN A;  3IIE A;  3T0Y A;  3UER A;  1ONP A;  2O7G A;  3AU9 A;  1MW2 A;  2WPG A;  4LUP A;  4OOF A;  4ZQH A;  4Y6R A;  4A03 A;  5JC1 A;  3ZI0 A;  3CZL A;  3UCQ A;  2JD2 A;  5JO0 A;  2MAP A;  1JGI A;  2JD0 A;  1JVS A;  1T1R A;  4Y67 A;  1ZS2 A;  2EGH A;  4FLR A;  5JMW A;  1MW1 A;  3WQQ A;  1H3L A;  4NQW A;  1MW3 A;  2Y1G A;  5JNL A;  5JMP A;  3R0I A;  5DUL A;  1ONN A;  1Q0Q A;  2JCY A;  3ZHX A;  2Y1C A;  1G5A A;  4ZN6 A;  3RAS A;  4FLO A;  4KP7 A;  3ZHZ A;  4OOE A;  2JCV A;  4ZQE A;  1Q0H A;  2MAO A;  1RP3 A;  1K5H A;  3AU8 A;  3WQS B;  1MW0 A;  4RCV A;  3ANL A;  4AYS A;  1S46 A;  5JBI A;  3CZK A; 
#chains in the Genus database with same CATH topology
 2HPO A;  4Y6P A;  4XN1 A;  3JSZ A;  5EV7 A;  2Y1D A;  1Q0L A;  2C82 A;  3EBH A;  4ZW5 A;  4CXF A;  4K5O A;  4J3B A;  2QJ1 A;  3JT1 A;  4MKT A;  3WQR A;  1MVY A;  1SC5 A;  2JCX A;  3CHR A;  4ZQG A;  1R0K A;  3AUA A;  3ZHY A;  4AIC A;  5BPP A;  3FH5 A;  5DYF A;  1JG9 A;  3CZG A;  1GW6 A;  3ANM A;  1R0L A;  3CZE A;  3FH7 A;  2DQM A;  2B61 A;  3EBG A;  4FLS A;  4XN2 A;  5JAZ A;  3CHS A;  4GAE A;  3UEQ A;  4K5P A;  2Y1F A;  4R5V A;  1T1S A;  4ZW6 A;  3FUM A;  3B2X A;  4ZW8 A;  3FTZ A;  3A06 A;  1OR7 A;  1ONO A;  4Y6S A;  2Y1E A;  4XN5 A;  3QJX A;  3VVM A;  2JD1 A;  3U9W A;  2JV7 A;  1H19 A;  4ZQF A;  2VJ8 A;  3A14 A;  3FUH A;  4QPE A;  3T8V A;  2DQ6 A;  4FLQ A;  1SQM A;  4AR9 A;  4XMW A;  4XN9 A;  4XNA A;  3ANN A;  3IIE A;  4BKX A;  3FUL A;  4ZX4 A;  3CHO A;  3T0Y A;  1ONP A;  3UER A;  2O7G A;  3AU9 A;  3FTU A;  1MW2 A;  4K5N A;  2WPG A;  3FTX A;  4QHP A;  5HLT A;  4LUP A;  2PGG A;  3FH8 A;  3B7R L;  3HW2 A;  3KED A;  4OOF A;  4ZX5 A;  4RVB A;  4PU2 A;  3CIA A;  4ZX3 A;  4R5T A;  4ZQH A;  3B3B A;  3EBI A;  3Q43 A;  3B7U X;  3FU5 A;  4Y6R A;  2HPT A;  4A03 A;  3B2P A;  4PVB A;  2C5Z A;  5JC1 A;  3ZI0 A;  4XMZ A;  3CZL A;  4XND A;  3UCQ A;  2A7O A;  4QME A;  2WZG A;  2JD2 A;  4R5X A;  4QIR A;  4XMX A;  2RJI A;  4MS6 A;  2R70 A;  4XNB A;  1HS6 A;  5JO0 A;  4XO5 A;  3B7T A;  3FU6 A;  4AR1 A;  5FWQ A;  2MAP A;  3B7S A;  4XO3 A;  4ZW7 A;  3FTV A;  4XMT A;  2XQ0 A;  4Q4I A;  3FUI A;  3RC3 A;  1JGI A;  2JD0 A;  3FUJ A;  4AR8 A;  1JVS A;  1T1R A;  1ZS2 A;  1X3Z A;  2EGH A;  4FLR A;  4Y67 A;  5JMW A;  3FU3 A;  1MW1 A;  3WQQ A;  1H3L A;  2ZXG A;  4NQW A;  4XO4 A;  2QVW A;  1MW3 A;  2Y1G A;  5JNL A;  3CXB A;  5JMP A;  3FUF A;  3R0I A;  5DUL A;  4L2L A;  1ONN A;  1Q0Q A;  2JCY A;  3ZHX A;  4ZX6 A;  4GAA A;  4ZQT A;  3FTW A;  2Y1C A;  3FU0 A;  1G5A A;  4K5L A;  4X2U A;  4ZN6 A;  5HNH A;  4FCA A;  3RAS A;  4DPR A;  2XPY A;  3B37 A;  3FUD A;  4XN8 A;  5HNF A;  4FLO A;  1X3W A;  4KP7 A;  2GTQ A;  4ARF A;  5AEN A;  1SG7 A;  4R7L A;  4XMU A;  3FUE A;  4XN7 A;  4XMV A;  3FUN A;  2PL5 A;  4XN4 A;  3ZHZ A;  2XPZ A;  3CHQ A;  3Q44 A;  4RSY A;  5DLL A;  2PUS A;  2R59 A;  3FUK A;  4OOE A;  2JCV A;  2FFL A;  3FTY A;  4ZQE A;  3PUU A;  2R72 A;  3FTS A;  4K5M A;  1Q0H A;  2MAO A;  3FHE A;  1RP3 A;  1K5H A;  3AU8 A;  2WZF A;  4Q4E A;  3RC8 A;  3WQS B;  1MW0 A;  4PW4 A;  4RCV A;  3VVL A;  3ANL A;  3CHP A;  2VLA A;  4ZW3 A;  4AYS A;  1S46 A;  5JBI A;  3B34 A;  3CZK A;  4QUO A;  4JND A; 
#chains in the Genus database with same CATH homology
 2HPO A;  4Y6P A;  4XN1 A;  3JSZ A;  5EV7 A;  2Y1D A;  1Q0L A;  2C82 A;  3EBH A;  4ZW5 A;  4CXF A;  4K5O A;  4J3B A;  2QJ1 A;  3JT1 A;  4MKT A;  3WQR A;  1MVY A;  1SC5 A;  2JCX A;  3CHR A;  4ZQG A;  1R0K A;  3AUA A;  3ZHY A;  4AIC A;  5BPP A;  3FH5 A;  5DYF A;  1JG9 A;  3CZG A;  1GW6 A;  3ANM A;  1R0L A;  3CZE A;  3FH7 A;  2DQM A;  2B61 A;  3EBG A;  4FLS A;  4XN2 A;  5JAZ A;  3CHS A;  4GAE A;  3UEQ A;  4K5P A;  2Y1F A;  4R5V A;  1T1S A;  4ZW6 A;  3FUM A;  3B2X A;  4ZW8 A;  3FTZ A;  3A06 A;  1OR7 A;  1ONO A;  4Y6S A;  2Y1E A;  4XN5 A;  3QJX A;  3VVM A;  2JD1 A;  3U9W A;  2JV7 A;  1H19 A;  4ZQF A;  2VJ8 A;  3A14 A;  3FUH A;  4QPE A;  3T8V A;  2DQ6 A;  4FLQ A;  1SQM A;  4AR9 A;  4XMW A;  4XN9 A;  4XNA A;  3ANN A;  3IIE A;  4BKX A;  3FUL A;  4ZX4 A;  3CHO A;  3T0Y A;  1ONP A;  3UER A;  2O7G A;  3AU9 A;  3FTU A;  1MW2 A;  4K5N A;  2WPG A;  3FTX A;  4QHP A;  5HLT A;  4LUP A;  2PGG A;  3FH8 A;  3B7R L;  3KED A;  4OOF A;  4ZX5 A;  4RVB A;  4PU2 A;  3CIA A;  4ZX3 A;  4R5T A;  4ZQH A;  3B3B A;  3EBI A;  3Q43 A;  3B7U X;  3FU5 A;  4Y6R A;  2HPT A;  4A03 A;  3B2P A;  4PVB A;  2C5Z A;  5JC1 A;  3ZI0 A;  4XMZ A;  3CZL A;  4XND A;  3UCQ A;  2A7O A;  4QME A;  2WZG A;  2JD2 A;  4R5X A;  4QIR A;  4XMX A;  2RJI A;  4MS6 A;  2R70 A;  4XNB A;  1HS6 A;  5JO0 A;  4XO5 A;  3B7T A;  3FU6 A;  4AR1 A;  5FWQ A;  2MAP A;  3B7S A;  4XO3 A;  4ZW7 A;  3FTV A;  4XMT A;  2XQ0 A;  4Q4I A;  3FUI A;  3RC3 A;  1JGI A;  2JD0 A;  3FUJ A;  4AR8 A;  1JVS A;  1T1R A;  1ZS2 A;  1X3Z A;  2EGH A;  4FLR A;  4Y67 A;  5JMW A;  3FU3 A;  1MW1 A;  3WQQ A;  1H3L A;  2ZXG A;  4NQW A;  4XO4 A;  2QVW A;  1MW3 A;  2Y1G A;  5JNL A;  5JMP A;  3FUF A;  3R0I A;  5DUL A;  4L2L A;  1ONN A;  1Q0Q A;  2JCY A;  3ZHX A;  4ZX6 A;  4GAA A;  4ZQT A;  3FTW A;  2Y1C A;  3FU0 A;  1G5A A;  4K5L A;  4X2U A;  4ZN6 A;  5HNH A;  4FCA A;  3RAS A;  4DPR A;  2XPY A;  3B37 A;  3FUD A;  4XN8 A;  5HNF A;  4FLO A;  1X3W A;  4KP7 A;  2GTQ A;  4ARF A;  5AEN A;  1SG7 A;  4R7L A;  4XMU A;  3FUE A;  4XN7 A;  4XMV A;  3FUN A;  2PL5 A;  4XN4 A;  3ZHZ A;  2XPZ A;  3CHQ A;  3Q44 A;  4RSY A;  5DLL A;  2PUS A;  2R59 A;  3FUK A;  4OOE A;  2JCV A;  2FFL A;  3FTY A;  4ZQE A;  3PUU A;  2R72 A;  3FTS A;  4K5M A;  1Q0H A;  2MAO A;  3FHE A;  1RP3 A;  1K5H A;  3AU8 A;  2WZF A;  4Q4E A;  3RC8 A;  3WQS B;  1MW0 A;  4PW4 A;  4RCV A;  3VVL A;  3ANL A;  3CHP A;  2VLA A;  4ZW3 A;  4AYS A;  1S46 A;  5JBI A;  3B34 A;  3CZK A;  4QUO A;  4JND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...