2MAOA

Nmr structure of region 2 of e. coli sigmae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2maoA00
5JC1A 2EGHA 3ANMA 3UCQA 1OR7A 3RASA 3ANLA 3AU8A 1MW1A 4Y67A 3WQSB 4A03A 3CZGA 4ZQHA 2JCVA 3WQQA 4FLOA 4FLQA 2MAPA 1K5HA 4OOEA 1ONOA 3WQRA 3AUAA 3A06A 3ZHXA 1T1SA 1R0LA 2JD1A 4ZQFA 4KP7A 2Y1GA 4Y6SA 4GAEA 3CZLA 2JCXA 3UERA 5JNLA 4AICA 4RCVA 2Y1FA 3IIEA 3ZI0A 2Y1EA 5JBIA 2JD2A 4NQWA 1Q0LA 2JD0A 1ZS2A 1SC5A 2WPGA 4FLRA 3CZEA 3ZHYA 1JVSA 1Q0HA 1ONPA 3AU9A 4ZQGA 1ONNA 4OOFA 1JGIA 3A14A 1MW3A 4FLSA 1H3LA 3UEQA 1R0KA 4ZN6A 1MW2A 3CZKA 2Y1DA 5DULA 2Y1CA 5JO0A 4Y6RA 1MVYA 2JCYA 1MW0A 1S46A 2MAOA 4AYSA 1T1RA 4LUPA 3T0YA 1Q0QA 3ANNA 3ZHZA 5JAZA 5JMWA 1JG9A 2O7GA 4CXFA 1G5AA 1RP3A 4ZQEA 2C82A 5JMPA 3R0IA 4Y6PA
chains in the Genus database with same CATH superfamily
3FTUA 3B7SA 5JC1A 2EGHA 3Q43A 2HPOA 5DLLA 2XPZA 3Q44A 4XMZA 3FUIA 3FTVA 3ANMA 3FUHA 4R5TA 3UCQA 3B3BA 4ARFA 1OR7A 3RASA 3FU6A 3ANLA 3CHRA 4RVBA 4AR1A 2HPTA 2B61A 3AU8A 5HLTA 5HNFA 2FFLA 3FH5A 1MW1A 2VJ8A 3EBIA 4XN8A 4Y67A 3FTZA 3WQSB 4A03A 4K5OA 3CZGA 3FULA 4ZQHA 2JCVA 4J3BA 3WQQA 4FCAA 4FLOA 2WZFA 4FLQA 2MAPA 4PW4A 2PGGA 3T8VA 4ZW7A 1K5HA 4OOEA 1ONOA 3FH8A 4XNDA 3WQRA 3AUAA 2RJIA 4ZX6A 2PUSA 4ZX4A 3A06A 4Q4EA 3ZHXA 3FTYA 3FUNA 4XO5A 1T1SA 4ZW8A 5AENA 1GW6A 2WZGA 4ZX3A 2VLAA 1R0LA 2JD1A 4ZQFA 4XMTA 4XN5A 4KP7A 2Y1GA 3B7UX 3FHEA 4Y6SA 4XNAA 4QIRA 3PUUA 3B37A 4K5MA 5DYFA 4ZW6A 4GAEA 4DPRA 3CZLA 5BPPA 2JCXA 3CHOA 3B7TA 3UERA 2ZXGA 3FH7A 4QUOA 3CIAA 5JNLA 3B2XA 2PL5A 3FUEA 3QJXA 4AICA 4RSYA 4K5NA 4ZX5A 3FUMA 4RCVA 4XN9A 4ZQTA 2Y1FA 3IIEA 3ZI0A 2Y1EA 3JT1A 5JBIA 3FUFA 2JD2A 1Q0LA 2JD0A 1HS6A 4NQWA 3EBHA 2XPYA 1ZS2A 1SC5A 2WPGA 4FLRA 3CZEA 4JNDA 3ZHYA 3FUKA 4AR8A 1JVSA 4R7LA 1Q0HA 4K5PA 1ONPA 4XMUA 3VVMA 5EV7A 4R5XA 3FTWA 3AU9A 4AR9A 3B34A 4XMWA 4ZQGA 4MKTA 1ONNA 4OOFA 1JGIA 3B2PA 3A14A 1MW3A 4FLSA 1H3LA 3FTXA 3UEQA 4PVBA 3RC3A 1R0KA 4XN4A 3CHPA 4XNBA 2A7OA 4BKXA 3FTSA 3HW2A 4ZN6A 3RC8A 1MW2A 3CZKA 2Y1DA 4XO3A 5DULA 4MS6A 2JV7A 4XMXA 2Y1CA 4QPEA 3CXBA 5JO0A 4R5VA 4Q4IA 2R70A 1X3ZA 1MVYA 4Y6RA 2JCYA 1MW0A 3FU3A 2GTQA 3B7RL 1X3WA 1S46A 2MAOA 3FUJA 2DQ6A 1T1RA 2R72A 4XN7A 4AYSA 3T0YA 4LUPA 2C5ZA 1Q0QA 4QHPA 4X2UA 1H19A 3CHQA 3JSZA 3ANNA 1SQMA 4GAAA 4K5LA 2QJ1A 3ZHZA 4L2LA 5JAZA 5JMWA 1JG9A 3CHSA 3KEDA 4PU2A 3FU5A 2O7GA 3FU0A 4CXFA 2XQ0A 5HNHA 4ZW5A 4QMEA 2R59A 4XN1A 4ZW3A 4XN2A 1G5AA 1RP3A 1SG7A 3U9WA 4ZQEA 2C82A 2DQMA 5JMPA 4XO4A 3VVLA 5FWQA 3R0IA 3FUDA 4Y6PA 2QVWA 3EBGA 4XMVA
chains in the Genus database with same CATH topology
3FTUA 3B7SA 5JC1A 2EGHA 3Q43A 2HPOA 5DLLA 2XPZA 3Q44A 4XMZA 3FUIA 3FTVA 3ANMA 3FUHA 4R5TA 3UCQA 3B3BA 4ARFA 1OR7A 3RASA 3FU6A 3ANLA 3CHRA 4RVBA 4AR1A 2HPTA 2B61A 3AU8A 5HLTA 5HNFA 2FFLA 3FH5A 1MW1A 2VJ8A 3EBIA 4XN8A 4Y67A 3FTZA 3WQSB 4A03A 4K5OA 3CZGA 3FULA 4ZQHA 2JCVA 4J3BA 3WQQA 4FCAA 4FLOA 2WZFA 4FLQA 2MAPA 4PW4A 2PGGA 3T8VA 4ZW7A 1K5HA 4OOEA 1ONOA 3FH8A 4XNDA 3WQRA 3AUAA 2RJIA 4ZX6A 2PUSA 4ZX4A 3A06A 4Q4EA 3ZHXA 3FTYA 3FUNA 4XO5A 1T1SA 4ZW8A 5AENA 1GW6A 2WZGA 4ZX3A 2VLAA 1R0LA 2JD1A 4ZQFA 4XMTA 4XN5A 4KP7A 2Y1GA 3B7UX 3FHEA 4Y6SA 4XNAA 4QIRA 3PUUA 3B37A 4K5MA 5DYFA 4ZW6A 4GAEA 4DPRA 3CZLA 5BPPA 2JCXA 3CHOA 3B7TA 3UERA 2ZXGA 3FH7A 4QUOA 3CIAA 5JNLA 3B2XA 2PL5A 3FUEA 3QJXA 4AICA 4RSYA 4K5NA 4ZX5A 3FUMA 4RCVA 4XN9A 4ZQTA 2Y1FA 3IIEA 3ZI0A 2Y1EA 3JT1A 5JBIA 3FUFA 2JD2A 1Q0LA 2JD0A 1HS6A 4NQWA 3EBHA 2XPYA 1ZS2A 1SC5A 2WPGA 4FLRA 3CZEA 4JNDA 3ZHYA 3FUKA 4AR8A 1JVSA 4R7LA 1Q0HA 4K5PA 1ONPA 4XMUA 3VVMA 5EV7A 4R5XA 3FTWA 3AU9A 4AR9A 3B34A 4XMWA 4ZQGA 4MKTA 1ONNA 4OOFA 1JGIA 3B2PA 3A14A 1MW3A 4FLSA 1H3LA 3FTXA 3UEQA 4PVBA 3RC3A 1R0KA 4XN4A 3CHPA 4XNBA 2A7OA 4BKXA 3FTSA 4ZN6A 3RC8A 1MW2A 3CZKA 2Y1DA 4XO3A 5DULA 4MS6A 2JV7A 4XMXA 2Y1CA 4QPEA 5JO0A 4R5VA 4Q4IA 2R70A 1X3ZA 1MVYA 4Y6RA 2JCYA 1MW0A 3FU3A 2GTQA 3B7RL 1X3WA 1S46A 2MAOA 3FUJA 2DQ6A 1T1RA 2R72A 4XN7A 4AYSA 3T0YA 4LUPA 2C5ZA 1Q0QA 4QHPA 4X2UA 1H19A 3CHQA 3JSZA 3ANNA 1SQMA 4GAAA 4K5LA 2QJ1A 3ZHZA 4L2LA 5JAZA 5JMWA 1JG9A 3CHSA 3KEDA 4PU2A 3FU5A 2O7GA 3FU0A 4CXFA 2XQ0A 5HNHA 4ZW5A 4QMEA 2R59A 4XN1A 4ZW3A 4XN2A 1G5AA 1RP3A 1SG7A 3U9WA 4ZQEA 2C82A 2DQMA 5JMPA 4XO4A 3VVLA 5FWQA 3R0IA 3FUDA 4Y6PA 2QVWA 3EBGA 4XMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JC1 A;  2EGH A;  3ANM A;  3UCQ A;  1OR7 A;  3RAS A;  3ANL A;  3AU8 A;  1MW1 A;  4Y67 A;  3WQS B;  4A03 A;  3CZG A;  4ZQH A;  2JCV A;  3WQQ A;  4FLO A;  4FLQ A;  2MAP A;  1K5H A;  4OOE A;  1ONO A;  3WQR A;  3AUA A;  3A06 A;  3ZHX A;  1T1S A;  1R0L A;  2JD1 A;  4ZQF A;  4KP7 A;  2Y1G A;  4Y6S A;  4GAE A;  3CZL A;  2JCX A;  3UER A;  5JNL A;  4AIC A;  4RCV A;  2Y1F A;  3IIE A;  3ZI0 A;  2Y1E A;  5JBI A;  2JD2 A;  4NQW A;  1Q0L A;  2JD0 A;  1ZS2 A;  1SC5 A;  2WPG A;  4FLR A;  3CZE A;  3ZHY A;  1JVS A;  1Q0H A;  1ONP A;  3AU9 A;  4ZQG A;  1ONN A;  4OOF A;  1JGI A;  3A14 A;  1MW3 A;  4FLS A;  1H3L A;  3UEQ A;  1R0K A;  4ZN6 A;  1MW2 A;  3CZK A;  2Y1D A;  5DUL A;  2Y1C A;  5JO0 A;  4Y6R A;  1MVY A;  2JCY A;  1MW0 A;  1S46 A;  2MAO A;  4AYS A;  1T1R A;  4LUP A;  3T0Y A;  1Q0Q A;  3ANN A;  3ZHZ A;  5JAZ A;  5JMW A;  1JG9 A;  2O7G A;  4CXF A;  1G5A A;  1RP3 A;  4ZQE A;  2C82 A;  5JMP A;  3R0I A;  4Y6P A; 
#chains in the Genus database with same CATH topology
 3FTU A;  3B7S A;  5JC1 A;  2EGH A;  3Q43 A;  2HPO A;  5DLL A;  2XPZ A;  3Q44 A;  4XMZ A;  3FUI A;  3FTV A;  3ANM A;  3FUH A;  4R5T A;  3UCQ A;  3B3B A;  4ARF A;  1OR7 A;  3RAS A;  3FU6 A;  3ANL A;  3CHR A;  4RVB A;  4AR1 A;  2HPT A;  2B61 A;  3AU8 A;  5HLT A;  5HNF A;  2FFL A;  3FH5 A;  1MW1 A;  2VJ8 A;  3EBI A;  4XN8 A;  4Y67 A;  3FTZ A;  3WQS B;  4A03 A;  4K5O A;  3CZG A;  3FUL A;  4ZQH A;  2JCV A;  4J3B A;  3WQQ A;  4FCA A;  4FLO A;  2WZF A;  4FLQ A;  2MAP A;  4PW4 A;  2PGG A;  3T8V A;  4ZW7 A;  1K5H A;  4OOE A;  1ONO A;  3FH8 A;  4XND A;  3WQR A;  3AUA A;  2RJI A;  4ZX6 A;  2PUS A;  4ZX4 A;  3A06 A;  4Q4E A;  3ZHX A;  3FTY A;  3FUN A;  4XO5 A;  1T1S A;  4ZW8 A;  5AEN A;  1GW6 A;  2WZG A;  4ZX3 A;  2VLA A;  1R0L A;  2JD1 A;  4ZQF A;  4XMT A;  4XN5 A;  4KP7 A;  2Y1G A;  3B7U X;  3FHE A;  4Y6S A;  4XNA A;  4QIR A;  3PUU A;  3B37 A;  4K5M A;  5DYF A;  4ZW6 A;  4GAE A;  4DPR A;  3CZL A;  5BPP A;  2JCX A;  3CHO A;  3B7T A;  3UER A;  2ZXG A;  3FH7 A;  4QUO A;  3CIA A;  5JNL A;  3B2X A;  2PL5 A;  3FUE A;  3QJX A;  4AIC A;  4RSY A;  4K5N A;  4ZX5 A;  3FUM A;  4RCV A;  4XN9 A;  4ZQT A;  2Y1F A;  3IIE A;  3ZI0 A;  2Y1E A;  3JT1 A;  5JBI A;  3FUF A;  2JD2 A;  1Q0L A;  2JD0 A;  1HS6 A;  4NQW A;  3EBH A;  2XPY A;  1ZS2 A;  1SC5 A;  2WPG A;  4FLR A;  3CZE A;  4JND A;  3ZHY A;  3FUK A;  4AR8 A;  1JVS A;  4R7L A;  1Q0H A;  4K5P A;  1ONP A;  4XMU A;  3VVM A;  5EV7 A;  4R5X A;  3FTW A;  3AU9 A;  4AR9 A;  3B34 A;  4XMW A;  4ZQG A;  4MKT A;  1ONN A;  4OOF A;  1JGI A;  3B2P A;  3A14 A;  1MW3 A;  4FLS A;  1H3L A;  3FTX A;  3UEQ A;  4PVB A;  3RC3 A;  1R0K A;  4XN4 A;  3CHP A;  4XNB A;  2A7O A;  4BKX A;  3FTS A;  3HW2 A;  4ZN6 A;  3RC8 A;  1MW2 A;  3CZK A;  2Y1D A;  4XO3 A;  5DUL A;  4MS6 A;  2JV7 A;  4XMX A;  2Y1C A;  4QPE A;  3CXB A;  5JO0 A;  4R5V A;  4Q4I A;  2R70 A;  1X3Z A;  1MVY A;  4Y6R A;  2JCY A;  1MW0 A;  3FU3 A;  2GTQ A;  3B7R L;  1X3W A;  1S46 A;  2MAO A;  3FUJ A;  2DQ6 A;  1T1R A;  2R72 A;  4XN7 A;  4AYS A;  3T0Y A;  4LUP A;  2C5Z A;  1Q0Q A;  4QHP A;  4X2U A;  1H19 A;  3CHQ A;  3JSZ A;  3ANN A;  1SQM A;  4GAA A;  4K5L A;  2QJ1 A;  3ZHZ A;  4L2L A;  5JAZ A;  5JMW A;  1JG9 A;  3CHS A;  3KED A;  4PU2 A;  3FU5 A;  2O7G A;  3FU0 A;  4CXF A;  2XQ0 A;  5HNH A;  4ZW5 A;  4QME A;  2R59 A;  4XN1 A;  4ZW3 A;  4XN2 A;  1G5A A;  1RP3 A;  1SG7 A;  3U9W A;  4ZQE A;  2C82 A;  2DQM A;  5JMP A;  4XO4 A;  3VVL A;  5FWQ A;  3R0I A;  3FUD A;  4Y6P A;  2QVW A;  3EBG A;  4XMV A; 
#chains in the Genus database with same CATH homology
 3FTU A;  3B7S A;  5JC1 A;  2EGH A;  3Q43 A;  2HPO A;  5DLL A;  2XPZ A;  3Q44 A;  4XMZ A;  3FUI A;  3FTV A;  3ANM A;  3FUH A;  4R5T A;  3UCQ A;  3B3B A;  4ARF A;  1OR7 A;  3RAS A;  3FU6 A;  3ANL A;  3CHR A;  4RVB A;  4AR1 A;  2HPT A;  2B61 A;  3AU8 A;  5HLT A;  5HNF A;  2FFL A;  3FH5 A;  1MW1 A;  2VJ8 A;  3EBI A;  4XN8 A;  4Y67 A;  3FTZ A;  3WQS B;  4A03 A;  4K5O A;  3CZG A;  3FUL A;  4ZQH A;  2JCV A;  4J3B A;  3WQQ A;  4FCA A;  4FLO A;  2WZF A;  4FLQ A;  2MAP A;  4PW4 A;  2PGG A;  3T8V A;  4ZW7 A;  1K5H A;  4OOE A;  1ONO A;  3FH8 A;  4XND A;  3WQR A;  3AUA A;  2RJI A;  4ZX6 A;  2PUS A;  4ZX4 A;  3A06 A;  4Q4E A;  3ZHX A;  3FTY A;  3FUN A;  4XO5 A;  1T1S A;  4ZW8 A;  5AEN A;  1GW6 A;  2WZG A;  4ZX3 A;  2VLA A;  1R0L A;  2JD1 A;  4ZQF A;  4XMT A;  4XN5 A;  4KP7 A;  2Y1G A;  3B7U X;  3FHE A;  4Y6S A;  4XNA A;  4QIR A;  3PUU A;  3B37 A;  4K5M A;  5DYF A;  4ZW6 A;  4GAE A;  4DPR A;  3CZL A;  5BPP A;  2JCX A;  3CHO A;  3B7T A;  3UER A;  2ZXG A;  3FH7 A;  4QUO A;  3CIA A;  5JNL A;  3B2X A;  2PL5 A;  3FUE A;  3QJX A;  4AIC A;  4RSY A;  4K5N A;  4ZX5 A;  3FUM A;  4RCV A;  4XN9 A;  4ZQT A;  2Y1F A;  3IIE A;  3ZI0 A;  2Y1E A;  3JT1 A;  5JBI A;  3FUF A;  2JD2 A;  1Q0L A;  2JD0 A;  1HS6 A;  4NQW A;  3EBH A;  2XPY A;  1ZS2 A;  1SC5 A;  2WPG A;  4FLR A;  3CZE A;  4JND A;  3ZHY A;  3FUK A;  4AR8 A;  1JVS A;  4R7L A;  1Q0H A;  4K5P A;  1ONP A;  4XMU A;  3VVM A;  5EV7 A;  4R5X A;  3FTW A;  3AU9 A;  4AR9 A;  3B34 A;  4XMW A;  4ZQG A;  4MKT A;  1ONN A;  4OOF A;  1JGI A;  3B2P A;  3A14 A;  1MW3 A;  4FLS A;  1H3L A;  3FTX A;  3UEQ A;  4PVB A;  3RC3 A;  1R0K A;  4XN4 A;  3CHP A;  4XNB A;  2A7O A;  4BKX A;  3FTS A;  4ZN6 A;  3RC8 A;  1MW2 A;  3CZK A;  2Y1D A;  4XO3 A;  5DUL A;  4MS6 A;  2JV7 A;  4XMX A;  2Y1C A;  4QPE A;  5JO0 A;  4R5V A;  4Q4I A;  2R70 A;  1X3Z A;  1MVY A;  4Y6R A;  2JCY A;  1MW0 A;  3FU3 A;  2GTQ A;  3B7R L;  1X3W A;  1S46 A;  2MAO A;  3FUJ A;  2DQ6 A;  1T1R A;  2R72 A;  4XN7 A;  4AYS A;  3T0Y A;  4LUP A;  2C5Z A;  1Q0Q A;  4QHP A;  4X2U A;  1H19 A;  3CHQ A;  3JSZ A;  3ANN A;  1SQM A;  4GAA A;  4K5L A;  2QJ1 A;  3ZHZ A;  4L2L A;  5JAZ A;  5JMW A;  1JG9 A;  3CHS A;  3KED A;  4PU2 A;  3FU5 A;  2O7G A;  3FU0 A;  4CXF A;  2XQ0 A;  5HNH A;  4ZW5 A;  4QME A;  2R59 A;  4XN1 A;  4ZW3 A;  4XN2 A;  1G5A A;  1RP3 A;  1SG7 A;  3U9W A;  4ZQE A;  2C82 A;  2DQM A;  5JMP A;  4XO4 A;  3VVL A;  5FWQ A;  3R0I A;  3FUD A;  4Y6P A;  2QVW A;  3EBG A;  4XMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...