2MAOA

Nmr structure of region 2 of e. coli sigmae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2maoA00
4ZQEA 3A14A 3WQQA 1T1SA 1JG9A 2Y1CA 1MVYA 3AU9A 2JD1A 1ZS2A 1S46A 2JCVA 4FLSA 3WQRA 4ZN6A 1K5HA 1ONOA 5JBIA 3AUAA 3T0YA 1Q0QA 3UEQA 5JO0A 2JCXA 2EGHA 5JNLA 1ONNA 4Y6SA 2JCYA 1R0KA 4Y6PA 4OOFA 4ZQFA 1SC5A 3ANLA 1MW1A 3IIEA 3AU8A 5JMWA 1H3LA 2WPGA 3CZGA 5JMPA 2O7GA 4Y67A 3ANNA 1R0LA 2JD0A 4AICA 3RASA 3ANMA 3ZI0A 4CXFA 4Y6RA 1MW0A 2C82A 1G5AA 4NQWA 4RCVA 2JD2A 3ZHXA 4FLQA 1JVSA 3CZLA 4FLRA 1ONPA 4ZQHA 4A03A 2Y1DA 2MAOA 3UCQA 3ZHYA 4GAEA 4OOEA 3CZEA 3ZHZA 3CZKA 1T1RA 2Y1FA 3UERA 1OR7A 5JC1A 2Y1EA 5DULA 1Q0HA 4FLOA 4LUPA 2Y1GA 5JAZA 4AYSA 2MAPA 3R0IA 1MW3A 4KP7A 4ZQGA 1Q0LA 1MW2A 1JGIA 1RP3A 3A06A 3WQSB
chains in the Genus database with same CATH superfamily
2XPYA 4ZQEA 3A14A 3WQQA 4RVBA 1X3ZA 1T1SA 3RC3A 3FHEA 4QHPA 2JV7A 3FUJA 1JG9A 2Y1CA 2ZXGA 3FU3A 4ZW5A 1MVYA 4ZQTA 3AU9A 3JT1A 4R5XA 4ZX5A 4X2UA 2JD1A 1GW6A 2DQMA 4K5LA 4XN5A 1ZS2A 5FWQA 1S46A 2JCVA 4FLSA 4ARFA 2VLAA 3WQRA 4ZN6A 1K5HA 3CHQA 5DYFA 3RC8A 1ONOA 5JBIA 3AUAA 3FU6A 3T0YA 1Q0QA 3UEQA 5JO0A 3FH8A 2JCXA 4R5TA 2EGHA 3T8VA 5JNLA 1ONNA 3FTUA 3FUFA 4RSYA 4QIRA 2R72A 4Y6SA 2QJ1A 4MS6A 4PVBA 2JCYA 4ZX4A 1R0KA 4Y6PA 4XMVA 4XN1A 4AR9A 2PL5A 5HNHA 3FUMA 4JNDA 3PUUA 4XN2A 4K5PA 4FCAA 4XN4A 4XN9A 3KEDA 4OOFA 4ZX6A 4DPRA 3B7RL 4ZQFA 1SC5A 3ANLA 1MW1A 2VJ8A 3IIEA 4XMTA 2XPZA 2HPOA 3AU8A 1H3LA 3FH7A 4XO3A 2WZGA 2WPGA 3CZGA 3FTWA 2GTQA 3CHOA 3FTSA 5JMWA 2XQ0A 5JMPA 2HPTA 4XNAA 2R59A 3B7SA 3B2XA 3B37A 3CHPA 4K5OA 2O7GA 4Q4IA 3ANNA 4Y67A 3CHRA 1R0LA 2A7OA 5AENA 2JD0A 4AICA 3FTXA 3CXBA 3RASA 3ANMA 4PU2A 4XN7A 4ZW8A 4MKTA 3ZI0A 4CXFA 4Y6RA 3FUDA 3JSZA 3U9WA 1MW0A 3VVLA 3B3BA 3FTVA 2C82A 4ZW6A 1HS6A 1G5AA 3B34A 3FUEA 4NQWA 4RCVA 2JD2A 3ZHXA 4FLQA 5EV7A 1JVSA 3B2PA 3CZLA 2PUSA 2C5ZA 4L2LA 4XMWA 4XO4A 4FLRA 3FULA 1ONPA 3FU0A 4XMZA 2B61A 4ZQHA 4K5MA 4R7LA 4PW4A 5HLTA 4J3BA 4A03A 4ZW3A 3CIAA 2Y1DA 1SQMA 2MAOA 5DLLA 4XMUA 3UCQA 3ZHYA 2QVWA 3HW2A 4GAEA 4QPEA 3EBGA 1X3WA 4QMEA 4XO5A 4AR8A 3FUKA 4OOEA 3CZEA 3FTZA 3B7UX 4XN8A 3ZHZA 3FUHA 3CZKA 2FFLA 4AR1A 3Q44A 4R5VA 5HNFA 4ZX3A 1T1RA 4XNDA 2Y1FA 3UERA 1OR7A 3FUIA 3QJXA 3CHSA 3EBHA 4Q4EA 5JC1A 2Y1EA 3EBIA 2RJIA 4ZW7A 5DULA 1Q0HA 4FLOA 4GAAA 4LUPA 1SG7A 2R70A 3Q43A 3FTYA 3FH5A 2Y1GA 5JAZA 2DQ6A 4K5NA 4AYSA 1H19A 3B7TA 4QUOA 3FU5A 3R0IA 1MW3A 3FUNA 4KP7A 4ZQGA 2MAPA 4XMXA 1Q0LA 5BPPA 1MW2A 2WZFA 1JGIA 1RP3A 4XNBA 3A06A 4BKXA 2PGGA 3VVMA 3WQSB
chains in the Genus database with same CATH topology
2XPYA 4ZQEA 3A14A 3WQQA 4RVBA 1X3ZA 1T1SA 3RC3A 3FHEA 4QHPA 2JV7A 3FUJA 1JG9A 2Y1CA 2ZXGA 3FU3A 4ZW5A 1MVYA 4ZQTA 3AU9A 3JT1A 4R5XA 4ZX5A 4X2UA 2JD1A 1GW6A 2DQMA 4K5LA 4XN5A 1ZS2A 5FWQA 1S46A 2JCVA 4FLSA 4ARFA 2VLAA 3WQRA 4ZN6A 1K5HA 3CHQA 5DYFA 3RC8A 1ONOA 5JBIA 3AUAA 3FU6A 3T0YA 1Q0QA 3UEQA 5JO0A 3FH8A 2JCXA 4R5TA 2EGHA 3T8VA 5JNLA 1ONNA 3FTUA 3FUFA 4RSYA 4QIRA 2R72A 4Y6SA 2QJ1A 4MS6A 4PVBA 2JCYA 4ZX4A 1R0KA 4Y6PA 4XMVA 4XN1A 4AR9A 2PL5A 5HNHA 3FUMA 4JNDA 3PUUA 4XN2A 4K5PA 4FCAA 4XN4A 4XN9A 3KEDA 4OOFA 4ZX6A 4DPRA 3B7RL 4ZQFA 1SC5A 3ANLA 1MW1A 2VJ8A 3IIEA 4XMTA 2XPZA 2HPOA 3AU8A 1H3LA 3FH7A 4XO3A 2WZGA 2WPGA 3CZGA 3FTWA 2GTQA 3CHOA 3FTSA 5JMWA 2XQ0A 5JMPA 2HPTA 4XNAA 2R59A 3B7SA 3B2XA 3B37A 3CHPA 4K5OA 2O7GA 4Q4IA 3ANNA 4Y67A 3CHRA 1R0LA 2A7OA 5AENA 2JD0A 4AICA 3FTXA 3RASA 3ANMA 4PU2A 4XN7A 4ZW8A 4MKTA 3ZI0A 4CXFA 4Y6RA 3FUDA 3JSZA 3U9WA 1MW0A 3VVLA 3B3BA 3FTVA 2C82A 4ZW6A 1HS6A 1G5AA 3B34A 3FUEA 4NQWA 4RCVA 2JD2A 3ZHXA 4FLQA 5EV7A 1JVSA 3B2PA 3CZLA 2PUSA 2C5ZA 4L2LA 4XMWA 4XO4A 4FLRA 3FULA 1ONPA 3FU0A 4XMZA 2B61A 4ZQHA 4K5MA 4R7LA 4PW4A 5HLTA 4J3BA 4A03A 4ZW3A 3CIAA 2Y1DA 1SQMA 2MAOA 5DLLA 4XMUA 3UCQA 3ZHYA 2QVWA 4GAEA 4QPEA 3EBGA 1X3WA 4QMEA 4XO5A 4AR8A 3FUKA 4OOEA 3CZEA 3FTZA 3B7UX 4XN8A 3ZHZA 3FUHA 3CZKA 2FFLA 4AR1A 3Q44A 4R5VA 5HNFA 4ZX3A 1T1RA 4XNDA 2Y1FA 3UERA 1OR7A 3FUIA 3QJXA 3CHSA 3EBHA 4Q4EA 5JC1A 2Y1EA 3EBIA 2RJIA 4ZW7A 5DULA 1Q0HA 4FLOA 4GAAA 4LUPA 1SG7A 2R70A 3Q43A 3FTYA 3FH5A 2Y1GA 5JAZA 2DQ6A 4K5NA 4AYSA 1H19A 3B7TA 4QUOA 3FU5A 3R0IA 1MW3A 3FUNA 4KP7A 4ZQGA 2MAPA 4XMXA 1Q0LA 5BPPA 1MW2A 2WZFA 1JGIA 1RP3A 4XNBA 3A06A 4BKXA 2PGGA 3VVMA 3WQSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQE A;  3A14 A;  3WQQ A;  1T1S A;  1JG9 A;  2Y1C A;  1MVY A;  3AU9 A;  2JD1 A;  1ZS2 A;  1S46 A;  2JCV A;  4FLS A;  3WQR A;  4ZN6 A;  1K5H A;  1ONO A;  5JBI A;  3AUA A;  3T0Y A;  1Q0Q A;  3UEQ A;  5JO0 A;  2JCX A;  2EGH A;  5JNL A;  1ONN A;  4Y6S A;  2JCY A;  1R0K A;  4Y6P A;  4OOF A;  4ZQF A;  1SC5 A;  3ANL A;  1MW1 A;  3IIE A;  3AU8 A;  5JMW A;  1H3L A;  2WPG A;  3CZG A;  5JMP A;  2O7G A;  4Y67 A;  3ANN A;  1R0L A;  2JD0 A;  4AIC A;  3RAS A;  3ANM A;  3ZI0 A;  4CXF A;  4Y6R A;  1MW0 A;  2C82 A;  1G5A A;  4NQW A;  4RCV A;  2JD2 A;  3ZHX A;  4FLQ A;  1JVS A;  3CZL A;  4FLR A;  1ONP A;  4ZQH A;  4A03 A;  2Y1D A;  2MAO A;  3UCQ A;  3ZHY A;  4GAE A;  4OOE A;  3CZE A;  3ZHZ A;  3CZK A;  1T1R A;  2Y1F A;  3UER A;  1OR7 A;  5JC1 A;  2Y1E A;  5DUL A;  1Q0H A;  4FLO A;  4LUP A;  2Y1G A;  5JAZ A;  4AYS A;  2MAP A;  3R0I A;  1MW3 A;  4KP7 A;  4ZQG A;  1Q0L A;  1MW2 A;  1JGI A;  1RP3 A;  3A06 A;  3WQS B; 
#chains in the Genus database with same CATH topology
 2XPY A;  4ZQE A;  3A14 A;  3WQQ A;  4RVB A;  1X3Z A;  1T1S A;  3RC3 A;  3FHE A;  4QHP A;  2JV7 A;  3FUJ A;  1JG9 A;  2Y1C A;  2ZXG A;  3FU3 A;  4ZW5 A;  1MVY A;  4ZQT A;  3AU9 A;  3JT1 A;  4R5X A;  4ZX5 A;  4X2U A;  2JD1 A;  1GW6 A;  2DQM A;  4K5L A;  4XN5 A;  1ZS2 A;  5FWQ A;  1S46 A;  2JCV A;  4FLS A;  4ARF A;  2VLA A;  3WQR A;  4ZN6 A;  1K5H A;  3CHQ A;  5DYF A;  3RC8 A;  1ONO A;  5JBI A;  3AUA A;  3FU6 A;  3T0Y A;  1Q0Q A;  3UEQ A;  5JO0 A;  3FH8 A;  2JCX A;  4R5T A;  2EGH A;  3T8V A;  5JNL A;  1ONN A;  3FTU A;  3FUF A;  4RSY A;  4QIR A;  2R72 A;  4Y6S A;  2QJ1 A;  4MS6 A;  4PVB A;  2JCY A;  4ZX4 A;  1R0K A;  4Y6P A;  4XMV A;  4XN1 A;  4AR9 A;  2PL5 A;  5HNH A;  3FUM A;  4JND A;  3PUU A;  4XN2 A;  4K5P A;  4FCA A;  4XN4 A;  4XN9 A;  3KED A;  4OOF A;  4ZX6 A;  4DPR A;  3B7R L;  4ZQF A;  1SC5 A;  3ANL A;  1MW1 A;  2VJ8 A;  3IIE A;  4XMT A;  2XPZ A;  2HPO A;  3AU8 A;  1H3L A;  3FH7 A;  4XO3 A;  2WZG A;  2WPG A;  3CZG A;  3FTW A;  2GTQ A;  3CHO A;  3FTS A;  5JMW A;  2XQ0 A;  5JMP A;  2HPT A;  4XNA A;  2R59 A;  3B7S A;  3B2X A;  3B37 A;  3CHP A;  4K5O A;  2O7G A;  4Q4I A;  3ANN A;  4Y67 A;  3CHR A;  1R0L A;  2A7O A;  5AEN A;  2JD0 A;  4AIC A;  3FTX A;  3CXB A;  3RAS A;  3ANM A;  4PU2 A;  4XN7 A;  4ZW8 A;  4MKT A;  3ZI0 A;  4CXF A;  4Y6R A;  3FUD A;  3JSZ A;  3U9W A;  1MW0 A;  3VVL A;  3B3B A;  3FTV A;  2C82 A;  4ZW6 A;  1HS6 A;  1G5A A;  3B34 A;  3FUE A;  4NQW A;  4RCV A;  2JD2 A;  3ZHX A;  4FLQ A;  5EV7 A;  1JVS A;  3B2P A;  3CZL A;  2PUS A;  2C5Z A;  4L2L A;  4XMW A;  4XO4 A;  4FLR A;  3FUL A;  1ONP A;  3FU0 A;  4XMZ A;  2B61 A;  4ZQH A;  4K5M A;  4R7L A;  4PW4 A;  5HLT A;  4J3B A;  4A03 A;  4ZW3 A;  3CIA A;  2Y1D A;  1SQM A;  2MAO A;  5DLL A;  4XMU A;  3UCQ A;  3ZHY A;  2QVW A;  3HW2 A;  4GAE A;  4QPE A;  3EBG A;  1X3W A;  4QME A;  4XO5 A;  4AR8 A;  3FUK A;  4OOE A;  3CZE A;  3FTZ A;  3B7U X;  4XN8 A;  3ZHZ A;  3FUH A;  3CZK A;  2FFL A;  4AR1 A;  3Q44 A;  4R5V A;  5HNF A;  4ZX3 A;  1T1R A;  4XND A;  2Y1F A;  3UER A;  1OR7 A;  3FUI A;  3QJX A;  3CHS A;  3EBH A;  4Q4E A;  5JC1 A;  2Y1E A;  3EBI A;  2RJI A;  4ZW7 A;  5DUL A;  1Q0H A;  4FLO A;  4GAA A;  4LUP A;  1SG7 A;  2R70 A;  3Q43 A;  3FTY A;  3FH5 A;  2Y1G A;  5JAZ A;  2DQ6 A;  4K5N A;  4AYS A;  1H19 A;  3B7T A;  4QUO A;  3FU5 A;  3R0I A;  1MW3 A;  3FUN A;  4KP7 A;  4ZQG A;  2MAP A;  4XMX A;  1Q0L A;  5BPP A;  1MW2 A;  2WZF A;  1JGI A;  1RP3 A;  4XNB A;  3A06 A;  4BKX A;  2PGG A;  3VVM A;  3WQS B; 
#chains in the Genus database with same CATH homology
 2XPY A;  4ZQE A;  3A14 A;  3WQQ A;  4RVB A;  1X3Z A;  1T1S A;  3RC3 A;  3FHE A;  4QHP A;  2JV7 A;  3FUJ A;  1JG9 A;  2Y1C A;  2ZXG A;  3FU3 A;  4ZW5 A;  1MVY A;  4ZQT A;  3AU9 A;  3JT1 A;  4R5X A;  4ZX5 A;  4X2U A;  2JD1 A;  1GW6 A;  2DQM A;  4K5L A;  4XN5 A;  1ZS2 A;  5FWQ A;  1S46 A;  2JCV A;  4FLS A;  4ARF A;  2VLA A;  3WQR A;  4ZN6 A;  1K5H A;  3CHQ A;  5DYF A;  3RC8 A;  1ONO A;  5JBI A;  3AUA A;  3FU6 A;  3T0Y A;  1Q0Q A;  3UEQ A;  5JO0 A;  3FH8 A;  2JCX A;  4R5T A;  2EGH A;  3T8V A;  5JNL A;  1ONN A;  3FTU A;  3FUF A;  4RSY A;  4QIR A;  2R72 A;  4Y6S A;  2QJ1 A;  4MS6 A;  4PVB A;  2JCY A;  4ZX4 A;  1R0K A;  4Y6P A;  4XMV A;  4XN1 A;  4AR9 A;  2PL5 A;  5HNH A;  3FUM A;  4JND A;  3PUU A;  4XN2 A;  4K5P A;  4FCA A;  4XN4 A;  4XN9 A;  3KED A;  4OOF A;  4ZX6 A;  4DPR A;  3B7R L;  4ZQF A;  1SC5 A;  3ANL A;  1MW1 A;  2VJ8 A;  3IIE A;  4XMT A;  2XPZ A;  2HPO A;  3AU8 A;  1H3L A;  3FH7 A;  4XO3 A;  2WZG A;  2WPG A;  3CZG A;  3FTW A;  2GTQ A;  3CHO A;  3FTS A;  5JMW A;  2XQ0 A;  5JMP A;  2HPT A;  4XNA A;  2R59 A;  3B7S A;  3B2X A;  3B37 A;  3CHP A;  4K5O A;  2O7G A;  4Q4I A;  3ANN A;  4Y67 A;  3CHR A;  1R0L A;  2A7O A;  5AEN A;  2JD0 A;  4AIC A;  3FTX A;  3RAS A;  3ANM A;  4PU2 A;  4XN7 A;  4ZW8 A;  4MKT A;  3ZI0 A;  4CXF A;  4Y6R A;  3FUD A;  3JSZ A;  3U9W A;  1MW0 A;  3VVL A;  3B3B A;  3FTV A;  2C82 A;  4ZW6 A;  1HS6 A;  1G5A A;  3B34 A;  3FUE A;  4NQW A;  4RCV A;  2JD2 A;  3ZHX A;  4FLQ A;  5EV7 A;  1JVS A;  3B2P A;  3CZL A;  2PUS A;  2C5Z A;  4L2L A;  4XMW A;  4XO4 A;  4FLR A;  3FUL A;  1ONP A;  3FU0 A;  4XMZ A;  2B61 A;  4ZQH A;  4K5M A;  4R7L A;  4PW4 A;  5HLT A;  4J3B A;  4A03 A;  4ZW3 A;  3CIA A;  2Y1D A;  1SQM A;  2MAO A;  5DLL A;  4XMU A;  3UCQ A;  3ZHY A;  2QVW A;  4GAE A;  4QPE A;  3EBG A;  1X3W A;  4QME A;  4XO5 A;  4AR8 A;  3FUK A;  4OOE A;  3CZE A;  3FTZ A;  3B7U X;  4XN8 A;  3ZHZ A;  3FUH A;  3CZK A;  2FFL A;  4AR1 A;  3Q44 A;  4R5V A;  5HNF A;  4ZX3 A;  1T1R A;  4XND A;  2Y1F A;  3UER A;  1OR7 A;  3FUI A;  3QJX A;  3CHS A;  3EBH A;  4Q4E A;  5JC1 A;  2Y1E A;  3EBI A;  2RJI A;  4ZW7 A;  5DUL A;  1Q0H A;  4FLO A;  4GAA A;  4LUP A;  1SG7 A;  2R70 A;  3Q43 A;  3FTY A;  3FH5 A;  2Y1G A;  5JAZ A;  2DQ6 A;  4K5N A;  4AYS A;  1H19 A;  3B7T A;  4QUO A;  3FU5 A;  3R0I A;  1MW3 A;  3FUN A;  4KP7 A;  4ZQG A;  2MAP A;  4XMX A;  1Q0L A;  5BPP A;  1MW2 A;  2WZF A;  1JGI A;  1RP3 A;  4XNB A;  3A06 A;  4BKX A;  2PGG A;  3VVM A;  3WQS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...