2MAOA

Nmr structure of region 2 of e. coli sigmae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords RNA polymerase sigma factor
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2maoA00
5JNLA 1T1RA 4AICA 4KP7A 2EGHA 3ANMA 4RCVA 4NQWA 5JO0A 4Y67A 5JC1A 3CZLA 1T1SA 3UERA 4OOEA 3T0YA 3AU9A 4LUPA 3ZI0A 3ZHXA 4ZQGA 2MAPA 1Q0QA 3ANNA 1MW3A 4OOFA 3A14A 4ZN6A 3AUAA 2Y1EA 3AU8A 4CXFA 1OR7A 2JD1A 3R0IA 4Y6PA 5JBIA 1R0KA 1ZS2A 4FLOA 1MW0A 4A03A 4FLSA 1Q0HA 4Y6SA 4ZQFA 2Y1GA 2Y1DA 4GAEA 3WQSB 3WQQA 1Q0LA 5JAZA 5JMWA 3UEQA 4Y6RA 4ZQEA 3ZHZA 2JD2A 1H3LA 1MW1A 3ZHYA 1RP3A 2JCYA 1ONPA 1R0LA 3RASA 3ANLA 2JD0A 4FLQA 3WQRA 2MAOA 4FLRA 2Y1FA 4ZQHA 5JMPA 3CZKA 3UCQA 5DULA 2WPGA 3IIEA 1ONOA 1SC5A 1JVSA 3CZEA 1ONNA 1JG9A 2C82A 1JGIA 3CZGA 1MW2A 1S46A 2Y1CA 2O7GA 1MVYA 3A06A 1K5HA 2JCVA 1G5AA 2JCXA 4AYSA
chains in the Genus database with same CATH superfamily
2B61A 1T1RA 3HW2A 3Q44A 3FTUA 4KP7A 4AICA 3U9WA 2EGHA 3ANMA 4JNDA 4RCVA 3CIAA 1X3ZA 4NQWA 2R72A 4XMZA 4PVBA 3FTWA 5JO0A 2C5ZA 4Y67A 3B7TA 4MKTA 2HPTA 5JC1A 4XMXA 3CZLA 4Q4IA 4QPEA 1T1SA 4K5NA 5JNLA 4XN8A 2DQ6A 3UERA 4OOEA 4XMWA 3T0YA 5HNHA 3FUDA 4R5TA 5DYFA 4Q4EA 4DPRA 5AENA 3AU9A 3CHRA 4LUPA 2XQ0A 4L2LA 3RC8A 4XN2A 1SG7A 4QMEA 3ZI0A 3ZHXA 4ZQGA 3FUNA 1H19A 2JV7A 1Q0QA 3ANNA 2MAPA 1MW3A 4OOFA 4K5PA 3KEDA 3A14A 4XO3A 4AR1A 3AUAA 2R70A 2PL5A 2Y1EA 3FH8A 3FUIA 4K5OA 3FUFA 3FUMA 3AU8A 4RVBA 4XMVA 4ZW6A 3VVLA 4CXFA 3FU0A 1OR7A 2JD1A 3R0IA 3Q43A 2WZGA 1X3WA 4Y6PA 4ZW3A 1R0KA 1ZS2A 3FULA 3PUUA 4FLOA 5BPPA 5JBIA 1MW0A 4BKXA 2PGGA 4PW4A 1GW6A 3EBIA 4A03A 4FLSA 3FU5A 1Q0HA 4Y6SA 3CHQA 2R59A 4ZQFA 2Y1GA 2Y1DA 1SQMA 4GAEA 4XN9A 3WQSB 3WQQA 5HNFA 1Q0LA 5JAZA 5JMWA 2VJ8A 2WZFA 3UEQA 4XO5A 4ZX5A 4Y6RA 4QHPA 3FU3A 3B3BA 3CHOA 4ZQEA 3ZHZA 5HLTA 4XN1A 2JD2A 4XMUA 1H3LA 1MW1A 3ZHYA 3JT1A 4PU2A 3B2XA 3B37A 4ZW7A 3FUKA 1RP3A 2JCYA 3FU6A 4FCAA 2VLAA 3FTXA 1ONPA 3B2PA 4J3BA 4R5VA 4XN5A 2QVWA 1R0LA 4XMTA 2RJIA 4K5LA 3RASA 3EBHA 3ANLA 5EV7A 2JD0A 4FLQA 3WQRA 5DLLA 4X2UA 2DQMA 3FUJA 2FFLA 2MAOA 3FTSA 4ZW5A 3B7SA 4XNDA 3FTYA 3FTZA 4FLRA 2ZXGA 4XO4A 2Y1FA 4ZX3A 4ZQHA 5JMPA 4AR9A 3CZKA 3UCQA 4K5MA 2QJ1A 3JSZA 5DULA 2WPGA 3FH7A 4ZX6A 4QUOA 1HS6A 2GTQA 3FH5A 3FUEA 4MS6A 3IIEA 1ONOA 1SC5A 3FTVA 4ARFA 3RC3A 4QIRA 1JVSA 2HPOA 3T8VA 4ZX4A 3CZEA 3FHEA 5FWQA 3B34A 1ONNA 4RSYA 4ZN6A 1JG9A 4ZQTA 4AR8A 2C82A 2XPZA 4XNAA 1JGIA 3B7RL 3CXBA 2A7OA 2PUSA 3CZGA 3EBGA 3VVMA 4XN4A 1MW2A 1S46A 4R5XA 3CHSA 2Y1CA 4XNBA 4GAAA 4XN7A 2O7GA 2XPYA 1MVYA 3A06A 3FUHA 1K5HA 2JCVA 4R7LA 1G5AA 2JCXA 3B7UX 4AYSA 3CHPA 4ZW8A 3QJXA
chains in the Genus database with same CATH topology
2B61A 1T1RA 3Q44A 4AICA 3FTUA 4KP7A 5JNLA 3U9WA 2EGHA 3ANMA 4JNDA 4RCVA 3CIAA 1X3ZA 4NQWA 2R72A 4XMZA 4PVBA 3FTWA 5JO0A 2C5ZA 4Y67A 3B7TA 4MKTA 2HPTA 5JC1A 4XMXA 3CZLA 4Q4IA 4QPEA 1T1SA 4K5NA 4XN8A 2DQ6A 3UERA 4OOEA 4XMWA 3T0YA 5HNHA 3FUDA 4R5TA 5DYFA 4Q4EA 4DPRA 5AENA 3AU9A 3CHRA 4LUPA 2XQ0A 4L2LA 3RC8A 4XN2A 1SG7A 4QMEA 3ZI0A 3ZHXA 4ZQGA 3FUNA 1H19A 2JV7A 1Q0QA 3ANNA 2MAPA 1MW3A 4OOFA 4K5PA 3KEDA 3A14A 4XO3A 4AR1A 3AUAA 2R70A 2PL5A 2Y1EA 3FH8A 3FUIA 4K5OA 3FUFA 3FUMA 3AU8A 4RVBA 4XMVA 4ZW6A 3VVLA 4CXFA 3FU0A 1OR7A 2JD1A 3R0IA 3Q43A 2WZGA 1X3WA 4Y6PA 4ZW3A 1R0KA 1ZS2A 3FULA 3PUUA 4FLOA 5BPPA 5JBIA 1MW0A 4BKXA 2PGGA 4PW4A 1GW6A 3EBIA 4A03A 4FLSA 3FU5A 1Q0HA 4Y6SA 3CHQA 2R59A 4ZQFA 2Y1GA 2Y1DA 1SQMA 4GAEA 4XN9A 3WQSB 3WQQA 5HNFA 1Q0LA 5JAZA 5JMWA 2VJ8A 2WZFA 3UEQA 4XO5A 4ZX5A 4Y6RA 4QHPA 3FU3A 3B3BA 3CHOA 4ZQEA 3ZHZA 5HLTA 4XN1A 2JD2A 4XMUA 1H3LA 1MW1A 3ZHYA 3JT1A 4PU2A 3B2XA 3B37A 4ZW7A 3FUKA 1RP3A 2JCYA 3FU6A 4FCAA 2VLAA 3FTXA 1ONPA 3B2PA 4J3BA 4R5VA 4XN5A 2QVWA 1R0LA 4XMTA 2RJIA 4K5LA 3RASA 3EBHA 3ANLA 5EV7A 2JD0A 4FLQA 3WQRA 5DLLA 4X2UA 2DQMA 3FUJA 2FFLA 2MAOA 3FTSA 4ZW5A 3B7SA 4XNDA 3FTYA 3FTZA 4FLRA 2ZXGA 4XO4A 2Y1FA 4ZX3A 4ZQHA 5JMPA 4AR9A 3CZKA 3UCQA 4K5MA 2QJ1A 3JSZA 5DULA 2WPGA 3FH7A 4ZX6A 4QUOA 1HS6A 2GTQA 3FH5A 3FUEA 4MS6A 3IIEA 1ONOA 1SC5A 3FTVA 4ARFA 3RC3A 4QIRA 1JVSA 2HPOA 3T8VA 4ZX4A 3CZEA 3FHEA 5FWQA 3B34A 1ONNA 4RSYA 4ZN6A 1JG9A 4ZQTA 4AR8A 2C82A 2XPZA 4XNAA 1JGIA 3B7RL 3EBGA 2A7OA 2PUSA 3CZGA 3VVMA 4XN4A 1MW2A 1S46A 4R5XA 3CHSA 2Y1CA 4XNBA 4GAAA 4XN7A 2O7GA 2XPYA 1MVYA 3A06A 3FUHA 1K5HA 2JCVA 4R7LA 1G5AA 2JCXA 3B7UX 4AYSA 3CHPA 4ZW8A 3QJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JNL A;  1T1R A;  4AIC A;  4KP7 A;  2EGH A;  3ANM A;  4RCV A;  4NQW A;  5JO0 A;  4Y67 A;  5JC1 A;  3CZL A;  1T1S A;  3UER A;  4OOE A;  3T0Y A;  3AU9 A;  4LUP A;  3ZI0 A;  3ZHX A;  4ZQG A;  2MAP A;  1Q0Q A;  3ANN A;  1MW3 A;  4OOF A;  3A14 A;  4ZN6 A;  3AUA A;  2Y1E A;  3AU8 A;  4CXF A;  1OR7 A;  2JD1 A;  3R0I A;  4Y6P A;  5JBI A;  1R0K A;  1ZS2 A;  4FLO A;  1MW0 A;  4A03 A;  4FLS A;  1Q0H A;  4Y6S A;  4ZQF A;  2Y1G A;  2Y1D A;  4GAE A;  3WQS B;  3WQQ A;  1Q0L A;  5JAZ A;  5JMW A;  3UEQ A;  4Y6R A;  4ZQE A;  3ZHZ A;  2JD2 A;  1H3L A;  1MW1 A;  3ZHY A;  1RP3 A;  2JCY A;  1ONP A;  1R0L A;  3RAS A;  3ANL A;  2JD0 A;  4FLQ A;  3WQR A;  2MAO A;  4FLR A;  2Y1F A;  4ZQH A;  5JMP A;  3CZK A;  3UCQ A;  5DUL A;  2WPG A;  3IIE A;  1ONO A;  1SC5 A;  1JVS A;  3CZE A;  1ONN A;  1JG9 A;  2C82 A;  1JGI A;  3CZG A;  1MW2 A;  1S46 A;  2Y1C A;  2O7G A;  1MVY A;  3A06 A;  1K5H A;  2JCV A;  1G5A A;  2JCX A;  4AYS A; 
#chains in the Genus database with same CATH topology
 2B61 A;  1T1R A;  3HW2 A;  3Q44 A;  3FTU A;  4KP7 A;  4AIC A;  3U9W A;  2EGH A;  3ANM A;  4JND A;  4RCV A;  3CIA A;  1X3Z A;  4NQW A;  2R72 A;  4XMZ A;  4PVB A;  3FTW A;  5JO0 A;  2C5Z A;  4Y67 A;  3B7T A;  4MKT A;  2HPT A;  5JC1 A;  4XMX A;  3CZL A;  4Q4I A;  4QPE A;  1T1S A;  4K5N A;  5JNL A;  4XN8 A;  2DQ6 A;  3UER A;  4OOE A;  4XMW A;  3T0Y A;  5HNH A;  3FUD A;  4R5T A;  5DYF A;  4Q4E A;  4DPR A;  5AEN A;  3AU9 A;  3CHR A;  4LUP A;  2XQ0 A;  4L2L A;  3RC8 A;  4XN2 A;  1SG7 A;  4QME A;  3ZI0 A;  3ZHX A;  4ZQG A;  3FUN A;  1H19 A;  2JV7 A;  1Q0Q A;  3ANN A;  2MAP A;  1MW3 A;  4OOF A;  4K5P A;  3KED A;  3A14 A;  4XO3 A;  4AR1 A;  3AUA A;  2R70 A;  2PL5 A;  2Y1E A;  3FH8 A;  3FUI A;  4K5O A;  3FUF A;  3FUM A;  3AU8 A;  4RVB A;  4XMV A;  4ZW6 A;  3VVL A;  4CXF A;  3FU0 A;  1OR7 A;  2JD1 A;  3R0I A;  3Q43 A;  2WZG A;  1X3W A;  4Y6P A;  4ZW3 A;  1R0K A;  1ZS2 A;  3FUL A;  3PUU A;  4FLO A;  5BPP A;  5JBI A;  1MW0 A;  4BKX A;  2PGG A;  4PW4 A;  1GW6 A;  3EBI A;  4A03 A;  4FLS A;  3FU5 A;  1Q0H A;  4Y6S A;  3CHQ A;  2R59 A;  4ZQF A;  2Y1G A;  2Y1D A;  1SQM A;  4GAE A;  4XN9 A;  3WQS B;  3WQQ A;  5HNF A;  1Q0L A;  5JAZ A;  5JMW A;  2VJ8 A;  2WZF A;  3UEQ A;  4XO5 A;  4ZX5 A;  4Y6R A;  4QHP A;  3FU3 A;  3B3B A;  3CHO A;  4ZQE A;  3ZHZ A;  5HLT A;  4XN1 A;  2JD2 A;  4XMU A;  1H3L A;  1MW1 A;  3ZHY A;  3JT1 A;  4PU2 A;  3B2X A;  3B37 A;  4ZW7 A;  3FUK A;  1RP3 A;  2JCY A;  3FU6 A;  4FCA A;  2VLA A;  3FTX A;  1ONP A;  3B2P A;  4J3B A;  4R5V A;  4XN5 A;  2QVW A;  1R0L A;  4XMT A;  2RJI A;  4K5L A;  3RAS A;  3EBH A;  3ANL A;  5EV7 A;  2JD0 A;  4FLQ A;  3WQR A;  5DLL A;  4X2U A;  2DQM A;  3FUJ A;  2FFL A;  2MAO A;  3FTS A;  4ZW5 A;  3B7S A;  4XND A;  3FTY A;  3FTZ A;  4FLR A;  2ZXG A;  4XO4 A;  2Y1F A;  4ZX3 A;  4ZQH A;  5JMP A;  4AR9 A;  3CZK A;  3UCQ A;  4K5M A;  2QJ1 A;  3JSZ A;  5DUL A;  2WPG A;  3FH7 A;  4ZX6 A;  4QUO A;  1HS6 A;  2GTQ A;  3FH5 A;  3FUE A;  4MS6 A;  3IIE A;  1ONO A;  1SC5 A;  3FTV A;  4ARF A;  3RC3 A;  4QIR A;  1JVS A;  2HPO A;  3T8V A;  4ZX4 A;  3CZE A;  3FHE A;  5FWQ A;  3B34 A;  1ONN A;  4RSY A;  4ZN6 A;  1JG9 A;  4ZQT A;  4AR8 A;  2C82 A;  2XPZ A;  4XNA A;  1JGI A;  3B7R L;  3CXB A;  2A7O A;  2PUS A;  3CZG A;  3EBG A;  3VVM A;  4XN4 A;  1MW2 A;  1S46 A;  4R5X A;  3CHS A;  2Y1C A;  4XNB A;  4GAA A;  4XN7 A;  2O7G A;  2XPY A;  1MVY A;  3A06 A;  3FUH A;  1K5H A;  2JCV A;  4R7L A;  1G5A A;  2JCX A;  3B7U X;  4AYS A;  3CHP A;  4ZW8 A;  3QJX A; 
#chains in the Genus database with same CATH homology
 2B61 A;  1T1R A;  3Q44 A;  4AIC A;  3FTU A;  4KP7 A;  5JNL A;  3U9W A;  2EGH A;  3ANM A;  4JND A;  4RCV A;  3CIA A;  1X3Z A;  4NQW A;  2R72 A;  4XMZ A;  4PVB A;  3FTW A;  5JO0 A;  2C5Z A;  4Y67 A;  3B7T A;  4MKT A;  2HPT A;  5JC1 A;  4XMX A;  3CZL A;  4Q4I A;  4QPE A;  1T1S A;  4K5N A;  4XN8 A;  2DQ6 A;  3UER A;  4OOE A;  4XMW A;  3T0Y A;  5HNH A;  3FUD A;  4R5T A;  5DYF A;  4Q4E A;  4DPR A;  5AEN A;  3AU9 A;  3CHR A;  4LUP A;  2XQ0 A;  4L2L A;  3RC8 A;  4XN2 A;  1SG7 A;  4QME A;  3ZI0 A;  3ZHX A;  4ZQG A;  3FUN A;  1H19 A;  2JV7 A;  1Q0Q A;  3ANN A;  2MAP A;  1MW3 A;  4OOF A;  4K5P A;  3KED A;  3A14 A;  4XO3 A;  4AR1 A;  3AUA A;  2R70 A;  2PL5 A;  2Y1E A;  3FH8 A;  3FUI A;  4K5O A;  3FUF A;  3FUM A;  3AU8 A;  4RVB A;  4XMV A;  4ZW6 A;  3VVL A;  4CXF A;  3FU0 A;  1OR7 A;  2JD1 A;  3R0I A;  3Q43 A;  2WZG A;  1X3W A;  4Y6P A;  4ZW3 A;  1R0K A;  1ZS2 A;  3FUL A;  3PUU A;  4FLO A;  5BPP A;  5JBI A;  1MW0 A;  4BKX A;  2PGG A;  4PW4 A;  1GW6 A;  3EBI A;  4A03 A;  4FLS A;  3FU5 A;  1Q0H A;  4Y6S A;  3CHQ A;  2R59 A;  4ZQF A;  2Y1G A;  2Y1D A;  1SQM A;  4GAE A;  4XN9 A;  3WQS B;  3WQQ A;  5HNF A;  1Q0L A;  5JAZ A;  5JMW A;  2VJ8 A;  2WZF A;  3UEQ A;  4XO5 A;  4ZX5 A;  4Y6R A;  4QHP A;  3FU3 A;  3B3B A;  3CHO A;  4ZQE A;  3ZHZ A;  5HLT A;  4XN1 A;  2JD2 A;  4XMU A;  1H3L A;  1MW1 A;  3ZHY A;  3JT1 A;  4PU2 A;  3B2X A;  3B37 A;  4ZW7 A;  3FUK A;  1RP3 A;  2JCY A;  3FU6 A;  4FCA A;  2VLA A;  3FTX A;  1ONP A;  3B2P A;  4J3B A;  4R5V A;  4XN5 A;  2QVW A;  1R0L A;  4XMT A;  2RJI A;  4K5L A;  3RAS A;  3EBH A;  3ANL A;  5EV7 A;  2JD0 A;  4FLQ A;  3WQR A;  5DLL A;  4X2U A;  2DQM A;  3FUJ A;  2FFL A;  2MAO A;  3FTS A;  4ZW5 A;  3B7S A;  4XND A;  3FTY A;  3FTZ A;  4FLR A;  2ZXG A;  4XO4 A;  2Y1F A;  4ZX3 A;  4ZQH A;  5JMP A;  4AR9 A;  3CZK A;  3UCQ A;  4K5M A;  2QJ1 A;  3JSZ A;  5DUL A;  2WPG A;  3FH7 A;  4ZX6 A;  4QUO A;  1HS6 A;  2GTQ A;  3FH5 A;  3FUE A;  4MS6 A;  3IIE A;  1ONO A;  1SC5 A;  3FTV A;  4ARF A;  3RC3 A;  4QIR A;  1JVS A;  2HPO A;  3T8V A;  4ZX4 A;  3CZE A;  3FHE A;  5FWQ A;  3B34 A;  1ONN A;  4RSY A;  4ZN6 A;  1JG9 A;  4ZQT A;  4AR8 A;  2C82 A;  2XPZ A;  4XNA A;  1JGI A;  3B7R L;  3EBG A;  2A7O A;  2PUS A;  3CZG A;  3VVM A;  4XN4 A;  1MW2 A;  1S46 A;  4R5X A;  3CHS A;  2Y1C A;  4XNB A;  4GAA A;  4XN7 A;  2O7G A;  2XPY A;  1MVY A;  3A06 A;  3FUH A;  1K5H A;  2JCV A;  4R7L A;  1G5A A;  2JCX A;  3B7U X;  4AYS A;  3CHP A;  4ZW8 A;  3QJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...