2MAOA

Nmr structure of region 2 of e. coli sigmae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2maoA00
3ZI0A 4ZN6A 4AYSA 2Y1GA 3WQRA 4FLQA 3UCQA 3T0YA 4FLRA 1G5AA 5JNLA 2JD1A 2MAOA 3CZGA 1R0LA 2Y1CA 3ANLA 4GAEA 2WPGA 1ONOA 2JD2A 4A03A 4FLSA 1ONPA 1Q0HA 4AICA 3CZKA 3ANNA 1ZS2A 4CXFA 3A14A 4OOEA 3AU9A 4ZQEA 5DULA 1Q0LA 4ZQHA 1OR7A 4Y67A 3UEQA 4KP7A 1T1SA 1S46A 3ZHXA 3IIEA 3ZHZA 2JCXA 3WQQA 5JAZA 1T1RA 2Y1FA 2C82A 3AUAA 1MW2A 2EGHA 5JBIA 2Y1DA 3WQSB 3ANMA 1JG9A 1MW1A 1Q0QA 3R0IA 3CZEA 1SC5A 2JCYA 1MVYA 4NQWA 3A06A 1JVSA 4ZQFA 1ONNA 4OOFA 2JD0A 4FLOA 5JC1A 1MW0A 2MAPA 4Y6PA 3RASA 1RP3A 4RCVA 3AU8A 1JGIA 2JCVA 2Y1EA 4ZQGA 4LUPA 4Y6RA 4Y6SA 1R0KA 1MW3A 3UERA 1K5HA 5JO0A 5JMPA 3ZHYA 3CZLA 1H3LA 5JMWA 2O7GA
chains in the Genus database with same CATH superfamily
3ZI0A 4L2LA 4ZN6A 4AYSA 5BPPA 2Y1GA 3JT1A 4QUOA 3WQRA 4FLQA 3UCQA 3FTXA 3HW2A 3T0YA 4FLRA 3B3BA 1G5AA 2XPYA 4JNDA 5JNLA 3CIAA 4XMXA 2JD1A 2MAOA 3CZGA 2VLAA 1R0LA 3FUIA 4RVBA 2Y1CA 4ZW5A 3ANLA 4XMZA 3CHQA 3FUKA 4QIRA 3FUEA 2GTQA 2WZFA 3CHRA 2WPGA 4GAEA 1ONOA 2FFLA 2JD2A 4ZW3A 4A03A 4FLSA 1ONPA 1Q0HA 4R5VA 4Q4IA 5EV7A 1X3ZA 4ZX5A 4AICA 3CZKA 4XNDA 4K5LA 3EBHA 3ANNA 3RC3A 4ZW6A 3KEDA 3CXBA 3FH7A 1ZS2A 4CXFA 3A14A 4OOEA 4XN2A 3B7SA 2WZGA 3FH8A 3AU9A 4PVBA 5HLTA 4ZQEA 5DULA 2PL5A 2R70A 4QMEA 1Q0LA 4ZQHA 2C5ZA 3FUJA 3B7UX 1OR7A 2XQ0A 2R72A 4XN9A 4Y67A 3FTWA 4PW4A 3B34A 3QJXA 3UEQA 4KP7A 4AR8A 4R7LA 2A7OA 2JV7A 1T1SA 1GW6A 3PUUA 1S46A 4XO5A 4QHPA 1X3WA 4XNBA 3ZHXA 2RJIA 3IIEA 3ZHZA 4MKTA 4ZW8A 5DYFA 4J3BA 2JCXA 4K5MA 3WQQA 4AR9A 4XMWA 3CHPA 3B37A 3FTVA 4XO3A 3FHEA 4RSYA 4XMVA 1HS6A 5JAZA 4XN5A 4XN8A 2HPTA 1T1RA 2PUSA 2Y1FA 2C82A 4DPRA 3AUAA 1MW2A 4XMTA 4ZX3A 3FUNA 3FTUA 2EGHA 5JBIA 3RC8A 2XPZA 4K5NA 2Y1DA 3CHSA 2B61A 3ANMA 3B7RL 3FUHA 3WQSB 1JG9A 3FU6A 5HNFA 1MW1A 3FH5A 4ZQTA 4R5XA 4XN7A 4PU2A 1Q0QA 1SQMA 4XN1A 3R0IA 3CZEA 2VJ8A 4R5TA 1SC5A 4BKXA 2JCYA 1MVYA 3U9WA 3FTYA 3FUMA 4NQWA 3FTZA 3Q43A 3A06A 4MS6A 5HNHA 1JVSA 3FU3A 1ONNA 4K5PA 4ZQFA 4OOFA 2DQMA 2JD0A 3EBIA 3EBGA 4FLOA 4ZX6A 5JC1A 1MW0A 4Q4EA 4ZW7A 2MAPA 2R59A 4Y6PA 2ZXGA 4AR1A 4XNAA 3B2XA 3RASA 2HPOA 1RP3A 4K5OA 3VVMA 1SG7A 3FU0A 4RCVA 3AU8A 1JGIA 2DQ6A 3FTSA 3FUFA 3Q44A 2JCVA 2Y1EA 4XMUA 4ZQGA 4LUPA 3FUDA 4Y6RA 5DLLA 2QJ1A 4Y6SA 1R0KA 4XN4A 4ARFA 1MW3A 3UERA 1K5HA 3T8VA 4ZX4A 3JSZA 3B7TA 1H19A 3B2PA 3VVLA 4QPEA 5JO0A 5JMPA 3CHOA 2PGGA 4X2UA 3ZHYA 4GAAA 4XO4A 3FU5A 3FULA 3CZLA 1H3LA 5FWQA 5JMWA 2O7GA 5AENA 4FCAA 2QVWA
chains in the Genus database with same CATH topology
3ZI0A 4L2LA 4ZN6A 4AYSA 5BPPA 2Y1GA 3JT1A 4QUOA 3WQRA 4FLQA 3UCQA 3FTXA 3T0YA 4FLRA 3B3BA 1G5AA 2XPYA 4JNDA 5JNLA 3CIAA 4XMXA 2JD1A 2MAOA 3CZGA 2VLAA 1R0LA 3FUIA 4RVBA 2Y1CA 4ZW5A 3ANLA 4XMZA 3CHQA 3FUKA 4QIRA 3FUEA 2GTQA 2WZFA 3CHRA 2WPGA 4GAEA 1ONOA 2FFLA 2JD2A 4ZW3A 4A03A 4FLSA 1ONPA 1Q0HA 4R5VA 4Q4IA 5EV7A 1X3ZA 4ZX5A 4AICA 3CZKA 4XNDA 4K5LA 3EBHA 3ANNA 3RC3A 4ZW6A 3KEDA 3FH7A 1ZS2A 4CXFA 3A14A 4OOEA 4XN2A 3B7SA 2WZGA 3FH8A 3AU9A 4PVBA 5HLTA 4ZQEA 5DULA 2PL5A 2R70A 4QMEA 1Q0LA 4ZQHA 2C5ZA 3FUJA 3B7UX 1OR7A 2XQ0A 2R72A 4XN9A 4Y67A 3FTWA 4PW4A 3B34A 3QJXA 3UEQA 4KP7A 4AR8A 4R7LA 2A7OA 2JV7A 1T1SA 1GW6A 3PUUA 1S46A 4XO5A 4QHPA 1X3WA 4XNBA 3ZHXA 2RJIA 3IIEA 3ZHZA 4MKTA 4ZW8A 5DYFA 4J3BA 2JCXA 4K5MA 3WQQA 4AR9A 4XMWA 3CHPA 3B37A 3FTVA 4XO3A 3FHEA 4RSYA 4XMVA 1HS6A 5JAZA 4XN5A 4XN8A 2HPTA 1T1RA 2PUSA 2Y1FA 2C82A 4DPRA 3AUAA 1MW2A 4XMTA 4ZX3A 3FUNA 3FTUA 2EGHA 5JBIA 3RC8A 2XPZA 4K5NA 2Y1DA 3CHSA 2B61A 3ANMA 3B7RL 3FUHA 3WQSB 1JG9A 3FU6A 5HNFA 1MW1A 3FH5A 4ZQTA 4R5XA 4XN7A 4PU2A 1Q0QA 1SQMA 4XN1A 3R0IA 3CZEA 2VJ8A 4R5TA 1SC5A 4BKXA 2JCYA 1MVYA 3U9WA 3FTYA 3FUMA 4NQWA 3FTZA 3Q43A 3A06A 4MS6A 5HNHA 1JVSA 3FU3A 1ONNA 4K5PA 4ZQFA 4OOFA 2DQMA 2JD0A 3EBIA 3EBGA 4FLOA 4ZX6A 5JC1A 1MW0A 4Q4EA 4ZW7A 2MAPA 2R59A 4Y6PA 2ZXGA 4AR1A 4XNAA 3B2XA 3RASA 2HPOA 1RP3A 4K5OA 3VVMA 1SG7A 3FU0A 4RCVA 3AU8A 1JGIA 2DQ6A 3FTSA 3FUFA 3Q44A 2JCVA 2Y1EA 4XMUA 4ZQGA 4LUPA 3FUDA 4Y6RA 5DLLA 2QJ1A 4Y6SA 1R0KA 4XN4A 4ARFA 1MW3A 3UERA 1K5HA 3T8VA 4ZX4A 3JSZA 3B7TA 1H19A 3B2PA 3VVLA 4QPEA 5JO0A 5JMPA 3CHOA 2PGGA 4X2UA 3ZHYA 4GAAA 4XO4A 3FU5A 3FULA 3CZLA 1H3LA 5FWQA 5JMWA 2O7GA 5AENA 4FCAA 2QVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZI0 A;  4ZN6 A;  4AYS A;  2Y1G A;  3WQR A;  4FLQ A;  3UCQ A;  3T0Y A;  4FLR A;  1G5A A;  5JNL A;  2JD1 A;  2MAO A;  3CZG A;  1R0L A;  2Y1C A;  3ANL A;  4GAE A;  2WPG A;  1ONO A;  2JD2 A;  4A03 A;  4FLS A;  1ONP A;  1Q0H A;  4AIC A;  3CZK A;  3ANN A;  1ZS2 A;  4CXF A;  3A14 A;  4OOE A;  3AU9 A;  4ZQE A;  5DUL A;  1Q0L A;  4ZQH A;  1OR7 A;  4Y67 A;  3UEQ A;  4KP7 A;  1T1S A;  1S46 A;  3ZHX A;  3IIE A;  3ZHZ A;  2JCX A;  3WQQ A;  5JAZ A;  1T1R A;  2Y1F A;  2C82 A;  3AUA A;  1MW2 A;  2EGH A;  5JBI A;  2Y1D A;  3WQS B;  3ANM A;  1JG9 A;  1MW1 A;  1Q0Q A;  3R0I A;  3CZE A;  1SC5 A;  2JCY A;  1MVY A;  4NQW A;  3A06 A;  1JVS A;  4ZQF A;  1ONN A;  4OOF A;  2JD0 A;  4FLO A;  5JC1 A;  1MW0 A;  2MAP A;  4Y6P A;  3RAS A;  1RP3 A;  4RCV A;  3AU8 A;  1JGI A;  2JCV A;  2Y1E A;  4ZQG A;  4LUP A;  4Y6R A;  4Y6S A;  1R0K A;  1MW3 A;  3UER A;  1K5H A;  5JO0 A;  5JMP A;  3ZHY A;  3CZL A;  1H3L A;  5JMW A;  2O7G A; 
#chains in the Genus database with same CATH topology
 3ZI0 A;  4L2L A;  4ZN6 A;  4AYS A;  5BPP A;  2Y1G A;  3JT1 A;  4QUO A;  3WQR A;  4FLQ A;  3UCQ A;  3FTX A;  3HW2 A;  3T0Y A;  4FLR A;  3B3B A;  1G5A A;  2XPY A;  4JND A;  5JNL A;  3CIA A;  4XMX A;  2JD1 A;  2MAO A;  3CZG A;  2VLA A;  1R0L A;  3FUI A;  4RVB A;  2Y1C A;  4ZW5 A;  3ANL A;  4XMZ A;  3CHQ A;  3FUK A;  4QIR A;  3FUE A;  2GTQ A;  2WZF A;  3CHR A;  2WPG A;  4GAE A;  1ONO A;  2FFL A;  2JD2 A;  4ZW3 A;  4A03 A;  4FLS A;  1ONP A;  1Q0H A;  4R5V A;  4Q4I A;  5EV7 A;  1X3Z A;  4ZX5 A;  4AIC A;  3CZK A;  4XND A;  4K5L A;  3EBH A;  3ANN A;  3RC3 A;  4ZW6 A;  3KED A;  3CXB A;  3FH7 A;  1ZS2 A;  4CXF A;  3A14 A;  4OOE A;  4XN2 A;  3B7S A;  2WZG A;  3FH8 A;  3AU9 A;  4PVB A;  5HLT A;  4ZQE A;  5DUL A;  2PL5 A;  2R70 A;  4QME A;  1Q0L A;  4ZQH A;  2C5Z A;  3FUJ A;  3B7U X;  1OR7 A;  2XQ0 A;  2R72 A;  4XN9 A;  4Y67 A;  3FTW A;  4PW4 A;  3B34 A;  3QJX A;  3UEQ A;  4KP7 A;  4AR8 A;  4R7L A;  2A7O A;  2JV7 A;  1T1S A;  1GW6 A;  3PUU A;  1S46 A;  4XO5 A;  4QHP A;  1X3W A;  4XNB A;  3ZHX A;  2RJI A;  3IIE A;  3ZHZ A;  4MKT A;  4ZW8 A;  5DYF A;  4J3B A;  2JCX A;  4K5M A;  3WQQ A;  4AR9 A;  4XMW A;  3CHP A;  3B37 A;  3FTV A;  4XO3 A;  3FHE A;  4RSY A;  4XMV A;  1HS6 A;  5JAZ A;  4XN5 A;  4XN8 A;  2HPT A;  1T1R A;  2PUS A;  2Y1F A;  2C82 A;  4DPR A;  3AUA A;  1MW2 A;  4XMT A;  4ZX3 A;  3FUN A;  3FTU A;  2EGH A;  5JBI A;  3RC8 A;  2XPZ A;  4K5N A;  2Y1D A;  3CHS A;  2B61 A;  3ANM A;  3B7R L;  3FUH A;  3WQS B;  1JG9 A;  3FU6 A;  5HNF A;  1MW1 A;  3FH5 A;  4ZQT A;  4R5X A;  4XN7 A;  4PU2 A;  1Q0Q A;  1SQM A;  4XN1 A;  3R0I A;  3CZE A;  2VJ8 A;  4R5T A;  1SC5 A;  4BKX A;  2JCY A;  1MVY A;  3U9W A;  3FTY A;  3FUM A;  4NQW A;  3FTZ A;  3Q43 A;  3A06 A;  4MS6 A;  5HNH A;  1JVS A;  3FU3 A;  1ONN A;  4K5P A;  4ZQF A;  4OOF A;  2DQM A;  2JD0 A;  3EBI A;  3EBG A;  4FLO A;  4ZX6 A;  5JC1 A;  1MW0 A;  4Q4E A;  4ZW7 A;  2MAP A;  2R59 A;  4Y6P A;  2ZXG A;  4AR1 A;  4XNA A;  3B2X A;  3RAS A;  2HPO A;  1RP3 A;  4K5O A;  3VVM A;  1SG7 A;  3FU0 A;  4RCV A;  3AU8 A;  1JGI A;  2DQ6 A;  3FTS A;  3FUF A;  3Q44 A;  2JCV A;  2Y1E A;  4XMU A;  4ZQG A;  4LUP A;  3FUD A;  4Y6R A;  5DLL A;  2QJ1 A;  4Y6S A;  1R0K A;  4XN4 A;  4ARF A;  1MW3 A;  3UER A;  1K5H A;  3T8V A;  4ZX4 A;  3JSZ A;  3B7T A;  1H19 A;  3B2P A;  3VVL A;  4QPE A;  5JO0 A;  5JMP A;  3CHO A;  2PGG A;  4X2U A;  3ZHY A;  4GAA A;  4XO4 A;  3FU5 A;  3FUL A;  3CZL A;  1H3L A;  5FWQ A;  5JMW A;  2O7G A;  5AEN A;  4FCA A;  2QVW A; 
#chains in the Genus database with same CATH homology
 3ZI0 A;  4L2L A;  4ZN6 A;  4AYS A;  5BPP A;  2Y1G A;  3JT1 A;  4QUO A;  3WQR A;  4FLQ A;  3UCQ A;  3FTX A;  3T0Y A;  4FLR A;  3B3B A;  1G5A A;  2XPY A;  4JND A;  5JNL A;  3CIA A;  4XMX A;  2JD1 A;  2MAO A;  3CZG A;  2VLA A;  1R0L A;  3FUI A;  4RVB A;  2Y1C A;  4ZW5 A;  3ANL A;  4XMZ A;  3CHQ A;  3FUK A;  4QIR A;  3FUE A;  2GTQ A;  2WZF A;  3CHR A;  2WPG A;  4GAE A;  1ONO A;  2FFL A;  2JD2 A;  4ZW3 A;  4A03 A;  4FLS A;  1ONP A;  1Q0H A;  4R5V A;  4Q4I A;  5EV7 A;  1X3Z A;  4ZX5 A;  4AIC A;  3CZK A;  4XND A;  4K5L A;  3EBH A;  3ANN A;  3RC3 A;  4ZW6 A;  3KED A;  3FH7 A;  1ZS2 A;  4CXF A;  3A14 A;  4OOE A;  4XN2 A;  3B7S A;  2WZG A;  3FH8 A;  3AU9 A;  4PVB A;  5HLT A;  4ZQE A;  5DUL A;  2PL5 A;  2R70 A;  4QME A;  1Q0L A;  4ZQH A;  2C5Z A;  3FUJ A;  3B7U X;  1OR7 A;  2XQ0 A;  2R72 A;  4XN9 A;  4Y67 A;  3FTW A;  4PW4 A;  3B34 A;  3QJX A;  3UEQ A;  4KP7 A;  4AR8 A;  4R7L A;  2A7O A;  2JV7 A;  1T1S A;  1GW6 A;  3PUU A;  1S46 A;  4XO5 A;  4QHP A;  1X3W A;  4XNB A;  3ZHX A;  2RJI A;  3IIE A;  3ZHZ A;  4MKT A;  4ZW8 A;  5DYF A;  4J3B A;  2JCX A;  4K5M A;  3WQQ A;  4AR9 A;  4XMW A;  3CHP A;  3B37 A;  3FTV A;  4XO3 A;  3FHE A;  4RSY A;  4XMV A;  1HS6 A;  5JAZ A;  4XN5 A;  4XN8 A;  2HPT A;  1T1R A;  2PUS A;  2Y1F A;  2C82 A;  4DPR A;  3AUA A;  1MW2 A;  4XMT A;  4ZX3 A;  3FUN A;  3FTU A;  2EGH A;  5JBI A;  3RC8 A;  2XPZ A;  4K5N A;  2Y1D A;  3CHS A;  2B61 A;  3ANM A;  3B7R L;  3FUH A;  3WQS B;  1JG9 A;  3FU6 A;  5HNF A;  1MW1 A;  3FH5 A;  4ZQT A;  4R5X A;  4XN7 A;  4PU2 A;  1Q0Q A;  1SQM A;  4XN1 A;  3R0I A;  3CZE A;  2VJ8 A;  4R5T A;  1SC5 A;  4BKX A;  2JCY A;  1MVY A;  3U9W A;  3FTY A;  3FUM A;  4NQW A;  3FTZ A;  3Q43 A;  3A06 A;  4MS6 A;  5HNH A;  1JVS A;  3FU3 A;  1ONN A;  4K5P A;  4ZQF A;  4OOF A;  2DQM A;  2JD0 A;  3EBI A;  3EBG A;  4FLO A;  4ZX6 A;  5JC1 A;  1MW0 A;  4Q4E A;  4ZW7 A;  2MAP A;  2R59 A;  4Y6P A;  2ZXG A;  4AR1 A;  4XNA A;  3B2X A;  3RAS A;  2HPO A;  1RP3 A;  4K5O A;  3VVM A;  1SG7 A;  3FU0 A;  4RCV A;  3AU8 A;  1JGI A;  2DQ6 A;  3FTS A;  3FUF A;  3Q44 A;  2JCV A;  2Y1E A;  4XMU A;  4ZQG A;  4LUP A;  3FUD A;  4Y6R A;  5DLL A;  2QJ1 A;  4Y6S A;  1R0K A;  4XN4 A;  4ARF A;  1MW3 A;  3UER A;  1K5H A;  3T8V A;  4ZX4 A;  3JSZ A;  3B7T A;  1H19 A;  3B2P A;  3VVL A;  4QPE A;  5JO0 A;  5JMP A;  3CHO A;  2PGG A;  4X2U A;  3ZHY A;  4GAA A;  4XO4 A;  3FU5 A;  3FUL A;  3CZL A;  1H3L A;  5FWQ A;  5JMW A;  2O7G A;  5AEN A;  4FCA A;  2QVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...