4NQWA

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
148
Chain Sequence
DLDALLRRVAHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
total genus 57
structure length 148
sequence length 176
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4nqwA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4nqwA01
3ZHYA 5JI6A 3NEUA 3FM5A 5JFRA 2P4WA 4KP7A 4CDGA 4S04A 5H6QA 1IN6A 3BJ6A 4KYWA 1FX7A 4HBLA 2M5WA 2ZMEB 2RV8A 4BQAA 4GAEA 3E6CC 4A6EA 1EH8A 2PQ8A 1BI3A 2XUBA 4OMYA 1W4MA 4HV6A 1PUEE 2LSOA 3WTTC 4HA8A 1T39A 3MEXA 4OIOF 5JO0A 4YIFA 2XAQA 2Q8KA 2XAFA 3GWZA 1Z91A 2J5OA 3R61A 3KCCA 3I0TA 4XLPF 1H3LA 5D5VB 5K1YA 3GX4X 2PMHA 4LD5A 5IT3A 2Y1GA 2HGCA 4G7ZF 4MTDA 4N9HA 3ZHXA 4L9NA 5CVJA 5BMZA 4EM2A 3HRSA 3WG9A 2W24A 4BHPA 2F5FA 1HW5A 1DDNA 4BHCA 3I53A 4WX9A 4HQEA 2JCYA 4CICA 2Y48A 5F1RA 3IHUA 1YTYA 2WV0A 4N0BA 2XKPA 4MQ9F 1LQ1A 1HKQA 1FBUA 4HX4A 4GO1A 1W5TA 1D8KA 3QOPA 2A61A 3V4GA 2DLLA 2OAZA 3FZVA 3D0SA 1S8NA 4G7OF 3ZP5A 2A3SA 1P4XA 4EVIA 4RB2C 3JSOA 2HQRA 2LF7A 5L3BA 3CUOA 1P92A 4BHBA 2ESHA 3AAFA 2QVOA 2H6BA 4P96A 1ZS2A 1L3LA 4RAZA 1FP1D 3LAJA 4KMFA 1QZZA 1FBQA 1AWCA 5ICFA 1D5VA 2P5LC 3EETA 4JK1X 1ZAOA 2O03A 1XGSA 1G4DA 2W25A 2W85A 5LRRA 3R4KA 4HQMA 4CXFA 1NHAA 3P9IA 4EJWA 1LEAA 3GFIA 5JHUA 1QNTA 3WGGA 1RZ4A 2F5EA 2EFPA 4CYDA 4LGWA 1J9IA 3MZYA 4L9VA 3BDDA 4HLXA 2GZWA 3ECHA 2D45A 2DQLA 3DPLC 4ETSA 1IN4A 2H27A 1O7FA 4KN4X 3M8FA 4AIKA 4ENNA 4LUPA 4IXAA 1HKSA 1ULYA 2JTVA 5DCMA 1IW7F 2M87A 2VT2A 3N4MA 2ZNYA 4Q5SF 3T0YA 4G94A 1Z9CA 2V1XA 3CO7C 1TQPA 3I58A 3IC7A 1T1SA 3JW4A 4CGZA 2RC4A 4IRGA 2EFOA 3TO7A 2JPCA 2JRTA 1BI2A 3I54A 2HQNA 5LLQA 1U6GA 3C1DA 3ABUA 2HYGD 5JAZA 3KFWX 3DF8A 5HDKA 5FFXA 1ONVA 2HKXA 3NRVA 4NQWA 1TQIA 1ZLJA 5D6FA 3VOEA 2RGVA 2P6SA 1U5TC 1G6NA 2RN7A 3C3WA 1DP7P 4UUVA 5HOOA 3DP7A 4RB0A 2VONA 4A2UA 2HDCA 1U3EM 4LB6B 4Y6SA 4OIQF 2FBKA 1ON2A 1XGMA 2GXBA 1BI0A 2P8TA 4AYSA 4U88A 4Y6PA 1OYWA 4EGZA 2FMYA 2JD2A 3GO5A 4QWQA 3JAMK 1KA8A 1G3YA 5FLXK 5HLIA 4OIPF 2NYXA 4ZN6A 3ZQ7A 5LHIA 3FXQA 2ISZA 2H6CA 5D5XB 1SMTA 2F5DA 4UV8A 3SZPA 4FHTA 4FX4A 4L18B 1S7AA 1ZG1A 1ZYRF 2EV5A 4U0WA 4O6JA 4GGGA 1YLFA 1L0OC 2JD1A 2XRNA 2WPGA 3LSTA 3FMSA 5FFZA 2LKPA 3WTSC 1U5TB 3OV8A 4A5MA 2QQBA 3V8JA 4XSXF 2P7CB 2DW4A 4U0YA 2ELHA 1O3SA 2VBYA 4ZYEA 2OZUA 1GXQA 4ZQFA 5AONA 3RPQA 4EJTA 1R1VA 1XDSA 1REPC 5K5QA 4RS8A 1MDMA 4HX7A 3JTGA 1Q0QA 1K6OA 2B0LA 2IP2A 3FXUA 3RKYA 1WRJA 1QZYA 2A5YB 1DPRA 1FPQA 4RGSA 1YYVA 2ZFWA 2NS0A 4KIFA 3EYYA 2FXAA 1BM9A 3ELKA 1J75A 2KJBA 4OMZA 2HTSA 2FNPA 3EDPA 3K69A 4M73A 1B4AA 5L3FA 3B73A 1E17A 1YFHA 2NNNA 5ICCA 1PP7U 2EK5A 4HX8A 3I5UA 3CTAA 5BS6A 3J80K 1LDDA 3ZMDA 2L01A 2DPUA 1I1GA 3BY6A 3CUQA 4IHSA 4I02A 4Y6RA 3Q9VA 4I0AA 1SC5A 2R3SA 2O8XA 1TW2A 4ZYGA 4A12A 2FMLA 4L0YB 2Z3YA 1YW9A 3P7NA 1H9GA 4UXNA 1IUYA 2MA3A 3CLOA 3WQSB 2XGXA 3F21A 2VBZA 3JSPA 3LFKA 3KEQA 1YS7A 3FHZA 4ZQEA 5H20A 1GXPA 1JGIA 1Z7UA 3J81Z 1K5HA 5D5UB 4R8HA 1GVJA 5D5WB 1BBYA 4A0ZA 1K78B 1V3FA 1SD7A 1WWXA 4D0PA 3CZGA 4YFKF 1ONOA 3RIRA 1ZG5A 1OKRA 4G8XA 5ERIA 3GFJA 1IRFA 5F64A 2UZKA 4Q4ZF 5JMPA 5D8LB 4AICA 2ZCWA 3MZHA 1CF7B 3H3ZA 1Z6RA 3ZPLA 5ED4A 1ONNA 5KK1A 1YO5C 3KZZA 1S46A 4G9YA 2G7HA 2HFHA 1LJ9A 2YR2A 3M1EA 4LMYA 3HHHA 1R1TA 2FBIA 4MTEA 4U7DA 4HF2A 5HLGA 3HTSB 1W7PB 3WTYC 2PG4A 2AS5F 5HS8A 2K86A 3GW2A 1U78A 1B1BA 3R60A 3VODA 3J7AO 4RGUA 4I7HA 1KYZA 2LNBA 3NQOA 4KIGA 2PI0A 4GXOA 3KP5A 2ZJ2A 1H9TA 2QBYA 3WGIA 1VTNC 1Q1HA 1FBSA 1B9NA 2ETHA 1ZGAA 3E3VA 3WTWC 2HS5A 5DV5A 4EMSA 2HYFA 4DQ2A 1J5YA 3E97A 1R36A 4Y17A 4EJUA 5CVIA 4PCQA 1FYMA 2EB7A 2A69F 2ACJA 3F8BA 1C0WA 1BI1A 4OU0A 1ZH5A 3Q5FA 3WGHA 2X4HA 2O6GE 1OYYA 4E70A 2OQGA 5CVRA 2CW0F 4HV5A 2P5VA 2QQ9A 4HOBA 1IN8A 1P6RA 4PGHA 1IXRC 3SQNA 2MH2A 2Y1DA 1D3YA 2LF8A 3UERA 2PLYA 3DQVC 3FF5A 1EV7A 4Q48A 5LEKA 1IXCA 4L5JA 2Z33A 1IXSB 2MH9A 2P6TA 2PEXA 1MW0A 4BYYA 4LFUA 3RYPA 2ESNA 3F8FA 2JCXA 4B8XA 2RQPA 3IKVA 1O7LA 3DPTA 3E5XA 3A14A 3TQNA 3RTRA 1MJBA 5DDGA 2ADUA 3ANMA 3M9AA 3E5QA 2D2WA 4GYGA 1XMKA 2STTA 4L9TA 2EGHA 1YW7A 5LEJA 1JGSA 2BE5F 4FLQA 1JE8A 4A6DA 3WQQA 5HS7A 5CVVA 4Z2YA 1T6SA 5E8GA 1R22A 3ZMVA 1B9MA 3TOAA 4LG0B 2EA4A 1D8JA 2DQRA 5DUKA 1B6AA 2E7WA 2O3FA 1MGTA 2VOOA 2VC0A 4WXHA 3BZ6A 5E1ZB 2IJLA 4KT5C 4ASNA 4HZFA 3BROA 5HDNA 3M7GA 1ZGJA 2E7XA 5KVRA 2MBFA 4M6XA 4KUMA 4HAMA 4M71A 3ML6A 3HRUA 3TO9A 3F22A 1YQAA 2ZO4A 3GF2A 2ISYA 2E1NA 1TBXA 1ZRDA 5DCFA 4I2OA 4CHUA 4FX0A 3ZHZA 4A0XA 2DBBA 3ROUA 4KIBA 3R0IA 2M45A 3CZKA 2OQRA 4EV0A 1DPUA 4HDUA 1PDNC 3ULQB 2FNAA 4Y13A 2QWWA 1YS6A 5IT9K 5TJJA 1YG2A 2IW5A 2KRFA 1QQIA 3RYRA 3LA7A 1G3SA 3TOBA 4LJZF 5ILUA 1TLHB 5A2QK 3RI4A 2XHKA 5LBQA 3WODF 3TO6A 4ENMA 3FWEA 3TDUC 5HVQC 2F5CA 2BEOA 3LQRA 1F5TA 3KETA 4KNYA 2OU2A 3GZ5A 1CGPA 3IWZA 1P4WA 2V1UA 4G6DA 4HYEA 3I71A 5LGNA 1MW2A 4HF0A 5DD4A 5EEGA 4M9XA 1R00A 3KLNA 5ICEA 3GLXA 1S7OA 3ANLA 3I59B 3FMRA 3UCQA 1UCRA 3W6KB 5DYMA 2JCVA 2VBWA 2OZ6A 5EEHA 1BC7C 1P4AA 3HIFA 3LWFA 1V4RA 2V1DA 3BOQA 2NRAC 4RGRA 2QYOA 2XROA 3BJOA 5FO5A 2DO7A 4AD9A 1LB2A 4M9ZA 1ZN2A 5CJ9A 3ZMZA 2P5KA 1XCBA 4EQQA 3VEPA 2FRHA 5E17F 2XAJA 2RKHA 4RCVA 4HLYA 2CO5A 4EGYA 4WXDA 4JBAA 3QPHA 5CYVA 4DNCA 3KP3A 2L54A 2P7VB 2H09A 2KIUA 2DK8A 5LHGA 3KP7A 1ZRCA 1MVYA 1XSVA 2DU9A 4Q47A 3WTUC 4LB5A 1RNLA 1FNNA 2PN6A 3WTXC 1J0RA 4YFNF 4I98B 2HTJA 1QGPA 2L3DA 2ZKZA 3F8MA 2EFWA 2JZYA 2HWVA 2FF4A 1K7AA 4UVAA 1R5GA 4M9SA 1KU9A 4EJOA 3QU3A 1I1SA 3KLOA 2L02A 4XLNF 3SHFA 4L9JA 1ONPA 2VE8A 4I0BA 1UHMA 1USSA 3TGNA 2DFIA 4OINF 4B09A 3KP2A 1R23A 3F8NA 2MLGA 1YIOA 3WE2A 3ZN0A 2Y1EA 1UFMA 1Z05A 2MC3A 1I6XA 4I09A 2UXXA 3KZYA 1LDKB 2HKOA 2IRFG 1KU2A 1S29A 2FA5A 4UVBA 4G6QA 5CLSA 2K4BA 1MJ9A 1Z1DA 3QP6A 4U7BA 5DCMB 4LLNA 2GA2A 2QENA 3FMQA 2O61A 4ON0A 2C6YA 4M6YA 1RIOH 1TQMA 2EWNA 5E18F 4JQFA 1XMAA 2BYVE 3PFIA 2VC1A 4AWXB 1IAWA 3V8LA 1BOAA 3DXJF 2ZMEA 2QUFA 2NNYA 4Y67A 3SXYA 2BGCA 4KDPA 1KU7A 1MW3A 2EFQA 3HTUA 3WTZA 3KEOA 1U8RA 2VXZA 3GXOA 3SZTA 1TNTA 3BPVA 4ENJA 4K2EA 5FGMA 5E20A 1SD6A 4R79A 1XDUA 4M72A 1KGSA 2Z9OA 2YPRA 1WQ2A 1I5ZA 2IA2A 1W7PD 1O3RA 2KJCA 2DAOA 3V7CA 4H0EA 5D4SA 1XGNA 1KQ8A 3KE2A 3N97A 1JG9A 1FYLA 3I4PA 4BXUA 2CSOA 4UHTA 5JC1A 2EV6A 2MLKA 3BWGA 3OOPA 2GQQA 4EJVA 2D1HA 3U9GA 1B59A 3P9CA 1Y0UA 4HW0A 3E5UA 1OPCA 4U0VA 4FLSA 4UVCA 5JNLA 1ZHFA 3D5LA 1K79A 4F7ZA 1F4KA 2L4AA 3J80Z 3H3UA 3ABTA 2RVCA 1XGOA 4ESFA 3L9FA 4WF2A 2AXLA 3EYIA 3WU0A 5FD6A 1TTYA 4MNUA 4A0YA 5LHHA 4KN7X 5FB2A 5LGTA 2EJRA 3BPXA 3IWFA 1IN7A 3O3KA 3HUGA 3E6BA 1MDMB 1R0LA 4S05A 4AIHA 3Q9SA 5J8FA 3F23A 2VOPA 1X3UA 2WTEA 5E1XA 4ZYDA 1J59A 4IVNA 4MEXF 2FBHA 2PFBA 1SMYF 3K0LA 4ZQGA 2CG4A 1FP2A 3WQRA 2QQAA 2D1VA 2JD0A 3ERED 1IRGA 3I64A 1I27A 4IHTA 1GHCA 4OOIA 4XRFA 1G3TA 2WWYA 3KP4A 2YSRA 3KP6A 1IN5A 3PQJA 3C7JA 1PP8F 2XV4S 4OIRF 3ANNA 2QLZA 5LRSA 1J7KA 2M8EA 2CWEA 4P5OA 1A04A 1WI9A 2DI3A 3F72A 1QBJA 1O3TA 3HSEA 1KQ9A 5ILSA 3TKYA 3MAJA 3QPTA 1XB4A 1O57A 1HKTA 3CUQB 4BNCA 2IA0A 4N9IA 4WWCA 1AOYA 5HLHA 2R7FA 2IA1A 4P9FA 3R0AA 4EM1A 2R7DA 2JSCA 4A5NA 3F8CA 3DEUA 4QLCU 2DTRA 2VT3A 3HSFA 1RP3A 1RI7A 2XVCA 4TV7A 1ZRFA 4IJAA 2VBXA 1FSHA 4RB1A 3U1DA 1WSUA 2O7GA 1BIBA 4KA4A 4LLLA 2Z99A 3BP8A 2YU3A 1U2WA 2BV6A 3K9TA 3I59A 3O6BB 4GYIA 1T1RA 5JBIA 2EV0A 1F1ZA 3IRRA 1HW2A 2ZXJA 1T98A 5HS9A 1R58A 1FY7A 1P2FA 2ZBKA 4IF4A 3ISPA 4ZZLA 5L3GA 1R1UA 4ZZDA 2C82A 2STWA 1W5SA 1ZLKA 3TDZC 3CDHA 2W57A 2FQ3A 2HEOA 4ENKA 1LVAA 1XCVA 3R6SA 5JVTA 3RKWA 4PZJA 1STZA 5H6RA 3QU6A 2JT1A 2LDUA 2V79A 1FYKA 3S2WA 1XSXA 5J8CA 2VE9A 4Y15A 1HSTA 4O3MA 1S3JA 4HDVA 4KFCA 5JR3A 2M1BA 1USTA 4LLGF 1JXSA 3B02A 2COMA 1T0FA 2UWMA 1U5TA 3CZEA 3F3XA 1T38A 2QBYB 4BH9A 2EFNA 5L3CA 3HRTA 3UEQA 4UNOA 5D8KB 5E8IA 3LAPA 1MKMA 2GWRA 3REOA 3K1NA 3RPUA 6PAXA 3GUDA 1FSEA 4BAYA 2Y1FA 3K1PA 3W6JB 3V7SA 1HBXG 1JHHA 4RAYA 3L09A 4G7HF 2A6HF 5D4RA 1FT9A 4OOEA 1RUOA 4LK1F 3IRQA 4CZZA 3HHGA 4NB5A 3IKTA 4ZH4F 1KQ0A 4KICA 2OA4A 2F2EA 1H0MA 2GXGA 1IZ1A 5DULA 2XIGA 3F6OA 4PGGA 2FOKA 1O3QA 3E6DA 2RDPA 3T8TA 4WK8F 3T1BA 3QP5A 5DEQA 2XASA 3FX3A 5JMWA 4MQVA 3IL2A 1LNWA 1FLIA 5D6EA 3U2RA 2GAUA 1OYIA 2FSWA 5AIPA 2K02A 3PQKA 3L2CA 2KKOA 4M74A 2A6EF 1OR7A 3QRFF 5L3EA 4YFXF 5CVUA 2YX7A 1FZPB 1FOKA 3AU8A 1ODDA 3P9KA 4OOFA 4FLOA 1BC8C 3GFMA 3WE3A 2Q2EA 3COAC 3GVAA 3WTVC 4ESJA 3HOSA 4A03A 4I01A 5ICGA 5IT9Z 3V8KA 5J6XA 4CO8A 1LEBA 4WCGA 1ON1A 2QZ8A 1K78A 5A2QZ 4GCVA 1BJAA 1XD7A 1HW1A 4P9UA 2IVMA 2V9VA 3ZMTA 1R7JA 1QO0D 3VB2A 2UXNA 2DK5A 3RJPA 4ESBA 4NHJA 1XSDA 1JHFA 3HRMA 1BN5A 1ZG3A 4IPAA 2Y1CA 1MZBA 2Z5UA 2GIVA 2J5PA 2FEZA 1CF7A 1MW1A 2Y0MA 2GA1A 2M30A 5BOXA 5BPIA 2NAZA 2CYYA 2H94A 4YG2F 4AIJA 3GEZA 3MWMA 1ZARA 4ZYHA 2O0YA 2XAHA 3K2ZA 2IPQX 4KMUX 5BPDA 2L4MA 2K27A 2HOEA 2ZNZA 3HYIA 1W7PA 5K5RA 4ZQHA 2BBYA 2WC2A 2Y75A 3QAHA 4IRIA 3RDIA 1RUNA 1SFEA 4HF1A 2QM3A 3ZI0A 2X0LA 3J81K 4MEYF 2MAOA 2DT5A 3AU9A 4WXCA 3F6VA 3ZMUA 1SFXA 5AIQA 5LGUA 3JAMZ 3HSRA 3E6MA 3RASA 5FLXZ 3BJAA 3ZN1A 3GFLA 2FE3A 1KYWA 3FM3A 4RGXA 3LA3A 2CQKA 2G7UA 1OMIA 4YIIA 3T5XA 1G5AA 3AUAA 1SAXA 2FU4A 3L7WA 3EUHA 4IRHA 4MGRA 3HOTA 5DD8A 4R1HA 2VODA 5E1WA 5K5OA 2EA2A 1MJAA 1FC3A 2DPDA 2G9WA 1HSJA 2CFXA 2RNJA 3CO6C 3GZ6A 1IF1A 3L00A 4EM0B 2KIMA 1ZREA 1Q0HA 1XN7A 1FWZA 3VFZA 4RB3C 5TRDA 2K7LA 3MQ0A 4L0ZB 4L5IA 4LK0F 1Q0LA 1Z6TA 1BIAA 3EQLF 2PJPA 2XKOA 3R0JA 3T8RA 1HXDA 3RKXA 2A07F 3LQQA 1SD4A 1EH6A 1DUXC 1J2XA 1YW8A 3A06A 1LDJA 2IT0A 1T2KA 2W84A 3JTHA 1QPMA 3IIEA 1R0KA 2KIFA 1F9NA 3ECOA 3G73A 2A68F 2VN2A 1JVSA 3C18A 2K4JA 2TDXA 3DV8A 2OBPA 1S6LA 5BQTA 3CZLA 4XBFA 2CGPA 1HQCA 2PMUA 1SFUA 3H92A 3M8EA 1UB9A 3ZMSA 3V7RA 2V6CA 3CJNA 3MFKA 5F6FA 4PDKA 3WU1B 4LG0A 4MHGA 1TNSA 1MD0A 5HDGA 5L3DA 3G3ZA 4AVPA 2MD5A 3CUQC 4XSZF 2YX4A 4P55A 1EH7A 1G3WA 5FD5A 1TW3A 1E2XA 3DKWA 4FT8A 4FLRA 2MAPA 3GYHX 2HZTA 2HR3A 3SFZA 1R5HA 2E1CA 1SD5A 3DFGA 4O5VA 5DUIA 3MCZA 2PBIA 3FXRA 1UHWA 3K1MA 4UV9A 2OD5A 3O2PE 1WKMA 1KU3A 2Q0OA 5ILVA 3LA2A 2JPBA 2XAGA
chains in the Genus database with same CATH superfamily
3ZHYA 3BR0A 2BHYA 3L2WA 5JI6A 3H36A 3NEUA 3FM5A 5JFRA 3LSIA 5KAFC 2P4WA 3GTGJ 3SFIA 2FX0A 4ZW5A 3K4MA 4KP7A 3PSIA 3B6CA 4GDFA 4CDGA 4S04A 3D5RC 5E3MA 3TMOA 4E7IA 1S5LC 3FKJA 4W1UA 5H6QA 3FUMA 1IN6A 3BJ6A 1MBJA 4KYWA 3S1MJ 2DT7B 4JX5A 1FX7A 4M3EA 4HBLA 3KX2A 2M5WA 3CDIA 2F6CA 5E3OA 2ZMEB 4ABZA 1MMNA 1DGWY 2RV8A 4BQAA 4GAEA 3OYHA 3E6CC 2M34A 3S2DJ 2HPIA 3NARA 2DT6A 4BU2A 1SVMA 3I9V2 4HRIA 4A6EA 1EH8A 3FHNA 3PO3J 2PQ8A 4ZX3A 4XMTA 4E7SA 1X1AA 1BI3A 2DYSH 2XUBA 3VSKA 5DS9A 4OMYA 1SAUA 1W4MA 4HV6A 2DMPA 4BE0A 1PUFB 2LSOA 1PUEE 3FISA 5F04A 3WTTC 4HA8A 1T39A 3MEXA 2Y9YA 4OIOF 2BVLA 5JO0A 1VF9A 4YIFA 2XAQA 1JUPA 3JR9A 2QQ8A 2Q8KA 2XAFA 2LOOA 3GWZA 3W3CA 1K83J 1Z91A 4IOCF 3KYCB 2J5OA 1D5YA 3PNYA 1SG7A 3R61A 3BG9A 1FOYA 3BTIA 3KCCA 3I0TA 4XLPF 1MBKA 1H3LA 5D5VB 1FMVA 5K1YA 1ZR4A 4AR1A 3GX4X 3NWTA 3S2HJ 2PMHA 4LD5A 3CCVI 1ORKA 4E7LA 4Y7NJ 4FE4A 5M3MJ 5IT3A 2Y1GA 2QGUA 2GOMA 3B7UX 2HGCA 4G7ZF 4QPOA 4MTDA 1QVUA 3K4CA 4N9HA 4BY7J 5B66C 3ZHXA 4L9NA 5CVJA 2IGMA 2F5VA 5BMZA 4EM2A 3HRSA 4AVZA 3WG9A 2W24A 3H5AA 4BHPA 3QPSA 1ETOA 2F5FA 1TWFJ 1HW5A 1YI2I 1DDNA 4II3A 5F27A 4BHCA 4PU2A 4ZW6A 3OS0A 1X19A 3I53A 4WX9A 2EPFA 3E0JB 1ETKA 4HQEA 5J1RA 2JCYA 2E2JJ 4CICA 2Y48A 3CLQA 4XORA 5F1RA 3IHUA 1YTYA 2WV0A 4N0BA 2XKPA 4MQ9F 1LQ1A 4RM2A 5FKOA 1HKQA 4M3FA 1FBUA 2H1LA 2VJ4A 4HX4A 4CA0A 4C2TA 4HNTA 4GO1A 5FLVA 2ZSHB 4XMYA 1QVTA 1YHQI 3VYRB 1W5TA 2HVRA 3MKYB 1D8KA 3QOPA 2A61A 3I3LA 3V4GA 2DLLA 4QMEA 2CW8A 2OAZA 1K4TA 3FZVA 3D0SA 5IP6A 4E7JA 1S8NA 4G7OF 1U0JA 2M9HA 2Y0SA 3ZP5A 3CHQA 2NOGA 3ESWB 3B37A 1DP3A 2JMWA 2A3SA 2YU9J 1P4XA 4EVIA 2G0EA 4RB2C 3S3MA 3JSOA 2HQRA 3JRIA 5HNFA 3RC8A 1BW6A 3QWLA 2LF7A 2OTLI 1V5EA 5L3BA 3W6VA 2P0WA 3CUOA 1P92A 4ZJZA 2JJ7A 4BHBA 3CCQI 4DPRA 2PMZN 3S16J 3HUGB 1FTZA 2ESHA 3AAFA 2QSHX 3A0HC 2QVOA 2BOLA 3GCMA 2H6BA 4P96A 4RBOA 1ZS2A 1L3LA 4A93J 4R5XA 2EINH 4Y52J 4RAZA 3K10A 1FP1D 3LAJA 4KMFA 1QZZA 1FBQA 2W4SA 4A3DJ 1AWCA 4RDUA 4BBSJ 1ETWA 2MSYA 2HDDA 5ICFA 1YITI 1D5VA 3PM1A 2P5LC 3EETA 4JK1X 2ELKA 2LY2A 4BJ6C 1X2NA 1ZAOA 2O03A 1XGSA 5IOYA 2WY7Q 3H9JA 1G4DA 2W25A 2W85A 1MMGA 4B3XA 2DOEA 2WBMA 1U9NA 5LRRA 4C3IJ 3M3YJ 4DJAA 3R4KA 2MABA 4CYCA 4HQMA 4CCJA 4CXFA 1NHAA 1XS9A 3P9IA 1RC9A 4EJWA 2VJ8A 3H0DA 2VQCA 2R7TA 1LEAA 3GFIA 2JA7J 3QQAA 5JHUA 1QNTA 3BTCA 5GAHJ 2C5ZA 4UB6C 3WGGA 1RZ4A 2VJIA 2F5EA 3K4KA 2L9VA 2EFPA 4FCYA 5FKNA 1WJBA 1PVEA 4CYDA 4LGWA 2HVSA 4XRSG 4XMUA 3OOUA 1J9IA 3MZYA 2DMNA 4L9VA 3FUHA 3CJQB 3BDDA 4HLXA 3SEQA 3B7RL 2GZWA 3ECHA 2E36A 2LP0A 2P81A 3DEWA 2D45A 2DQLA 3DPLC 4ETSA 1IN4A 2H27A 3KEDA 1R5ID 1O7FA 2FOWA 3M8FA 4KN4X 4AIKA 2E5ZA 2XRLA 1QHGA 5F0HA 4ZX4A 3PNTA 3JRDA 4ENNA 4LUPA 4IXAA 4C9YA 1HKSA 1ULYA 1BOBA 1N25A 2CFOA 2JTVA 5DCMA 1IW7F 1D0YA 2L7FP 2M87A 3BC8A 4IEJA 1JTXA 4BGDA 1QU3A 2VT2A 3N4MA 2ZNYA 5EF6A 4XNBA 1Q1VA 2DDBA 4Q5SF 2W1OA 3T0YA 4G94A 1Z9CA 2HVQA 2V1XA 3CO7C 1AKHB 4XN5A 2E71A 1TQPA 3I58A 3IC7A 2DOAA 1T1SA 3JW4A 3LSPA 4CGZA 2RC4A 1ETYA 4IRGA 3HG9A 3L2QA 2EFOA 3JRBA 1W36C 3S1NJ 1MH4A 3OYIA 3TO7A 2JPCA 2JRTA 1Y1WJ 1BI2A 5M5WJ 4ZC3A 3RKQA 3I54A 1W36D 1Y56A 5AENA 2HQNA 3KZIC 1OISA 1U6GA 5LLQA 3FTWA 3C1DA 3ABUA 3RZOJ 2HYGD 5JAZA 3KFWX 3JRAA 3DF8A 2MG4A 5HDKA 5FFXA 4MFDA 1ONVA 1I50J 4CH7A 2IS1A 2HKXA 4BJTA 4A3GJ 3NRVA 2IXSA 4NQWA 1N77A 2HOSA 1TQIA 3AKZA 1ZLJA 5D6FA 3VOEA 1T0FC 2RGVA 2DODA 2V6EA 3Q43A 2CMPA 1CQTA 2P6SA 1U5TC 1G6NA 2RN7A 3C3WA 4U87A 4X2UA 1DP7P 4UUVA 1I6HJ 5HOOA 1VQPI 2CS3A 3DP7A 4RB0A 2VONA 4A2UA 2HDCA 1IV8A 4QUOA 2X48A 1U3EM 4LB6B 2VJ5A 4BXFA 1X1CA 5DYFA 4Y6SA 4PJ0C 4OIQF 2FBKA 2BW3B 1ON2A 1XGMA 2GXBA 1BI0A 2P8TA 4AYSA 4U88A 4RMNA 1F43A 4Y6PA 1OYWA 4EGZA 2L7KA 3GLLA 3CC4I 4RVBA 2CUZA 2FMYA 2JD2A 3GO5A 4ZYAA 4QWQA 5E3NA 1Y39A 3RPUD 3JAMK 4R7LA 1KA8A 1G3YA 4QPQA 5M5XJ 1R9TJ 5FLXK 2A6TA 5HLIA 2ECBA 4OIPF 2NYXA 3BG5A 3HEFA 4ZN6A 2L7MP 3DKYA 3ZQ7A 5LHIA 3FXQA 2ISZA 2H6CA 4YELA 2D5VA 5D5XB 1SMTA 2CUEA 1ETVA 2F5DA 4UV8A 1TP4A 3NAUA 4AYBN 1Z3YA 3SZPA 4FHTA 4FX4A 4L18B 1S7AA 4XN3A 1ZG1A 2EH3A 4XRMA 4A3LJ 2GOXB 1ZYRF 1JKOC 2EV5A 2IS2A 3FIWA 4U0WA 4O6JA 2K9NA 1FIAA 4GGGA 2VLAA 1YLFA 4Y4RA 1L0OC 2MFZA 4QSHA 3ZRGA 2JD1A 1NK3P 2XRNA 5FKMA 3MD2A 3LSTA 2WPGA 4PFPA 4D7MA 3FMSA 2BXYA 5FFZA 4ANJA 3B2XA 5IYBJ 2LKPA 2DN0A 4B47A 3WTSC 1U5TB 3OV8A 4A5MA 1MBFA 4A3EJ 3PO2J 2QQBA 3V8JA 1IC8A 4XSXF 2P7CB 2DW4A 3OYAA 2OTJI 4U0YA 2ELHA 3FH8A 2CV1A 1O3SA 3CF2A 2VBYA 3H9QA 2NVUB 4ZYEA 1AHDP 2OZUA 1GXQA 4ZQFA 4ZTFA 5AONA 2ZJQF 2W82A 1OCPA 1F36A 3RPQA 4EJTA 1R1VA 3BT9A 1VQNI 1XDSA 1REPC 5C4JJ 5K5QA 4RS8A 3A01B 3CXBA 4CCKA 1MDMA 2LY9A 1R6RA 3K4JA 3QYBA 4HX7A 3JTGA 1UAAA 2XC7A 1Q0QA 2VASA 4RLFA 1K6OA 2B9SA 3ASNH 2PJRB 1R4MB 2WAQN 4HSRA 2VL8A 2B0LA 1VQ9I 2LK2A 2DFHA 1I3AA 2IP2A 3FXUA 3RKYA 1WRJA 1QZYA 4EATA 2W48A 1MSFC 4Q4IA 2A5YB 5FWQA 1DPRA 1FPQA 1RRJA 4RGSA 3UNGC 2V9PA 2X6OA 1YYVA 4M6VA 2ZFWA 3GTMJ 3DEEA 5EG0B 4D5CA 2NS0A 4A3BJ 2LBFA 4KIFA 3EYYA 5IY5H 1HCRA 1X4PA 2FXAA 4BS9A 1BM9A 3ELKA 1J75A 4E7KA 1DU6A 1M1EB 2KJBA 4OMZA 2HTSA 2FNPA 3EDPA 1JJ8C 3BZCA 3VVMA 5J4VA 2E60A 3K69A 4M73A 2GM4A 4FISA 1B4AA 5L3FA 3B73A 1OCRH 1E17A 1YFHA 2NNNA 5ICCA 1PP7U 2QCOA 2CQXA 1B72B 4HG2A 2EK5A 3ZQQA 2Z1DA 3H35A 2GXAA 4HX8A 3I5UA 3CTAA 5BS6A 3J80K 3CZ6A 1LDDA 3KIOA 1MBGA 3CC7I 3ZMDA 5IYDJ 4JYKA 2L01A 2HPMA 1I1GA 3BY6A 3CUQA 2DPUA 1X4OA 3FXKA 4UUTA 4I02A 4IHSA 4Y6RA 3Q9VA 5E79C 3S3OA 4C2MJ 4I0AA 1SC5A 2R3SA 2O8XA 1TW2A 4ZYGA 3HBLA 4A12A 2FMLA 2LG4A 4L0YB 2JVHA 3TP0A 3KEYA 2Z3YA 1YW9A 5C4XJ 3P7NA 1H9GA 4UXNA 3BCBA 4PJNA 2GIZA 1X2MA 3CJRB 5KNLA 3B7TA 2XDVA 1IUYA 2MA3A 2WZGA 2AQFA 3CLOA 1E0EA 4XLHA 2Q2EB 2VI6A 3WQSB 1B8IA 2XGXA 3F21A 2VBZA 3JSPA 2L2OA 1UZCA 3LFKA 4ZX5A 3X2QH 2JK3A 1TWCJ 2E1MC 3KEQA 1YS7A 3A0BC 1ZQ3P 3W2WA 2M7AA 5BPPA 1S72I 2V4JC 3FHZA 2DA2A 2X6YA 3J7AY 1TC3C 3IH2A 4ZQEA 5H20A 2HQAA 3K70C 4JOMA 1GXPA 1JGIA 1Z7UA 3J81Z 1K5HA 3Q0WA 5IP9J 5D5UB 1LKXA 1GVJA 4R8HA 2VKDA 5D5WB 2KFDA 1X3WA 1BBYA 3K70D 4A0ZA 1MH3A 1K78B 2O5RA 1V3FA 1WJFA 1SD7A 1ZK8A 1PJRA 1R4NB 1VQ7I 1WWXA 5FJ8J 3G1OA 3G2BA 4L5EA 4KJZA 4D0PA 3CZGA 1GV5A 4YFKF 1ONOA 5M3FJ 2JV7A 3RIRA 1ZG5A 4DYRA 1OKRA 2HU9A 4XLEA 4G8XA 4E6KG 5ERIA 3GFJA 1IRFA 1Y8QB 5F64A 2UZKA 4Q4ZF 5JMPA 5D8LB 4IHVA 4AICA 2R92J 4RLQA 2ZCWA 2OV7A 3OS1A 1V5GA 2EIJH 2VXDA 3MZHA 1CF7B 1VQLI 4PVBA 4AR9A 3H3ZA 1Z6RA 2R5YA 3ZPLA 2ZC2A 2E1OA 5ED4A 4NC6A 1XTAA 1ONNA 4XM3A 1X3ZA 5KK1A 1IO2A 4Y3OA 1YO5C 3KZZA 1LUJB 3W2VA 1YJ9I 1IJWC 1S46A 4G9YA 1VQ4I 2G7HA 2HFHA 3ONQA 1LJ9A 2YR2A 3M1EA 3HOYJ 4LMYA 3HHHA 3D1NI 1PYVA 3OL3A 2JA2A 1R1TA 2FBIA 4MTEA 3MKZA 4U7DA 1Z7LA 2NVQJ 4XLFA 4HF2A 5HLGA 3HTSB 1W7PB 2CV2A 2DQ6A 3WTYC 3FTZA 2PG4A 2AS5F 5HS8A 2O7OA 3HL2A 2K86A 3M8JA 3GW2A 1U78A 2JSPA 3LSKA 1B1BA 3R60A 3VODA 3J7AO 2ZXHA 4RGUA 4I7HA 1KYZA 2LNBA 3NQOA 5IPAA 2NVYJ 3S3NA 3CJTB 4KIGA 2PI0A 5B1AH 4GXOA 3KP5A 3G1MA 4XN0A 3DLAA 1MMSA 2ZJ2A 1H9TA 4KITB 2QBYA 1MNDA 3WGIA 1DQUA 1FMWA 4BEHA 1UMQA 1VTNC 1Q1HA 1FBSA 1B9NA 5B3SH 2KDZA 1ZR2A 2ETHA 1A6QA 1ZGAA 3VYUB 3E3VA 2EZLA 4DGWB 4IQ4A 3WTWC 2HS5A 5DV5A 4EMSA 1MMDA 2HYFA 2LTPA 4DQ2A 1BW5A 3EUKL 3OYDA 1J5YA 3E97A 1LFBA 1WJ5A 1R36A 4Y17A 4AUXA 4EJUA 5CVIA 1UG2A 4PCQA 4YIRX 2EB7A 3LMMA 1FYMA 2A69F 3AG3H 2ACJA 3F8BA 1C0WA 3HPHA 2B61A 1BI1A 4F3QA 4OU0A 1ZH5A 3Q5FA 3OYMA 3DWLE 1MBEA 3WGHA 2X4HA 3CHPA 4XKBA 2XF5A 4BQNA 2O6GE 1OYYA 2L9RA 4E70A 2OQGA 1TL8A 3TP3A 5CVRA 1EKEA 2CW0F 4HV5A 2P5VA 2QQ9A 3OYEA 3CMAI 4HOBA 1IN8A 3LSRA 3QOEA 3SDGA 1P6RA 2KZVA 4PGHA 4ARFA 4V19K 1IXRC 4NC7A 2MH2A 3SQNA 2Y1DA 1D3YA 2LF8A 4II2A 3UERA 2PLYA 3DQVC 3FF5A 3IAS2 3FU6A 1EV7A 4NUBA 1LE8B 4G6TB 2I8DA 1NG6A 4Q48A 1ZKGA 5LEKA 1EJ9A 1IXCA 4L5JA 1X1PA 3ABLH 2Z33A 1IXSB 3ZR8X 4BQQA 4FETA 3A03A 2HI3A 2MH9A 2P6TA 2PEXA 3BR1A 3DLLF 2CJJA 1MW0A 3Q44A 4BYYA 3K4BA 4LFUA 3RYPA 3I56I 2CV0A 2ESNA 3F8FA 2JCXA 4B8XA 5GTIC 2RQPA 3K4LA 3IKVA 1XG1A 3CCMI 3HDDA 3G1LA 3DBRB 1O7LA 4PJLA 3ZQFA 3JRFA 3BR2A 1G2HA 3CIAA 2FQ4A 3DPTA 3E5XA 3OY9A 1K61A 3A14A 2DJIA 3TQNA 3RTRA 3H3VK 1MJBA 4YEJA 2RJIA 3TW7A 5DDGA 2QJ1A 2ADUA 1MBHA 3ANMA 2K40A 3M9AA 4XO5A 3E5QA 2D2WA 4R5TA 4GYGA 4XKVA 1XMKA 2STTA 1VNDA 4L9TA 4RM3A 2EGHA 1OQYA 1YW7A 5LEJA 1JGSA 2BE5F 4FLQA 1JE8A 4A6DA 2DA6A 3WQQA 3PNVA 3C2GA 4M3GA 5HS7A 5CVVA 3GBGA 2ID6A 3FXMA 3ASOH 3VPRA 2ICWG 3ZOBA 2ZJRF 2HPOA 4Z2YA 1GDTA 1T6SA 3FXLA 5E8GA 1R22A 3ZMVA 3VDXA 1B9MA 1VQ6I 1D1AA 3TOAA 5EEAA 4UUSB 2R5ZB 4LG0B 3ZCOA 2EA4A 1VQOI 1D8JA 4N4NB 2AO9A 2DQRA 1QPIA 3QJXA 2KIQA 2XPWA 5DUKA 1B6AA 4BY1J 2E7WA 2O3FA 2OCCH 4M3DA 1MGTA 1T08B 1G8XA 3LSJA 3KPHA 2VOOA 2IGKA 4XMWA 3OYJA 2VC0A 2XSJC 4NDLA 4WXHA 4OAZA 4XMZA 4XONA 2WV1A 3BZ6A 3JCUC 2M4KA 5E1ZB 1GW6A 2IJLA 4KT5C 2X6XA 1SFOJ 4ASNA 5HODA 1IGNA 1HDDC 4HZFA 3BROA 3OYLA 1HOMA 5HDNA 1NH3A 3M7GA 3SYTA 4CCLA 1ZGJA 2E7XA 5KVRA 2MBFA 1RR7A 3HPGA 4M6XA 4KUMA 4HAMA 4M71A 3ML6A 3HRUA 3TO9A 3PIPF 3B3BA 2DMUA 3BCAA 1XMXA 3F22A 2M4GA 4JX4A 2QA4I 1YQAA 2IAIA 2ZO4A 3GF2A 3AG4H 5JLXA 5EGOB 1YRNB 3I4MJ 4A3FJ 2EZIA 2Y9ZA 2ISYA 4K5NA 1FEXA 5M5YJ 3PSFA 4MLOA 2E1NA 3HJEA 2DCEA 4PJJA 1TBXA 4A3IJ 1ZRDA 5DCFA 4I2OA 4CHUA 4FX0A 3ZHZA 4A0XA 3A2KA 3DKXA 2DBBA 3ROUA 5K7ZA 4KIBA 1OFCX 3DCFA 3R0IA 5HNHA 2M45A 3BG3A 3CZKA 2OQRA 4EV0A 4DZJA 4BE1A 1DPUA 4HDUA 1PDNC 3CQZJ 2FNAA 3ULQB 4Y13A 3IP4B 2QWWA 3HW2A 3BR6A 1YS6A 4XNAA 5IT9K 4LG3A 2M0CA 5TJJA 1YG2A 4GAAA 1R71A 2IW5A 3AL0C 2KRFA 4F92B 3PL8A 1IRZA 1QQIA 1TT0A 2AQEA 3RYRA 3LA7A 1G3SA 2BHZA 1Z3XA 3TOBA 4LJZF 5ILUA 3KYLA 4IKFA 1MSEC 1BR2A 1TLHB 4RAGA 4A3KJ 5A2QK 1QHHD 3RI4A 2DTZA 1X1DA 2XHKA 4XLAA 5LBQA 3U21A 3HXLA 3WODF 3FH5A 3TO6A 4ENMA 3BG7A 3C2HA 3FWEA 3TDUC 5HVQC 1V5FA 2F5CA 4ZTJA 1D1BA 5F0CA 3FTUA 2BEOA 3LQRA 2XGEA 2R4GA 3KETA 4IZZA 1F5TA 3CC2I 4KNYA 2OU2A 2LREA 2E19A 2JWTA 3GZ5A 5FLMJ 1CGPA 3CD6I 3IWZA 1P4WA 2V1UA 4G6DA 4HYEA 3SDBA 2E2HJ 3I71A 5LGNA 1MW2A 4HF0A 2DA5A 2A5WA 1T8IA 1YE9A 2XF6A 4X6AJ 5DD4A 5EEGA 2EILH 4M9XA 1R00A 3KLNA 3JSZA 5ICEA 4MIMA 1WGXA 3GLXA 1S7OA 4UY8I 3ANLA 3I59B 1OCZH 3FMRA 3UCQA 2XQ0A 1UCRA 3W6KB 5DYMA 4HPQA 2JCVA 2VBWA 2IEKA 2OZ6A 5EEHA 2Y2ZA 1BC7C 3HGGA 3E7LA 5BNGA 1P4AA 3HIFA 3LWFA 4D9JA 1V4RA 2V1DA 3BOQA 2NRAC 4RGRA 4CCMA 3HM5A 1JT6A 4B44A 4Y33A 2QYOA 2MC4A 2XAUA 3BJOA 2XROA 2HOAA 5FRMA 2PL5A 5FO5A 1MNMC 2DO7A 3AFHA 4AD9A 3AL0B 3FUJA 4A69C 1LB2A 3I55I 4M9ZA 1ZN2A 1LFUP 5CJ9A 3ZMZA 2P5KA 1XCBA 4EQQA 2DOFA 2WY8Q 3M1CA 5K7FA 3VEPA 2FRHA 4QIRA 5E17F 2XAJA 1WHUA 2RKHA 4RCVA 2EZKA 2EZHA 4HLYA 2CO5A 4EGYA 1WCMJ 4PJMA 4WXDA 3QPLA 4JBAA 3IAM2 3QPHA 3DU5A 2KQRA 3PJRA 5CYVA 1RESA 4DNCA 1VZ0A 3KP3A 3CCUI 2L54A 2P7VB 5KCMA 2H09A 3PIOF 2KIUA 2DK8A 5LHGA 2R7OA 3OYFA 3H5NA 1WPKA 2CU7A 1WJDA 2DMTA 3KP7A 1ZRCA 2HOTA 2YUSA 1JUSA 4CUGA 1BJZA 1IV6A 4L2LA 2DA7A 2BY2A 4BE2A 2R7XA 1MVYA 1XSVA 3JT1A 2DU9A 4Q47A 3Q3SA 3WTUC 4LB5A 1RNLA 5FRNA 4JNDA 3HB9A 1FNNA 3S17J 2PN6A 1IRXA 3WTXC 2BXZA 2CRGA 1J0RA 5DTDA 1OCTC 4YFNF 4XN8A 4XICA 4I98B 4NC8A 4H4KC 1FOWA 2CUFA 3V42A 2HTJA 1QGPA 1VQ5I 3S1QJ 3OSFA 2L3DA 2ZKZA 3F8MA 2EFWA 2JZYA 2HWVA 2FF4A 1A31A 1K7AA 3M4OJ 2HXOA 4UVAA 2MD0A 4ZDLA 2EIKH 5LFAA 1R5GA 2M8GX 4M9SA 3FUNA 1KU9A 3NWSA 2E35A 4EJOA 3K6GA 3VYSB 3LNQA 3QU3A 1WZ2A 1ERDA 1I1SA 3T8VA 1WFXA 3KLOA 3TW6A 5IOZA 3EBHA 4K5MA 2L02A 1H88C 4XLNF 4OWRB 3SHFA 2O9LA 4XL9A 1OR7C 4L9JA 1ONPA 3CHRA 1RETA 4ZW8A 2VE8A 4I0BA 1UHMA 3JRCA 4AR8A 4XOTA 5GPAA 1USSA 2IBDA 2XB0X 2JQ7A 2I5UA 2LH9A 3HGYA 3TGNA 3RQ4A 2K3FA 2DFIA 4OINF 4B09A 3ABKH 2V7FA 1HDPA 5E3LA 3KP2A 2ID3A 1S7EA 4XK4A 4D7NA 2R7ZJ 1R23A 3CCLI 1QA6A 3F8NA 4J01A 2MLGA 1YIOA 2LYCA 4ITVA 3WE2A 3ZN0A 3OYKA 2W7NA 4MKTA 2Y1EA 3L2UA 1YJWI 1UFMA 1Z05A 2K9LA 3FULA 3CP2A 1TZLA 2MC3A 1BA5A 1I6XA 3MMYB 4I09A 2UXXA 3KZYA 3TL4X 1LDKB 2HKOA 2IRFG 1KU2A 1S29A 3WHCA 2FA5A 4UVBA 4G6QA 3FXOA 5CLSA 2K4BA 2DYRH 2X1DA 1KZHA 2QSGX 1MJ9A 3S1RJ 4FQGA 1Z1DA 3QP6A 4FE7A 1MNEA 5DCMB 4U7BA 4LLNA 2GA2A 2QENA 2R7SA 2DFFA 3H1CA 2ME6A 4S0HB 3FMQA 5C3EJ 2LC2A 1GT0C 2O61A 2Y31A 2PMZA 3CP8A 4ON0A 3S8PA 4QTRA 3QYEA 2C6YA 5GAEJ 3DTIA 1JGGA 3HKZA 1BR4A 1Z0XA 4M6YA 2JVGA 2QSFX 1RIOH 1TQMA 2EWNA 2M3AA 5E18F 4JQFA 1XMAA 2BYVE 1SVLA 4IX7A 2N8GA 4X1EA 3PFIA 2VC1A 4NBQA 4AWXB 1IAWA 3CCSI 3V8LA 1BOAA 5GP9A 3TBIA 4XMVA 3DXJF 1XC5A 2QUFA 2ZMEA 2NNYA 4ZQTA 4Y67A 3SXYA 2ZSIB 2BGCA 1NTCA 2BVMA 3OS2A 3DPUA 4KDPA 2KLOA 4LITA 1U9OA 1KU7A 2KRHA 1MW3A 1O4XA 1V55H 5F1JA 4MFEA 4XO4A 4XRSA 2EFQA 4QIWN 1IDYA 3VVLA 3HTUA 1WH5A 2VUMJ 3WTZA 3KEOA 1U8RA 2NOJB 1PUFA 1GV2A 2VXZA 4HNUA 1ETQA 2O8KA 3F9KA 3GXOA 2LFBA 4J19A 3AG1H 3SZTA 1TNTA 4G12A 4HEA2 3WHBA 3BPVA 4ENJA 4K2EA 2Y0SN 5FGMA 5GADJ 5E20A 4QPEA 2WADA 1SD6A 2AXTC 3OL4A 1XDUA 4R79A 1LE8A 2JA6J 2TCTA 4M72A 1KGSA 3GTLJ 2Z9OA 2YPRA 1WQ2A 1I5ZA 4JP0A 2IA2A 2HPTA 2WAFA 3E1SA 2HYJA 1W7PD 1O3RA 1I39A 4C3JJ 2MGQA 2KJCA 3IUOA 2DAOA 2UUZA 3V7CA 4H0EA 1Z77A 1SC7A 2H1KA 3PUFA 5D4SA 1X1BA 1XGNA 4CCOA 2LKXA 1KQ8A 2JA8J 3MN2A 4DYQA 3KE2A 3N97A 1JG9A 1A6IA 1FYLA 3I4PA 4BXUA 2K85A 4F91B 1GUUA 4I76A 2CSOA 4UHTA 3FUFA 5JC1A 1T95A 3EUAA 1TWHJ 1OLTA 5IYCJ 2EV6A 2MLKA 3BWGA 3OOPA 2GQQA 4EJVA 2D1HA 1P9QC 2JN6A 2NS7A 3U9GA 1B59A 3P9CA 2V1NA 1Y0UA 3EUHC 4HW0A 2FUG2 3FTSA 5EV7A 2DFEA 3E5UA 1OPCA 4U0VA 4FLSA 4UVCA 1RKWA 4B1RA 5JNLA 1FIPA 3J7YJ 1ZHFA 5GPCA 2H8RA 4UB8C 3D5LA 1K79A 3L2VA 1LPQA 3CESA 3IH3A 4HSTA 4F7ZA 1F4KA 2L4AA 1AU7A 4LIVA 3J80Z 3H3UA 5TGTA 2X9DA 4AU7A 3FTYA 3OR2C 3ABTA 2RVCA 1XGOA 4ESFA 3L9FA 4WF2A 4QHPA 2KT0A 3LOCA 3IH4A 4M3BA 5C44J 2XPYA 2EQRA 2AXLA 2F4MB 5KHDA 3EYIA 3WU0A 5FD6A 3S15J 1TTYA 3LFUA 3JRHA 3EBIA 4MNUA 2WB1A 4A0YA 5LHHA 1U8BA 4RSYA 4KN7X 5FB2A 4XO3A 5LGTA 2EJRA 3BPXA 1FTTA 3IWFA 3HOUJ 4ZX6A 4RAFA 1IN7A 3O3KA 3HUGA 3E6BA 5EDNA 1MDMB 1BL0A 1R0LA 4S05A 2R7RA 4AIHA 3Q9SA 5J8FA 4PFOA 4F55A 3F23A 2VOPA 1X3UA 2WTEA 4DIQA 4AC0A 2VQGA 3FDYA 5E1XA 4ZYDA 2VKHA 1VQ8I 4DZPA 1J59A 3FXJA 3CMYA 4IVNA 4MEXF 2FBHA 2PFBA 1XPXA 1SMYF 3K0LA 4ZQGA 2CG4A 1FP2A 3WQRA 1D1CA 1D0ZA 2QQAA 1MMAA 2D1VA 2JD0A 2K5CA 4BBRJ 3ERED 3HOWJ 2IS6A 3JREA 1D0XA 1IRGA 4I99C 4NNJA 3CDLA 3I64A 1YRNA 1I27A 4IHWA 2LBFB 4IHTA 1GHCA 2LLKA 4OOIA 4XRFA 1G3TA 2ZFUA 2WWYA 3KP4A 2YSRA 3OIOA 3KP6A 5IP7J 2LD5A 3OYBA 1IN5A 4PW4A 3BQYA 3PQJA 4B4CA 1JKPC 4IQJA 4HNVA 1XX5A 3C7JA 1PP8F 1NK2P 2XV4S 4OIRF 3ANNA 2QLZA 5LRSA 1J7KA 2M8EA 2NVXJ 1JKRC 2CWEA 4P5OA 4XMXA 2FFLA 1A04A 2CQQA 2QKMB 3BTJA 3O8HA 1ZTRA 4BL0B 4AIDA 1WI9A 2DI3A 4XN7A 3F72A 1QBJA 3HC7A 1O3TA 2R7VA 3RQIA 3HSEA 1KQ9A 5ILSA 3TKYA 3MAJA 2A05A 2BY3A 3QPTA 4D1QA 1XB4A 2RNGA 1O57A 2OF7A 4C2UA 1HKTA 3CUQB 4BNCA 2IA0A 4N9IA 3PFYA 4WWCA 1AOYA 3CMMA 2Q1ZB 5HLHA 2R7FA 2IA1A 3KYDB 2ZJPF 3I4NJ 4P9FA 3B34A 3R0AA 1G59A 1TWGJ 2M0MA 2UV1A 4EM1A 1J09A 2CQ7A 2LVSA 3CHOA 2VPRA 2XPUA 2R7DA 2JSCA 4A5NA 3F8CA 2L0KA 3DEUA 4QLCU 2DTRA 4B48A 4ZDPA 2VT3A 3HSFA 1RP3A 2V26A 1RI7A 1V54H 2HDWA 3FU0A 2XVCA 4F93B 3WG7H 4YRVA 1WJCA 1AKHA 2WAQA 2BY1A 1EF4A 2E2IJ 2XGDA 4TV7A 1ZRFA 1B8IB 4CCNA 1IG7A 4IJAA 2VBXA 2L9NA 1FSHA 4RB1A 3FBNB 3U1DA 5JLWA 1H19A 4XN9A 1WSUA 2O7GA 1BIBA 4KA4A 4LLLA 2Z99A 3BP8A 3P5JA 2YU3A 1U2WA 2QF7A 3G71I 3TEDA 2BV6A 3K9TA 3B6AA 3I59A 3LSMA 3O6BB 4XIDA 4GYIA 1H89C 1T1RA 5JBIA 2EV0A 1F1ZA 1W1WE 5CKTA 3IRRA 3CF5F 1HW2A 3CCJI 2L9SA 3SZGA 1X3WB 2B7EA 2ZXJA 1LFPA 1T98A 3GMEA 5HS9A 1R58A 4E4HA 1FY7A 1HLVA 1Z21A 2E5NA 1P2FA 2ZBKA 4IF4A 3O8GA 4LIUA 2Y69H 2KPMA 4W97A 3JRGA 3AG2H 3ISPA 4ZZLA 5L3GA 4BQOA 1R1UA 4ZZDA 3BR3A 2C82A 2STWA 2CH0A 1W5SA 1VQKI 2JUCA 1ZLKA 2RAEA 2BW3A 2VQHA 3QYFA 2NVTJ 1X58A 1HS6A 1S9HA 2ECCA 3M07A 3TDZC 3CDHA 2W57A 2LRDA 2FQ3A 1UELB 2CW7A 3FU5A 2HEOA 4ENKA 1LVAA 1XCVA 4XNFA 2R5YB 3R6SA 5JVTA 1X3ZB 5HLTA 3S32A 3RKWA 2MYSA 2EBIA 1WI3A 4PZJA 2X1CA 1TWAJ 4ZW7A 1STZA 5H6RA 3OR1C 1WJAA 4BACA 2R70A 2F48A 4XN1A 1Y0NA 2ZXGA 5GTHC 2NS8A 3FUKA 1ZELA 2VJJA 3QU6A 4XQFA 2A7OA 4K5PA 2JT1A 2LDUA 2V79A 3LL7A 3DTEA 2HZDA 1WH7A 3WU2C 1W5CC 4X0GA 1FYKA 5CQEA 2BY0A 2VB6A 1XSXA 3S2WA 1UG0A 2CQNA 5J8CA 2VE9A 4Y15A 5DM7F 1HSTA 4O3MA 1S3JA 4HDVA 4GRIA 2R7QA 1W0TA 4CZCA 5JR3A 4KFCA 2M1BA 1USTA 3HKZN 3DBHB 4LLGF 3LSHA 4C3HJ 3B02A 2COMA 5F0FA 1JXSA 1T0FA 4DYCA 2R7WA 2UWMA 1GLNA 1U5TA 2H8WA 2K9QA 3CZEA 3F3XA 2OC6A 1T38A 2NXNB 3VWBA 3GTQJ 2QBYB 2VPLA 4BH9A 2EFNA 4JX6A 1I3QJ 5L3CA 3HRTA 4BEHB 1JT0A 3UEQA 1FJLA 4UNOA 5D8KB 3VYTB 5E8IA 4E7ZA 3LAPA 1VI0A 2V9KA 4E7HA 1MKMA 2WAEA 2LMDA 2GWRA 2DDAA 3REOA 4A3JJ 3K1NA 3RPUA 6PAXA 3GUDA 3B7SA 1FSEA 4BAYA 2LKSA 3A01A 2Y1FA 3K1PA 3W6JB 3V7SA 1HBXG 1JHHA 4LOCA 4RAYA 3L09A 4G7HF 2A6HF 3ZQGA 1GVDA 2LR8A 5D4RA 1FT9A 2PJRA 2XPZA 3HOZJ 4OOEA 2KDOA 1SFKA 1RUOA 4LK1F 3IRQA 3MKWB 4CZZA 1VQMI 5J1UA 3HHGA 4NB5A 3MZ8A 5F08A 3IKTA 3BQZA 2E34A 2KISA 4K5OA 3J7ZI 4ZH4F 5EG0A 1KQ0A 4KICA 2OA4A 2F2EA 4B43A 4BXXJ 1H0MA 3FTXA 2GXGA 1IZ1A 2K9SA 5DULA 3C2BA 2XIGA 3F0CA 3F6OA 4PGGA 1OCCH 3FU3A 4A3CJ 4C30A 1IUFA 9ANTA 2QEXI 4F52A 2FOKA 1O3QA 3E6DA 3HZJA 3K7AJ 3EBGA 2RDPA 2XGCA 3T8TA 3ZQIA 4WK8F 1WJEA 3T1BA 3QP5A 5DEQA 4BDZA 2OPTA 1RR8C 4IL6C 4IHXA 3BZKA 2XASA 3FX3A 5JMWA 4MQVA 3IL2A 1LNWA 1E3HA 5D6EA 1B72A 3RCOA 5LD2C 1FLIA 2GBYA 3U2RA 3HOXJ 5DLLA 2GAUA 3BTLA 1OYIA 1YIJI 4BJ5C 2FSWA 5FKKA 4PSXA 5AIPA 2K02A 1SQMA 4DW6A 3PQKA 3L2CA 4IOAF 2KKOA 1K4SA 4M74A 1SANA 2A6EF 1FOXA 2L5QA 1OR7A 3QRFF 5L3EA 5JVGF 2WA0A 1K6YA 1H8AC 3ABMH 4YFXF 1T33A 2HNHA 5CVUA 2XSDC 2YX7A 1FZPB 1FOKA 3GTOJ 4N4OB 3AU8A 1ODDA 3P9KA 4OOFA 4FCAA 3RZDJ 4FLOA 1BC8C 3GFMA 3WE3A 1YX3A 2Q2EA 3COAC 2DA4A 3K2AA 3GVAA 2ELJA 4OAYA 1ITYA 3L2RA 4BUPA 3FK6A 3WTVC 4ESJA 3HOSA 4A03A 4I01A 5ICGA 5IT9Z 1SEUA 2WB1N 5CPRB 2B63J 3V8KA 2R72A 5J6XA 4CO8A 1LVKA 3GTKJ 4RA2A 1LEBA 4WCGA 1ON1A 2L7ZA 2QZ8A 3ZQCA 1N75A 3VSLA 2OCEA 1WVRA 4A3MJ 1APLC 2Y30A 1ACIA 1K78A 5A2QZ 4GCVA 3CCYA 1MIJA 1BJAA 1XD7A 1HW1A 4P9UA 2XB5A 4MS6A 5EZGA 1R49A 1JI8A 2IVMA 2V9VA 3ZMTA 1R7JA 2X85A 1QO0D 3VB2A 4B3AA 3OYNA 2UXNA 2DK5A 3RJPA 4ESBA 4NHJA 2OUMA 3ZGKA 4R5VA 1XSDA 1EA3A 5GAGJ 1JHFA 3HRMA 1BN5A 1ZG3A 2DA3A 2Z2SB 4IPAA 2QKLB 1MZBA 2Z5UA 2GIVA 2Y1CA 2J5PA 2FEZA 4XNDA 1JUMA 1CF7A 2X51A 2DA1A 4GFBA 1E3OC 2DXIA 3OIQA 1MW1A 2JRMA 2JUGA 2Y0MA 2GA1A 2M30A 3A1YA 5BOXA 2NAZA 5BPIA 3GTJJ 2CYYA 3S93A 1ENHA 3Q0UA 2H94A 4CYCB 2GTQA 2HXIA 4YG2F 4I6ZA 4AIJA 3GEZA 1OCOH 1AA7A 3MWMA 5CQGA 1ZARA 4KISA 4ZYHA 2O0YA 3HOVJ 2XAHA 3FBIB 3K2ZA 3A4CA 2IPQX 5K7HA 3OSGA 4KMUX 3BG6A 5BPDA 2L4MA 1P7IA 2K27A 2HOEA 2ZNZA 1Y1VJ 3MVPA 4ZW3A 3HYIA 5TISC 1W7PA 5K5RA 4D5FA 4ZQHA 4DBQA 2BBYA 3RSNA 2WC2A 4BKXA 2Y75A 3ZXSA 3G6EI 3QAHA 1Y6IA 4IRIA 3RDIA 2X1EA 1RUNA 1SFEA 4HF1A 2QM3A 5DM6F 3RC3A 5FROA 2W00A 3ZI0A 2X0LA 3J81K 4MEYF 2MAOA 2DT5A 5EYRA 4Q4EA 1YX5A 3IV5A 1ZGWA 3B2PA 3AU9A 4WXCA 3F6VA 3ZMUA 2FJ1A 1SFXA 3Q0VA 5AIQA 5LGUA 1DGRM 3JAMZ 1MW7A 4PUSA 4XLCA 3OYCA 4XN4A 3HSRA 4DBRA 3E6MA 3RASA 5FLXZ 3BJAA 5KAIC 1BR1A 1UJ8A 3ZN1A 3GFLA 1HF0A 1QZEA 2FE3A 1KYWA 1P7JA 1T56A 2LY1A 3FM3A 1RKTA 2RREA 3K4NA 4RGXA 3LA3A 3BLYA 2I10A 2CQKA 4V2FA 2G7UA 3H9GA 2GLOA 5H2FC 1OMIA 3LSGA 4YIIA 2KL4A 3T5XA 1NG7A 1G5AA 3AUAA 3DTKA 2KRCA 2KZGA 1SAXA 2FU4A 2M7BA 3L7WA 3EUHA 4IRHA 2KMUA 4MGRA 3GTPJ 2K9MA 2VKEA 5EJCA 1UHSA 3HOTA 5DD8A 2R0QC 4R1HA 2VODA 3SJMA 5E1WA 3FTVA 5J3LA 5FKLA 2R7UA 5K5OA 2EA2A 1MJAA 1FC3A 2DPDA 2G9WA 3CHSA 2F4IA 2M2EA 1HSJA 1POGA 2CFXA 2IGOA 2RNJA 3CO6C 3GZ6A 2R59A 4NQWB 4MO7A 1IF1A 2EIMH 3L00A 4EM0B 1A5JA 2MW8A 1YOVB 1Z67A 2KIMA 5J40A 1ZREA 3H0GJ 2F4OB 1Q0HA 3OIPA 1XN7A 3PUUA 2ZXIA 1FWZA 3VFZA 5JHFA 4RB3C 4V2GA 3UKGA 5TRDA 2K7LA 3MQ0A 4J00A 4L0ZB 4L5IA 1ETXA 3CMEI 4LK0F 1IDZA 1Q0LA 3A02A 3FUIA 3FH7A 1QRYA 2DJNA 3FKIJ 2Z16A 1Z6TA 4Z6YA 1BIAA 3EQLF 1Y8RB 2ZXWH 2PJPA 2HQ5A 2IS4A 2XKOA 3R0JA 2VIXA 1A35A 3T8RA 1HXDA 2OJED 5EZHA 3RKXA 2A07F 2DMQA 3H5RA 3LQQA 5J47A 1SD4A 3GZNB 1EH6A 1DUXC 1J2XA 4XOPA 3QODA 1YW8A 3A06A 2KP6A 1LDJA 2IT0A 1T2KA 2W84A 3JTHA 2JA5J 4AM3A 1QPMA 3FUDA 3IIEA 1A36A 1R0KA 1KONA 4J3BA 2KIFA 4BDYA 1F9NA 3ECOA 1YJNI 3ZQLA 1JTYA 3G73A 2K3PA 1SVOA 2A68F 2VN2A 2ZB9A 3ERMA 1JVSA 3C18A 3FUEA 2K4JA 2TDXA 1N78A 3DV8A 2OBPA 4XKWA 2COBA 2PX9A 2AHQA 1S6LA 5BQTA 3BR5A 4FTHA 3DU6A 1JJ6C 1HA8A 3CZLA 1RPWA 3U9WA 3OMYA 1HC8A 3W2AA 3G4SI 4XBFA 2CGPA 2WZFA 1TT5B 4EEFG 2TRTA 3ZQHA 2PGGA 4K5LA 5J1YA 1HQCA 2PMUA 1SFUA 3H92A 3M8EA 2VQLA 3EPZA 1VFCA 1UB9A 1E3PA 3ZMSA 2VKVA 3V7RA 2IGNA 2V6CA 3CJNA 2BZTA 3MFKA 3S14J 5F6FA 3L1PA 2X6WA 4ZDOA 4PDKA 4IO9F 3FK7A 3OYGA 3WU1B 2R5ZA 4LG0A 4MHGA 3SEZA 5J4YA 4UUSA 1TNSA 2YS9A 1MD0A 2KHMA 2R93J 2QVWA 5HDGA 1DU0A 5L3DA 3D5SC 3G3ZA 4AVPA 2ZMEC 3CUQC 2MD5A 4XSZF 4PK4A 5B1BH 2YX4A 4P55A 1EH7A 3N05A 1G3WA 2ME0A 3CCRI 5FD5A 1TW3A 1E2XA 1JKQC 2XPVA 3DKWA 4FT8A 4FLRA 2PUSA 4KT6A 2MAPA 4FASD 3DBLB 3GYHX 2HZTA 3OWTA 2HR3A 3SFZA 1R5HA 2E1CA 1SD5A 3DFGA 2E1MB 4IHYA 4O5VA 5DUIA 3UR3C 3MCZA 3PUBA 2PBIA 3FXRA 2XF7A 3CCEI 1UHWA 3K1MA 4UV9A 2CUJA 2DQMA 2OD5A 3O2PE 4PSWA 1WKMA 4XR6A 1KU3A 2FD5A 2Q0OA 2RQQA 3MKLA 5ILVA 3LA2A 1W0UA 4XN2A 4P1WA 4XKCA 3FHEA 4AYBA 1OJLA 4DOZA 5EGOA 5B5EC 2JPBA 4CSWA 2XAGA 3U1KA
chains in the Genus database with same CATH topology
3ZHYA 5JI6A 3NEUA 3FM5A 5JFRA 2P4WA 4ZW5A 4KP7A 4CDGA 4S04A 5H6QA 3FUMA 1IN6A 3BJ6A 4KYWA 1FX7A 4HBLA 2M5WA 2ZMEB 2RV8A 4BQAA 4GAEA 3E6CC 4A6EA 1EH8A 2PQ8A 4ZX3A 4XMTA 1BI3A 2XUBA 4OMYA 1W4MA 4HV6A 1PUEE 2LSOA 3WTTC 4HA8A 1T39A 3MEXA 4OIOF 5JO0A 4YIFA 2XAQA 2Q8KA 2XAFA 3GWZA 1Z91A 2J5OA 1SG7A 3R61A 3KCCA 3I0TA 4XLPF 1H3LA 5D5VB 5K1YA 4AR1A 3GX4X 2PMHA 4LD5A 5IT3A 2Y1GA 3B7UX 2HGCA 4G7ZF 4MTDA 4N9HA 3ZHXA 4L9NA 5CVJA 5BMZA 4EM2A 3HRSA 3WG9A 2W24A 4BHPA 2F5FA 1HW5A 1DDNA 4BHCA 4PU2A 4ZW6A 3I53A 4WX9A 4HQEA 2JCYA 4CICA 2Y48A 5F1RA 3IHUA 1YTYA 2WV0A 4N0BA 2XKPA 4MQ9F 1LQ1A 1HKQA 1FBUA 4HX4A 4GO1A 1W5TA 1D8KA 3QOPA 2A61A 3V4GA 2DLLA 4QMEA 2OAZA 3FZVA 3D0SA 1S8NA 4G7OF 3ZP5A 3CHQA 3B37A 2A3SA 1P4XA 4EVIA 4RB2C 3JSOA 2HQRA 5HNFA 3RC8A 2LF7A 5L3BA 3CUOA 1P92A 4BHBA 4DPRA 2ESHA 3AAFA 2QVOA 2H6BA 4P96A 1ZS2A 1L3LA 4R5XA 4RAZA 1FP1D 3LAJA 4KMFA 1QZZA 1FBQA 1AWCA 5ICFA 1D5VA 2P5LC 3EETA 4JK1X 1ZAOA 2O03A 1XGSA 1G4DA 2W25A 2W85A 5LRRA 3R4KA 4HQMA 4CXFA 1NHAA 3P9IA 4EJWA 2VJ8A 1LEAA 3GFIA 5JHUA 1QNTA 2C5ZA 3WGGA 1RZ4A 2F5EA 2EFPA 4CYDA 4LGWA 4XMUA 1J9IA 3MZYA 4L9VA 3FUHA 3BDDA 4HLXA 3B7RL 2GZWA 3ECHA 2D45A 2DQLA 3DPLC 4ETSA 1IN4A 2H27A 3KEDA 1O7FA 4KN4X 3M8FA 4AIKA 4ZX4A 4ENNA 4LUPA 4IXAA 1HKSA 1ULYA 2JTVA 5DCMA 1IW7F 2M87A 2VT2A 3N4MA 2ZNYA 4XNBA 4Q5SF 3T0YA 4G94A 1Z9CA 2V1XA 3CO7C 4XN5A 1TQPA 3I58A 3IC7A 1T1SA 3JW4A 4CGZA 2RC4A 4IRGA 2EFOA 3TO7A 2JPCA 2JRTA 1BI2A 3I54A 5AENA 2HQNA 5LLQA 1U6GA 3FTWA 3C1DA 3ABUA 2HYGD 5JAZA 3KFWX 3DF8A 5HDKA 5FFXA 1ONVA 2HKXA 3NRVA 4NQWA 1TQIA 1ZLJA 5D6FA 3VOEA 2RGVA 3Q43A 2P6SA 1U5TC 1G6NA 2RN7A 3C3WA 4X2UA 1DP7P 4UUVA 5HOOA 3DP7A 4RB0A 2VONA 4A2UA 2HDCA 4QUOA 1U3EM 4LB6B 5DYFA 4Y6SA 4OIQF 2FBKA 1ON2A 1XGMA 2GXBA 1BI0A 2P8TA 4AYSA 4U88A 4Y6PA 1OYWA 4EGZA 4RVBA 2FMYA 2JD2A 3GO5A 4QWQA 3JAMK 4R7LA 1KA8A 1G3YA 5FLXK 5HLIA 4OIPF 2NYXA 4ZN6A 3ZQ7A 5LHIA 3FXQA 2ISZA 2H6CA 5D5XB 1SMTA 2F5DA 4UV8A 3SZPA 4FHTA 4FX4A 4L18B 1S7AA 1ZG1A 1ZYRF 2EV5A 4U0WA 4O6JA 4GGGA 2VLAA 1YLFA 1L0OC 2JD1A 2XRNA 2WPGA 3LSTA 3FMSA 5FFZA 3B2XA 2LKPA 3WTSC 1U5TB 3OV8A 4A5MA 2QQBA 3V8JA 4XSXF 2P7CB 2DW4A 4U0YA 2ELHA 3FH8A 1O3SA 2VBYA 4ZYEA 2OZUA 1GXQA 4ZQFA 5AONA 3RPQA 4EJTA 1R1VA 1XDSA 1REPC 5K5QA 4RS8A 1MDMA 4HX7A 3JTGA 1Q0QA 1K6OA 2B0LA 2IP2A 3FXUA 3RKYA 1WRJA 1QZYA 4Q4IA 2A5YB 5FWQA 1DPRA 1FPQA 4RGSA 1YYVA 2ZFWA 2NS0A 4KIFA 3EYYA 2FXAA 1BM9A 3ELKA 1J75A 2KJBA 4OMZA 2HTSA 2FNPA 3EDPA 3VVMA 3K69A 4M73A 1B4AA 5L3FA 3B73A 1E17A 1YFHA 2NNNA 5ICCA 1PP7U 2EK5A 4HX8A 3I5UA 3CTAA 5BS6A 3J80K 1LDDA 3ZMDA 2L01A 2DPUA 1I1GA 3BY6A 3CUQA 4IHSA 4I02A 4Y6RA 3Q9VA 4I0AA 1SC5A 2R3SA 2O8XA 1TW2A 4ZYGA 4A12A 2FMLA 4L0YB 2Z3YA 1YW9A 3P7NA 1H9GA 4UXNA 3B7TA 1IUYA 2MA3A 2WZGA 3CLOA 3WQSB 2XGXA 3F21A 2VBZA 3JSPA 3LFKA 4ZX5A 3KEQA 1YS7A 5BPPA 3FHZA 4ZQEA 5H20A 1GXPA 1JGIA 1Z7UA 3J81Z 1K5HA 5D5UB 4R8HA 1GVJA 5D5WB 1X3WA 1BBYA 4A0ZA 1K78B 1V3FA 1SD7A 1WWXA 4D0PA 3CZGA 4YFKF 1ONOA 2JV7A 3RIRA 1ZG5A 1OKRA 4G8XA 5ERIA 3GFJA 1IRFA 5F64A 2UZKA 4Q4ZF 5JMPA 5D8LB 4AICA 2ZCWA 3MZHA 1CF7B 4PVBA 4AR9A 3H3ZA 1Z6RA 3ZPLA 5ED4A 1ONNA 1X3ZA 5KK1A 1YO5C 3KZZA 1S46A 4G9YA 2G7HA 2HFHA 1LJ9A 2YR2A 3M1EA 4LMYA 3HHHA 1R1TA 2FBIA 4MTEA 4U7DA 4HF2A 5HLGA 3HTSB 1W7PB 2DQ6A 3FTZA 3WTYC 2PG4A 2AS5F 5HS8A 2K86A 3GW2A 1U78A 1B1BA 3R60A 3VODA 3J7AO 4RGUA 4I7HA 1KYZA 2LNBA 3NQOA 4KIGA 2PI0A 4GXOA 3KP5A 2ZJ2A 1H9TA 2QBYA 3WGIA 1VTNC 1Q1HA 1FBSA 1B9NA 2ETHA 1ZGAA 3E3VA 3WTWC 2HS5A 5DV5A 4EMSA 2HYFA 4DQ2A 1J5YA 3E97A 1R36A 4Y17A 4EJUA 5CVIA 4PCQA 1FYMA 2EB7A 2A69F 2ACJA 3F8BA 1C0WA 2B61A 1BI1A 4OU0A 1ZH5A 3Q5FA 3WGHA 2X4HA 3CHPA 2O6GE 1OYYA 4E70A 2OQGA 5CVRA 2CW0F 4HV5A 2P5VA 2QQ9A 4HOBA 1IN8A 1P6RA 4PGHA 4ARFA 1IXRC 3SQNA 2MH2A 2Y1DA 1D3YA 2LF8A 3UERA 2PLYA 3DQVC 3FF5A 3FU6A 1EV7A 4Q48A 5LEKA 1IXCA 4L5JA 2Z33A 1IXSB 2MH9A 2P6TA 2PEXA 1MW0A 3Q44A 4BYYA 4LFUA 3RYPA 2ESNA 3F8FA 2JCXA 4B8XA 2RQPA 3IKVA 1O7LA 3CIAA 3DPTA 3E5XA 3A14A 3TQNA 3RTRA 1MJBA 2RJIA 5DDGA 2QJ1A 2ADUA 3ANMA 3M9AA 4XO5A 3E5QA 2D2WA 4R5TA 4GYGA 1XMKA 2STTA 4L9TA 2EGHA 1YW7A 5LEJA 1JGSA 2BE5F 4FLQA 1JE8A 4A6DA 3WQQA 5HS7A 5CVVA 2HPOA 4Z2YA 1T6SA 5E8GA 1R22A 3ZMVA 1B9MA 3TOAA 4LG0B 2EA4A 1D8JA 2DQRA 3QJXA 5DUKA 1B6AA 2E7WA 2O3FA 1MGTA 2VOOA 4XMWA 2VC0A 4WXHA 4XMZA 3BZ6A 1GW6A 5E1ZB 2IJLA 4KT5C 4ASNA 4HZFA 3BROA 5HDNA 3M7GA 1ZGJA 2E7XA 5KVRA 2MBFA 4M6XA 4KUMA 4HAMA 4M71A 3ML6A 3HRUA 3TO9A 3B3BA 3F22A 1YQAA 2ZO4A 3GF2A 2ISYA 4K5NA 2E1NA 1TBXA 1ZRDA 5DCFA 4I2OA 4CHUA 4FX0A 3ZHZA 4A0XA 2DBBA 3ROUA 4KIBA 3R0IA 5HNHA 2M45A 3CZKA 2OQRA 4EV0A 1DPUA 4HDUA 1PDNC 3ULQB 2FNAA 4Y13A 2QWWA 1YS6A 4XNAA 5IT9K 5TJJA 1YG2A 4GAAA 2IW5A 2KRFA 1QQIA 3RYRA 3LA7A 1G3SA 3TOBA 4LJZF 5ILUA 1TLHB 5A2QK 3RI4A 2XHKA 5LBQA 3WODF 3FH5A 3TO6A 4ENMA 3FWEA 3TDUC 5HVQC 2F5CA 3FTUA 2BEOA 3LQRA 1F5TA 3KETA 4KNYA 2OU2A 3GZ5A 1CGPA 3IWZA 1P4WA 2V1UA 4G6DA 4HYEA 3I71A 5LGNA 1MW2A 4HF0A 5DD4A 5EEGA 4M9XA 1R00A 3KLNA 3JSZA 5ICEA 3GLXA 1S7OA 3ANLA 3I59B 3FMRA 3UCQA 2XQ0A 1UCRA 3W6KB 5DYMA 2JCVA 2VBWA 2OZ6A 5EEHA 1BC7C 1P4AA 3HIFA 3LWFA 1V4RA 2V1DA 3BOQA 2NRAC 4RGRA 2QYOA 2XROA 3BJOA 2PL5A 5FO5A 2DO7A 4AD9A 3FUJA 1LB2A 4M9ZA 1ZN2A 5CJ9A 3ZMZA 2P5KA 1XCBA 4EQQA 3VEPA 2FRHA 4QIRA 5E17F 2XAJA 2RKHA 4RCVA 4HLYA 2CO5A 4EGYA 4WXDA 4JBAA 3QPHA 5CYVA 4DNCA 3KP3A 2L54A 2P7VB 2H09A 2KIUA 2DK8A 5LHGA 3KP7A 1ZRCA 4L2LA 1MVYA 1XSVA 3JT1A 2DU9A 4Q47A 3WTUC 4LB5A 1RNLA 4JNDA 1FNNA 2PN6A 3WTXC 1J0RA 4YFNF 4XN8A 4I98B 2HTJA 1QGPA 2L3DA 2ZKZA 3F8MA 2EFWA 2JZYA 2HWVA 2FF4A 1K7AA 4UVAA 1R5GA 4M9SA 3FUNA 1KU9A 4EJOA 3QU3A 1I1SA 3T8VA 3KLOA 3EBHA 4K5MA 2L02A 4XLNF 3SHFA 4L9JA 1ONPA 3CHRA 4ZW8A 2VE8A 4I0BA 1UHMA 4AR8A 1USSA 3TGNA 2DFIA 4OINF 4B09A 3KP2A 1R23A 3F8NA 2MLGA 1YIOA 3WE2A 3ZN0A 4MKTA 2Y1EA 1UFMA 1Z05A 3FULA 2MC3A 1I6XA 4I09A 2UXXA 3KZYA 1LDKB 2HKOA 2IRFG 1KU2A 1S29A 2FA5A 4UVBA 4G6QA 5CLSA 2K4BA 1MJ9A 1Z1DA 3QP6A 4U7BA 5DCMB 4LLNA 2GA2A 2QENA 3FMQA 2O61A 4ON0A 2C6YA 4M6YA 1RIOH 1TQMA 2EWNA 5E18F 4JQFA 1XMAA 2BYVE 3PFIA 2VC1A 4AWXB 1IAWA 3V8LA 1BOAA 4XMVA 3DXJF 2ZMEA 2QUFA 2NNYA 4ZQTA 4Y67A 3SXYA 2BGCA 4KDPA 1KU7A 1MW3A 4XO4A 2EFQA 3VVLA 3HTUA 3WTZA 3KEOA 1U8RA 2VXZA 3GXOA 3SZTA 1TNTA 3BPVA 4ENJA 4K2EA 5FGMA 5E20A 4QPEA 1SD6A 4R79A 1XDUA 4M72A 1KGSA 2Z9OA 2YPRA 1WQ2A 1I5ZA 2IA2A 2HPTA 1W7PD 1O3RA 2KJCA 2DAOA 3V7CA 4H0EA 5D4SA 1XGNA 1KQ8A 3KE2A 3N97A 1JG9A 1FYLA 3I4PA 4BXUA 2CSOA 4UHTA 3FUFA 5JC1A 2EV6A 2MLKA 3BWGA 3OOPA 2GQQA 4EJVA 2D1HA 3U9GA 1B59A 3P9CA 1Y0UA 4HW0A 3FTSA 5EV7A 3E5UA 1OPCA 4U0VA 4FLSA 4UVCA 5JNLA 1ZHFA 3D5LA 1K79A 4F7ZA 1F4KA 2L4AA 3J80Z 3H3UA 3FTYA 3ABTA 2RVCA 1XGOA 4ESFA 3L9FA 4WF2A 4QHPA 2XPYA 2AXLA 3EYIA 3WU0A 5FD6A 1TTYA 3EBIA 4MNUA 4A0YA 5LHHA 4RSYA 4KN7X 5FB2A 4XO3A 5LGTA 2EJRA 3BPXA 3IWFA 4ZX6A 1IN7A 3O3KA 3HUGA 3E6BA 1MDMB 1R0LA 4S05A 4AIHA 3Q9SA 5J8FA 3F23A 2VOPA 1X3UA 2WTEA 5E1XA 4ZYDA 1J59A 4IVNA 4MEXF 2FBHA 2PFBA 1SMYF 3K0LA 4ZQGA 2CG4A 1FP2A 3WQRA 2QQAA 2D1VA 2JD0A 3ERED 1IRGA 3I64A 1I27A 4IHTA 1GHCA 4OOIA 4XRFA 1G3TA 2WWYA 3KP4A 2YSRA 3KP6A 1IN5A 4PW4A 3PQJA 3C7JA 1PP8F 2XV4S 4OIRF 3ANNA 2QLZA 5LRSA 1J7KA 2M8EA 2CWEA 4P5OA 4XMXA 2FFLA 1A04A 1WI9A 2DI3A 4XN7A 3F72A 1QBJA 1O3TA 3HSEA 1KQ9A 5ILSA 3TKYA 3MAJA 3QPTA 1XB4A 1O57A 1HKTA 3CUQB 4BNCA 2IA0A 4N9IA 4WWCA 1AOYA 5HLHA 2R7FA 2IA1A 4P9FA 3B34A 3R0AA 4EM1A 3CHOA 2R7DA 2JSCA 4A5NA 3F8CA 3DEUA 4QLCU 2DTRA 2VT3A 3HSFA 1RP3A 1RI7A 3FU0A 2XVCA 4TV7A 1ZRFA 4IJAA 2VBXA 1FSHA 4RB1A 3U1DA 4XN9A 1H19A 1WSUA 2O7GA 1BIBA 4KA4A 4LLLA 2Z99A 3BP8A 2YU3A 1U2WA 2BV6A 3K9TA 3I59A 3O6BB 4GYIA 1T1RA 5JBIA 2EV0A 1F1ZA 3IRRA 1HW2A 2ZXJA 1T98A 5HS9A 1R58A 1FY7A 1P2FA 2ZBKA 4IF4A 3ISPA 4ZZLA 5L3GA 1R1UA 4ZZDA 2C82A 2STWA 1W5SA 1ZLKA 1HS6A 3TDZC 3CDHA 2W57A 2FQ3A 3FU5A 2HEOA 4ENKA 1LVAA 1XCVA 3R6SA 5JVTA 5HLTA 3RKWA 4PZJA 4ZW7A 1STZA 5H6RA 2R70A 4XN1A 2ZXGA 3FUKA 4K5PA 3QU6A 2A7OA 2JT1A 2LDUA 2V79A 1FYKA 3S2WA 1XSXA 5J8CA 2VE9A 4Y15A 1HSTA 4O3MA 1S3JA 4HDVA 4KFCA 5JR3A 2M1BA 1USTA 4LLGF 1JXSA 3B02A 2COMA 1T0FA 2UWMA 1U5TA 3CZEA 3F3XA 1T38A 2QBYB 4BH9A 2EFNA 5L3CA 3HRTA 3UEQA 4UNOA 5D8KB 5E8IA 3LAPA 1MKMA 2GWRA 3REOA 3K1NA 3RPUA 6PAXA 3GUDA 3B7SA 1FSEA 4BAYA 2Y1FA 3K1PA 3W6JB 3V7SA 1HBXG 1JHHA 4RAYA 3L09A 4G7HF 2A6HF 5D4RA 1FT9A 2XPZA 4OOEA 1RUOA 4LK1F 3IRQA 4CZZA 3HHGA 4NB5A 3IKTA 4K5OA 4ZH4F 1KQ0A 4KICA 2OA4A 2F2EA 1H0MA 3FTXA 2GXGA 1IZ1A 5DULA 2XIGA 3F6OA 4PGGA 3FU3A 2FOKA 1O3QA 3E6DA 3EBGA 2RDPA 3T8TA 4WK8F 3T1BA 3QP5A 5DEQA 2XASA 3FX3A 5JMWA 4MQVA 3IL2A 1LNWA 1FLIA 5D6EA 3U2RA 5DLLA 2GAUA 1OYIA 2FSWA 5AIPA 2K02A 1SQMA 3PQKA 3L2CA 2KKOA 4M74A 2A6EF 1OR7A 3QRFF 5L3EA 4YFXF 5CVUA 2YX7A 1FZPB 1FOKA 3AU8A 1ODDA 3P9KA 4OOFA 4FCAA 4FLOA 1BC8C 3GFMA 3WE3A 2Q2EA 3COAC 3GVAA 3WTVC 4ESJA 3HOSA 4A03A 4I01A 5ICGA 5IT9Z 3V8KA 2R72A 5J6XA 4CO8A 1LEBA 4WCGA 1ON1A 2QZ8A 1K78A 5A2QZ 4GCVA 1BJAA 1XD7A 1HW1A 4P9UA 4MS6A 2IVMA 2V9VA 3ZMTA 1R7JA 1QO0D 3VB2A 2UXNA 2DK5A 3RJPA 4ESBA 4NHJA 4R5VA 1XSDA 1JHFA 3HRMA 1BN5A 1ZG3A 4IPAA 2Y1CA 1MZBA 2Z5UA 2GIVA 2J5PA 2FEZA 4XNDA 1CF7A 1MW1A 2Y0MA 2GA1A 2M30A 5BOXA 5BPIA 2NAZA 2CYYA 2H94A 2GTQA 4YG2F 4AIJA 3GEZA 3MWMA 1ZARA 4ZYHA 2O0YA 2XAHA 3K2ZA 2IPQX 4KMUX 5BPDA 2L4MA 2K27A 2HOEA 2ZNZA 4ZW3A 3HYIA 1W7PA 5K5RA 4ZQHA 2BBYA 2WC2A 4BKXA 2Y75A 3QAHA 4IRIA 3RDIA 1RUNA 1SFEA 4HF1A 2QM3A 3RC3A 3ZI0A 2X0LA 3J81K 4MEYF 2MAOA 2DT5A 4Q4EA 3B2PA 3AU9A 4WXCA 3F6VA 3ZMUA 1SFXA 5AIQA 5LGUA 3JAMZ 4XN4A 3HSRA 3E6MA 3RASA 5FLXZ 3BJAA 3ZN1A 3GFLA 2FE3A 1KYWA 3FM3A 4RGXA 3LA3A 2CQKA 2G7UA 1OMIA 4YIIA 3T5XA 1G5AA 3AUAA 1SAXA 2FU4A 3L7WA 3EUHA 4IRHA 4MGRA 3HOTA 5DD8A 4R1HA 2VODA 5E1WA 3FTVA 5K5OA 2EA2A 1MJAA 1FC3A 2DPDA 2G9WA 3CHSA 1HSJA 2CFXA 2RNJA 3CO6C 3GZ6A 2R59A 1IF1A 3L00A 4EM0B 2KIMA 1ZREA 1Q0HA 1XN7A 3PUUA 1FWZA 3VFZA 4RB3C 5TRDA 2K7LA 3MQ0A 4L0ZB 4L5IA 4LK0F 1Q0LA 3FUIA 3FH7A 1Z6TA 1BIAA 3EQLF 2PJPA 2XKOA 3R0JA 3T8RA 1HXDA 3RKXA 2A07F 3LQQA 1SD4A 1EH6A