4NQWA

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
148
Chain Sequence
DLDALLRRVAHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
molecule keywords ECF RNA polymerase sigma factor SigK
total genus 57
structure length 148
sequence length 176
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4nqwA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4nqwA01
4BNCA 2RV8A 3ISPA 5JMPA 5D8LB 3WGIA 1GXQA 3KP5A 4KIGA 3F8FA 4CYDA 3FXRA 4HAMA 1ZH5A 1R36A 3R0IA 4WCGA 1XD7A 2VC0A 1ZARA 3GEZA 1ZG5A 2QQ9A 4BXUA 3TOBA 1ODDA 1O3TA 3CZGA 3ECOA 2AXLA 3A06A 3BPXA 4XRFA 2FXAA 3D5LA 4GCVA 2W85A 1Z9CA 1JGIA 1F9NA 2LF7A 4OIPF 2DFIA 2WTEA 3F6OA 3CDHA 4N9HA 3ELKA 2Q8KA 2VBXA 1ZREA 2FA5A 5AIQA 1Z7UA 1MW0A 3G3ZA 2ELHA 2LKPA 5CYVA 1PP7U 3RYRA 3LWFA 1SD5A 3LFKA 2BEOA 1HW5A 4HOBA 4YFXF 2Z3YA 5DCMA 1DUXC 2Y1CA 3LSTA 3CZEA 1REPC 2E1CA 3BJ6A 1BI2A 4M6XA 4Z2YA 5JBIA 3JSPA 4L0ZB 4HV5A 3DXJF 1YG2A 6PAXA 2Y75A 4FLSA 1YW7A 1SD6A 3ZMTA 2H6CA 4LFUA 1QBJA 1Q0HA 2JD0A 5E18F 4RB1A 2K4BA 2IA1A 1P2FA 1KQ9A 1ZN2A 2QZ8A 2VE9A 2Y1GA 4L5IA 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 4G7OF 2XVCA 3IL2A 4YG2F 4WK8F 5LRRA 1T1RA 1E2XA 3GZ5A 2A07F 4XBFA 3HOSA 4G94A 1R1UA 1XB4A 1YQAA 3ZMDA 4IHSA 4EMSA 4ZN6A 1S7OA 1IN4A 1G6NA 2JSCA 2FEZA 1O7FA 3U9GA 3EETA 1OMIA 2EV0A 3GWZA 4BHCA 3PQJA 3FMSA 4U0YA 5AONA 3DKWA 3EQLF 2V79A 3L00A 2CQKA 3CUQC 2F2EA 1PP8F 2W25A 3E6BA 4XLPF 1BC8C 2XUBA 2FMLA 3HUGA 2GXGA 4IXAA 1BJAA 3MAJA 1IXCA 1TNSA 1XCVA 3RKWA 2DQRA 1T98A 4KFCA 1J59A 3TGNA 4P9FA 3MZHA 2CO5A 3SZPA 3AU8A 4LD5A 2W24A 4GAEA 4I09A 3M1EA 1NHAA 5LLQA 2PQ8A 1BM9A 3HRTA 5HOOA 1OYYA 3NEUA 3QP6A 3DP7A 1U3EM 2K7LA 1GXPA 5H6RA 4HLXA 2XAJA 4AD9A 4CGZA 1G4DA 2Y0MA 1BN5A 2HWVA 4CO8A 4S04A 4RS8A 2PMUA 1FNNA 1IN8A 3T1BA 5LEKA 2VT3A 1F4KA 3HRUA 3V8KA 3TQNA 3HHHA 1B59A 4GYGA 5L3CA 3GFJA 2YR2A 3BY6A 1J0RA 3MFKA 2COMA 4UUVA 2D1HA 4HX7A 1TQIA 4ZYHA 4CZZA 1B9NA 1HQCA 4EV0A 2M30A 4OIQF 2P7VB 5FD6A 3K2ZA 3R0AA 1JHHA 3M8FA 2NYXA 3WQSB 4P55A 3QPHA 5CLSA 4LK1F 2ISZA 1IXRC 2GIVA 1ONVA 4G8XA 1R0KA 4ZH4F 2IPQX 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 3WQQA 5LBQA 5D4SA 2P6SA 4KUMA 1B6AA 2E7WA 5K5QA 3I0TA 2DPUA 3WTWC 4MEXF 3KE2A 4KA4A 4I02A 4KIFA 3MQ0A 4YIFA 5BPIA 1O3SA 4UVAA 3CJNA 4MTDA 2NAZA 2P5KA 4OMYA 4ZYDA 3IRQA 3E5QA 4PZJA 4L5JA 3I53A 2DAOA 4Q5SF 3QPTA 2M5WA 2FOKA 2C82A 1O3QA 5LEJA 4E70A 4Y13A 1ZAOA 2XASA 1K79A 2NS0A 1SMYF 4FT8A 1B1BA 5BMZA 4NQWA 2HZTA 2HOEA 2RVCA 1BI0A 4Y6SA 2P5LC 3I5UA 4ASNA 4LG0A 4ESJA 1VTNC 4HDVA 3REOA 4MGRA 3WTTC 4U7BA 1Z6TA 4LUPA 3NRVA 3TO6A 1XN7A 1MDMA 5D6EA 3M7GA 1S46A 3QP5A 1U5TC 1FSHA 1W5TA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 4EGYA 4LB5A 1J5YA 3JW4A 1RP3A 2JRTA 4UNOA 2KIFA 1BOAA 3WU1B 3RYPA 4HW0A 4OOIA 1Q0LA 3TO9A 1ZLJA 1JXSA 5FFXA 2K02A 3ANLA 2MH2A 1IXSB 1UFMA 3I59B 5EEHA 3K1NA 3P7NA 4TV7A 4N9IA 5ILUA 2G7UA 1D3YA 4KT5C 2P4WA 1HSJA 1SFXA 3GXOA 2DO7A 2FBIA 3F6VA 4KMUX 3ZMVA 2MAPA 3I64A 3WE2A 5F64A 2CG4A 4L9TA 2Y1DA 3ZMSA 4U88A 4UV8A 3Q9SA 4L9JA 1MW1A 1X3UA 5D5XB 2TDXA 1J2XA 5DD4A 1OYWA 1FLIA 1LDDA 2HTJA 1FY7A 1HW2A 1FBUA 4N0BA 1DPRA 3ROUA 4Q48A 5JC1A 4ETSA 1USSA 3T0YA 1MZBA 3G73A 1MGTA 5IT9Z 4Y6PA 3ZP5A 1C0WA 3C18A 1R7JA 2LNBA 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 4OOFA 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 4G7HF 2HS5A 4HBLA 4MNUA 2CYYA 1P6RA 1RZ4A 3R4KA 1QO0D 1CF7A 2L02A 2UWMA 4FLQA 1CF7B 3CO7C 4AWXB 3BDDA 2CW0F 3JSOA 1LVAA 3F72A 4EM1A 2HR3A 1P4WA 3GFIA 4EJUA 2ZMEB 1TLHB 1KU7A 2E7XA 2QWWA 4G9YA 4I2OA 2IW5A 2O03A 2PMHA 3LQRA 4AIKA 1KU9A 4GGGA 1TQMA 1B4AA 3GZ6A 3Q5FA 3RIRA 2R7FA 3MZYA 5FFZA 1YYVA 2JPCA 4LLNA 1YIOA 1UB9A 3KP4A 2V1DA 2Y1EA 1I27A 1RIOH 2A3SA 1G3SA 2O6GE 3TO7A 1ONOA 5E1WA 3A14A 2HEOA 5FD5A 2L4MA 3Q9VA 3IC7A 3AAFA 5L3BA 2OA4A 1J9IA 3RJPA 3FM5A 1Q0QA 2ZCWA 3GYHX 5DCFA 5KVRA 3O3KA 2JTVA 4P9UA 2HQRA 2G7HA 4PGGA 4UHTA 2H94A 4EQQA 3QOPA 2A68F 3OOPA 1ON1A 2Q2EA 3I71A 3WTZA 4LGWA 1L3LA 5L3FA 3KEQA 2ZFWA 3V4GA 4ZQGA 1IUYA 1EH6A 1JVSA 4PDKA 3SHFA 1H9GA 3VFZA 1UHWA 3VB2A 4M72A 5HVQC 1R1VA 2XROA 4KNYA 4A2UA 3ZMUA 4JBAA 4RAYA 3H3UA 3HSEA 1LQ1A 2L4AA 3T8TA 1D8JA 1LB2A 4M6YA 2MLGA 2WWYA 3I54A 3HHGA 2VBZA 2O7GA 4HF1A 3QRFF 1XDSA 3TDZC 5JR3A 1KA8A 4NHJA 2KIUA 3TOAA 1XSVA 2NNYA 2VOOA 4ENMA 4R79A 1SD7A 4A03A 2ZXJA 3WTUC 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 4A5NA 1WI9A 4QWQA 3GF2A 2STTA 4I98B 4UVCA 4EM2A 3FM3A 5E8IA 2DQLA 5JHUA 1IN6A 2YU3A 1UCRA 2M45A 1JGSA 4L18B 1ZG1A 3KP2A 5L3DA 2P7CB 5ICFA 5JVTA 2MA3A 5FGMA 4QLCU 1Z91A 3KP3A 4Y67A 1MKMA 5ILVA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 2JZYA 2BYVE 4HDUA 1KYWA 4CICA 2P5VA 4FX4A 1ZYRF 1J75A 1ZHFA 5DUIA 4EGZA 5D5VB 2FF4A 3KP7A 2OQGA 3C1DA 5ERIA 3V7RA 5DEQA 4DQ2A 1K7AA 3RI4A 5E17F 2A61A 1AWCA 5E1ZB 4HZFA 4LLLA 4L9VA 2EFWA 2IRFG 2HGCA 4ZQFA 1I1SA 1V4RA 5EEGA 2RN7A 3E6MA 1S29A 1HKTA 5ICCA 2O0YA 1H3LA 3N97A 1RNLA 4CHUA 1K78B 2MBFA 2F5FA 2FMYA 3IKTA 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 4WXDA 3IRRA 4B09A 1P4AA 5L3GA 3WGGA 4A5MA 5CVVA 1L0OC 4L9NA 2O61A 1IN5A 4RB0A 3SZTA 1FYKA 1R0LA 1SD4A 3LAJA 4A0YA 4M73A 5FB2A 2OZ6A 4EVIA 3WTSC 4ZZLA 3W6KB 4HX8A 3HSFA 1G3YA 3E5XA 4FHTA 4IVNA 4RB3C 1S7AA 2MLKA 2EFNA 4A0XA 2EFOA 2QQAA 3F21A 2FE3A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5HDKA 4YIIA 4M71A 4KP7A 2V1UA 1MDMB 2G9WA 4BHBA 1WQ2A 1T38A 4IRIA 2XV4S 4UV9A 4RCVA 2OD5A 1LNWA 1Z05A 2Z5UA 1S6LA 2MD5A 3BWGA 2XAFA 1YS7A 4BYYA 3IWZA 3E6CC 2XAHA 4WXCA 3JTGA 1EH7A 3WU0A 2A5YB 3ANMA 2STWA 1WKMA 1YTYA 5H6QA 3RTRA 1D5VA 5HLGA 2QQBA 1O3RA 3FMQA 1U5TA 3BPVA 1USTA 4YFNF 1BBYA 3RPQA 2M1BA 2LSOA 3P9IA 2KJBA 3CTAA 2PI0A 3GW2A 2VODA 2QLZA 5LGNA 1AOYA 1FP1D 2D2WA 2K4JA 2PG4A 1JG9A 2JCYA 5JAZA 3UERA 2ZJ2A 1YO5C 1IW7F 2XRNA 5ICEA 1MVYA 2F5DA 2R7DA 5D8KB 4ESFA 1R58A 4ZQHA 2MH9A 3CUQB 3WTXC 3GX4X 5LHGA 3I58A 4IF4A 2GA1A 1O7LA 3K69A 3KCCA 2JD1A 5LGTA 3K0LA 4S05A 2DW4A 2DU9A 4DNCA 4G6QA 1K6OA 5LHHA 2OBPA 1R5GA 2XIGA 2L54A 5CVJA 3MEXA 4LB6B 2L3DA 4BH9A 4M9XA 4BAYA 4RGXA 4RGSA 3DQVC 2JPBA 5DDGA 1LDKB 1FSEA 4MEYF 4PGHA 4CXFA 5JO0A 3RASA 2HYGD 3ZN1A 4HQMA 2DI3A 3AUAA 1ZG3A 2EFQA 1KYZA 3FX3A 3IKVA 4KYWA 3B73A 1FWZA 4GXOA 3F8MA 4XLNF 1KGSA 5HLIA 2W84A 2ACJA 4O3MA 3WODF 3CLOA 2FQ3A 3F8NA 1JHFA 2HYFA 3SQNA 3BROA 1WSUA 3ERED 4Q47A 2EFPA 2F5CA 3C3WA 2ZKZA 2Z9OA 3I59A 3K1PA 2PBIA 3IWFA 1U6GA 4K2EA 3K9TA 2DPDA 3DV8A 4IRHA 4Q4ZF 3ANNA 1DDNA 1HXDA 1XDUA 2KKOA 4M74A 2ZNYA 2EWNA 4KMFA 1YW9A 3LA2A 1QZZA 3D0SA 2RQPA 3F22A 2RNJA 3P9CA 4RAZA 3WE3A 4HX4A 1TW3A 2JCVA 5ILSA 5D5WB 2K27A 1HW1A 5DV5A 2VXZA 2WV0A 1H0MA 1F5TA 4M9ZA 5A2QK 3V7SA 2XKOA 2Z33A 4FLOA 3WQRA 3H92A 4RGRA 1Z6RA 1I1GA 3CO6C 4R8HA 5D5UB 5IT3A 1BI1A 3VODA 1KU3A 1CGPA 2XHKA 1ZRDA 1YW8A 4HA8A 2PJPA 1V3FA 2IT0A 4ENJA 2H6BA 2AS5F 2QVOA 5D4RA 2PEXA 1Y0UA 4OOEA 4AICA 3ZHYA 3KLOA 4MQVA 3V7CA 4WXHA 2YX4A 2HTSA 4RB2C 3GLXA 3ECHA 4WF2A 2ISYA 2BBYA 1QNTA 3R0JA 1ZLKA 4XSXF 2KRFA 1TNTA 3V8LA 4M9SA 1MJ9A 3AU9A 3DFGA 1T0FA 3RKXA 3HYIA 2UZKA 4WWCA 3NQOA 1FX7A 3L9FA 4U7DA 3EYIA 1U8RA 3ABUA 4GO1A 1S8NA 3HTSB 1J7KA 2P8TA 4ON0A 1TQPA 1YFHA 2JT1A 3N4MA 1STZA 3K1MA 3FXQA 3W6JB 1MJBA 2GA2A 3V8JA 2VT2A 2X0LA 4I0AA 2ZO4A 1QPMA 3L2CA 1IF1A 1MJAA 4EJVA 1TBXA 3OV8A 4LK0F 5DYMA 4A6EA 2RDPA 2Z99A 3ML6A 1A04A 2EV5A 5F6FA 3ZPLA 2CFXA 2FBKA 2XGXA 2FU4A 2DLLA 1PDNC 2EJRA 1E17A 2CSOA 2HKXA 4OIRF 1P4XA 3U1DA 1TW2A 2H09A 4A6DA 5ED4A 3T5XA 5HDNA 3RPUA 2KJCA 5J8CA 1UHMA 3QAHA 1PUEE 1FOKA 3CUOA 1W5SA 3GUDA 4JK1X 4ZZDA 2V9VA 3E6DA 1ZGAA 4XSZF 3LA7A 4A12A 1IN7A 3WG9A 1EH8A 2A69F 3P9KA 3BJAA 2YPRA 3DEUA 3H3ZA 2IA0A 3HSRA 5DULA 2PN6A 3LAPA 4EJOA 2RKHA 1FC3A 1S3JA 5JI6A 1I6XA 4H0EA 2WC2A 1K5HA 3CZLA 2H27A 2ZNZA 1RUOA 2WPGA 2ETHA 5LGUA 2DK5A 4ZYGA 1U5TB 1DP7P 4FLRA 1OR7A 4B8XA 2XAQA 2KIMA 2IA2A 3E97A 3CUQA 5K5RA 1IZ1A 4FX0A 5E1XA 1XGMA 1GVJA 2IJLA 5AIPA 2ZBKA 3R60A 4MQ9F 5E20A 4I01A 2W57A 4O6JA 3COAC 2VONA 1IRFA 5IT9K 1ULYA 3ABTA 2DTRA 4GYIA 4IPAA 5LRSA 2HDCA 4ESBA 1ZRCA 4OIOF 5CJ9A 2MAOA 5DCMB 2UXXA 2NNNA 2FRHA 2RGVA 3RKYA 2P6TA 5BOXA 1W7PB 4O5VA 1HKQA 3SFZA 4ZYEA 4Y6RA 4LLGF 1K78A 4P5OA 4HF0A 2VN2A 4R1HA 3BZ6A 2YX7A 3FHZA 1QGPA 5K1YA 1OKRA 4AIHA 2EK5A 1R00A 1BC7C 2VC1A 2J5OA 5FLXK 4KICA 1BIAA 1BIBA 2EA4A 1FT9A 3U2RA 5JMWA 1G3WA 3ZMZA 1FBQA 4D0PA 4U0WA 2QBYA 1KQ0A 5J6XA 5FO5A 5DD8A 1R22A 2VBWA 3FZVA 5JNLA 1I5ZA 2ZMEA 2IP2A 2V6CA 3QU6A 1P92A 3ULQB 3FXUA 1T6SA 4Y17A 2RC4A 1F1ZA 1SFEA 5ICGA 1D8KA 2GZWA 5CVRA 1EV7A 3BJOA 1FBSA 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 2IVMA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 1W4MA 3JTHA 4LG0B 3EYYA 4ZQEA 4Y15A 2D45A 1T2KA 3O2PE 1XSDA 2DT5A 2B0LA 5HLHA 1OYIA 5E8GA 4UXNA 2VBYA 3J7AO 1SMTA 1DPUA 2DBBA 3F8CA 3T8RA 4OINF 4EJWA 2OU2A 4LJZF 4HLYA 1R5HA 3DF8A 4ENNA 1G5AA 5TJJA 3J80K 3M9AA 1ZGJA 3BOQA 4OMZA 3VOEA 2BV6A 4ENKA 1QQIA 1H9TA 2PFBA 1ONNA 2X4HA 3WTYC 1XCBA 4U0VA 1XGNA 5BPDA 2F5EA 3ZHXA 3KFWX 5CVUA 4IJAA 2D1VA 4YFKF 2BE5F 4I0BA 1LDJA 4HF2A 1Q1HA 2PLYA 2XAGA 3TKYA 5HS8A 2K86A 1TTYA 2NRAC 1U78A 5F1RA 4NB5A 1MD0A 1YS6A 4RGUA 3O6BB 4EJTA 2FSWA 3FMRA 2A6EF 4JQFA 5KK1A 2CGPA 1HSTA 3HTUA 2JCXA 4PCQA 5A2QZ 5K5OA 3UEQA 2Y1FA 2Y48A 3QU3A 3LA3A 5J8FA 2OZUA 1W7PD 5DUKA 1IAWA 2ESNA 5HS7A 3VEPA 1Z1DA 1IRGA 2R3SA 4OU0A 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 4BHPA 1U2WA 2VOPA 3E5UA 2LDUA 1OPCA 4LMYA 3DPLC 1ON2A 1SAXA 2J5PA 1LEBA 2EGHA 2O8XA 2HQNA 2V1XA 1FP2A 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 1XGOA 3JAMZ 2OQRA 4BQAA 5TRDA 1SC5A 2QENA 1O57A 2XKPA 1WWXA 1YLFA 2A6HF 1FYLA 3GO5A 3I4PA 1MW2A 1LJ9A 5BS6A 3HRSA 5HDGA 3SXYA 3J81Z 3J80Z 1XGSA 2GAUA 5L3EA 4AYSA 4EM0B 2C6YA 2MC3A 2UXNA 5BQTA 2FNAA 3KZYA 2GWRA 3IHUA 3KLNA 3UCQA 4G7ZF 2CWEA 4P96A 3RDIA 2M8EA 2O3FA 1MW3A 3F23A 3ZI0A 1GHCA 1BI3A 1XMAA 4IRGA 2JD2A 1LEAA 1ZS2A 3FWEA 1ZRFA 1T1SA 2M87A 2HKOA 5H20A 3CZKA 3DPTA 2EA2A 1ONPA 2E1NA 3R61A 2QBYB 1WRJA 1R1TA 3M8EA 2LF8A 3FF5A 3ZHZA 4HYEA 1QZYA 3TDUC 2GQQA 4A0ZA 2QYOA 1XMKA 4IHTA 1XSXA 3WTVC 3ZN0A 3HIFA 3EDPA 2OAZA 3PQKA 1RI7A 4KN4X 1G3TA 3KEOA 3WGHA 4HQEA 3GVAA 4KDPA 3ZQ7A 4KN7X 4L0YB 1FZPB 3KP6A 3IIEA 4F7ZA 2BGCA
chains in the Genus database with same CATH superfamily
3JRFA 4BNCA 2L7MP 1ETWA 3FHEA 2RV8A 4C2TA 1BR4A 3ISPA 1R5ID 5GPCA 5JMPA 2X1CA 5D8LB 3WGIA 4D7NA 2DQMA 5LD2C 1GXQA 4HEA2 5GAEJ 4OAZA 3I56I 2EIJH 3ASNH 2XGCA 3KP5A 4KIGA 2ZXGA 3F8FA 4CYDA 2XF5A 4G12A 3FXRA 3CHSA 4HAMA 1ZH5A 3IUOA 1R36A 3ZRGA 3R0IA 2QJ1A 4WCGA 3A0BC 3S3MA 1XD7A 2K9QA 3TEDA 5EGOB 2VC0A 1ZARA 3QQAA 2XGDA 4A93J 4LIVA 3GEZA 1ZG5A 2QQ9A 3QYEA 4BXUA 2HI3A 1ODDA 3TOBA 1O3TA 3CIAA 1MSEC 1OLTA 5E3MA 3S1MJ 3CZGA 3ECOA 2AXLA 3BC8A 3A06A 3BPXA 4XRFA 2VIXA 4NBQA 1Y8RB 3GTJJ 3DWLE 2FXAA 3D5LA 4GCVA 2W85A 2X1EA 4GRIA 5EG0A 1Z9CA 1JGIA 2FJ1A 3BQYA 1F9NA 2LF7A 2E2JJ 3OR2C 4Z6YA 1DGWY 4OIPF 4MKTA 2DFIA 2WTEA 3JRIA 1E3HA 3F6OA 4PW4A 3CDHA 2E1OA 4N9HA 3ELKA 3HOYJ 2Q8KA 2VBXA 2XB5A 2X6XA 1ZREA 2FA5A 2KIQA 5AIQA 5FKKA 3FTWA 5CKTA 1Z7UA 1MW0A 3G3ZA 3I3LA 3G2BA 1T95A 2ELHA 2LKPA 3L2WA 5CYVA 3CC2I 4RA2A 1PP7U 1NH3A 4NUBA 3RYRA 1DP3A 3FUDA 3LWFA 1SD5A 5DS9A 3I4NJ 3LFKA 2BEOA 4YIRX 4PJJA 5HNHA 3KPHA 2R7WA 1HW5A 4HOBA 5CQEA 4RLFA 1RR8C 4DBRA 4YFXF 1QHHD 2Z3YA 5DCMA 3TW7A 1DUXC 4R5XA 2Y1CA 1E3PA 3LSTA 3CZEA 2ELKA 2M7BA 1REPC 4A3KJ 2E1CA 2RQQA 1X3WB 4OWRB 1A6QA 3BJ6A 3V42A 4PK4A 2BW3A 1BI2A 2QCOA 2WAQN 2DYSH 4M6XA 5J40A 4Z2YA 3TBIA 1JI8A 5JBIA 4BQNA 3JSPA 3DBRB 4L0ZB 4HV5A 3DXJF 1YG2A 2Z2SB 3PJRA 6PAXA 2Y75A 4FLSA 1YW7A 1SD6A 2E5ZA 3ZMTA 3A4CA 2H6CA 2X85A 3K4BA 4LFUA 1QBJA 1Q0HA 1GDTA 2XPWA 2JD0A 5E18F 4RB1A 4RM3A 1ETQA 2OCEA 3FXJA 2CV2A 3OS0A 2K4BA 2M2EA 2QEXI 2IA1A 1P2FA 1KQ9A 1ZN2A 3JRAA 2QZ8A 1ZQ3P 4XN8A 2VE9A 2R7XA 2Y1GA 4L5IA 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 3AG4H 4G7OF 2ID3A 2XVCA 3BR0A 4II2A 1X2NA 2FUG2 4BKXA 3IL2A 3CMAI 4YG2F 4WK8F 5LRRA 1T1RA 1E2XA 3GZ5A 2A07F 4ZX4A 1VQ7I 4XBFA 3HOSA 4G94A 1W5CC 4F52A 1R1UA 1XB4A 4NC7A 1YQAA 2DYRH 3ZMDA 2M3AA 4IHSA 2V9PA 2QSHX 4EMSA 3S1NJ 3K2AA 1GW6A 4ZN6A 4BACA 1S7OA 3HPGA 1IN4A 1G6NA 2JSCA 4DYCA 2FEZA 1Z3XA 1FTTA 1O7FA 2KRHA 5F1JA 2KQRA 3U9GA 2XDVA 5F27A 3EETA 1HA8A 3I4MJ 3GMEA 5TISC 3ZQCA 1OMIA 3DEWA 3JREA 2EV0A 3CJTB 3GWZA 3AL0C 4BHCA 2ZJRF 3PQJA 3RQIA 1W1WE 3FMSA 3W2WA 3AL0B 4U0YA 5AONA 4UUSA 3DKWA 3EQLF 2M0MA 2V79A 3L00A 2CQKA 4RBOA 2XGEA 5J4YA 3Q0VA 3CUQC 2F2EA 1PP8F 4ZDOA 1YX5A 2DFFA 2W25A 3E6BA 4XLPF 1BC8C 2XUBA 2KL4A 2FMLA 4IZZA 3HUGA 4DPRA 4B4CA 1BOBA 1YRNA 2GXGA 4IXAA 3JR9A 3JRHA 1BJAA 2ECCA 3MAJA 4GDFA 1IXCA 1TNSA 1XCVA 1QA6A 2LBFA 3RKWA 1B72B 1D0XA 2DQRA 4IX7A 1T98A 4KFCA 1J59A 3TGNA 1S7EA 3BG7A 4P9FA 3MZHA 4LITA 3PFYA 2BHZA 2WAQA 1GUUA 2CO5A 2GXAA 3SZPA 4E7LA 4A3MJ 3AU8A 2HPMA 1WJEA 2VPRA 4LD5A 2W24A 4GAEA 4I09A 3M1EA 1NHAA 1Z0XA 5LLQA 3DKXA 5JVGF 2PQ8A 4GFBA 1BA5A 1BW5A 3FUMA 1BM9A 2HZDA 2A7OA 3HRTA 5HOOA 1OYYA 2K3FA 3NEUA 3QP6A 3OYGA 3DP7A 1FIPA 3B7TA 2LYCA 1U3EM 2K7LA 3ASOH 1YJNI 1GXPA 4AR8A 1POGA 5H6RA 4HLXA 2XAJA 4AD9A 4CGZA 1G4DA 2CRGA 5DTDA 1ZTRA 2Y0MA 2CUJA 3DTKA 1BN5A 2HWVA 4MFDA 4CO8A 3OYKA 2L7KA 4S04A 4RS8A 3BR1A 3ZCOA 2LREA 2PMUA 1FNNA 2UUZA 4EATA 2ZJQF 4HPQA 1IN8A 3T1BA 4XN5A 3FTZA 5LEKA 2VT3A 3BZCA 1F4KA 1K6YA 5IP9J 4XLFA 3HRUA 2M4GA 2PMZA 2EH3A 4JYKA 3V8KA 3TQNA 3CC7I 3HHHA 1B59A 1PUFA 4GYGA 4HNUA 3H5RA 5L3CA 2ME6A 2E34A 3GFJA 2ZXHA 3BZKA 3BG5A 1J09A 2YR2A 3AG2H 3BY6A 5EV7A 4UB6C 3GTOJ 1J0RA 3MFKA 2JRMA 2KISA 2COMA 2WZFA 4PSXA 1VQ5I 2CV0A 4UUVA 4XMZA 2LH9A 2BGCA 5HODA 1IRXA 2D1HA 1HLVA 2L7FP 1BW6A 1ZR2A 4HX7A 1FOYA 4DYQA 2N8GA 2VJIA 2XSJC 5IYDJ 1TQIA 2XF6A 1V5GA 4CZZA 4ZYHA 1B9NA 1HQCA 4EV0A 3M4OJ 2M30A 3HBLA 1MBJA 4AU7A 1OCRH 1YE9A 3MKYB 4OIQF 4BJ5C 2P7VB 5FD6A 3K2ZA 3R0AA 4XN2A 4ZW5A 1JHHA 1I3QJ 1GV2A 4BE2A 3M8FA 4XMYA 2NYXA 3VVLA 2CW7A 4P55A 2IS1A 5E3NA 3E0JB 3QPHA 5CLSA 3WQSB 4LK1F 2ISZA 1IXRC 2GIVA 1ONVA 2JUGA 4G8XA 1R0KA 3DLAA 4BEHA 3FULA 4B3AA 4ZH4F 5J1RA 3LSRA 2VI6A 3FUFA 2IPQX 4QMEA 1MH3A 3GTQJ 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 3WQQA 3HOVJ 5M5XJ 5LBQA 5D4SA 2P6SA 1E0EA 4KUMA 3G71I 1XG1A 1B6AA 2AQFA 2E7WA 2KRCA 4R5VA 5K5QA 2KLOA 3I0TA 4CA0A 2DPUA 2H8RA 3WTWC 4MEXF 3KE2A 1WGXA 5F04A 2A5WA 4I02A 2EZIA 5EF6A 4E6KG 4KA4A 1YJWI 2XPZA 4X2UA 4KIFA 1MNEA 3MQ0A 4YIFA 5BPIA 3JT1A 1O3SA 3PUUA 2VJ5A 2A6TA 4UVAA 2ICWG 1JTXA 5K7ZA 1WJCA 4FE7A 3RPUD 3OWTA 5GAGJ 5HLTA 3QYBA 5IYBJ 1S5LC 3CJNA 3O8HA 4MTDA 2NAZA 2P5KA 4FISA 4OMYA 4XONA 4XOPA 4ZYDA 3IRQA 1TWAJ 4FASD 3FU0A 4C3IJ 1ENHA 3E5QA 4A3DJ 2DA6A 4PZJA 4L5JA 1Y8QB 4MIMA 3I53A 2DN0A 2DAOA 2R7UA 1B72A 4QPQA 3HG9A 3QPTA 4Q5SF 3CCRI 2M5WA 2FOKA 1ITYA 5EDNA 1O3QA 2C82A 2R5ZB 5LEJA 3CP8A 4E70A 4Y13A 1ZAOA 3FU3A 2E60A 2XASA 1K79A 2A05A 2NS0A 1MBKA 4A3CJ 4PJ0C 4F3QA 1D0YA 1A36A 4D5CA 2HVSA 1SMYF 2DOEA 2OC6A 4FT8A 2DA1A 1VQ8I 1B1BA 5BMZA 4NQWA 2HZTA 3H0DA 1R71A 2HPTA 2HOEA 2PMZN 1SVOA 2RVCA 3M1CA 1EKEA 4IL6C 1BI0A 4Y6SA 2MFZA 3MMYB 2P5LC 3IH3A 3L2UA 3I5UA 1TT5B 4ASNA 1Z7LA 4LG0A 2LBFB 4ESJA 1VTNC 4HDVA 4AM3A 3DU5A 4MGRA 3REOA 2M7AA 3WG7H 3WTTC 4F92B 4U7BA 1Z6TA 1XS9A 4LUPA 3NRVA 3TO6A 1XN7A 1MDMA 1UHSA 5D6EA 3M7GA 1S46A 3QP5A 4AR1A 1U5TC 2BZTA 1FSHA 1W5TA 3FUJA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 2M4KA 1T08B 4XOTA 1DU6A 4EGYA 4LB5A 1J5YA 3FKIJ 3JW4A 3OYBA 1RP3A 2M9HA 4NQWB 2JRTA 4BJTA 4UNOA 2VKEA 3ERMA 3LSJA 2KIFA 1BOAA 3WU1B 3RYPA 1QVTA 4HW0A 4OOIA 3A02A 5EEAA 1SANA 3CLQA 1Q0LA 4XLEA 3TO9A 1ZLJA 4PSWA 1JXSA 3OYCA 1A31A 1WH7A 1V5FA 5FFXA 4KISA 2K02A 3HOUJ 3ANLA 1IC8A 2MH2A 2OCCH 1IXSB 1UFMA 4NNJA 3I59B 5EEHA 2XSDC 3K1NA 3VVMA 2WA0A 3P7NA 2RAEA 4M3DA 1X1AA 4QHPA 2K9NA 2F48A 4TV7A 4N9IA 5ILUA 2G7UA 1D3YA 3MVPA 3BTJA 4DZJA 4KT5C 4BS9A 2K40A 2P4WA 3FXKA 1HSJA 2DA7A 1OCCH 1R4NB 5BNGA 1FOXA 1SFXA 3GXOA 2DO7A 3SZGA 2FBIA 3F6VA 4KMUX 3RSNA 4LIUA 3FU5A 3ZMVA 4ZC3A 2MAPA 3OYJA 4AYBA 3I64A 3WE2A 1M1EB 5F64A 4XNAA 1X1DA 2CG4A 2IS4A 5DM6F 4L9TA 2Y1DA 3ZMSA 3RKQA 4U88A 3VYRB 4UV8A 5JLXA 3Q9SA 2R7SA 4DJAA 3U1KA 4L9JA 3S2HJ 1MW1A 1X3UA 3Q0UA 5D5XB 2TDXA 4BJ6C 3S3OA 1JUPA 1J2XA 5DD4A 1OYWA 1FLIA 1LDDA 2HTJA 2VQGA 1FY7A 3HKZN 3FDYA 2ZMEC 1FBUA 5IOZA 1HW2A 4N0BA 3H9GA 1DPRA 3ROUA 4Q48A 1QVUA 3BQZA 4XN1A 5EGOA 5B1AH 5JC1A 2WB1A 2XB0X 3K4KA 1X1CA 4ETSA 4N4OB 1USSA 3T0YA 1MZBA 3G73A 3CESA 3TP0A 3OIQA 1MGTA 5IT9Z 4Y6PA 3K4LA 3ZP5A 1C0WA 1JJ8C 3C18A 2LKXA 2Z16A 1ORKA 2FFLA 1R7JA 1B8IA 2LNBA 3D5RC 4I6ZA 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 4A3EJ 2V7FA 4B44A 2DT6A 4OOFA 2JVGA 4CCKA 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 1S9HA 2WY7Q 4G7HF 2HS5A 4HBLA 4MNUA 2CYYA 1P6RA 1RZ4A 2KMUA 3PSFA 3R4KA 1Y1WJ 1QO0D 2WZGA 1CF7A 1CQTA 2CUFA 3JRDA 2L02A 1YHQI 2UWMA 1LUJB 4FLQA 1TT0A 5B1BH 1CF7B 3CO7C 4AWXB 2JA6J 4D5FA 3ABKH 3CMEI 3BDDA 2CW0F 4UUTA 1BJZA 3JSOA 1LVAA 3F72A 4CSWA 4DBQA 1WJFA 3FTSA 4EM1A 3ESWB 2HR3A 1P4WA 2G0EA 4OAYA 3OYMA 3GFIA 4A3FJ 3HB9A 2GLOA 4L5EA 4EJUA 4ZW3A 2ZMEB 1TLHB 1KU7A 2E7XA 2QWWA 1P9QC 4G9YA 2K3PA 4I2OA 1I3AA 2IW5A 3GTGJ 4BY1J 3S16J 3OYDA 5KAIC 1ETVA 2O03A 2PMHA 3CF2A 3FIWA 3LQRA 4AIKA 1KU9A 4XMTA 4GGGA 1TQMA 1B4AA 3GZ6A 2NXNB 3Q5FA 4C30A 3RIRA 2R7FA 4Y3OA 4I76A 4CZCA 3MZYA 5FFZA 1YYVA 3L1PA 2JPCA 4FCYA 4LLNA 3OYEA 4JX5A 1YIOA 1APLC 4IQ4A 3CD6I 1UB9A 3KP4A 2V1DA 3K70C 2Y1EA 4J00A 1I27A 2CS3A 3QODA 1RIOH 1A5JA 5J1UA 1ZELA 2A3SA 1G3SA 2BXZA 2O6GE 5CQGA 1GVDA 1T0FC 3TO7A 1ONOA 2EBIA 5E1WA 3A14A 2HEOA 5CPRB 5FD5A 2X6OA 2F6CA 2L4MA 3IC7A 3Q9VA 2WB1N 2L2OA 3AAFA 2LD5A 5L3BA 2OF7A 3ZQFA 2OA4A 2GM4A 4FTHA 5FLMJ 1J9IA 2VQHA 3RJPA 3I55I 3FM5A 1Q0QA 2ZCWA 3GYHX 1XC5A 3MZ8A 1IDZA 5DCFA 2EIMH 1ZR4A 5KVRA 4L2LA 1UG2A 3LMMA 4K5NA 3O3KA 3IV5A 4BBSJ 2JTVA 2EQRA 2I8DA 4P9UA 2HQRA 2G7HA 4PGGA 4UHTA 2H94A 2VKHA 3PL8A 4EQQA 2K9MA 2Y9YA 1JKRC 1HF0A 4C9YA 2HQAA 3QOPA 4D1QA 2A68F 4JX6A 4A3JJ 3OOPA 1ON1A 3HUGB 1XX5A 2Q2EA 3I71A 2HDWA 2LOOA 3WTZA 1X4PA 4V2GA 4LGWA 5GADJ 2NS8A 1R49A 1L3LA 1IV8A 5L3FA 3KEQA 2ZFWA 3V4GA 5EG0B 4ZQGA 5FKLA 2JQ7A 1WI3A 1IUYA 1EH6A 3HJEA 1SG7A 3BR2A 4J01A 2XPVA 1JVSA 4PDKA 4XN4A 3SHFA 1H9GA 3MKZA 1Z21A 3VFZA 1UHWA 2OJED 2D5VA 3VB2A 4M72A 5HVQC 1SFOJ 1R1VA 2XROA 1VQPI 4KNYA 2Y30A 4A2UA 3ZMUA 1IO2A 4JBAA 4RAYA 2MG4A 2DTZA 2CMPA 3D5SC 3RCOA 3H3UA 2V1NA 3HSEA 3H9JA 3S17J 2P81A 3TMOA 1OCOH 1LQ1A 2L4AA 3T8TA 2IS6A 1D8JA 4II3A 1LB2A 3ZQHA 3E7LA 1JKOC 1Y6IA 4XORA 4M6YA 2L9SA 2MLGA 2WWYA 3I54A 3HHGA 2VBZA 2O7GA 1MSFC 4HF1A 2ZSIB 3QRFF 1XDSA 3TDZC 2TCTA 1D1AA 5JR3A 1KA8A 4NHJA 1MMNA 2KIUA 3TP3A 3TOAA 1XSVA 2NNYA 2VOOA 2DQ6A 4XMVA 2KT0A 4ENMA 4R79A 1SD7A 4A03A 2ZXJA 3ONQA 3WTUC 3QJXA 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 3CMMA 3LFUA 4A5NA 5GTIC 1WI9A 3F9KA 4ANJA 4QWQA 4BGDA 3GF2A 2STTA 2R72A 4I98B 4UVCA 4EEFG 2W82A 3FM3A 4EM2A 2JN6A 5E8IA 2ME0A 3GLLA 1TL8A 2DQLA 5JHUA 1IN6A 2VJ8A 2L0KA 4A3GJ 4XICA 2NOGA 2YU3A 1UCRA 2M45A 1JGSA 2BOLA 3CCQI 1ZG1A 4L18B 3KP2A 5L3DA 2R92J 3FTYA 3PM1A 2P7CB 1QZEA 5ICFA 5JVTA 2MA3A 5FGMA 3CQZJ 3J7AY 4QLCU 1Z91A 3CJQB 1G2HA 3KP3A 4Y67A 2B7EA 4XM3A 3FUHA 1MKMA 5ILVA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 4I99C 2EIKH 3BR3A 2JZYA 2BYVE 4HDUA 1VQMI 1JTYA 3HEFA 1KYWA 2DFHA 4CICA 2P5VA 4FX4A 3FUKA 4A3IJ 2QGUA 1ZYRF 3CHPA 1J75A 4CCLA 1ZHFA 5DUIA 4EGZA 5D5VB 5FKOA 2FF4A 1HDDC 3KP7A 2OQGA 3C1DA 4HNVA 2UV1A 5ERIA 2VASA 2LY9A 3V7RA 4MFEA 3SDBA 3DTIA 5DEQA 3H35A 4MO7A 4DQ2A 1K7AA 5F0FA 3RI4A 5E17F 2A61A 1AWCA 2GTQA 4PJNA 1ZK8A 2PJRA 5E1ZB 2GOXB 4HZFA 2X51A 2L9VA 3JCUC 3EBHA 4LLLA 3DCFA 4L9VA 3DEEA 4B48A 4IEJA 4XRSA 2EFWA 2IRFG 4IQJA 4ZW6A 2F5VA 2HGCA 4ZQFA 1I1SA 1V4RA 5EEGA 2H1KA 2RN7A 3E6MA 3NARA 3S8PA 1S29A 2XC7A 1HKTA 5ICCA 4UY8I 1TWHJ 3SJMA 2O0YA 3CCUI 1H3LA 1UJ8A 3N97A 4ZJZA 1RNLA 4CHUA 2BVLA 1K78B 4K5MA 1R6RA 2MBFA 2DDBA 2F5FA 2KDOA 2FMYA 3CDIA 5BPPA 3IKTA 5J4VA 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 4XO5A 4WXDA 3IRRA 2B61A 2B63J 4B09A 1P4AA 2K85A 2CFOA 4IHYA 5L3GA 2OV7A 1XPXA 3WGGA 4A5MA 5CVVA 1L0OC 1WVRA 1Y1VJ 4RAFA 1JUSA 3AG3H 1P7JA 4L9NA 4DZPA 2DFEA 2O61A 1IN5A 4E7KA 1VZ0A 4RB0A 2K9LA 4LOCA 3SZTA 1FYKA 1R0LA 1GV5A 1SD4A 3LAJA 4A0YA 4M73A 3BT9A 5FB2A 3S2DJ 5M3FJ 2KZVA 2OZ6A 1UZCA 2F4MB 4EVIA 3X2QH 3WTSC 2PL5A 2O7OA 4GAAA 4ZZLA 4JNDA 2R4GA 1BR2A 2MYSA 4YEJA 3W6KB 4HX8A 3HSFA 1OCPA 1G3YA 3E5XA 2JV7A 4FHTA 1Z3YA 4IVNA 4BE0A 4RB3C 1S7AA 2NVYJ 4NDLA 3FUIA 4S0HB 2MLKA 2EFNA 3S15J 3RQ4A 2X9DA 1D1CA 2ECBA 4A0XA 3PO2J 2EFOA 5B3SH 1IUFA 2QQAA 2H1LA 1SFKA 3F21A 5KCMA 1Q1VA 3OSFA 2FE3A 2FQ4A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5HDKA 3VSLA 4YIIA 4M71A 4KP7A 1JT6A 2V1UA 1FIAA 1MDMB 1LE8B 3M07A 3VWBA 2G9WA 4BHBA 4RSYA 3N05A 4BQOA 3IAS2 1A6IA 3AKZA 4XN3A 1WQ2A 1T38A 4IRIA 2XV4S 4UV9A 4CCOA 4RCVA 2W00A 1JT0A 2OD5A 1KONA 1LNWA 1Z05A 2Z5UA 1OCZH 2R5YA 1S6LA 3GTLJ 3BWGA 1Y0NA 2MD5A 3A2KA 2DJIA 1YS7A 2O5RA 2XAFA 4BYYA 2VLAA 3IWZA 3E6CC 3HM5A 2XAHA 2Y9ZA 4CCNA 2L7ZA 3B7RL 4WXCA 3JTGA 1EH7A 5M5WJ 3WU0A 2A5YB 3ANMA 2STWA 4QIRA 1WKMA 2IAIA 1YTYA 1VQ9I 3W2AA 3NAUA 5H6QA 3RTRA 1D5VA 4ITVA 5HLGA 2QQBA 4PJMA 1O3RA 2VXDA 2MD0A 1V5EA 2JUCA 3FMQA 1U5TA 3BPVA 1USTA 4Y4RA 2DA3A 5IPAA 4YFNF 4UUSB 1BBYA 2HDDA 4V19K 2YS9A 5GTHC 1WHUA 3RPQA 2M1BA 2LSOA 3P9IA 1EF4A 2KJBA 3CTAA 2PI0A 2XPYA 5GAHJ 1YIJI 3GW2A 2VODA 3GTMJ 4XKBA 2R70A 2W1OA 4QTRA 4ZX3A 5FROA 2DMUA 2QLZA 5LGNA 1HS6A 1AOYA 3CHQA 1FP1D 2TRTA 3G4SI 1X3ZB 2D2WA 2K4JA 1HOMA 2PG4A 3VDXA 1JG9A 2JCYA 3ZQIA 5JAZA 3UERA 1VQOI 1EJ9A 3S14J 3OY9A 1RKTA 1UMQA 2ZJ2A 1MW7A 1YO5C 2QQ8A 5E3OA 1IW7F 2XRNA 3DPUA 5ICEA 1MVYA 2F5DA 4AVZA 3M3YJ 2R7DA 5D8KB 4ESFA 3LNQA 2BY2A 1MMSA 1R58A 4ZQHA 2MH9A 2Y31A 3GBGA 3WU2C 3CF5F 3CUQB 3QWLA 3WTXC 2XF7A 3GCMA 3GX4X 5LHGA 1LKXA 3I58A 3JRGA 4IF4A 2BY1A 2GA1A 4KITB 1O7LA 3K69A 1ZKGA 2DA4A 1IV6A 3KCCA 2JD1A 5LGTA 1TC3C 3K0LA 4S05A 1X58A 3B37A 2DW4A 1V55H 2DU9A 4G6QA 4DNCA 2JVHA 1K6OA 5LHHA 3G1LA 1OFCX 2OBPA 4B47A 2ZFUA 1R5GA 1DQUA 2XIGA 2L54A 3TL4X 4K5LA 2DOFA 2OUMA 5CVJA 3MEXA 1VQLI 1MNDA 2L3DA 4LB6B 3MN2A 4YELA 4BH9A 3S1QJ 4M9XA 4BAYA 2L9NA 4RGXA 4RGSA 3A01A 1X3WA 3OOUA 3DQVC 3G1OA 2WY8Q 2JPBA 3W3CA 1P7IA 5DDGA 1LDKB 1FSEA 4MEYF 4E7IA 4PGHA 1FJLA 4XNBA 4HSTA 1T8IA 3EUHC 2RJIA 2VKVA 3BTCA 4RM2A 3VYTB 2FD5A 4CXFA 5JO0A 3RASA 2HYGD 3ZN1A 4XIDA 4HQMA 5C4XJ 5KAFC 1YOVB 4JOMA 2DI3A 3AUAA 1ZG3A 2EFQA 1WJAA 3A03A 3QYFA 1KYZA 5IP6A 3FX3A 1W36C 2WV1A 3IKVA 4KYWA 2IBDA 2IS2A 3DKYA 3B73A 3LOCA 4IKFA 1FWZA 2QKLB 1NTCA 4GXOA 3F8MA 4XLNF 5F08A 1I50J 1KGSA 3JRCA 3Q43A 3CCYA 5HLIA 2W84A 2ACJA 4O3MA 3WODF 2HVQA 1K4TA 5IOYA 1SEUA 3U21A 2VUMJ 3Q44A 3CLOA 2FQ3A 3FXOA 1OCTC 1QPIA 3F8NA 2HOTA 3W2VA 1JHFA 2AO9A 2HYFA 3SQNA 4G6TB 4P1WA 3BROA 3HL2A 4Q47A 1PYVA 2EFPA 4W1UA 3ERED 1WSUA 3FUEA 3FHNA 4HG2A 1ETKA 2F5CA 3FBIB 3PNTA 3C3WA 4ZYAA 2RNGA 3CCEI 2ZKZA 3SFIA 2Z9OA 3I59A 2CUEA 3K1PA 5F0HA 2PBIA 2X1DA 2HYJA 2E1MB 2HOSA 4NC8A 3IWFA 4ZDPA 1U9NA 4R5TA 5B66C 2XPUA 1U6GA 1VNDA 1WZ2A 4K2EA 3K9TA 3S93A 1OJLA 3DV8A 3UR3C 3CCVI 1AKHB 2DPDA 4IRHA 3KYDB 4Q4ZF 5FRMA 3ANNA 3FK6A 1WCMJ 2KPMA 1DDNA 1HXDA 4B43A 1X1BA 4MLOA 2AXTC 1XDUA 2KKOA 4M74A 2VB6A 2V9KA 3HOXJ 2Y69H 3DTEA 2ZNYA 2EWNA 2E19A 1RKWA 4KMFA 2KZGA 4C2MJ 1YW9A 3LA2A 5FLVA 1QZZA 2JA7J 5E79C 3D0SA 2RQPA 3LSGA 2KDZA 1SVLA 1HDPA 5C4JJ 3F22A 3UKGA 2WADA 1WJDA 2RNJA 3P9CA 2ELJA 4M3FA 4XMWA 4RAZA 2C5ZA 3VYUB 3M8JA 4XLAA 3WE3A 3S3NA 2VKDA 4HX4A 1TW3A 2JCVA 4KT6A 2B9SA 4LG3A 2Z1DA 3H1CA 5ILSA 5D5WB 2K27A 2QVWA 1HW1A 2LK2A 5DV5A 2NVQJ 2VXZA 2WV0A 1LVKA 1H0MA 2OPTA 3QPLA 1QHGA 1F5TA 2EPFA 4M9ZA 1F36A 5A2QK 3V7SA 2E1MC 2XKOA 4ZTJA 2Z33A 4FLOA 3W6VA 3WQRA 2LLKA 4AUXA 3H92A 4RGRA 4PJLA 4ZW8A 3OYFA 1S72I 2LVSA 1Z6RA 1I1GA 3CO6C 4R8HA 4CH7A 5D5UB 5IT3A 3CHOA 3FTUA 1BI1A 1W0UA 2Y2ZA 4BE1A 1BR1A 2CQ7A 3VODA 1N75A 1KU3A 2EZKA 1CGPA 1PVEA 2XHKA 1YJ9I 1MNMC 1ZRDA 1YW8A 4HA8A 2PJPA 2NVXJ 1V3FA 2IT0A 4ENJA 1K61A 3CCLI 2H6BA 3FXMA 1N77A 2QVOA 5D4RA 2AS5F 3GZNB 5EJCA 5E3LA 2EINH 4XRSG 2PEXA 3PIOF 3CCJI 1MIJA 1Y0UA 3BR6A 2ZJPF 4M3GA 4OOEA 4X6AJ 2E2IJ 1I6HJ 4AICA 3OR1C 3ZHYA 3KLOA 4E4HA 3KIOA 2IGNA 4MQVA 1ZGWA 3FH8A 3V7CA 4WXHA 3VYSB 2DODA 1MMDA 1LFUP 2YX4A 2HTSA 4RB2C 3GLXA 3ECHA 1MBGA 4WF2A 2X6WA 4AR9A 2ISYA 2BBYA 1F43A 1QNTA 3PSIA 2LKSA 3A01B 1ERDA 2LTPA 3R0JA 1ZLKA 4QUOA 3CP2A 2E71A 3LSPA 1RRJA 2CQNA 2HXOA 3JSZA 2QKMB 1HC8A 4XSXF 5KNLA 2BHYA 2KRFA 1H8AC 1H88C 1TNTA 4X1EA 2E5NA 3V8LA 1E3OC 4M9SA 5EZHA 3KYCB 1MJ9A 3AU9A 1WH5A 2YU9J 2R7OA 3DFGA 4DGWB 1T0FA 1X1PA 3RKXA 1X3ZA 3HYIA 2UZKA 4WWCA 2CQQA 4M6VA 2EZLA 3NQOA 3CXBA 1JKQC 3B6AA 3H0GJ 1FX7A 4QPOA 4B1RA 3L9FA 2IGKA 3CZ6A 4U7DA 3EYIA 5K7HA 1U8RA 3ABUA 1JUMA 4RAGA 4CCJA 4GO1A 1S8NA 1IDYA 2WBMA 3FK7A 1J7KA 2P8TA 3HTSB 4ON0A 1TQPA 2NVTJ 1YFHA 2GIZA 4E7HA 3VSKA 3L2RA 2JT1A 1D5YA 1RESA 3N4MA 1STZA 3K1MA 3FXQA 2CU7A 3W6JB 1MJBA 1X4OA 2GA2A 2VT2A 3V8JA 1VQKI 3RC8A 1LPQA 2X0LA 2ZXIA 2R59A 4I0AA 2DMQA 3OIPA 2ZO4A 1QPMA 4XLHA 3L2CA 1YRNB 1IF1A 3EPZA 1MJAA 4EJVA 1TBXA 3OV8A 4LK0F 5DYMA 4A6EA 2RDPA 1X2MA 2Z99A 2PGGA 4A3BJ 3ML6A 1WJ5A 2R0QC 1A04A 1EA3A 2EV5A 3PIPF 2R5ZA 2Q1ZB 5F6FA 2CFXA 2FBKA 3ZPLA 2XGXA 2FU4A 5DYFA 4CUGA 4N4NB 3FBNB 2DLLA 1PDNC 2MC4A 2EJRA 1R4MB 1E17A 2CSOA 3PNVA 2HKXA 4NC6A 4OIRF 1P4XA 1RPWA 3U1DA 3HZJA 1TW2A 4PVBA 2H09A 4A6DA 3EUAA 3OS2A 2DMPA 5ED4A 2VQLA 3LSMA 1MH4A 3P5JA 1Y56A 3T5XA 5HDNA 5JLWA 3RPUA 1JGGA 2QA4I 2KJCA 1D1BA 3LSHA 5J8CA 4DIQA 3L2QA 1UHMA 2R7ZJ 1G59A 3IP4B 1W36D 3CCSI 3QAHA 1PUEE 1FOKA 3CUOA 3DBLB 3GUDA 1W5SA 2BY0A 4JK1X 4ZZDA 3FU6A 4Q4EA 2V9VA 3E6DA 4CYCA 4BDZA 1ZGAA 4XSZF 3LA7A 3BCAA 4A12A 1U8BA 2R7VA 3C2BA 3L2VA 2HPIA 1IN7A 2HXIA 1G8XA 1SVMA 2CH0A 2LY1A 1SC7A 1A35A 2LC2A 4ZTFA 3H36A 3WG9A 1EH8A 3VPRA 2OTLI 2XAUA 2A69F 2IEKA 5K7FA 1MBEA 3SEZA 4ZDLA 2V26A 3P9KA 3BJAA 3RC3A 3OS1A 4MS6A 2YPRA 3G1MA 3DEUA 2R5YB 4PUSA 3H3ZA 4XQFA 2I10A 2IA0A 3HSRA 2IGOA 1UELB 5DULA 4ZW7A 1OISA 2PN6A 1WFXA 2HPOA 3CMYA 3G6EI 3FUNA 3LAPA 1RC9A 4FETA 2Y0SN 3BR5A 4EJOA 1Z77A 1RR7A 4R7LA 2RKHA 1FC3A 4QPEA 1S3JA 5JI6A 1GT0C 1I6XA 4KJZA 4H0EA 2WC2A 1Y39A 5J1YA 1K5HA 3CZLA 1LE8A 2LP0A 2EZHA 2K9SA 4F93B 3OYIA 4RLQA 2H27A 2ZNZA 1RUOA 2WPGA 4XLCA 2ETHA 1MMGA 5LGUA 2DK5A 2JK3A 4ZYGA 1Z67A 1U5TB 2XQ0A 3GTKJ 1DP7P 1FTZA 4XRMA 4FLRA 1OR7A 2ZC2A 4B8XA 2XAQA 2KIMA 1BL0A 2IA2A 3E97A 2X48A 3OL4A 3CUQA 5K5RA 1IZ1A 1MBHA 4FX0A 5E1XA 3C2HA 1XGMA 1GVJA 2VQCA 2IJLA 5AIPA 2ZBKA 3R60A 3A1YA 2ZB9A 3HDDA 4F55A 3CDLA 4MQ9F 5E20A 4I01A 2W57A 1AA7A 4O6JA 2PUSA 2MABA 1NG7A 2VJJA 3COAC 3A0HC 3K7AJ 3H5AA 2VONA 1IRFA 3NWTA 1YITI 5IT9K 1ACIA 3B3BA 1FOWA 1OR7C 1ULYA 1MBFA 3ABTA 2DTRA 2W4SA 4GYIA 4IPAA 5EZGA 5LRSA 3FH7A 2AQEA 2HDCA 2LMDA 4ESBA 1ZRCA 3E1SA 2QSGX 4OIOF 5CJ9A 2MAOA 1UG0A 5DCMB 2UXXA 2MGQA 2NNNA 3H3VK 4XK4A 2FRHA 2RGVA 3RKYA 2P6TA 4ZX6A 5BOXA 1W7PB 4O5VA 1HKQA 3SFZA 4ZYEA 5DM7F 4Y6RA 3CHRA 4LLGF 1SAUA 1K78A 2R7RA 4Y52J 4P5OA 3BLYA 4HF0A 2VN2A 2JSPA 4BXXJ 4R1HA 3MKLA 3BZ6A 3SEQA 2LFBA 2YX7A 3FHZA 1QGPA 5K1YA 3CCMI 3H9QA 3UNGC 1OKRA 4AIHA 1IJWC 2EK5A 2PX9A 3PO3J 1R00A 2W7NA 5JHFA 5FRNA 1BC7C 2VC1A 3WHCA 3IAM2 2J5OA 2QF7A 4Y33A 5FLXK 3FTXA 4KICA 1BIAA 2E2HJ 1BIBA 3HOZJ 4XO3A 2EA4A 3BG6A 3I9V2 5FKMA 1FT9A 3PNYA 2LRDA 3U2RA 3WHBA 4ARFA 5JMWA 1G3WA 4BY7J 2L5QA 2VJ4A 1U0JA 4FQGA 3K10A 3ZMZA 1FBQA 3K4NA 3ZOBA 1FEXA 3ABLH 4D0PA 4HNTA 2MW8A 5C3EJ 4RDUA 3QPSA 4U0WA 3DLLF 3MKWB 3HGGA 2QBYA 4AYBN 4IOAF 4XKCA 2DMNA 1KQ0A 5J6XA 5FO5A 5DD8A 1R22A 2VBWA 3O8GA 4BXFA 3FZVA 5JNLA 1I5ZA 1JKPC 2ZMEA 5J3LA 2IP2A 2V6CA 3QU6A 4C3JJ 2VPLA 1XTAA 2CQXA 1LFPA 1P92A 3ULQB 2MSYA 2O9LA 3J7YJ 1HCRA 3FXUA 2NOJB 1T6SA 3AG1H 3H5NA 4K5OA 4Y17A 2RC4A 1WPKA 4M3EA 4CCMA 1JJ6C 1F1ZA 1SFEA 2BW3B 5ICGA 1MMAA 1D8KA 2QSFX 3K4CA 4FCAA 3LSIA 2OTJI 2GZWA 1TWFJ 2DMTA 5CVRA 1EV7A 3ZQGA 2CW8A 3BJOA 4ZX5A 2HQ5A 5IYCJ 1AHDP 3K70D 1FBSA 2BXYA 3HOWJ 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 5J47A 2IVMA 4DYRA 1FMVA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 4BDYA 1W4MA 3FXLA 3JTHA 4LG0B 2WAFA 5IP7J 3LL7A 3B2PA 1NG6A 4BQQA 3IH4A 4Y7NJ 4PFOA 3EYYA 1X19A 4ZQEA 4Y15A 4CYCB 1OQYA 2D45A 1T2KA 3B7UX 3O2PE 2P0WA 1XSDA 2DT5A 2CV1A 2B0LA 1I39A 5HLHA 1OYIA 2KP6A 2GOMA 4U87A 5E8GA 4XO4A 3HW2A 3DU6A 4UXNA 4XKVA 2VBYA 1TWGJ 3J7AO 1SMTA 3IH2A 1DPUA 2DBBA 3F8CA 3T8RA 2DXIA 2LG4A 4OINF 2V4JC 4EJWA 2OU2A 4LJZF 4HLYA 3Q0WA 4B3XA 4C3HJ 1R5HA 4XL9A 3KEYA 3DF8A 3B2XA 3OYHA 4ENNA 1G5AA 1O4XA 5TJJA 3EBGA 3J80K 3M9AA 1ZGJA 3BOQA 4OMZA 3VOEA 2BV6A 3OSGA 4ENKA 5TGTA 2EILH 3CC4I 1QQIA 1H9TA 3U9WA 2O8KA 2DDAA 5LFAA 4QIWN 3ZR8X 2PFBA 4XN9A 1ONNA 3FTVA 2VL8A 2X4HA 4M3BA 3K4MA 2X6YA 3WTYC 1DGRM 1TWCJ 1XCBA 4U0VA 1XGNA 5BPDA 2W48A 2JA8J 2F5EA 2HVRA 3KEDA 3KFWX 4BL0B 3ZHXA 2H8WA 4X0GA 5CVUA 4YRVA 1GLNA 4XKWA 4IJAA 3T8VA 2NS7A 2D1VA 4BUPA 4YFKF 2BE5F 2DA2A 3Q3SA 4I0BA 5B5EC 1LDJA 2ZSHB 1ETYA 4HF2A 3ZXSA 2F4IA 3LSKA 4XMUA 1Q1HA 4PU2A 2PLYA 2XAGA 4J19A 1IG7A 4XN0A 3S1RJ 1VQNI 3TKYA 5HS8A 2K86A 3K4JA 1TTYA 4A69C 1RETA 3BTLA 4RMNA 2NRAC 5FJ8J 1U78A 5F1RA 4NB5A 2DT7B 4JP0A 5IY5H 1MD0A 2WAEA 1YS6A 3B6CA 3EUKL 4RGUA 1VQ6I 3RZOJ 3O6BB 5KHDA 2ZXWH 4BBRJ 4EJTA 2HOAA 9ANTA 5HNFA 3K6GA 2R93J 2FSWA 3OYLA 3FMRA 4DOZA 2A6EF 4JQFA 5KK1A 1H89C 3TW6A 2R7QA 3EBIA 2CJJA 4RVBA 2CGPA 3GTPJ 1HSTA 1VI0A 3HTUA 5GP9A 1R9TJ 3QOEA 2JCXA 2ID6A 4PCQA 2M0CA 5A2QZ 5K5OA 3UEQA 5GPAA 2Y1FA 2Y48A 1TP4A 1YX3A 4ABZA 4HRIA 3ZQLA 3QU3A 3LA3A 4FE4A 4XR6A 5J8FA 1T33A 2OZUA 3C2GA 1W7PD 5DUKA 1IAWA 1DU0A 2ESNA 4UB8C 5FKNA 1TZLA 3BG9A 5HS7A 3VEPA 4V2FA 2BVMA 1Z1DA 4AIDA 2R3SA 3D1NI 4OU0A 1IRGA 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 4BHPA 1U2WA 2JA5J 2M8GX 4JX4A 3E5UA 2VOPA 2GBYA 1H19A 2LDUA 4IHWA 1OPCA 4LMYA 3DPLC 4XNDA 1ETOA 1ON2A 2JWTA 1SAXA 2J5PA 1LEBA 3BG3A 4IO9F 2M34A 2EGHA 5H2FC 1IGNA 3OIOA 2O8XA 2HQNA 2V1XA 3BTIA 2NVUB 3HKZA 1FP2A 3B34A 2AHQA 2I5UA 3JRBA 3HXLA 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 1XGOA 3JAMZ 2OQRA 3HGYA 4DW6A 1NK3P 2BY3A 2LR8A 4E7SA 5TRDA 4BQAA 1FMWA 3PUBA 4A3LJ 1SC5A 2PJRB 2FOWA 1D0ZA 2QENA 4PFPA 1O57A 2XKPA 3ZGKA 1WWXA 1YLFA 2A6HF 1FYLA 3PUFA 1VFCA 3B7SA 3GO5A 3I4PA 3FKJA 3RZDJ 2RREA 3MD2A 3FH5A 1MW2A 2CUZA 3OMYA 1LJ9A 4XNFA 1KZHA 5BS6A 4HSRA 4E7ZA 2XRLA 3HRSA 5HDGA 1UAAA 3SXYA 4BEHB 3J81Z 3J80Z 1XGSA 2GAUA 5L3EA 4AYSA 3KYLA 4K5PA 4EM0B 2C6YA 4IOCF 2MC3A 2UXNA 5BQTA 2FNAA 3KZYA 4BU2A 2GWRA 5F0CA 3IHUA 5M3MJ 3KLNA 3UCQA 2JMWA 4G7ZF 1VQ4I 2CWEA 2JJ7A 4P96A 3RDIA 2M8EA 3F0CA 2O3FA 1MW3A 5EYRA 3F23A 4C2UA 2L9RA 4E7JA 4D7MA 3ZI0A 1GHCA 2COBA 1N78A 1B8IB 1BI3A 1XMAA 4IRGA 1N25A 3J7ZI 1LEAA 2JD2A 1SQMA 4ZQTA 2LY2A 1K4SA 3DBHB 1ZS2A 4Q4IA 1K83J 2DA5A 3FWEA 1ZRFA 1T1SA 2M87A 1LFBA 2HKOA 3AFHA 5H20A 4D9JA 3CZKA 1NK2P 3HC7A 3DPTA 2K5CA 3KX2A 2EA2A 4XN7A 3HPHA 1VF9A 4XMXA 1QU3A 3ZQQA 3OYNA 1ONPA 2E1NA 3SYTA 3R61A 2QBYB 2E36A 1WRJA 2HNHA 3S32A 1R1TA 3M8EA 1PJRA 2LF8A 2JA2A 3FF5A 5FWQA 4HYEA 3OYAA 3ZHZA 1QZYA 1QRYA 3TDUC 2DOAA 2HU9A 2E35A 2GQQA 2Q2EB 2IXSA 4A0ZA 4F91B 3OL3A 2QYOA 1U9OA 1XMKA 2KFDA 2V6EA 4IHTA 1XSXA 3WTVC 4AC0A 3KZIC 3ZN0A 5C44J 1IRZA 1V54H 2YUSA 1T56A 2DCEA 2FX0A 1AU7A 3HIFA 3EDPA 2OAZA 1PUFB 3PQKA 1AKHA 1RI7A 2KHMA 1YI2I 4KN4X 4IHVA 1G3TA 1XMXA 2DJNA 3SDGA 3KEOA 3WGHA 5M5YJ 4W97A 2Y0SA 3CJRB 4HQEA 3GVAA 1W0TA 2R7TA 4J3BA 4KDPA 3ZQ7A 2F4OB 3BCBA 3FISA 4KN7X 3NWSA 1WJBA 4L0YB 5DLLA 1ETXA 3ABMH 3KP6A 1FZPB 3IIEA 5AENA 4H4KC 4QSHA 4F7ZA 4IHXA 2IGMA
chains in the Genus database with same CATH topology
4BNCA 3FHEA 2RV8A 3ISPA 5JMPA 5D8LB 3WGIA 2DQMA 1GXQA 3KP5A 4KIGA 2ZXGA 3F8FA 4CYDA 3FXRA 3CHSA 4HAMA 1ZH5A 1R36A 3R0IA 2QJ1A 4WCGA 1XD7A 2VC0A 1ZARA 3GEZA 1ZG5A 2QQ9A 3CIAA 4BXUA 3TOBA 1ODDA 1O3TA 3CZGA 3ECOA 2AXLA 3A06A 3BPXA 4XRFA 2FXAA 3D5LA 4GCVA 2W85A 1Z9CA 1JGIA 1F9NA 2LF7A 4OIPF 2DFIA 2WTEA 3F6OA 4PW4A 3CDHA 4N9HA 3ELKA 2Q8KA 2VBXA 1ZREA 2FA5A 5AIQA 3FTWA 1Z7UA 1MW0A 3G3ZA 2ELHA 2LKPA 5CYVA 1PP7U 3RYRA 3FUDA 3LWFA 1SD5A 3LFKA 2BEOA 5HNHA 1HW5A 4HOBA 4YFXF 2Z3YA 5DCMA 1DUXC 4R5XA 2Y1CA 3LSTA 3CZEA 1REPC 2E1CA 3BJ6A 1BI2A 4M6XA 4Z2YA 5JBIA 3JSPA 4L0ZB 4HV5A 3DXJF 1YG2A 6PAXA 2Y75A 4FLSA 1YW7A 1SD6A 3ZMTA 2H6CA 4LFUA 1QBJA 1Q0HA 2JD0A 5E18F 4RB1A 2K4BA 2IA1A 1P2FA 1KQ9A 1ZN2A 2QZ8A 4XN8A 2VE9A 2Y1GA 4L5IA 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 4G7OF 2XVCA 4BKXA 3IL2A 4YG2F 4WK8F 5LRRA 1T1RA 1E2XA 3GZ5A 2A07F 4ZX4A 4XBFA 3HOSA 4G94A 1R1UA 1XB4A 1YQAA 3ZMDA 4IHSA 4EMSA 1GW6A 4ZN6A 1S7OA 1IN4A 1G6NA 2JSCA 2FEZA 1O7FA 3U9GA 3EETA 1OMIA 2EV0A 3GWZA 4BHCA 3PQJA 3FMSA 4U0YA 5AONA 3DKWA 3EQLF 2V79A 3L00A 2CQKA 3CUQC 2F2EA 1PP8F 2W25A 3E6BA 4XLPF 1BC8C 2XUBA 2FMLA 3HUGA 4DPRA 2GXGA 4IXAA 1BJAA 3MAJA 1IXCA 1TNSA 1XCVA 3RKWA 2DQRA 1T98A 4KFCA 1J59A 3TGNA 4P9FA 3MZHA 2CO5A 3SZPA 3AU8A 4LD5A 2W24A 4GAEA 4I09A 3M1EA 1NHAA 5LLQA 3FUMA 2PQ8A 1BM9A 2A7OA 3HRTA 5HOOA 1OYYA 3NEUA 3QP6A 3DP7A 3B7TA 1U3EM 2K7LA 4AR8A 1GXPA 5H6RA 4HLXA 2XAJA 4AD9A 4CGZA 1G4DA 2Y0MA 1BN5A 2HWVA 4CO8A 4S04A 4RS8A 2PMUA 1FNNA 1IN8A 3T1BA 4XN5A 3FTZA 5LEKA 2VT3A 1F4KA 3HRUA 3V8KA 3TQNA 3HHHA 1B59A 4GYGA 5L3CA 3GFJA 2YR2A 3BY6A 5EV7A 1J0RA 3MFKA 2COMA 2WZFA 4UUVA 4XMZA 2D1HA 4HX7A 1TQIA 4ZYHA 4CZZA 1B9NA 1HQCA 4EV0A 2M30A 4OIQF 2P7VB 5FD6A 3K2ZA 3R0AA 4XN2A 4ZW5A 1JHHA 3M8FA 2NYXA 3VVLA 3WQSB 4P55A 3QPHA 5CLSA 4LK1F 2ISZA 1IXRC 2GIVA 1ONVA 4G8XA 1R0KA 3FULA 4ZH4F 3FUFA 2IPQX 4QMEA 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 3WQQA 5LBQA 5D4SA 2P6SA 4KUMA 1B6AA 2E7WA 4R5VA 5K5QA 3I0TA 2DPUA 3WTWC 4MEXF 3KE2A 4KA4A 2XPZA 4I02A 4X2UA 4KIFA 3MQ0A 4YIFA 5BPIA 3JT1A 3PUUA 1O3SA 4UVAA 5HLTA 3CJNA 4MTDA 2NAZA 2P5KA 4OMYA 4ZYDA 3IRQA 3FU0A 3E5QA 4PZJA 4L5JA 3I53A 2DAOA 4Q5SF 3QPTA 2M5WA 2FOKA 2C82A 1O3QA 5LEJA 4E70A 4Y13A 1ZAOA 3FU3A 2XASA 1K79A 2NS0A 1SMYF 4FT8A 1B1BA 5BMZA 4NQWA 2HZTA 2HPTA 2HOEA 2RVCA 1BI0A 4Y6SA 2P5LC 3I5UA 4ASNA 4LG0A 4ESJA 1VTNC 4HDVA 3REOA 4MGRA 3WTTC 4U7BA 1Z6TA 4LUPA 3NRVA 3TO6A 1XN7A 1MDMA 5D6EA 3M7GA 1S46A 3QP5A 4AR1A 1U5TC 1FSHA 1W5TA 3FUJA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 4EGYA 4LB5A 1J5YA 3JW4A 1RP3A 2JRTA 4UNOA 2KIFA 1BOAA 3WU1B 3RYPA 4HW0A 4OOIA 1Q0LA 3TO9A 1ZLJA 1JXSA 5FFXA 2K02A 3ANLA 2MH2A 1IXSB 1UFMA 3I59B 5EEHA 3K1NA 3VVMA 3P7NA 4QHPA 4TV7A 4N9IA 5ILUA 2G7UA 1D3YA 4KT5C 2P4WA 1HSJA 1SFXA 3GXOA 2DO7A 2FBIA 3F6VA 4KMUX 3FU5A 3ZMVA 2MAPA 3I64A 3WE2A 5F64A 4XNAA 2CG4A 4L9TA 2Y1DA 3ZMSA 4U88A 4UV8A 3Q9SA 4L9JA 1MW1A 1X3UA 5D5XB 2TDXA 1J2XA 5DD4A 1OYWA 1FLIA 1LDDA 2HTJA 1FY7A 1HW2A 1FBUA 4N0BA 1DPRA 3ROUA 4Q48A 4XN1A 5JC1A 4ETSA 1USSA 3T0YA 1MZBA 3G73A 1MGTA 5IT9Z 4Y6PA 3ZP5A 1C0WA 3C18A 2FFLA 1R7JA 2LNBA 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 4OOFA 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 4G7HF 2HS5A 4HBLA 4MNUA 2CYYA 1P6RA 1RZ4A 3R4KA 1QO0D 2WZGA 1CF7A 2L02A 2UWMA 4FLQA 1CF7B 3CO7C 4AWXB 3BDDA 2CW0F 3JSOA 1LVAA 3F72A 3FTSA 4EM1A 2HR3A 1P4WA 3GFIA 4EJUA 4ZW3A 2ZMEB 1TLHB 1KU7A 2E7XA 2QWWA 4G9YA 4I2OA 2IW5A 2O03A 2PMHA 3LQRA 4AIKA 1KU9A 4XMTA 4GGGA 1TQMA 1B4AA 3GZ6A 3Q5FA 3RIRA 2R7FA 3MZYA 5FFZA 1YYVA 2JPCA 4LLNA 1YIOA 1UB9A 3KP4A 2V1DA 2Y1EA 1I27A 1RIOH 2A3SA 1G3SA 2O6GE 3TO7A 1ONOA 5E1WA 3A14A 2HEOA 5FD5A 2L4MA 3Q9VA 3IC7A 3AAFA 5L3BA 2OA4A 1J9IA 3RJPA 3FM5A 1Q0QA 2ZCWA 3GYHX 5DCFA 5KVRA 4L2LA 4K5NA 3O3KA 2JTVA 4P9UA 2HQRA 2G7HA 4PGGA 4UHTA 2H94A 4EQQA 3QOPA 2A68F 3OOPA 1ON1A 2Q2EA 3I71A 3WTZA 4LGWA 1L3LA 5L3FA 3KEQA 2ZFWA 3V4GA 4ZQGA 1IUYA 1EH6A 1SG7A 4XN4A 1JVSA 4PDKA 3SHFA 1H9GA 3VFZA 1UHWA 3VB2A 4M72A 5HVQC 1R1VA 2XROA 4KNYA 4A2UA 3ZMUA 4JBAA 4RAYA 3H3UA 3HSEA 1LQ1A 2L4AA 3T8TA 1D8JA 1LB2A 4M6YA 2MLGA 2WWYA 3I54A 3HHGA 2VBZA 2O7GA 4HF1A 3QRFF 1XDSA 3TDZC 5JR3A 1KA8A 4NHJA 2KIUA 3TOAA 1XSVA 2NNYA 2VOOA 2DQ6A 4XMVA 4ENMA 4R79A 1SD7A 4A03A 2ZXJA 3WTUC 3QJXA 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 4A5NA 1WI9A 4QWQA 3GF2A 2STTA 2R72A 4I98B 4UVCA 4EM2A 3FM3A 5E8IA 2DQLA 5JHUA 1IN6A 2VJ8A 2YU3A 1UCRA 2M45A 1JGSA 4L18B 1ZG1A 3KP2A 5L3DA 3FTYA 2P7CB 5ICFA 5JVTA 2MA3A 5FGMA 4QLCU 1Z91A 3KP3A 4Y67A 3FUHA 1MKMA 5ILVA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 2JZYA 2BYVE 4HDUA 1KYWA 4CICA 2P5VA 4FX4A 3FUKA 1ZYRF 3CHPA 1J75A 1ZHFA 5DUIA 4EGZA 5D5VB 2FF4A 3KP7A 2OQGA 3C1DA 5ERIA 3V7RA 5DEQA 4DQ2A 1K7AA 3RI4A 5E17F 2A61A 1AWCA 2GTQA 5E1ZB 4HZFA 3EBHA 4LLLA 4L9VA 2EFWA 4ZW6A 2IRFG 2HGCA 4ZQFA 1I1SA 1V4RA 5EEGA 2RN7A 3E6MA 1S29A 1HKTA 5ICCA 2O0YA 1H3LA 3N97A 1RNLA 4CHUA 1K78B 4K5MA 2MBFA 2F5FA 2FMYA 5BPPA 3IKTA 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 4XO5A 4WXDA 3IRRA 2B61A 4B09A 1P4AA 5L3GA 3WGGA 4A5MA 5CVVA 1L0OC 4L9NA 2O61A 1IN5A 4RB0A 3SZTA 1FYKA 1R0LA 1SD4A 3LAJA 4A0YA 4M73A 5FB2A 2OZ6A 4EVIA 3WTSC 2PL5A 4GAAA 4ZZLA 4JNDA 3W6KB 4HX8A 3HSFA 1G3YA 3E5XA 2JV7A 4FHTA 4IVNA 4RB3C 1S7AA 3FUIA 2MLKA 2EFNA 4A0XA 2EFOA 2QQAA 3F21A 2FE3A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5HDKA 4YIIA 4M71A 4KP7A 2V1UA 1MDMB 2G9WA 4BHBA 4RSYA 1WQ2A 1T38A 4IRIA 2XV4S 4UV9A 4RCVA 2OD5A 1LNWA 1Z05A 2Z5UA 1S6LA 2MD5A 3BWGA 2XAFA 1YS7A 2VLAA 4BYYA 3IWZA 3E6CC 2XAHA 3B7RL 4WXCA 3JTGA 1EH7A 3WU0A 2A5YB 3ANMA 2STWA 4QIRA 1WKMA 1YTYA 5H6QA 3RTRA 1D5VA 5HLGA 2QQBA 1O3RA 3FMQA 1U5TA 3BPVA 1USTA 4YFNF 1BBYA 3RPQA 2M1BA 2LSOA 3P9IA 2KJBA 3CTAA 2PI0A 2XPYA 3GW2A 2VODA 2R70A 4ZX3A 2QLZA 5LGNA 1HS6A 1AOYA 3CHQA 1FP1D 2D2WA 2K4JA 2PG4A 1JG9A 2JCYA 5JAZA 3UERA 2ZJ2A 1YO5C 1IW7F 2XRNA 5ICEA 1MVYA 2F5DA 2R7DA 5D8KB 4ESFA 1R58A 4ZQHA 2MH9A 3CUQB 3WTXC 3GX4X 5LHGA 3I58A 4IF4A 2GA1A 1O7LA 3K69A 3KCCA 2JD1A 5LGTA 3K0LA 4S05A 3B37A 2DW4A 2DU9A 4DNCA 4G6QA 1K6OA 5LHHA 2OBPA 4K5LA 1R5GA 2XIGA 2L54A 5CVJA 3MEXA 4LB6B 2L3DA 4BH9A 4M9XA 4BAYA 4RGXA 1X3WA 4RGSA 3DQVC 2JPBA 5DDGA 1LDKB 1FSEA 4MEYF 4XNBA 4PGHA 2RJIA 4CXFA 5JO0A 3RASA 2HYGD 3ZN1A 4HQMA 2DI3A 3AUAA 1ZG3A 2EFQA 1KYZA 3FX3A 3IKVA 4KYWA 3B73A 1FWZA 4GXOA 3F8MA 4XLNF 1KGSA 3Q43A 5HLIA 2W84A 2ACJA 4O3MA 3WODF 3Q44A 3CLOA 2FQ3A 3F8NA 1JHFA 2HYFA 3SQNA 3BROA 1WSUA 3ERED 4Q47A 2EFPA 3FUEA 2F5CA 3C3WA 2ZKZA 2Z9OA 3I59A 3K1PA 2PBIA 3IWFA 4R5TA 1U6GA 4K2EA 3K9TA 2DPDA 3DV8A 4IRHA 4Q4ZF 3ANNA 1DDNA 1HXDA 1XDUA 2KKOA 4M74A 2ZNYA 2EWNA 4KMFA 1YW9A 3LA2A 1QZZA 3D0SA 2RQPA 3F22A 2RNJA 3P9CA 4XMWA 4RAZA 2C5ZA 3WE3A 4HX4A 1TW3A 2JCVA 5ILSA 5D5WB 2K27A 2QVWA 1HW1A 5DV5A 2VXZA 2WV0A 1H0MA 1F5TA 4M9ZA 5A2QK 3V7SA 2XKOA 2Z33A 4FLOA 3WQRA 3H92A 4RGRA 4ZW8A 1Z6RA 1I1GA 3CO6C 4R8HA 3CHOA 5D5UB 5IT3A 3FTUA 1BI1A 3VODA 1KU3A 1CGPA 2XHKA 1ZRDA 1YW8A 4HA8A 2PJPA 1V3FA 2IT0A 4ENJA 2H6BA 2AS5F 2QVOA 5D4RA 2PEXA 1Y0UA 4OOEA 4AICA 3ZHYA 3KLOA 4MQVA 3FH8A 3V7CA 4WXHA 2YX4A 2HTSA 4RB2C 3GLXA 3ECHA 4WF2A 4AR9A 2ISYA 2BBYA 1QNTA 3R0JA 1ZLKA 4QUOA 3JSZA 4XSXF 2KRFA 1TNTA 3V8LA 4M9SA 1MJ9A 3AU9A 3DFGA 1T0FA 3RKXA 1X3ZA 3HYIA 2UZKA 4WWCA 3NQOA 1FX7A 3L9FA 4U7DA 3EYIA 1U8RA 3ABUA 4GO1A 1S8NA 3HTSB 1J7KA 2P8TA 4ON0A 1TQPA 1YFHA 2JT1A 3N4MA 1STZA 3K1MA 3FXQA 3W6JB 1MJBA 2GA2A 3V8JA 2VT2A 3RC8A 2X0LA 2R59A 4I0AA 2ZO4A 1QPMA 3L2CA 1IF1A 1MJAA 4EJVA 1TBXA 3OV8A 4LK0F 5DYMA 4A6EA 2RDPA 2Z99A 2PGGA 3ML6A 1A04A 2EV5A 5F6FA 3ZPLA 2CFXA 2FBKA 2XGXA 2FU4A 5DYFA 2DLLA 1PDNC 2EJRA 1E17A 2CSOA 2HKXA 4OIRF 1P4XA 3U1DA 1TW2A 4PVBA 2H09A 4A6DA 5ED4A 3T5XA 5HDNA 3RPUA 2KJCA 5J8CA 1UHMA 3QAHA 1PUEE 1FOKA 3CUOA 4Q4EA 1W5SA 3GUDA 4JK1X 4ZZDA 3FU6A 2V9VA 3E6DA 1ZGAA 4XSZF 3LA7A 4A12A 1IN7A 3WG9A 1EH8A 2A69F 3P9KA 3RC3A 3BJAA 4MS6A 2YPRA 3DEUA 3H3ZA 2IA0A 3HSRA 5DULA 4ZW7A 2PN6A 2HPOA 3FUNA 3LAPA 4EJOA 4R7LA 2RKHA 1FC3A 4QPEA 1S3JA 5JI6A 1I6XA 4H0EA 2WC2A 1K5HA 3CZLA 2H27A 2ZNZA 1RUOA 2WPGA 2ETHA 5LGUA 2DK5A 4ZYGA 2XQ0A 1U5TB 1DP7P 4FLRA 1OR7A 4B8XA 2XAQA 2KIMA 2IA2A 3E97A 3CUQA 5K5RA 1IZ1A 4FX0A 5E1XA 1XGMA 1GVJA 2IJLA 5AIPA 2ZBKA 3R60A 4MQ9F 5E20A 4I01A 2W57A 4O6JA 2PUSA 3COAC 2VONA 1IRFA 5IT9K 3B3BA 4MKTA 1ULYA 3ABTA 2DTRA 4GYIA 4IPAA 5LRSA 3FH7A 2HDCA 4ESBA 1ZRCA 4OIOF 5CJ9A 2MAOA 5DCMB 2UXXA 2NNNA 2FRHA 2RGVA 3RKYA 2P6TA 4ZX6A 5BOXA 1W7PB 4O5VA 1HKQA 3SFZA 4ZYEA 4Y6RA 3CHRA 4LLGF 1K78A 4P5OA 4HF0A 2VN2A 4R1HA 3BZ6A 2YX7A 3FHZA 1QGPA 5K1YA 1OKRA 4AIHA 2EK5A 1R00A 1BC7C 2VC1A 2J5OA 5FLXK 3FTXA 4KICA 1BIAA 1BIBA 4XO3A 2EA4A 1FT9A 3U2RA 4ARFA 5JMWA 1G3WA 3ZMZA 1FBQA 4D0PA 4U0WA 2QBYA 1KQ0A 5J6XA 5FO5A 5DD8A 1R22A 2VBWA 3FZVA 5JNLA 1I5ZA 2ZMEA 2IP2A 2V6CA 3QU6A 1P92A 3ULQB 3FXUA 1T6SA 4K5OA 4Y17A 2RC4A 1F1ZA 1SFEA 5ICGA 1D8KA 4FCAA 2GZWA 5CVRA 1EV7A 3BJOA 4ZX5A 1FBSA 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 2IVMA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 1W4MA 3JTHA 4LG0B 3B2PA 3EYYA 4ZQEA 4Y15A 2D45A 1T2KA 3B7UX 3O2PE 1XSDA 2DT5A 2B0LA 5HLHA 1OYIA 5E8GA 4XO4A 4UXNA 2VBYA 3J7AO 1SMTA 1DPUA 2DBBA 3F8CA 3T8RA 4OINF 4EJWA 2OU2A 4LJZF 4HLYA 1R5HA 3DF8A 3B2XA 4ENNA 1G5AA 5TJJA 3EBGA 3J80K 3M9AA 1ZGJA 3BOQA 4OMZA 3VOEA 2BV6A 4ENKA 1QQIA 1H9TA 3U9WA 2PFBA 4XN9A 1ONNA 3FTVA 2X4HA 3WTYC 1XCBA 4U0VA 1XGNA 5BPDA 2F5EA 3KEDA 3ZHXA 3KFWX 5CVUA 4IJAA 3T8VA 2D1VA 4YFKF 2BE5F 4I0BA 1LDJA 4HF2A 4XMUA 1Q1HA 4PU2A 2PLYA 2XAGA 3TKYA 5HS8A 2K86A 1TTYA 2NRAC 1U78A 5F1RA 4NB5A 1MD0A 1YS6A 4RGUA 3O6BB 4EJTA 5HNFA 2FSWA 3FMRA 2A6EF 4JQFA 5KK1A 3EBIA 4RVBA 2CGPA 1HSTA 3HTUA 2JCXA 4PCQA 5A2QZ 5K5OA 3UEQA 2Y1FA 2Y48A 3QU3A 3LA3A 5J8FA 2OZUA 1W7PD 5DUKA 1IAWA 2ESNA 5HS7A 3VEPA 1Z1DA 1IRGA 2R3SA 4OU0A 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 4BHPA 1U2WA 2VOPA 3E5UA 1H19A 2LDUA 1OPCA 4LMYA 3DPLC 4XNDA 1ON2A 1SAXA 2J5PA 1LEBA 2EGHA 2O8XA 2HQNA 2V1XA 1FP2A 3B34A 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 1XGOA 3JAMZ 2OQRA 4BQAA 5TRDA 1SC5A 2QENA 1O57A 2XKPA 1WWXA 1YLFA 2A6HF 1FYLA 3B7SA