4NQWA

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
148
Chain Sequence
DLDALLRRVAHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
molecule keywords ECF RNA polymerase sigma factor SigK
total genus 57
structure length 148
sequence length 176
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4nqwA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4nqwA01
4CXFA 1R1TA 2IPQX 3GW2A 2LNBA 1WSUA 4G6DA 2L3DA 3RKWA 2VONA 4ZQGA 2EV5A 4GCVA 5CJ9A 3ROUA 2VE8A 4RGUA 2JTVA 3QP5A 3I59B 2IA0A 3WGGA 4XBFA 1F4KA 2HQNA 1BJAA 5E1ZB 5JVTA 3TO7A 3I4PA 4O3MA 3V8LA 3PQJA 3DXJF 1U2WA 2VN2A 4G6QA 3MZYA 4KIFA 3Q9VA 2VBXA 3L2CA 4Q48A 4G8XA 2ADUA 1LVAA 3ZHZA 1BBYA 2CGPA 2UXXA 4ESBA 4EV0A 5D4SA 4A6EA 1F5TA 1R0LA 3D5LA 2GA1A 5DD4A 5ICFA 3I5UA 1R5HA 4N0BA 4CYDA 2W84A 3U1DA 4I0BA 1MVYA 2X0LA 2Y48A 3J7AO 3GFJA 1GXQA 2JD1A 1LDJA 1UCRA 2D2WA 1TTYA 3K0LA 1HBXG 1H9TA 1YS7A 1XMKA 1U78A 4HF2A 4YIFA 3DKWA 5HLHA 5L3BA 2MBFA 1L0OC 4OOEA 2XUBA 4M9SA 2DK5A 2O61A 2FNPA 5H20A 3CUQB 2YU3A 4S04A 5D6EA 5HLIA 1YS6A 1YO5C 1XSDA 2LF8A 2H6BA 5F64A 4U0WA 1ONOA 5DCMB 1DP7P 2Y1EA 3BPVA 4RCVA 4AVPA 1LB2A 3COAC 3T5XA 3EYIA 4EJTA 1BI2A 3L00A 2Z5UA 2D45A 4GXOA 1B4AA 5JNLA 3REOA 3LAPA 3KP7A 3GZ5A 2EV6A 1YW9A 3BPXA 4UUVA 5FLXZ 1TQPA 3DQVC 1U8RA 3H92A 5K1YA 3SFZA 5FB2A 2VODA 1J9IA 5JHUA 4A5NA 3W6KB 4A6DA 3K1NA 5EEHA 5LHGA 2VC1A 3CZLA 1HSTA 4EMSA 5ERIA 2BYVE 3CO6C 2O6GE 2P6TA 2A68F 2NRAC 3KLNA 4ENJA 4GYGA 1Y0UA 1HXDA 1KQ9A 4KMFA 3U9GA 3HIFA 4UV9A 2P8TA 3KEQA 1DUXC 5J6XA 1F9NA 2WWYA 1OYYA 3FMQA 3P9CA 3WODF 3C18A 2MLKA 5F6FA 2X4HA 3J81K 1T0FA 1IRFA 1S7OA 3M8FA 4G7OF 4L9TA 2EK5A 2LF7A 2DPUA 1PP8F 2XRNA 3C7JA 4LLGF 2E7XA 3E3VA 2XIGA 4KN7X 2ZNZA 2FXAA 3F6OA 3DF8A 3A14A 5HOOA 3QPHA 2HGCA 1G4DA 1LQ1A 1EH7A 1XGMA 3RASA 3K9TA 4KNYA 4Q4ZF 5E17F 2DAOA 1SMTA 2Q2EA 4AICA 3ELKA 1BOAA 2RV8A 5H6RA 3WE2A 1QZYA 3HYIA 1XGSA 1IF1A 1Z05A 2QLZA 3DPLC 4ZH4F 1R1VA 1ZLKA 1OPCA 1U5TC 4I98B 3K1MA 5BPDA 1ZARA 2XKPA 3I53A 1FWZA 1RP3A 4L9JA 1ZG5A 2JPBA 1TLHB 3U2RA 3V8KA 3AUAA 2XAFA 4WX9A 4HYEA 3ISPA 5ILVA 4LK1F 1U5TA 2P5KA 3TGNA 1WQ2A 2O03A 1LNWA 2CG4A 1T38A 1JVSA 4BH9A 4YFNF 3E5QA 3BP8A 3F8FA 3L7WA 2EB7A 2IRFG 1FPQA 4ENKA 3F22A 1F1ZA 4CZZA 1TQIA 1FYMA 3VB2A 2J5PA 2Y1CA 3CTAA 2ETHA 4HX7A 4PZJA 2F2EA 5JR3A 3ERED 2CQKA 2CWEA 4MTEA 1ZS2A 1KGSA 2CO5A 3DPTA 2ZCWA 1R36A 3SXYA 2C6YA 2KRFA 1ZG1A 1G3YA 4OIRF 5LLQA 5JMWA 2EJRA 3I71A 1FBUA 1ZAOA 3ABTA 3WU0A 1K5HA 1QQIA 3DV8A 2L54A 4EGYA 3E6DA 3S2WA 2Y1GA 3BZ6A 3Q9SA 1K78B 4HBLA 1USSA 4HOBA 1KYWA 3UCQA 1P4AA 3ANLA 2Y75A 3HRUA 3CZGA 2H6CA 2COMA 4HW0A 2HDCA 1ZLJA 3GVAA 3CZKA 1WKMA 2F5EA 5J8FA 1RI7A 4KICA 3VEPA 3OOPA 4RAYA 3ZMDA 3MAJA 4U0VA 1LJ9A 3T8TA 1FBSA 4KIGA 2MD5A 2WTEA 4IRHA 1REPC 1GXPA 5ED4A 2RQPA 4WXHA 1XSVA 2M5WA 1HW5A 4UVAA 2ACJA 4U7BA 3QP6A 1T1SA 4YFXF 5HS8A 3R4KA 4K2EA 3BDDA 4YIIA 2HEOA 4B09A 3UEQA 4D0PA 4GGGA 4M71A 4WCGA 1NHAA 1IAWA 2OD5A 3E6MA 5LRRA 4JQFA 2LKPA 4M9ZA 4U88A 4P96A 1MZBA 1XSXA 3DFGA 4MGRA 5DCMA 2EWNA 1J59A 4XRFA 2P6SA 1IRGA 2IT0A 5JMPA 3KP4A 2ZXJA 1SD5A 3I64A 1B6AA 4BYYA 4WXDA 1ZREA 2W24A 4BQAA 1Z6RA 2M45A 1TW2A 4FLRA 2D1VA 1WRJA 4XLNF 2G7HA 3LA7A 2JPCA 4PGGA 1UHMA 4R8HA 2JD2A 1W5TA 1B9MA 3LSTA 2PG4A 3HSFA 5FGMA 2M8EA 1H3LA 2FNAA 1YG2A 2AS5F 1W7PB 1XMAA 4WXCA 1XGNA 4RB2C 4R1HA 2KJCA 4M72A 1CF7B 1FSHA 3FMSA 3DEUA 2OQRA 2BEOA 3MEXA 4IJAA 2F5CA 1O7FA 2V6CA 2HZTA 4UNOA 2HFHA 2HTJA 2R7DA 1ZRDA 1HQCA 4I01A 1G6NA 1ONNA 1IN6A 4HLXA 3ZMVA 1S8NA 4WWCA 4KFCA 1O3TA 3KE2A 2L01A 1ULYA 2FBHA 2GA2A 5IT9Z 4A5MA 2A5YB 3MZHA 5EEGA 1ZGAA 2RN7A 4M6YA 4ASNA 4Y6RA 2YX7A 1I1SA 1JHFA 1G5AA 2OZ6A 3D0SA 4ZYHA 3HTSB 2L02A 5JC1A 2RNJA 3RKYA 4FLSA 5E1XA 4G7HF 3WTVC 5AIQA 2A61A 3LFKA 2YSRA 3ZI0A 5BQTA 4ZYEA 4I2OA 2F5DA 2RGVA 4JK1X 1SFXA 2IVMA 2A3SA 4OINF 1J5YA 2FRHA 4FX0A 2IW5A 3JAMZ 1RUNA 4KUMA 2J5OA 2QENA 2ZNYA 3HSEA 5ICEA 1BI3A 4QLCU 2TDXA 1YIOA 1MW1A 3FZVA 2EA2A 2STTA 4GYIA 2V79A 3F72A 2GXBA 4A03A 1KA8A 3WTYC 3WTUC 2PFBA 4FHTA 1LDKB 5IT9K 1JGIA 2R7FA 2PBIA 4A2UA 5DV5A 4OOFA 1MW0A 2DBBA 3HOTA 2Q8KA 4HA8A 4XLPF 2JRTA 2XKOA 3W6JB 3ECOA 4KIBA 1ZH5A 1CGPA 3IRQA 1YLFA 3JTGA 4ESFA 2Q0OA 1XCBA 3F6VA 5BPIA 4G9YA 1OYWA 4HV6A 2VT3A 1P4XA 3T8RA 3QOPA 1FLIA 3N4MA 2IJLA 5CLSA 5JAZA 5LRSA 2HOEA 1FY7A 1R58A 4AYSA 3CUQC 5LGTA 3K69A 4O6JA 3AU9A 1OR7A 1P6RA 4IRGA 4KA4A 5E18F 5DCFA 2A69F 2G7UA 3JAMK 3WGIA 1MGTA 4L0YB 1O57A 3CO7C 4NHJA 1TW3A 2ESHA 4LG0A 3VODA 3KP5A 3G73A 1FX7A 2K27A 1HW2A 2W57A 1D8JA 5JBIA 4M9XA 5TJJA 3FM5A 3B02A 4AIJA 4HF0A 2MAPA 3V7CA 1K79A 3HRSA 4EJWA 1IN5A 3O3KA 2XAQA 3R6SA 2XROA 3WU1B 1W7PD 3VOEA 1U3EM 1JGSA 2H27A 5L3FA 4EQQA 1KU9A 5H6QA 5L3CA 1L3LA 4CICA 4UVBA 2V1UA 1MKMA 3ULQB 3LQRA 2EGHA 4ZQFA 2OAZA 2K4BA 2E1NA 3QRFF 1SC5A 4FLQA 3RYPA 3IRRA 4MQVA 4B8XA 4CO8A 1ZHFA 4IVNA 2ZBKA 1XDSA 1D5VA 3GFMA 3T0YA 1TNTA 3FMRA 5KK1A 2VBWA 3B73A 4RGXA 2O0YA 1IN7A 4MTDA 3EUHA 2EFQA 6PAXA 4OU0A 3V7RA 4N9IA 1SAXA 1K78A 1J7KA 4ZZDA 1O7LA 2BV6A 3HHHA 4WF2A 4UXNA 2O7GA 4TV7A 2ESNA 1W4MA 1PUEE 5AONA 1G3WA 4PCQA 4EJUA 3I59A 3ANMA 3ANNA 3E5UA 3ECHA 4LG0B 4RS8A 3SZTA 3WG9A 4IXAA 3BROA 3FF5A 2VBZA 5LBQA 3ZHYA 1B59A 3LAJA 4BNCA 2FMLA 1IXCA 1MJ9A 3R61A 2JD0A 4MQ9F 1YTYA 3GO5A 4EJOA 2DK8A 2QBYA 3EETA 2PQ8A 4L9VA 1YYVA 3M9AA 3WQRA 2QUFA 3K2ZA 3GWZA 3F23A 1FP2A 1A04A 3RI4A 2CFXA 1R0KA 2HQRA 5BS6A 1IZ1A 2FF4A 5JI6A 3CDHA 4LB5A 3WE3A 1Z1DA 1FP1D 2UWMA 2A07F 3HUGA 1I1GA 2K86A 4BHPA 3CJNA 5CVVA 2VXZA 2EFNA 3TOAA 1H9GA 1BI0A 3WGHA 1HSJA 3HRMA 1YW8A 5F1RA 2B0LA 2OQGA 1MW2A 4LGWA 2KIUA 5HDKA 4BXUA 1MJAA 2KIFA 1HKTA 2PMUA 4HZFA 3P9IA 4FT8A 5L3DA 4EM0B 1S29A 3M8EA 3E5XA 3E6BA 4BHBA 1E2XA 2PJPA 3KETA 4HDUA 2P5LC 2JCXA 1G3TA 5DEQA 2W85A 3I0TA 3WQQA 2XVCA 1P4WA 4XSXF 4EGZA 4DQ2A 1Q0QA 1ODDA 4U0YA 4LUPA 1O3RA 2FMYA 2FEZA 3FXQA 3P9KA 3E6CC 2HKXA 1USTA 2FSWA 4CHUA 5A2QZ 2Y1DA 2ELHA 4M74A 5K5RA 4LB6B 1XB4A 1R5GA 1B9NA 2GAUA 1MD0A 3WQSB 4LJZF 3J80Z 1ON2A 4IHTA 1PP7U 3HSRA 4KYWA 3WTXC 4LFUA 2P7VB 1TNSA 2NS0A 1E17A 4UV8A 2F5FA 4HX8A 4JBAA 1ZRFA 4ZQEA 4L5IA 4LLLA 5DUKA 2JZYA 4MNUA 3H3UA 4CDGA 4ENNA 1MDMA 1FZPB 2NNYA 5IT3A 2GWRA 2HTSA 5HLGA 1IUYA 5TRDA 1G3SA 3CUOA 1ZG3A 3ABUA 2IA1A 2NNNA 4IPAA 5HDGA 2PN6A 2JT1A 2QYOA 4EM1A 1C0WA 4OMYA 1Q0HA 4ZZLA 4HDVA 4HQEA 2XAJA 2G9WA 1DPUA 5E8IA 3RJPA 2A6EF 5AIPA 5D6FA 3MQ0A 1QPMA 2H94A 1XGOA 5LEJA 3QAHA 1X3UA 4HX4A 3RTRA 3J80K 3AU8A 3FX3A 5LHHA 1B1BA 1UFMA 3MWMA 1MDMB 1R00A 2EFOA 2FQ3A 2ZMEB 4M6XA 2C82A 1KU7A 2DTRA 5FD5A 1AWCA 2AXLA 2OU2A 3BJOA 3BJAA 3QPTA 1FC3A 1S3JA 3F8MA 3FXRA 2BGCA 2A6HF 4NQWA 1P2FA 5LGUA 1FYLA 2L4AA 2QBYB 1I27A 1K7AA 3SQNA 3V8JA 5A2QK 3GEZA 3M7GA 1DPRA 3RKXA 3QU6A 2NAZA 1BC7C 1DDNA 5CVRA 2DI3A 2QQAA 3ZHXA 1P92A 2RKHA 2PI0A 3N97A 1JE8A 1D8KA 4RB0A 4AIKA 3VFZA 1R1UA 1T1RA 2GIVA 1SMYF 2PLYA 4OIPF 3NEUA 1U5TB 2FE3A 3IKVA 4ZQHA 3TO9A 2DPDA 3LA3A 1W5SA 3GZ6A 3SHFA 3P7NA 3RPUA 1TBXA 1YFHA 1KYZA 1HW1A 5FO5A 3ML6A 3PQKA 2QQBA 3KEOA 2OZUA 3DP7A 1KU3A 4BHCA 4MEXF 3HHGA 4RAZA 3RPQA 1Z9CA 4ESJA 2WV0A 1BIAA 4EVIA 2DQLA 1R22A 4EJVA 3RIRA 1ZRCA 1BI1A 3KLOA 2E7WA 3KZYA 2JCYA 1FT9A 3FXUA 3R0AA 3ZPLA 1IXSB 1I5ZA 5K5QA 4YG2F 4G7ZF 3KP2A 2P7CB 4AWXB 5E1WA 5CYVA 4A12A 4Y67A 2QZ8A 3GFLA 2WPGA 5HDNA 2VE9A 3TOBA 1QZZA 3LWFA 4A0ZA 5BOXA 2QQ9A 3KFWX 4RGRA 4ZYGA 3HOSA 3V4GA 3F3XA 4O5VA 2WC2A 3H3ZA 4GAEA 2DQRA 1BC8C 1T39A 4XSZF 2Z3YA 1RNLA 4Y17A 3HTUA 2EV0A 3GF2A 3EYYA 3EQLF 4I7HA 4WK8F 4RB3C 4I09A 1J75A 3BOQA 5ICGA 2JSCA 2Z99A 2XGXA 2L4MA 3EDPA 1CF7A 2OBPA 3WTWC 2ZO4A 2BBYA 4RB1A 2XHKA 4NB5A 3BWGA 3R0IA 3IHUA 2RC4A 4OOIA 4H0EA 4Y6PA 2MAOA 4HF1A 3JSPA 3OV8A 5D5VB 1SD6A 4IRIA 2FU4A 1W7PA 4P9FA 2DW4A 4HAMA 3V7SA 3GXOA 2UXNA 4S05A 1STZA 3F21A 1KQ0A 4ETSA 1JXSA 4Q47A 1YQAA 5ILSA 3RDIA 4YFKF 3JW4A 2XV4S 4BAYA 5LHIA 4OIOF 5CVUA 2VC0A 2IP2A 2LSOA 2JCVA 5E20A 3KZZA 5E8GA 1RIOH 2Y0MA 1V3FA 2ISYA 4FLOA 1Q0LA 1AOYA 5D5WB 2H09A 4IF4A 2O3FA 4A0XA 1OYIA 1QO0D 5DYMA 1V4RA 3ZP5A 1S6LA 2MH2A 2P5VA 1FYKA 1JG9A 3LA2A 2FOKA 5L3EA 4P9UA 2MLGA 5BMZA 2UZKA 1BM9A 2M30A 2HYGD 3JTHA 3MCZA 2Z33A 2EFPA 5ILUA 3A06A 1ONVA 3RYRA 3Q5FA 1ON1A 5FFZA 2YX4A 2EFWA 1IN4A 1IW7F 2V1DA 3FM3A 1O3QA 1Q1HA 5CVJA 1S46A 3ZMZA 1D3YA 2IA2A 3UERA 3O6BB 1UHWA 3GUDA 2KKOA 1QGPA 4RGSA 2ZJ2A 3FWEA 4F7ZA 3IWFA 1OMIA 5LGNA 4ENMA 2ZMEA 1EV7A 2K7LA 2OA4A 5DULA 2ISZA 2M1BA 1RZ4A 3I58A 3I54A 2YR2A 4HQMA 4HLYA 3TDZC 3L9FA 1ZYRF 4Y6SA 3GYHX 1MW3A 1KQ8A 2R3SA 4ZYDA 1J2XA 2GZWA 3IWZA 1S7AA 5CVIA 2QM3A 2LDUA 1XCVA 1O3SA 4Y13A 2ZFWA 4E70A 1FBQA 2W25A 5HS7A 5JO0A 2KJBA 1H0MA 2EA4A 5J8CA 1FNNA 3TKYA 4KDPA 1TQMA 2MH9A 1Z91A 4MEYF 4ON0A 1JHHA 4PGHA 1R7JA 5FD6A 4N9HA 5HS9A 3O2PE 3R0JA 1WWXA 2KIMA 1BN5A 4I02A 2VOPA 1SFEA 3NQOA 3BY6A 3QU3A 5JFRA 1SD7A 4HV5A 1LEAA 1T6SA 1Z6TA 4I0AA 1IN8A 3GFIA 4AD9A 2QWWA 4L9NA 5LEKA 1LEBA 4EM2A 5FFXA 5HVQC 2DT5A 3KCCA 2HS5A 1HKSA 1GHCA 1BIBA 5DUIA 1YW7A 2YPRA 2XAGA 4U7DA 3SZPA 4G94A 5D8KB 4CGZA 2HYFA 2STWA 1IXRC 2M87A 3NRVA 4LD5A 4LK0F 1Z7UA 4IHSA 4GO1A 2BE5F 3T1BA 3TO6A 1FOKA 3WTTC 1EH8A 4Q5SF 1QNTA 4Y15A 4OIQF 2FBIA 4KT5C 2RVCA 1T2KA 4UVCA 4Z2YA 2O8XA 3GLXA 5DD8A 3ZQ7A 2VOOA 2K02A 3F8CA 3R60A 2CYYA 2HWVA 2PMHA 2Z9OA 3FHZA 5K5OA 1UB9A 3G3ZA 1HKQA 4LMYA 5D4RA 3CUQA 3IIEA 5KVRA 1ZGJA 1J0RA 3C3WA 3F8NA 1R23A 3IKTA 2FBKA 1OKRA 3E97A 3TDUC 2ZKZA 3ZMSA 1GVJA 4UHTA 3CZEA 3WTZA 1ZN2A 2DU9A 1LDDA 2MC3A 5D5XB 2DFIA 3K1PA 4L0ZB 1I6XA 3ZMTA 4DNCA 3M1EA 4QWQA 2K4JA 2D1HA 4KP7A 4MHGA 3BJ6A 1VTNC 2HR3A 1PDNC 4P55A 5L3GA 4ZN6A 3ZMUA 4OMZA 5ICCA 4P5OA 2DO7A 1KU2A 3F8BA 2MA3A 3AAFA 1K6OA 2PEXA 3WTSC 4L18B 3ZN0A 2FA5A 2CW0F 1XDUA 4LLNA 4M73A 1FSEA 3KP3A 5FLXK 3JSOA 3IL2A 5D5UB 4FX4A 1QBJA 2GQQA 3PFIA 3GX4X 2Y1FA 4KN4X 3MFKA 3CLOA 5DDGA 1XD7A 2XAHA 2NYXA 3C1DA 2XASA 2V1XA 5D8LB 4R79A 1WI9A 4AIHA 2DLLA 1SD4A 3ZN1A 1SFUA 4PDKA 2GXGA 2E1CA 2VBYA 2V9VA 1XN7A 2CSOA 4L5JA 1EH6A 3TQNA 2P4WA 3KP6A 2HKOA 1RUOA 3IC7A 1U6GA 3J81Z 4KMUX 1MJBA 4A0YA 2QVOA 2RDPA 2VT2A 1ONPA 3LQQA 1T98A 3HRTA 3L09A
chains in the Genus database with same CATH superfamily
1V5GA 4BE0A 1N78A 4CXFA 4V19K 3F0CA 1R1TA 3BG5A 4LIUA 1X19A 3CLQA 4XN7A 5B66C 2AQFA 2IPQX 3GW2A 3NWTA 2LNBA 2BHZA 3RZOJ 1WSUA 2W48A 3DBRB 2L3DA 4G6DA 4ZDLA 3RKWA 2LG4A 4Q4EA 2W00A 4YEJA 2VONA 4ZQGA 2EV5A 4MO7A 4GCVA 2CQXA 2VASA 5CJ9A 3ROUA 1H19A 1TT0A 2VE8A 4RGUA 2ZFUA 2JTVA 3QP5A 2VKDA 3I59B 2WAEA 4D1QA 4X0GA 2IA0A 2IGMA 3WGGA 4XBFA 2QA4I 1F4KA 2QGUA 3H0DA 2A7OA 2IGOA 2HQNA 4RAGA 1BJAA 3BZCA 5E1ZB 5JVTA 3PJRA 3TO7A 2LKSA 3I4PA 4JP0A 4K5NA 1LKXA 4C30A 2ZXIA 4O3MA 3V8LA 5GPCA 3PQJA 3DXJF 1U2WA 2VN2A 4YIRX 4G6QA 3MZYA 2WBMA 4KIFA 3Q9VA 1I39A 2VBXA 3B3BA 2M0MA 3L2CA 4Q48A 4A69C 4G8XA 1BOBA 1JUSA 2ADUA 3AG4H 3CCUI 2HNHA 2XF5A 3FXOA 1LVAA 3ZHZA 2LYCA 3M3YJ 1BBYA 4YELA 2CGPA 2UXXA 4D5FA 1WGXA 3ZR8X 4ESBA 1H8AC 3HKZA 4EV0A 4XRSG 5D4SA 4A6EA 1F5TA 3SDBA 1R0LA 3D5LA 2GA1A 1W5CC 3DPUA 4DZPA 2HPIA 4PFPA 3LL7A 2R7VA 5DD4A 5ICFA 3I5UA 4GFBA 4MKTA 1R5HA 5GP9A 4N0BA 4CYDA 5FKNA 2W84A 2XPUA 2ZC2A 2M2EA 3SDGA 3U1DA 4I0BA 1YIJI 1MVYA 2X0LA 4XO4A 1U9NA 2Y48A 3J7AO 4ZW7A 3RC8A 1HA8A 3B6CA 3GFJA 4FQGA 1GXQA 2JD1A 1LDJA 1UCRA 2D2WA 4PJ0C 1TTYA 3K0LA 1HBXG 1R4MB 1H9TA 3CCLI 1YS7A 1XMKA 1U78A 4HF2A 4YIFA 3DKWA 5HLHA 1VF9A 2EIKH 2MBFA 5L3BA 1L0OC 2C5ZA 4OOEA 4CH7A 2XUBA 1VNDA 3RCOA 4M9SA 2HDWA 2DK5A 3E7LA 2R93J 4R5XA 2O61A 3FXJA 2JQ7A 4IOCF 3IH4A 3HL2A 3IUOA 2X6XA 2FNPA 1WJDA 3H3VK 5H20A 2JVHA 3AG1H 3ZQIA 4F91B 3CUQB 4OAYA 2YU3A 4JX6A 5D6EA 3SFIA 4S04A 5HLIA 1YS6A 4IHSA 1YO5C 1XSDA 2LF8A 2H6BA 5F64A 4J00A 3QYEA 4U0WA 1ONOA 2EZLA 5DCMB 1X1DA 5EDNA 2V6EA 4QPEA 2IS4A 2LD5A 2JUCA 2XPYA 1DP7P 2Y1EA 3BPVA 1VQPI 4RCVA 4AVPA 2KQRA 1LB2A 3COAC 2E1MB 3M4OJ 2Y31A 1MH4A 3T5XA 3EYIA 3FKJA 4RLFA 4EJTA 1BI2A 1XMXA 3L00A 2Z5UA 2D45A 4GXOA 1B4AA 3QODA 1BR4A 2W1OA 3ERMA 5JNLA 3REOA 3WHCA 1MH3A 3LAPA 3KP7A 3GZ5A 1Y1VJ 1OCZH 2EV6A 1YW9A 3BPXA 4UUVA 5FLXZ 1TQPA 3DQVC 3DBLB 5IYBJ 1U8RA 3H92A 4BL0B 5K1YA 4AUXA 3SFZA 2V26A 1K4SA 5FB2A 2VODA 1J9IA 5JHUA 4A5NA 1Z3XA 4BE2A 3W6KB 1BA5A 2IGNA 4A6DA 4A3LJ 4A3KJ 3NWSA 3K1NA 2QSGX 1JTXA 5EEHA 5F0CA 4P1WA 5LHGA 3HDDA 2VJ4A 2VC1A 3CZLA 3Q0WA 5J1UA 5KHDA 4ZTFA 1HSTA 2LY9A 4EMSA 4A3JJ 1OLTA 3FUNA 5ERIA 3OYIA 2KRCA 4XN8A 2BYVE 2K5CA 3CO6C 2O6GE 1HS6A 2P6TA 2A68F 2NRAC 4M3FA 1R9TJ 3KLNA 4ENJA 5IYCJ 3SYTA 4GYGA 1Y0UA 5EG0B 1HXDA 3CMYA 1KQ9A 3H35A 4KMFA 3U9GA 3HIFA 4UV9A 2P8TA 1NG6A 3KEQA 2HOAA 2ME6A 5GAEJ 1DUXC 5J6XA 2AO9A 1H88C 1F9NA 2WWYA 1OYYA 3FMQA 2L9NA 3P9CA 3WODF 3CD6I 3B7TA 3C18A 2E5NA 3FU5A 2MLKA 2O8KA 1FTTA 1ZK8A 1RR7A 2JA7J 1ETOA 4E7KA 4XO3A 5F6FA 2HOTA 2X4HA 3J81K 1T0FA 3OMYA 1IRFA 3JREA 2BXZA 2H1KA 1S7OA 3M8FA 2BVMA 4G7OF 1WJCA 4L9TA 2EK5A 4II2A 2LF7A 5M3MJ 2DPUA 2L5QA 4JX5A 1PP8F 2XRNA 3C7JA 4LLGF 3VYRB 1GVDA 4JX4A 2UUZA 1AKHB 3PNTA 2E7XA 3E3VA 2XIGA 3G1MA 1UAAA 5FKMA 4KN7X 2ZNZA 3O8HA 2HVSA 2BZTA 2FXAA 1XG1A 3F6OA 3DCFA 3DF8A 2ZJQF 3K7AJ 3A14A 5HOOA 1OR7C 3JRGA 2QSHX 2VQLA 3QPHA 4KITB 2JA8J 2KZGA 1WJBA 5E3LA 3HPGA 2HGCA 1G4DA 1LQ1A 1EH7A 1XGMA 1GV2A 1XPXA 1ETQA 3RASA 2EH3A 3K9TA 3CQZJ 4KNYA 3QPSA 2HQAA 2Z2SB 4Q4ZF 5E17F 2DAOA 1SMTA 1PUFB 2DDAA 2Q2EA 4AICA 1W36D 3ELKA 1BOAA 1ZR4A 2RV8A 2FUG2 2VXDA 4FE4A 5H6RA 3WE2A 1QZYA 3HYIA 4Y33A 2H1LA 1XGSA 2WB1N 1IF1A 1APLC 3ABLH 1LFPA 2VQCA 2DOFA 1Z05A 2QLZA 2R7SA 2IBDA 3DPLC 4ZH4F 1R1VA 2G0EA 3G1OA 3EUKL 3BTIA 1T56A 2CQQA 1ZLKA 1OPCA 1U5TC 4IHVA 2IS2A 2VKHA 2Y69H 4I98B 3FH7A 3K1MA 3CHRA 5BPDA 1ZARA 2XKPA 4UB8C 3DEEA 2WZFA 3I53A 3HBLA 2LBFB 1D1AA 5M5YJ 4M3BA 4ANJA 3CJRB 1FWZA 1RP3A 2GOMA 5F04A 1TWHJ 4ZW3A 4UUSB 4L9JA 2JPBA 1TLHB 2OV7A 3U2RA 1ZG5A 1IJWC 2VJ8A 1MW7A 4IHWA 3V8KA 3AUAA 4GDFA 1M1EB 2BW3B 2XAFA 4WX9A 4XMZA 5AENA 2KIQA 4HYEA 3JRAA 3ISPA 4BUPA 2FJ1A 1WCMJ 2VPRA 5ILVA 4LK1F 2DFHA 4AYBN 3HOYJ 3NARA 1U5TA 5FRNA 2CMPA 2P5KA 1LPQA 3TGNA 1WQ2A 3MKYB 2O03A 1LNWA 3GZNB 2OUMA 2CG4A 1T38A 1JVSA 3CHOA 3GTMJ 4BH9A 4YFNF 3ONQA 3E5QA 3K4NA 3BP8A 3F8FA 4F3QA 3LSRA 3L7WA 2EB7A 2IRFG 1FPQA 4ENKA 3W2AA 3F22A 3FTSA 1F1ZA 4CZZA 5C4JJ 2L7KA 1TQIA 1H89C 1Z77A 1FYMA 2MC4A 3VB2A 2J5PA 3G6EI 1BL0A 2Y1CA 3BR3A 3CTAA 2ETHA 4HX7A 3UR3C 2HU9A 3EBIA 1R71A 4PZJA 2F2EA 4F52A 2LH9A 2WAQA 1WVRA 3S16J 3ZQLA 5JR3A 3ERED 2CQKA 2CWEA 3D5SC 2NVUB 3ESWB 4MTEA 1Q1VA 1A36A 2LBFA 4I99C 1ZS2A 4RDUA 1KGSA 1YHQI 2CO5A 3DPTA 2ZCWA 4L2LA 1N77A 2LK2A 2XF6A 1R36A 3SXYA 4AIDA 1MBFA 4PJLA 3OS1A 2I5UA 2C6YA 2VJJA 2KRFA 5J4YA 2XGEA 1ETXA 2DXIA 1ZG1A 1G3YA 3D1NI 3ZQQA 1ZR2A 4OIRF 3I9V2 5LLQA 1VI0A 3K2AA 5JMWA 3OR1C 1AU7A 2EJRA 3CDIA 3I71A 1FBUA 1ZAOA 1KONA 3Q3SA 3ABTA 2Y30A 2HPMA 5GAHJ 4QPOA 2NVQJ 3WU0A 3JRIA 2OTJI 1K5HA 1QQIA 2BY0A 2L54A 3DV8A 4PSWA 4GAAA 4EGYA 4ZW5A 3E6DA 3S2WA 1LFBA 2Y1GA 3DTKA 3S1NJ 3GTKJ 3BZ6A 3Q9SA 1G8XA 1WJ5A 4HBLA 3A4CA 1USSA 2YS9A 1K78B 4MIMA 1X1PA 3DTIA 4K5LA 4HOBA 3OYJA 1KYWA 3UCQA 2W7NA 1VQKI 1P4AA 3ANLA 2Y75A 3HRUA 1IO2A 3CZGA 2VB6A 2H6CA 4XLCA 2ZSIB 3OYBA 2COMA 4HW0A 2HDCA 2R7QA 1ZLJA 3GVAA 2OCEA 3CZKA 1WKMA 4A3MJ 4ZW8A 2O7OA 2F5EA 4IQ4A 1MNDA 5B3SH 5J8FA 3S3OA 1RI7A 4KICA 4R5TA 3VEPA 1YJNI 3RZDJ 3BR0A 3BC8A 4BDYA 3OOPA 4Y52J 3KPHA 4RAYA 3ZMDA 2JUGA 1EKEA 2DOAA 2DMPA 2ELJA 4BJ6C 1Y6IA 3MAJA 4U0VA 1LJ9A 3T8TA 1VFCA 1T33A 5C44J 3GLLA 1FBSA 3DU5A 4KIGA 1FOYA 2XGCA 3I4MJ 2MD5A 2WTEA 1VQMI 2R7ZJ 4IRHA 2OPTA 2RQQA 4U87A 4XRMA 1REPC 1VQ9I 4IQJA 1GXPA 4Q4IA 5ED4A 2RQPA 4WXHA 1XSVA 3H5AA 5H2FC 2M5WA 1HW5A 4UVAA 3BG3A 3CMEI 1HOMA 2ACJA 1K61A 1S9HA 4DJAA 4U7BA 2ID3A 1FJLA 3QP6A 1T1SA 4YFXF 4XOPA 1EJ9A 5HS8A 3R4KA 4K2EA 1MSFC 3BDDA 4YIIA 2HEOA 4B09A 3UEQA 4D0PA 4GGGA 4X2UA 2AHQA 4M71A 1NHAA 4WCGA 1IAWA 3CXBA 2LFBA 2OD5A 3E6MA 1ORKA 5EV7A 5LRRA 3Q44A 4JQFA 1TWCJ 4D7NA 2HXOA 2LKPA 4M9ZA 4U88A 2E71A 1MZBA 2LMDA 4P96A 4BS9A 4V2FA 1QPIA 4BY1J 4B44A 1XSXA 3LSHA 3DFGA 4MGRA 5DCMA 2EWNA 1J59A 4XRFA 2P6SA 1IRGA 2IT0A 4II3A 3DLLF 3BZKA 5JMPA 1X1AA 3KP4A 3K4CA 1VQ8I 2ZXJA 1SD5A 2R72A 5J4VA 3I55I 3KX2A 5BNGA 1W1WE 3I64A 4NNJA 1B6AA 4BYYA 4WXDA 1ZREA 2W24A 1YI2I 4BQAA 2VPLA 1Z6RA 2M45A 2O9LA 2JVGA 3PO3J 2ICWG 1TW2A 5KNLA 5F27A 4FLRA 3CZ6A 2D1VA 1WRJA 2ZB9A 2B7EA 3TBIA 3JCUC 3CC2I 4XLNF 2G7HA 3LA7A 2JPCA 4PGGA 1UHMA 2WADA 4R8HA 2JD2A 1W5TA 4ZDPA 5IPAA 1B9MA 2KPMA 2VQGA 3CCRI 2LKXA 1RETA 3KZIC 4E6KG 1TWAJ 1SVLA 3LSTA 2PG4A 3HSFA 3BR5A 5FGMA 4MS6A 2NS7A 2M8EA 4BE1A 5B5EC 1H3LA 2FNAA 1YG2A 2AS5F 3HZJA 1W7PB 1XMAA 2DMTA 2IXSA 4WXCA 1LUJB 4XNBA 1XGNA 1PVEA 3AFHA 4RB2C 4R1HA 1WH5A 2KJCA 1R6RA 1SANA 2DJNA 5FJ8J 4M72A 1CF7B 1UELB 4MFDA 3MVPA 2ZJRF 1FSHA 3TP0A 3FMSA 3ABKH 3DEUA 2OQRA 3FIWA 3ZGKA 3OOUA 2BEOA 3MEXA 4YRVA 1SG7A 4IJAA 3Q43A 2F5CA 3CCQI 2Y2ZA 1O7FA 1JTYA 2V6CA 2HZTA 4UNOA 3LSGA 4XLAA 3B7UX 2HFHA 2HTJA 2R7DA 2DA2A 2XSDC 3AKZA 1ZRDA 1U9OA 1J09A 1HQCA 4HG2A 4I01A 3FU0A 1G6NA 1ONNA 3BTJA 3RKQA 1IN6A 1U8BA 4HLXA 4M3DA 3ZMVA 3L2RA 2LP0A 3FXMA 4XK4A 1S8NA 4WWCA 1R49A 3BCBA 4KFCA 1O3TA 3HC7A 1Z21A 3KE2A 4BEHA 2L01A 5M3FJ 4A93J 1ULYA 2FBHA 3FTVA 2E36A 2GA2A 4FISA 5IT9Z 4A5MA 3BR2A 3X2QH 2YU9J 2A5YB 3C2GA 3MZHA 5EEGA 1ZGAA 3ZRGA 3K70C 2H8WA 2RN7A 2B63J 4M6YA 1E3PA 3H5RA 2EIJH 4ASNA 2B9SA 4Y6RA 2YX7A 1I1SA 1JHFA 4DPRA 2X1EA 2GBYA 1G5AA 3FTWA 2OZ6A 3UNGC 2F5VA 3KEYA 3D0SA 4ZYHA 3HM5A 4RA2A 3HTSB 2L02A 3IP4B 5JC1A 3Q0VA 1RPWA 2RNJA 2IS6A 2CH0A 4A3EJ 2KLOA 3RKYA 4FLSA 3PSIA 5E1XA 3ASNH 1EA3A 2BY2A 3WTVC 4G7HF 2BVLA 4E7LA 3OIQA 1P7IA 2A61A 5AIQA 4PW4A 3HB9A 2YSRA 3LFKA 5BQTA 3ZI0A 2OCCH 4ZYEA 5IP7J 4XNDA 1RRJA 4I2OA 1VQ6I 2F5DA 3A02A 3W3CA 3LSMA 2RGVA 4JK1X 1SFXA 2IVMA 2A3SA 4OINF 4CYCB 3FH8A 4ABZA 3P5JA 1J5YA 3EUHC 3VSLA 2FRHA 2FD5A 1FOWA 2L7MP 1UZCA 4DYQA 4FX0A 2E2HJ 2IW5A 3JAMZ 1PUFA 1RUNA 4KUMA 2Z1DA 1JJ8C 2J5OA 2VI6A 4QMEA 3RSNA 2QENA 3HOXJ 4BU2A 2XPWA 2ZNYA 3HSEA 3FBNB 5ICEA 1BI3A 4QIRA 4ZX6A 2HVQA 4XLHA 4QLCU 2K9QA 1QHGA 2CUZA 4RM3A 2TDXA 1YIOA 4Y4RA 1MW1A 2WY8Q 3FZVA 1NTCA 2EA2A 1D0YA 2STTA 4GYIA 1VQOI 2V79A 3F72A 2GXBA 1TZLA 3F9KA 4A03A 1KA8A 3WTYC 3WTUC 4NBQA 2PFBA 3S93A 1BR1A 1YOVB 4UUSA 4FHTA 3JT1A 2M4KA 1LDKB 5IT9K 1JGIA 2R7FA 2PBIA 4XONA 4IOAF 3GTGJ 3T8VA 4A2UA 5GTHC 5DV5A 2F4IA 1HLVA 2JA5J 5M5XJ 4OOFA 1MW0A 2DBBA 3HOTA 2LOOA 3OYGA 2Q8KA 4HA8A 3GCMA 3LMMA 4XLPF 2JRTA 3K4MA 2XKOA 5B1BH 2WA0A 1QVUA 2GOXB 3W6JB 4QIWN 1A31A 3ECOA 4KIBA 3FU6A 1BJZA 1W0TA 1ZH5A 4HSRA 3OYAA 4A3GJ 1OJLA 1CGPA 2R7RA 3LSJA 3IRQA 1YLFA 2LY2A 2VL8A 3JTGA 4ESFA 2H8RA 4ZX4A 2Q0OA 2L7FP 2BXYA 4ZX3A 3L2UA 1XCBA 3F6VA 5BPIA 4G9YA 3OSGA 1ETYA 2R92J 1UHSA 1OYWA 4HV6A 2IGKA 2PL5A 2UV1A 2VT3A 1P4XA 3T8RA 3QOPA 5LD2C 1FLIA 3WU2C 1TC3C 4BJ5C 2F4OB 3N4MA 2IJLA 1FMWA 5CLSA 5JAZA 5LRSA 2HOEA 1D5YA 1WJFA 1MNEA 3K6GA 1FY7A 1GLNA 1MSEC 3MN2A 1R58A 3HJEA 2EIMH 4AYSA 1HDPA 3WG7H 2DA1A 3CUQC 5LGTA 3K69A 4O6JA 4DGWB 2D5VA 3AU9A 1OR7A 1P6RA 2HXIA 4MFEA 2VQHA 4E7ZA 4IRGA 4KA4A 4AVZA 3RPUD 5E18F 3HOVJ 5DCFA 2A69F 3S2HJ 2G7UA 4N4OB 3GTLJ 3JAMK 3LSIA 3WGIA 1MGTA 2V4JC 1IRXA 1G59A 4L0YB 1O57A 4C2UA 3CO7C 4NHJA 1TW3A 2ID6A 4ZQTA 4XN5A 2ESHA 4LG0A 3VODA 3TP3A 5EF6A 4BACA 3JRCA 2F48A 2HZDA 2X1CA 3M1CA 3W6VA 3H36A 3KP5A 4XR6A 4EATA 3G73A 3CCVI 1AA7A 2CU7A 1FX7A 2K27A 2NOJB 3FISA 1HW2A 2W57A 1D8JA 1WI3A 3BG9A 4M9XA 1IV6A 5JBIA 1RKTA 3CHPA 1K6YA 3FM5A 5TJJA 5IP6A 3B02A 3OYKA 4AIJA 2DN0A 4HF0A 4XICA 2BY3A 2MAPA 3JRDA 2M0CA 3V7CA 1K79A 2KHMA 1DGRM 3HRSA 1IN5A 3QQAA 4EJWA 3O3KA 2XAQA 2M3AA 3FHNA 3R6SA 2XROA 3WU1B 3G71I 1W7PD 4KJZA 1VQLI 3VOEA 2A6TA 1X2NA 1U3EM 4XMVA 1JGSA 2H27A 5L3FA 4EQQA 3S17J 5IP9J 1KU9A 1JKQC 2RREA 5H6QA 5L3CA 1UG0A 1YITI 1NG7A 5DS9A 3DKYA 1L3LA 4CICA 3S15J 4UVBA 2V1UA 2GIZA 1MKMA 3ULQB 5FLMJ 3LQRA 2Y0SA 2EGHA 4LITA 4ZQFA 4M6VA 2DMUA 2OAZA 2K4BA 2MYSA 4D9JA 5EGOB 2E1NA 3QRFF 5EGOA 1NK2P 3B2PA 3GTJJ 2MD0A 1SC5A 2KDOA 4FLQA 3RYPA 2K9LA 4MQVA 3IRRA 3C2HA 3BTCA 3K4BA 4B8XA 5JHFA 4CO8A 1ZHFA 4J3BA 2O5RA 4IVNA 1JJ6C 2ZBKA 3E0JB 4XIDA 1XDSA 5J47A 1D5VA 3GFMA 1Y8RB 3T0YA 1R4NB 1TNTA 3FMRA 4NDLA 5KK1A 2VBWA 1TWFJ 3B73A 1RESA 2O0YA 4RGXA 1IN7A 2GM4A 3EUHA 4MTDA 2EFQA 3AL0C 2DA4A 4OU0A 3V7RA 6PAXA 4N9IA 1SAXA 4FE7A 1K78A 3WHBA 1J7KA 4ZZDA 2NXNB 5IYDJ 4PK4A 5DM7F 4RLQA 1O7LA 2BV6A 3HHHA 1CQTA 4WF2A 4UXNA 2RNGA 2O7GA 4TV7A 2ESNA 1W4MA 5JVGF 1V55H 1PUEE 2E1MC 5AONA 4D7MA 4IKFA 2JA6J 1G3WA 4PCQA 4EJUA 3I59A 3ANMA 2K3FA 1AKHA 3ANNA 2DTZA 3GTPJ 2E34A 3E5UA 3ECHA 5F0FA 3A0BC 4LG0B 3CCJI 3PUUA 1S7EA 2DFEA 3ZCOA 4RS8A 3W2VA 2CUJA 1HDDC 1SVOA 4A3FJ 3SZTA 3VYUB 2WAQN 2ZXHA 3WG9A 1E3OC 2E2IJ 1Z3YA 5GADJ 3S3NA 1WH7A 2K85A 5C3EJ 4IXAA 2V9KA 3BROA 2FOWA 3FF5A 4BY7J 2VBZA 2RAEA 4C9YA 5LBQA 1MBGA 3ZHYA 1B59A 3LAJA 4BNCA 4MLOA 2JK3A 4XM3A 3QYBA 5B1AH 2M8GX 5C4XJ 3OYNA 2HVRA 2FMLA 1W36C 1IXCA 1QVTA 2BY1A 3UKGA 1MJ9A 3R61A 2JD0A 2JSPA 3DEWA 4MQ9F 1YTYA 3B34A 3GO5A 4Z6YA 1VQ7I 3MKZA 4EJOA 3FK7A 1A35A 5EEAA 2DK8A 1XS9A 2QBYA 3EETA 2PQ8A 4XQFA 3JR9A 4L9VA 3Q0UA 5EYRA 1K83J 4JYKA 1YYVA 2LLKA 1ENHA 4A3BJ 3M9AA 3FXLA 5HLTA 1Y0NA 3FUDA 3WQRA 2QUFA 3AG2H 3K2ZA 3GWZA 3F23A 2LRDA 2WY7Q 1FP2A 1A04A 3RI4A 2CFXA 4PVBA 1I3QJ 3BLYA 1R0KA 2HQRA 1X58A 3FUKA 5BS6A 1X3ZA 1IZ1A 1FIPA 2FF4A 3A01A 3FTZA 5JI6A 1Y1WJ 2CV1A 2FX0A 3CDHA 3QWLA 4LB5A 3WE3A 1Z1DA 1FP1D 2UWMA 2TCTA 1MIJA 3LSKA 1GT0C 4XMUA 2A07F 3HUGA 5DTDA 2I8DA 4XN3A 1I1GA 2K86A 2QVWA 4BHPA 4XN4A 4XORA 3CJNA 5CVVA 2VXZA 5KAIC 4ZW6A 2EFNA 3TOAA 4PJMA 3FKIJ 1IG7A 1H9GA 1BI0A 4X6AJ 4E7HA 1WZ2A 3WGHA 2L9RA 1JGGA 1HSJA 3HRMA 1YW8A 4CCMA 5F1RA 4XRSA 3FDYA 2B0LA 2KMUA 2MGQA 4ZDOA 2OQGA 1MW2A 4LGWA 2ECCA 3A0HC 1VQNI 2KIUA 5HDKA 1DQUA 1VQ4I 3PUFA 4BXUA 1MJAA 2KIFA 3VDXA 1HKTA 2NVTJ 1ZTRA 4IL6C 2PMUA 4HZFA 3VYSB 3P9IA 4FT8A 2OF7A 5L3DA 4EM0B 3MD2A 1S29A 3FXKA 3FUMA 1DU6A 3M8EA 3E5XA 3E6BA 4BHBA 3TL4X 1E2XA 2PJPA 1SFKA 1P7JA 3KETA 4HDUA 2P5LC 4W97A 2JCXA 4BQQA 1G3TA 1DU0A 3RQ4A 5DEQA 2W85A 3I0TA 2DDBA 4BXFA 2KISA 4XN1A 2JJ7A 3MKLA 3WQQA 2AXTC 2XVCA 4G12A 2EZHA 4XN2A 2KZVA 3DU6A 1P4WA 4XSXF 5J3LA 3OYDA 4EGZA 4DQ2A 3OYLA 1Q0QA 4PFOA 1ODDA 4U0YA 1PYVA 1O3RA 4LUPA 5CQEA 4HRIA 4B4CA 2FMYA 1MBKA 2FEZA 3CCEI 4K5PA 3DTEA 3FXQA 3C2BA 1QU3A 3P9KA 3E6CC 2L9VA 3MKWB 2HKXA 3BR1A 1USTA 2FSWA 4CHUA 5A2QZ 2Y1DA 2ELHA 4M74A 2E35A 5K5RA 2MABA 4C3JJ 3PUBA 4LB6B 1OFCX 1XB4A 1R5GA 1SAUA 2CRGA 3U21A 1B9NA 4ZTJA 2GXAA 1T8IA 1B72A 2GAUA 2DA5A 5KCMA 1MD0A 1V54H 4BBSJ 2HPOA 3FUIA 3V42A 3WQSB 4LJZF 5E3NA 3S32A 3J80Z 4HNVA 1ON2A 4HNTA 4IHTA 3SEQA 1PP7U 3HSRA 3IH3A 4KYWA 3FU3A 3WTXC 2R4GA 3PFYA 4LFUA 2BOLA 3B37A 3HOUJ 5GTIC 4KISA 2P7VB 1TNSA 2NS0A 3J7AY 1E17A 1Y8QB 1OCOH 4RBOA 3H9QA 4UV8A 2F5FA 2Q2EB 1OISA 2PUSA 4C3IJ 4HX8A 3HOWJ 4JBAA 1IUFA 2PMZA 1ZRFA 2X6OA 5HNFA 3OL3A 3HEFA 2E60A 3ZOBA 1X4PA 3BG7A 3BQYA 4L5IA 4LLLA 4ZQEA 3PSFA 2DYRH 4PU2A 5DUKA 3QPLA 3S14J 2JZYA 4MNUA 2R59A 1BW5A 3H3UA 4CDGA 4XN0A 1JKPC 2LREA 4ENNA 3FTUA 1MDMA 1XX5A 1FZPB 2NNYA 4A3DJ 5IT3A 2GWRA 2HTSA 5HLGA 3G2BA 1IUYA 4CYCA 5TRDA 2XAUA 1G3SA 2MSYA 2E1OA 1WFXA 5CPRB 3CUOA 1ZG3A 2KP6A 2E2JJ 3ABUA 4FCYA 4DW6A 2IA1A 1TWGJ 2X9DA 2NNNA 4IPAA 5HDGA 2PN6A 3FBIB 2JT1A 2QYOA 4EM1A 1C0WA 4OMYA 1Q0HA 1QRYA 5F0HA 4ZZLA 4HDVA 4NQWB 1X3ZB 4HQEA 5CKTA 1D1BA 2XAJA 1LE8A 2PJRA 2G9WA 4S0HB 1S5LC 2PJRB 3M8JA 1DPUA 5E8IA 3RJPA 2KT0A 2A6EF 3CF2A 5AIPA 5D6FA 4XMWA 3MQ0A 1ACIA 5F1JA 2DMNA 3OYEA 2VUMJ 1QPMA 4QUOA 2H94A 1XGOA 5LEJA 3QAHA 1X3UA 4HX4A 1BW6A 1IGNA 3RTRA 5J40A 3PL8A 4AYBA 3J80K 1B72B 3AU8A 3FX3A 5LHHA 2M4GA 3I56I 5FKOA 1YRNA 1B1BA 2DQ6A 1OQYA 1UFMA 2ZJPF 3MWMA 2CW8A 1MDMB 1FIAA 1R00A 2EFOA 2FQ3A 5F08A 2ZMEB 1UMQA 4M6XA 1TP4A 2C82A 1KU7A 3O8GA 2QJ1A 2DTRA 5FD5A 4IX7A 1AWCA 2AXLA 2HPTA 2OU2A 1EF4A 3BJOA 3BJAA 1OCPA 3QPTA 1FC3A 1S3JA 3F8MA 3KYLA 2PGGA 4R5VA 3FXRA 4B1RA 2BGCA 3NAUA 2A6HF 4NQWA 1P2FA 5LGUA 1FYLA 2L4AA 2DQMA 2QBYB 1I27A 2R5ZA 5KAFC 1OCRH 1WPKA 1K7AA 3SQNA 4I6ZA 3V8JA 4F92B 5A2QK 3GEZA 3M7GA 1DPRA 2JRMA 3RKXA 3QU6A 3FUEA 2Z16A 2NAZA 4UUTA 1BC7C 1DDNA 5CVRA 3OIPA 3PIOF 2DI3A 2QQAA 3K70D 1JUPA 5IOYA 3ZHXA 3ASOH 1P92A 2RKHA 2PI0A 2R7UA 3N97A 1JE8A 4HEA2 1D8KA 4RB0A 4AIKA 5TGTA 3VFZA 2MFZA 1R1UA 1YE9A 3CMMA 2GLOA 1GW6A 1T1RA 3HG9A 1FTZA 2GIVA 1SMYF 2PMZN 4IEJA 2PLYA 4OIPF 3NEUA 1U5TB 2FE3A 3IKVA 4ZQHA 2JWTA 3TO9A 2DPDA 3S3MA 4QHPA 5HODA 3LA3A 3FUHA 3RQIA 2EZKA 1W5SA 2VIXA 3GZ6A 3SHFA 5IOZA 5EZHA 2DA6A 2HOSA 3P7NA 3RPUA 4B48A 1TBXA 3DLAA 4FETA 1YFHA 2MG4A 5FWQA 4AR8A 1KYZA 4RVBA 1HW1A 5FO5A 3ML6A 3E1SA 4C3HJ 3PQKA 4ZX5A 3U9WA 2QQBA 1OCCH 2QCOA 3KEOA 3BCAA 3OL4A 2OZUA 3DP7A 5FLVA 1P9QC 3H1CA 3QYFA 3GMEA 1KU3A 4BHCA 4V2GA 3SJMA 1A6QA 1YX3A 4MEXF 3PNYA 2ZMEC 3HHGA 4RAZA 3RPQA 4RAFA 1Z9CA 4ESJA 4G6TB 3OS0A 2WV0A 1U0JA 1BIAA 4EVIA 2DQLA 1UJ8A 1R22A 2FQ4A 4EJVA 1VQ5I 4HSTA 3RIRA 1ZRCA 1BI1A 1X2MA 3KLOA 2E7WA 2YUSA 3KZYA 2JCYA 3VVLA 1FT9A 2TRTA 1SVMA 3MMYB 4DYCA 3FXUA 1E0EA 3R0AA 3ZPLA 4J19A 3B6AA 1IXSB 5LFAA 1I5ZA 5K5QA 2XRLA 4M3EA 4YG2F 4G7ZF 3L2QA 3KP2A 2VJIA 2P7CB 4AWXB 3FK6A 3VWBA 3D5RC 5E1WA 5CYVA 3PIPF 4A12A 4Y67A 2QZ8A 3GFLA 2WPGA 5HDNA 2CJJA 2EBIA 1RR8C 3HUGB 3I4NJ 5JLWA 2DA3A 1W0UA 2VE9A 1T08B 2BHYA 3TOBA 2R5ZB 1QZZA 4AR9A 3LWFA 2B61A 1RKWA 4A0ZA 5BOXA 2QQ9A 5JLXA 3KFWX 4RGRA 4ZYGA 2I10A 4E7SA 3HOSA 3V4GA 3F3XA 4BEHB 4O5VA 2WC2A 3H0GJ 3H3ZA 4GAEA 2DQRA 1Z7LA 2X48A 3IAM2 2COBA 1FOXA 3SZGA 1BC8C 4F55A 1T39A 1IDZA 3A03A 3CESA 2CQNA 4XSZF 1XC5A 2Z3YA 1RNLA 1HC8A 1JUMA 4Y17A 2OC6A 3HTUA 4A3IJ 2EV0A 2V1NA 3GF2A 3EYYA 3EQLF 4I7HA 4WK8F 4RB3C 4XN9A 3IAS2 4I09A 1J75A 1MNMC 2F6CA 3BOQA 5ICGA 2JSCA 2Z99A 2KDZA 1X1BA 2XGXA 2L4MA 3EDPA 1CF7A 3OWTA 3PM1A 2OBPA 4RM2A 4PSXA 3WTWC 2ZO4A 2BBYA 4RB1A 1XTAA 3VYTB 2ELKA 4W1UA 2KFDA 1ETKA 2XHKA 3HKZN 4NB5A 3BWGA 4Y3OA 3HW2A 3R0IA 4XMXA 3VVMA 2QSFX 3IHUA 2RC4A 4XKWA 4CCLA 1IC8A 2WZGA 5DYFA 3CC4I 3EBHA 4OOIA 3CMAI 4H0EA 4Y6PA 2QKLB 2HDDA 1F43A 5CQGA 3KIOA 2MAOA 3CF5F 3VPRA 1SFOJ 4D5CA 3L1PA 4HF1A 3FTYA 3JSPA 5M5WJ 3OV8A 5D5VB 3BR6A 3RC3A 3FUFA 2DYSH 1SD6A 3ZXSA 3CP2A 4IRIA 1BR2A 3LSPA 3JRFA 2FU4A 1W7PA 4NC7A 2QF7A 4BKXA 4P9FA 1R5ID 5E3MA 2DW4A 3MZ8A 4HAMA 3V7SA 4CCJA 3S1RJ 4BXXJ 3GXOA 2FFLA 2UXNA 4S05A 3K4KA 1STZA 3H5NA 3F21A 1KQ0A 4ETSA 1JXSA 1MMAA 3OYMA 4Q47A 4X1EA 1YQAA 5ILSA 2Y9YA 5GAGJ 2HI3A 3RDIA 4YFKF 3JW4A 3ZQGA 4IHXA 1D0ZA 2XV4S 2CS3A 1PJRA 4LOCA 4BAYA 4Y7NJ 5LHIA 4OIOF 5CVUA 3I3LA 5IY5H 2VC0A 2IP2A 2LSOA 3L2WA 2JCVA 4UY8I 2K9NA 5E20A 5E79C 1F36A 3OYCA 3KZZA 5E8GA 1RIOH 5K7ZA 1I50J 1Z67A 3B7RL 3EPZA 4LIVA 2Y0MA 3TMOA 3HGYA 2R7WA 1K4TA 1V3FA 2ISYA 3K4LA 2EINH 4FLOA 2L9SA 1Q0LA 4XL9A 1AOYA 2K3PA 5D5WB 5J1YA 2H09A 4IF4A 3VSKA 2O3FA 4A0XA 1O4XA 1OYIA 1QO0D 5DYMA 1NK3P 5BPPA 1OCTC 3SEZA 1V4RA 1JKOC 4DIQA 4CCOA 1A6IA 3B7SA 2ECBA 4JOMA 3ZP5A 4H4KC 3AG3H 1S6LA 5EJCA 2E5ZA 2GTQA 1GUUA 2NS8A 2A05A 2P0WA 2MH2A 2P5VA 3OR2C 1FYKA 1IRZA 4BJTA 1JG9A 2CQ7A 4CCNA 4AR1A 3LA2A 2FOKA 4CZCA 5L3EA 4QTRA 1IV8A 4P9UA 2QEXI 4FCAA 3OYFA 3EUAA 3KEDA 2M7AA 2MLGA 1TT5B 4ZJZA 5BMZA 2UZKA 1BM9A 1TL8A 2M30A 2HYGD 4ZC3A 3JTHA 1FMVA 4DYRA 3CCMI 4B43A 3A2KA 2R7XA 3MCZA 4BDZA 2Z33A 2EFPA 3CP8A 3BQZA 5ILUA 3A06A 1ONVA 3RYRA 3U1KA 3Q5FA 1ON1A 5FFZA 2YX4A 4NUBA 2EFWA 4A3CJ 1LVKA 1IN4A 1IW7F 2V1DA 3FHEA 3FM3A 1O3QA 3JRHA 1Q1HA 5CVJA 2ZSHB 1S46A 4HNUA 2JV7A 3ZMZA 1D3YA 1N25A 2IA2A 2WB1A 4AU7A 1X1CA 3UERA 3O6BB 2CW7A 1UHWA 3OSFA 1B8IB 3GUDA 2KKOA 1QGPA 4RGSA 3BT9A 4DOZA 2VKVA 4ZYAA 4FTHA 2ZJ2A 2LR8A 3FWEA 3IWFA 4F7ZA 1OMIA 1X3WA 1RC9A 2JA2A 5LGNA 4ENMA 2ZMEA 3DWLE 1EV7A 2K7LA 2OA4A 5DULA 2ISZA 1I3AA 3S1MJ 2M1BA 3PNVA 5FRMA 4E7JA 1RZ4A 3I58A 3I54A 1ERDA 2F4MB 2YR2A 4HQMA 4QSHA 2AQEA 3CHSA 4HLYA 3J7YJ 4CCKA 3TDZC 3L9FA 4M3GA 1DGWY 4E4HA 1JKRC 1ZYRF 4Y6SA 4IHYA 3GYHX 2EPFA 1MW3A 4XKVA 2DODA 1KQ8A 2R3SA 5FKKA 4ZYDA 1J2XA 4XLFA 5DLLA 2GZWA 2JMWA 3HXLA 3IWZA 3TW7A 1S7AA 1UG2A 1MBEA 2EILH 5CVIA 2QM3A 5K7HA 2LDUA 2EQRA 3OY9A 1MMGA 4LG3A 1G2HA 1XCVA 1O3SA 4Y13A 2P81A 2ZFWA 4E70A 1FBQA 1GDTA 2W25A 1GV5A 2X51A 5HS7A 2RJIA 5JO0A 3G1LA 3BTLA 1QZEA 2KJBA 1ZKGA 1H0MA 2EA4A 3ZQFA 5J8CA 4B47A 1FNNA 2CFOA 2LTPA 4PUSA 4DBQA 3ZQCA 3TKYA 4KDPA 4KT6A 1TQMA 2MH9A 4PJNA 1Z91A 3LOCA 4CUGA 1Z0XA 3QOEA 4MEYF 2IS1A 4ON0A 1JHHA 1ETVA 3HGGA 3L2VA 2CV2A 3EBGA 4PGHA 5GPAA 3S8PA 1R7JA 3DKXA 4PJJA 2M7BA 4RMNA 3GTQJ 1MMDA 5FD6A 4N9HA 1S72I 2XPVA 5HS9A 3PO2J 2R7OA 4OWRB 3GTOJ 3A01B 1Y39A 3O2PE 1A5JA 3R0JA 1HF0A 1WWXA 1JT0A 2KIMA 2R70A 4AC0A 4HPQA 1BN5A 4ITVA 4RSYA 4I02A 1MBHA 2VOPA 1SFEA 2X85A 2XSJC 3NQOA 3BY6A 4NC6A 2DT6A 2N8GA 1X4OA 4BQNA 3QU3A 5JFRA 2Y9ZA 1SD7A 2OTLI 3TEDA 4HV5A 1LEAA 3B2XA 1D0XA 1T6SA 1Z6TA 4I0AA 3IV5A 4XOTA 1IN8A 1B8IA 3GFIA 3K10A 4AD9A 1HCRA 2QWWA 2BW3A 4L9NA 1POGA 5LEKA 2OJED 4NC8A 1YRNB 4C2TA 1LEBA 4EM2A 5FFXA 2IEKA 2DJIA 2X1DA 4L5EA 5HVQC 3ZQHA 4B3XA 2DT5A 3KCCA 1SEUA 2L0KA 2HS5A 2JN6A 4FASD 1WJEA 4BBRJ 9ANTA 4I76A 5TISC 1HKSA 1YJWI 1GHCA 2XDVA 1BIBA 3CCYA 1YW7A 5DUIA 2YPRA 4IO9F 2XAGA 4U7DA 3SZPA 2NOGA 2R5YB 1IDYA 2VLAA 1AHDP 3S2DJ 4XKCA 4J01A 2XB5A 4G94A 3J7ZI 5D8KB 4CGZA 2HYFA 2STWA 1IXRC 2M87A 3H9JA 3NRVA 4LD5A 4LK0F 1LFUP 1MBJA 1KZHA 1Z7UA 3A1YA 1N75A 3LNQA 4GO1A 2W4SA 2BE5F 2L2OA 2ME0A 3T1BA 3TO6A 1FOKA 5FKLA 3HOZJ 3WTTC 3CDLA 3HPHA 1EH8A 3QJXA 4Q5SF 2WAFA 1QNTA 4Y15A 4OIQF 4E7IA 1JI8A 2WV1A 1DP3A 2FBIA 1SQMA 3LFUA 3ABMH 4KT5C 2QKMB 4UB6C 2RVCA 2K9MA 1T2KA 4UVCA 2IAIA 4Z2YA 4IZZA 3FH5A 2O8XA 3GLXA 5DD8A 3ZQ7A 2K9SA 4DZJA 3CHQA 2QQ8A 2VOOA 3FUJA 5FROA 2K02A 3F8CA 3R60A 4JNDA 2CYYA 2HWVA 1YJ9I 2PMHA 2V7FA 3FHZA 5K5OA 2Z9OA 2LVSA 1UB9A 3G3ZA 1HKQA 4LMYA 1FEXA 5D4RA 2DMQA 1V5EA 1WHUA 3CUQA 3KYCB 5KVRA 1YX5A 3FTXA 3IIEA 5K7FA 1ZGJA 1J0RA 5DM6F 3C3WA 3F8NA 4C2MJ 1R23A 2M9HA 3IKTA 2FBKA 1OKRA 3E97A 5E3OA 2XPZA 3TDUC 1LE8B 2ZKZA 1V5FA 1ZQ3P 1ZGWA 3FULA 3ZMSA 1GVJA 4UHTA 2V9PA 3CZEA 2R0QC 2L7ZA 3WTZA 1ZN2A 2DU9A 1LDDA 2R5YA 4OAZA 2MC3A 5J1RA 2E19A 5D5XB 2DFIA 3K1PA 1MMNA 4L0ZB 1I6XA 2DA7A 3ZMTA 4DNCA 3M1EA 4QWQA 1ETWA 2K4JA 2D1HA 4KP7A 5HNHA 4K5MA 2DCEA 4MHGA 3BJ6A 1VTNC 2HR3A 2DT7B 1PDNC 4BQOA 4P55A 5L3GA 4XNAA 4ZN6A 4GRIA 2Q1ZB 4AM3A 2HQ5A 2X6YA 1VZ0A 3ZMUA 3CC7I 4K5OA 1ITYA 4OMZA 5ICCA 1T0FC 4XMTA 4BGDA 2CV0A 4P5OA 2DOEA 1Y56A 2XB0X 2CUEA 2DO7A 2A5WA 1KU2A 3F8BA 2MA3A 3AAFA 2M34A 1K6OA 2PEXA 1WJAA 3WTSC 1JT6A 3ZN0A 4L18B 3KYDB 2FA5A 2CW0F 2XGDA 2XF7A 3JSZA 1XDUA 4LLNA 4EEFG 4M73A 1NH3A 1FSEA 2HYJA 2W82A 2LC2A 5EG0A 3KP3A 4DBRA 5FLXK 2XC7A 3JSOA 3G4SI 4XNFA 1MMSA 2X6WA 3IL2A 4XLEA 2NVXJ 4XMYA 3AL0B 5D5UB 1SC7A 3JRBA 3BG6A 1QHHD 4FX4A 1QBJA 2GQQA 3PFIA 2NVYJ 3GX4X 2VJ5A 2KL4A 4KN4X 3MFKA 2Y1FA 3CLOA 3M07A 5DDGA 5EZGA 3W2WA 2XQ0A 4F93B 3K4JA 1XD7A 4R7LA 4CA0A 2VKEA 2XAHA 2NYXA 2DFFA 2ZXGA 1X3WB 3C1DA 2XASA 1E3HA 2MW8A 1ZELA 3CJTB 2V1XA 5D8LB 4R79A 1WI9A 4AIHA 3CIAA 3H9GA 4CSWA 2DLLA 3N05A 1SD4A 3ZN1A 1SFUA 4PDKA 2GXGA 2E1CA 3DBHB 3IH2A 2LY1A 4N4NB 2VBYA 4XO5A 2KRHA 2V9VA 3S1QJ 1XN7A 3TW6A 3CJQB 2CSOA 4L5JA 1EH6A 2CUFA 3TQNA 2P4WA 2EZIA 3KP6A 2HKOA 1RUOA 3IC7A 2Y0SN 1U6GA 3J81Z 2K40A 3OS2A 2PX9A 4KMUX 1D1CA 1MJBA 4QPQA 3CCSI 4A0YA 1I6HJ 4ARFA 3OYHA 2QVOA 2RDPA 2R7TA 1QA6A 2VT2A 4XKBA 3GBGA 1ONPA 3LQQA 1T98A 3OIOA 3HRTA 1T95A 4B3AA 2ZXWH 3L09A
chains in the Genus database with same CATH topology
4CXFA 1R1TA 4XN7A 2IPQX 3GW2A 2LNBA 1WSUA 4G6DA 2L3DA 3RKWA 4Q4EA 2VONA 4ZQGA 2EV5A 4GCVA 5CJ9A 3ROUA 1H19A 2VE8A 4RGUA 2JTVA 3QP5A 3I59B 2IA0A 3WGGA 4XBFA 1F4KA 2A7OA 2HQNA 1BJAA 5E1ZB 5JVTA 3TO7A 3I4PA 4K5NA 4O3MA 3V8LA 3PQJA 3DXJF 1U2WA 2VN2A 4G6QA 3MZYA 4KIFA 3Q9VA 2VBXA 3B3BA 3L2CA 4Q48A 4G8XA 2ADUA 1LVAA 3ZHZA 1BBYA 2CGPA 2UXXA 4ESBA 4EV0A 5D4SA 4A6EA 1F5TA 1R0LA 3D5LA 2GA1A 5DD4A 5ICFA 3I5UA 4MKTA 1R5HA 4N0BA 4CYDA 2W84A 3U1DA 4I0BA 1MVYA 2X0LA 4XO4A 2Y48A 3J7AO 4ZW7A 3RC8A 3GFJA 1GXQA 2JD1A 1LDJA 1UCRA 2D2WA 1TTYA 3K0LA 1HBXG 1H9TA 1YS7A 1XMKA 1U78A 4HF2A 4YIFA 3DKWA 5HLHA 5L3BA 2MBFA 1L0OC 2C5ZA 4OOEA 2XUBA 4M9SA 2DK5A 4R5XA 2O61A 2FNPA 5H20A 3CUQB 2YU3A 4S04A 5D6EA 5HLIA 1YS6A 1YO5C 1XSDA 2LF8A 2H6BA 5F64A 4U0WA 1ONOA 5DCMB 4QPEA 2XPYA 1DP7P 2Y1EA 3BPVA 4RCVA 4AVPA 1LB2A 3COAC 3T5XA 3EYIA 4EJTA 1BI2A 3L00A 2Z5UA 2D45A 4GXOA 1B4AA 5JNLA 3REOA 3LAPA 3KP7A 3GZ5A 2EV6A 1YW9A 3BPXA 4UUVA 5FLXZ 1TQPA 3DQVC 1U8RA 3H92A 5K1YA 3SFZA 5FB2A 2VODA 1J9IA 5JHUA 4A5NA 3W6KB 4A6DA 3K1NA 5EEHA 5LHGA 2VC1A 3CZLA 1HSTA 4EMSA 3FUNA 5ERIA 4XN8A 2BYVE 3CO6C 2O6GE 1HS6A 2P6TA 2A68F 2NRAC 3KLNA 4ENJA 4GYGA 1Y0UA 1HXDA 1KQ9A 4KMFA 3U9GA 3HIFA 4UV9A 2P8TA 3KEQA 1DUXC 5J6XA 1F9NA 2WWYA 1OYYA 3FMQA 3P9CA 3WODF 3B7TA 3C18A 3FU5A 2MLKA 4XO3A 5F6FA 2X4HA 3J81K 1T0FA 1IRFA 1S7OA 3M8FA 4G7OF 4L9TA 2EK5A 2LF7A 2DPUA 1PP8F 2XRNA 3C7JA 4LLGF 2E7XA 3E3VA 2XIGA 4KN7X 2ZNZA 2FXAA 3F6OA 3DF8A 3A14A 5HOOA 3QPHA 2HGCA 1G4DA 1LQ1A 1EH7A 1XGMA 3RASA 3K9TA 4KNYA 4Q4ZF 5E17F 2DAOA 1SMTA 2Q2EA 4AICA 3ELKA 1BOAA 2RV8A 5H6RA 3WE2A 1QZYA 3HYIA 1XGSA 1IF1A 1Z05A 2QLZA 3DPLC 4ZH4F 1R1VA 1ZLKA 1OPCA 1U5TC 3FH7A 4I98B 3K1MA 3CHRA 5BPDA 1ZARA 2XKPA 2WZFA 3I53A 1FWZA 1RP3A 4ZW3A 4L9JA 1ZG5A 2JPBA 1TLHB 3U2RA 2VJ8A 3V8KA 3AUAA 2XAFA 4XMZA 4WX9A 5AENA 4HYEA 3ISPA 5ILVA 4LK1F 1U5TA 2P5KA 3TGNA 1WQ2A 2O03A 1LNWA 2CG4A 1T38A 1JVSA 3CHOA 4BH9A 4YFNF 3E5QA 3BP8A 3F8FA 3L7WA 2EB7A 2IRFG 1FPQA 4ENKA 3FTSA 3F22A 1F1ZA 4CZZA 1TQIA 1FYMA 3VB2A 2J5PA 2Y1CA 3CTAA 2ETHA 4HX7A 3EBIA 4PZJA 2F2EA 5JR3A 3ERED 2CQKA 2CWEA 4MTEA 1ZS2A 1KGSA 2CO5A 3DPTA 2ZCWA 4L2LA 1R36A 3SXYA 2C6YA 2KRFA 1ZG1A 1G3YA 4OIRF 5LLQA 5JMWA 2EJRA 3I71A 1FBUA 1ZAOA 3ABTA 3WU0A 1K5HA 1QQIA 3DV8A 2L54A 4ZW5A 4GAAA 4EGYA 3E6DA 3S2WA 2Y1GA 3BZ6A 3Q9SA 1K78B 4HBLA 1USSA 4K5LA 4HOBA 1KYWA 3UCQA 1P4AA 3ANLA 2Y75A 3HRUA 3CZGA 2H6CA 2COMA 4HW0A 2HDCA 1ZLJA 3GVAA 3CZKA 1WKMA 4ZW8A 2F5EA 5J8FA 1RI7A 4KICA 4R5TA 3VEPA 3OOPA 4RAYA 3ZMDA 3MAJA 4U0VA 1LJ9A 3T8TA 1FBSA 4KIGA 2MD5A 2WTEA 4IRHA 1REPC 4Q4IA 1GXPA 5ED4A 2RQPA 4WXHA 1XSVA 2M5WA 1HW5A 4UVAA 2ACJA 4U7BA 3QP6A 1T1SA 4YFXF 5HS8A 3R4KA 4K2EA 3BDDA 4YIIA 2HEOA 4B09A 3UEQA 4D0PA 4GGGA 4X2UA 4M71A 4WCGA 1NHAA 1IAWA 2OD5A 3E6MA 5EV7A 5LRRA 3Q44A 4JQFA 2LKPA 4M9ZA 4U88A 4P96A 1MZBA 1XSXA 3DFGA 4MGRA 5DCMA 2EWNA 1J59A 4XRFA 2P6SA 1IRGA 2IT0A 5JMPA 3KP4A 2ZXJA 1SD5A 2R72A 3I64A 1B6AA 4BYYA 4WXDA 1ZREA 2W24A 4BQAA 1Z6RA 2M45A 1TW2A 4FLRA 2D1VA 1WRJA 4XLNF 2G7HA 3LA7A 2JPCA 4PGGA 1UHMA 4R8HA 2JD2A 1W5TA 1B9MA 3LSTA 2PG4A 3HSFA 5FGMA 4MS6A 2M8EA 1H3LA 2FNAA 1YG2A 2AS5F 1W7PB 1XMAA 4WXCA 4XNBA 1XGNA 4RB2C 4R1HA 2KJCA 4M72A 1CF7B 1FSHA 3FMSA 3DEUA 2OQRA 2BEOA 3MEXA 1SG7A 4IJAA 3Q43A 2F5CA 1O7FA 2V6CA 2HZTA 4UNOA 3B7UX 2HFHA 2HTJA 2R7DA 1ZRDA 1HQCA 4I01A 3FU0A 1G6NA 1ONNA 1IN6A 4HLXA 3ZMVA 1S8NA 4WWCA 4KFCA 1O3TA 3KE2A 2L01A 1ULYA 2FBHA 3FTVA 2GA2A 5IT9Z 4A5MA 2A5YB 3MZHA 5EEGA 1ZGAA 2RN7A 4M6YA 4ASNA 4Y6RA 2YX7A 1I1SA 1JHFA 4DPRA 1G5AA 3FTWA 2OZ6A 3D0SA 4ZYHA 3HTSB 2L02A 5JC1A 2RNJA 3RKYA 4FLSA 5E1XA 4G7HF 3WTVC 5AIQA 2A61A 4PW4A 3LFKA 2YSRA 3ZI0A 5BQTA 4ZYEA 4XNDA 4I2OA 2F5DA 2RGVA 4JK1X 1SFXA 2IVMA 2A3SA 4OINF 3FH8A 1J5YA 2FRHA 4FX0A 2IW5A 3JAMZ 1RUNA 4KUMA 2J5OA 4QMEA 2QENA 2ZNYA 3HSEA 5ICEA 1BI3A 4QIRA 4ZX6A 4QLCU 2TDXA 1YIOA 1MW1A 3FZVA 2EA2A 2STTA 4GYIA 2V79A 3F72A 2GXBA 4A03A 1KA8A 3WTYC 3WTUC 2PFBA 4FHTA 3JT1A 1LDKB 5IT9K 1JGIA 2R7FA 2PBIA 3T8VA 4A2UA 5DV5A 4OOFA 1MW0A 2DBBA 3HOTA 2Q8KA 4HA8A 4XLPF 2JRTA 2XKOA 3W6JB 3ECOA 4KIBA 3FU6A 1ZH5A 1CGPA 3IRQA 1YLFA 3JTGA 4ESFA 4ZX4A 2Q0OA 4ZX3A 1XCBA 3F6VA 5BPIA 4G9YA 1OYWA 4HV6A 2PL5A 2VT3A 1P4XA 3T8RA 3QOPA 1FLIA 3N4MA 2IJLA 5CLSA 5JAZA 5LRSA 2HOEA 1FY7A 1R58A 4AYSA 3CUQC 5LGTA 3K69A 4O6JA 3AU9A 1OR7A 1P6RA 4IRGA 4KA4A 5E18F 5DCFA 2A69F 2G7UA 3JAMK 3WGIA 1MGTA 4L0YB 1O57A 3CO7C 4NHJA 1TW3A 4ZQTA 4XN5A 2ESHA 4LG0A 3VODA 3KP5A 3G73A 1FX7A 2K27A 1HW2A 2W57A 1D8JA 5JBIA 4M9XA 3CHPA 5TJJA 3FM5A 3B02A 4AIJA 4HF0A 2MAPA 3V7CA 1K79A 3HRSA 4EJWA 1IN5A 3O3KA 2XAQA 3R6SA 2XROA 3WU1B 1W7PD 3VOEA 1U3EM 4XMVA 1JGSA 2H27A 5L3FA 4EQQA 1KU9A 5H6QA 5L3CA 1L3LA 4CICA 4UVBA 2V1UA 1MKMA 3ULQB 3LQRA 2EGHA 4ZQFA 2OAZA 2K4BA 2E1NA 3QRFF 3B2PA 1SC5A 4FLQA 3RYPA 3IRRA 4MQVA 4B8XA 4CO8A 1ZHFA 4J3BA 4IVNA 2ZBKA 1XDSA 1D5VA 3GFMA 3T0YA 1TNTA 3FMRA 5KK1A 2VBWA 3B73A 4RGXA 2O0YA 1IN7A 4MTDA 3EUHA 2EFQA 6PAXA 4OU0A 3V7RA 4N9IA 1SAXA 1K78A 1J7KA 4ZZDA 1O7LA 2BV6A 3HHHA 4WF2A 4UXNA 2O7GA 4TV7A 2ESNA 1W4MA 1PUEE 5AONA 1G3WA 4PCQA 4EJUA 3I59A 3ANMA 3ANNA 3E5UA 3ECHA 4LG0B 3PUUA 4RS8A 3SZTA 3WG9A 4IXAA 3BROA 3FF5A 2VBZA 5LBQA 3ZHYA 1B59A 3LAJA 4BNCA 2FMLA 1IXCA 1MJ9A 3R61A 2JD0A 4MQ9F 1YTYA 3B34A 3GO5A 4EJOA 2DK8A 2QBYA 3EETA 2PQ8A 4L9VA 1YYVA 3M9AA 5HLTA 3FUDA 3WQRA 2QUFA 3K2ZA 3GWZA 3F23A 1FP2A 1A04A 3RI4A 2CFXA 4PVBA 1R0KA 2HQRA 3FUKA 5BS6A 1X3ZA 1IZ1A 2FF4A 3FTZA 5JI6A 3CDHA 4LB5A 3WE3A 1Z1DA 1FP1D 2UWMA 4XMUA 2A07F 3HUGA 1I1GA 2K86A 2QVWA 4BHPA 4XN4A 3CJNA 5CVVA 2VXZA 4ZW6A 2EFNA 3TOAA 1H9GA 1BI0A 3WGHA 1HSJA 3HRMA 1YW8A 5F1RA 2B0LA 2OQGA 1MW2A 4LGWA 2KIUA 5HDKA 4BXUA 1MJAA 2KIFA 1HKTA 2PMUA 4HZFA 3P9IA 4FT8A 5L3DA 4EM0B 3FUMA 1S29A 3M8EA 3E5XA 3E6BA 4BHBA 1E2XA 2PJPA 3KETA 4HDUA 2P5LC 2JCXA 1G3TA 5DEQA 2W85A 3I0TA 4XN1A 3WQQA 4XN2A 2XVCA 1P4WA 4XSXF 4EGZA 4DQ2A 1Q0QA 1ODDA 4U0YA 4LUPA 1O3RA 2FMYA 2FEZA 4K5PA 3FXQA 3P9KA 3E6CC 2HKXA 1USTA 2FSWA 4CHUA 5A2QZ 2Y1DA 2ELHA 4M74A 5K5RA 4LB6B 1XB4A 1R5GA 1B9NA 2GAUA 1MD0A 3FUIA 2HPOA 3WQSB 4LJZF 3J80Z 1ON2A 4IHTA 1PP7U 3HSRA 4KYWA 3FU3A 3WTXC 4LFUA 3B37A 2P7VB 1TNSA 2NS0A 1E17A 4UV8A 2F5FA 2PUSA 4HX8A 4JBAA 1ZRFA 5HNFA 4ZQEA 4L5IA 4LLLA 4PU2A 5DUKA 2JZYA 4MNUA 2R59A 3H3UA 4CDGA 3FTUA 4ENNA 1MDMA 1FZPB 2NNYA 5IT3A 2GWRA 2HTSA 5HLGA 1IUYA 5TRDA 1G3SA 3CUOA 1ZG3A 3ABUA 2IA1A 2NNNA 4IPAA 5HDGA 2PN6A 2JT1A 2QYOA 4EM1A 1C0WA 4OMYA 1Q0HA 4ZZLA 4HDVA 4HQEA 2XAJA 2G9WA 1DPUA 5E8IA 3RJPA 2A6EF 5AIPA 5D6FA 4XMWA 3MQ0A 1QPMA 4QUOA 2H94A 1XGOA 5LEJA 3QAHA 1X3UA 4HX4A 3RTRA 3J80K 3AU8A 3FX3A 5LHHA 1B1BA 2DQ6A 1UFMA 3MWMA 1MDMB 1R00A 2EFOA 2FQ3A 2ZMEB 4M6XA 2C82A 1KU7A 2QJ1A 2DTRA 5FD5A 1AWCA 2AXLA 2HPTA 2OU2A 3BJOA 3BJAA 3QPTA 1FC3A 1S3JA 3F8MA 2PGGA 4R5VA 3FXRA 2BGCA 2A6HF 4NQWA 1P2FA 5LGUA 1FYLA 2L4AA 2DQMA 2QBYB 1I27A 1K7AA 3SQNA 3V8JA 5A2QK 3GEZA 3M7GA 1DPRA 3RKXA 3QU6A 3FUEA 2NAZA 1BC7C 1DDNA 5CVRA 2DI3A 2QQAA 3ZHXA 1P92A 2RKHA 2PI0A 3N97A 1JE8A 1D8KA 4RB0A 4AIKA 3VFZA 1R1UA 1GW6A 1T1RA 2GIVA 1SMYF 2PLYA 4OIPF 3NEUA 1U5TB 2FE3A 3IKVA 4ZQHA 3TO9A 2DPDA 4QHPA 3LA3A 3FUHA 1W5SA 3GZ6A 3SHFA 3P7NA 3RPUA 1TBXA 5FWQA 1YFHA 4AR8A 1KYZA 4RVBA 1HW1A 5FO5A 3ML6A 4ZX5A 3U9WA 3PQKA 2QQBA 3KEOA 2OZUA 3DP7A 1KU3A 4BHCA 4MEXF 3HHGA 4RAZA 3RPQA 1Z9CA 4ESJA 2WV0A 1BIAA 4EVIA 2DQLA 1R22A 4EJVA 3RIRA 1ZRCA 1BI1A 3KLOA 2E7WA 3KZYA 2JCYA 3VVLA 1FT9A 3FXUA 3R0AA 3ZPLA 1IXSB 1I5ZA 5K5QA 4YG2F 4G7ZF 3KP2A 2P7CB 4AWXB 5E1WA 5CYVA 4A12A 4Y67A 2QZ8A 3GFLA 2WPGA 5HDNA 2VE9A 3TOBA 1QZZA 4AR9A 3LWFA 2B61A 4A0ZA 5BOXA 2QQ9A 3KFWX 4RGRA 4ZYGA 3HOSA 3V4GA 3F3XA 4O5VA 2WC2A 3H3ZA 4GAEA 2DQRA 1BC8C 1T39A 4XSZF 2Z3YA 1RNLA 4Y17A 3HTUA 2EV0A 3GF2A 3EYYA 3EQLF 4I7HA 4WK8F 4RB3C 4XN9A 4I09A 1J75A 3BOQA 5ICGA 2JSCA 2Z99A 2XGXA 2L4MA 3EDPA 1CF7A 2OBPA 3WTWC 2ZO4A 2BBYA 4RB1A 2XHKA 4XMXA 4NB5A 3BWGA 3R0IA 3VVMA 3IHUA 2RC4A 2WZGA 5DYFA 3EBHA 4OOIA 4H0EA 4Y6PA 2MAOA 3FTYA 4HF1A 3JSPA 3OV8A 5D5VB 3RC3A 3FUFA 1SD6A 4IRIA 2FU4A 1W7PA 4BKXA 4P9FA 2DW4A 4HAMA 3V7SA 3GXOA 2FFLA 2UXNA 4S05A 1STZA 3F21A 1KQ0A 4ETSA 1JXSA 4Q47A 1YQAA 5ILSA 3RDIA 4YFKF 3JW4A 2XV4S 4BAYA 5LHIA 4OIOF 5CVUA 2VC0A 2IP2A 2LSOA 2JCVA 5E20A 3KZZA 5E8GA 1RIOH 3B7RL 2Y0MA 1V3FA 2ISYA 4FLOA 1Q0LA 1AOYA 5D5WB 2H09A 4IF4A 2O3FA 4A0XA 1OYIA 1QO0D 5DYMA 5BPPA 1V4RA 3B7SA 3ZP5A 1S6LA 2GTQA 2MH2A 2P5VA 1FYKA 1JG9A 4AR1A 3LA2A 2FOKA 5L3EA 4P9UA 4FCAA 3KEDA 2MLGA 5BMZA 2UZKA 1BM9A 2M30A 2HYGD 3JTHA 3MCZA 2Z33A 2EFPA 5ILUA 3A06A 1ONVA 3RYRA 3Q5FA 1ON1A 5FFZA 2YX4A 2EFWA 1IN4A 1IW7F 2V1DA 3FHEA 3FM3A 1O3QA 1Q1HA 5CVJA 1S46A 2JV7A 3ZMZA 1D3YA 2IA2A 3UERA 3O6BB 1UHWA 3GUDA 2KKOA 1QGPA 4RGSA 2ZJ2A 3FWEA 4F7ZA 3IWFA 1X3WA 1OMIA 5LGNA 4ENMA 2ZMEA 1EV7A 2K7LA 2OA4A 5DULA 2ISZA 2M1BA 1RZ4A 3I58A 3I54A 2YR2A 4HQMA 3CHSA 4HLYA 3TDZC 3L9FA 1ZYRF 4Y6SA 3GYHX 1MW3A 1KQ8A 2R3SA 4ZYDA 1J2XA 5DLLA 2GZWA 3IWZA 1S7AA 5CVIA 2QM3A 2LDUA 1XCVA 1O3SA 4Y13A 2ZFWA 4E70A 1FBQA 2W25A 5HS7A 2RJIA 5JO0A 2KJBA 1H0MA 2EA4A 5J8CA 1FNNA 3TKYA 4KDPA 1TQMA 2MH9A 1Z91A 4MEYF 4ON0A 1JHHA 3EBGA 4PGHA 1R7JA 5FD6A 4N9HA 5HS9A 3O2PE 3R0JA 1WWXA 2KIMA 2R70A 1BN5A 4RSYA 4I02A 2VOPA 1SFEA 3NQOA 3BY6A 3QU3A 5JFRA 1SD7A 4HV5A 1LEAA 3B2XA 1T6SA 1Z6TA 4I0AA 1IN8A 3GFIA 4AD9A 2QWWA 4L9NA 5LEKA 1LEBA 4EM2A 5FFXA 5HVQC 2DT5A 3KCCA 2HS5A 1HKSA 1GHCA 1BIBA 5DUIA 1YW7A 2YPRA 2XAGA 4U7DA 3SZPA 2VLAA 4G94A 5D8KB 4CGZA 2HYFA 2STWA 1IXRC 2M87A 3NRVA 4LD5A 4LK0F 1Z7UA 4IHSA 4GO1A 2BE5F 3T1BA 3TO6A 1FOKA 3WTTC 1EH8A 3QJXA 4Q5SF 1QNTA 4Y15A 4OIQF 2FBIA 1SQMA 4KT5C 2RVCA 1T2KA 4UVCA 4Z2YA 3FH5A 2O8XA 3GLXA 5DD8A 3ZQ7A 3CHQA 2VOOA 3FUJA 2K02A 3F8CA 3R60A 4JNDA 2CYYA 2HWVA 2PMHA 2Z9OA 3FHZA 5K5OA 1UB9A 3G3ZA 1HKQA 4LMYA 5D4RA 3CUQA 3IIEA 3FTXA 5KVRA 1ZGJA 1J0RA 3C3WA 3F8NA 1R23A 3IKTA 2FBKA 1OKRA 3E97A 2XPZA 3TDUC 2ZKZA 3FULA 3ZMSA 1GVJA 4UHTA 3CZEA 3WTZA 1ZN2A 2DU9A 1LDDA 2MC3A 5D5XB 2DFIA 3K1PA 4L0ZB 1I6XA 3ZMTA 4DNCA