4NQWA

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
148
Chain Sequence
DLDALLRRVAHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/protein binding
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 57
structure length 148
sequence length 176
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4nqwA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4nqwA01
3BPVA 5HDKA 2HFHA 3N97A 1HW2A 4ENKA 1XMKA 2H6BA 1W4MA 3GXOA 1R58A 2VOPA 1LDDA 4OOFA 1HXDA 1KU7A 1R0KA 1TQPA 2FA5A 4QWQA 2QWWA 1ZRDA 1WSUA 1VTNC 2JD2A 3HHHA 3KP6A 5TRDA 1T2KA 3I5UA 1QGPA 2HKXA 4M9ZA 2XHKA 3REOA 1V3FA 2JT1A 4LFUA 4M74A 3E6DA 4EJTA 1HBXG 4UVAA 4ZYDA 2RN7A 1MJAA 4P9FA 4G7HF 2GA2A 2RKHA 4HDUA 1EH7A 1OPCA 1ZLJA 4EJUA 2GAUA 4CDGA 5ED4A 1YS6A 3PQKA 4PCQA 4CHUA 1H3LA 2RVCA 1O7FA 3QU3A 2HQRA 3QP5A 2FBKA 2XKPA 3COAC 1LB2A 4O3MA 2DQLA 2FE3A 4ENNA 4KUMA 1TQIA 2V79A 4U88A 4AIHA 2OAZA 4I0AA 1ONNA 2GXGA 2R7DA 1J59A 2VOOA 3K69A 2EFQA 2CFXA 1HKSA 2F5CA 5FLXK 1TTYA 1P92A 3M7GA 5D4SA 1KQ9A 3EYYA 4HYEA 1YW9A 1WWXA 4HQEA 2GQQA 1YW8A 3WU0A 2E7XA 2CYYA 2KRFA 2WV0A 4B8XA 1B59A 4D0PA 3M8EA 4P9UA 2VXZA 2D2WA 4KNYA 3MAJA 3WQSB 1B1BA 3K9TA 3RYPA 4KT5C 5DD8A 2PI0A 1CGPA 1TNSA 3AUAA 1LDJA 3C1DA 4G7ZF 3WTZA 1KQ0A 2W24A 1MW2A 5FO5A 2OZUA 1J75A 4BNCA 3P9KA 5CLSA 2DW4A 1G3SA 2O3FA 5HS8A 1RZ4A 5JMWA 1G6NA 2DPDA 5AIQA 1KYWA 4OMYA 1GHCA 3E5QA 2ZNYA 4BHCA 1O3QA 3I64A 3ULQB 2Q8KA 4IHTA 5J8FA 3QP6A 3C3WA 4WCGA 5JO0A 3GZ5A 2KIFA 3ANNA 1S7AA 2NNNA 4L5IA 4I0BA 1IAWA 1FBQA 2P4WA 1PP7U 2E1CA 1TW2A 1GVJA 3CO7C 2VBWA 5ICCA 3SXYA 2ELHA 3CZLA 3N4MA 3T0YA 1IN6A 3A06A 3KETA 3CUQC 3ECHA 4HF0A 3LFKA 5FD5A 2K27A 4P96A 3CZGA 1R0LA 4G7OF 4Z2YA 5LEKA 2VBYA 1YO5C 3L2CA 2BGCA 5BPDA 1J0RA 2P5LC 3FXRA 3HTSB 5LEJA 4KN4X 4M72A 3R0IA 1EH6A 4G8XA 1FT9A 2IP2A 4HV5A 3SZPA 1BI2A 1CF7B 1D8KA 1FLIA 1XSXA 1MW3A 2ZMEB 3QRFF 4ENMA 3JAMK 5DUKA 1ONVA 1ZARA 1O7LA 1SD7A 1F4KA 3WU1B 5CVRA 4RB1A 3O2PE 2XAFA 1O3TA 2JZYA 2E7WA 4IVNA 2VC1A 2A3SA 4KYWA 2FRHA 4FHTA 3F8CA 5DDGA 1C0WA 1KU3A 3J7AO 3LAPA 4XBFA 4YFXF 3BROA 3FWEA 4PGHA 4A5NA 5D6EA 1DP7P 4OMZA 1QZYA 3WTVC 1T1SA 3AU8A 4Y6RA 2P7CB 1W7PB 3Q9SA 4N9IA 3IC7A 4DQ2A 1OYIA 3U9GA 1BIAA 1L0OC 3MEXA 2XRNA 5IT9K 1HSTA 3D0SA 5EEHA 3V8KA 3T8RA 4EV0A 1JXSA 5EEGA 2IJLA 4ZH4F 3WGHA 1BI3A 2V1XA 4RGXA 2EA2A 1TW3A 1ZGAA 1WI9A 4S05A 4EM2A 2F2EA 5ICEA 5F6FA 2VN2A 1Q0HA 2EV5A 2K4JA 4BHBA 2QQ9A 2YR2A 1FP2A 4HX4A 1FSEA 1F5TA 2QENA 3UEQA 5DCFA 2VONA 4I2OA 1REPC 1JG9A 2EWNA 2VBXA 3KZYA 3WTUC 3H3UA 2E1NA 1OYWA 4IXAA 2P8TA 1J9IA 1F1ZA 5CJ9A 1P6RA 1STZA 4MHGA 4ZQGA 2M45A 2ESHA 2FEZA 3T5XA 1EV7A 4O6JA 3KP7A 2EFPA 3GLXA 1J5YA 3V8JA 3FMQA 1FP1D 3SZTA 4OU0A 1TQMA 4LLGF 1BJAA 1BIBA 5J8CA 4P5OA 2OA4A 2V1DA 1SD5A 4OIRF 1JHFA 5K1YA 4M6XA 1QZZA 4A0YA 2UWMA 1BOAA 2YPRA 4EMSA 3I59A 1KU9A 3B02A 1BI1A 1ONPA 3K1NA 4XSZF 2STTA 5DYMA 2RV8A 5JC1A 3H3ZA 2Y48A 5D5XB 2FNPA 1IN4A 1PP8F 2KIMA 3JSOA 3QAHA 2JD1A 1R1VA 5JHUA 5LHGA 5A2QZ 2CW0F 3R0AA 2GWRA 3MQ0A 1WRJA 1Q0QA 5BMZA 1SMYF 3DV8A 3ZMTA 4PGGA 1U3EM 3JTGA 1OMIA 4XLPF 2XKOA 3E97A 1HQCA 2WTEA 1S8NA 4ZQHA 5K5RA 3BY6A 3HRSA 3NEUA 4G6DA 2G9WA 1IRFA 1Q1HA 1S7OA 1AWCA 1IRGA 3ZMUA 3DFGA 4HX8A 2IA2A 1ZHFA 2PMUA 3R60A 1Z9CA 2X4HA 2FXAA 2RGVA 3EYIA 1SFXA 2BV6A 2HYGD 2IPQX 2ZO4A 3HSRA 2KKOA 3P9IA 5CVVA 2YU3A 1T1RA 1ZGJA 2EFWA 1YFHA 1HKQA 2PFBA 3JW4A 1FC3A 4EGYA 1SD4A 5DULA 2EA4A 5ERIA 2DBBA 3DKWA 1EH8A 5KVRA 3WE2A 3RPUA 3CLOA 4A6DA 3ABUA 5L3CA 2PEXA 4ESJA 4RAYA 4U0YA 3LQRA 4RAZA 4OINF 3ZMVA 2BYVE 2LDUA 2OQGA 3RIRA 3IIEA 3EETA 2A6EF 5JNLA 1MD0A 2CG4A 1D5VA 2ZNZA 4U7DA 3L00A 2PN6A 4EM0B 4CICA 1ZYRF 2K02A 5F64A 1R00A 4YIIA 3VFZA 2A07F 3UCQA 1XCVA 1K5HA 4ZQFA 5JVTA 3EUHA 4OIQF 2DK5A 5K5QA 5FGMA 2MLGA 2LSOA 4FLQA 3HYIA 1BM9A 3ZHZA 5DEQA 3LQQA 5ICGA 3B73A 4YFKF 5K5OA 2EK5A 1UHWA 1KA8A 1O3SA 4RGRA 2HEOA 4L5JA 2M8EA 4FLSA 2QZ8A 2K4BA 3MWMA 4A6EA 5FFXA 3U1DA 3ZQ7A 3CDHA 1LEBA 1P4XA 4Q47A 1IN8A 1JGIA 2W25A 3GX4X 3V4GA 4M71A 4L9NA 4AIJA 4GYGA 3Q9VA 4OOIA 3E6MA 3GEZA 1U2WA 3HSEA 1KGSA 3BPXA 1DUXC 5LRRA 2H6CA 5H20A 3JSPA 2RDPA 3DQVC 1UCRA 1YG2A 2A68F 1Z7UA 1LNWA 5IT3A 3F8BA 1R1TA 4I01A 3I54A 1Y0UA 5DD4A 2LF8A 1ZG1A 2L01A 3ABTA 1OR7A 3TOAA 4FT8A 1ZRFA 1HW1A 4O5VA 4IJAA 2MA3A 1X3UA 4ETSA 1I5ZA 2OZ6A 2M87A 4HLYA 1P4AA 2D1VA 4XLNF 2R3SA 4LD5A 5AONA 3DXJF 1Q0LA 4M9SA 3HSFA 4HQMA 1YTYA 3V7RA 3LWFA 1BN5A 2HQNA 2D1HA 3ZHXA 4HW0A 2LF7A 2NNYA 1Z6RA 1MKMA 4R1HA 3RTRA 5L3DA 5LHIA 2MAPA 1XGOA 4LMYA 1QBJA 4B09A 3WQQA 2CQKA 2HTJA 1O57A 3BJAA 4BH9A 3RPQA 4GGGA 4CZZA 4A12A 1LDKB 4A03A 4EM1A 3HRUA 3IHUA 1DDNA 2F5EA 2IA1A 2IA0A 1MZBA 2UXNA 3F8NA 1H0MA 4YFNF 1FYKA 4LG0A 2L3DA 5ILSA 2FBIA 5HS7A 2VC0A 3QU6A 2GXBA 2ZXJA 2MBFA 5JR3A 4KICA 2QVOA 4HF2A 2A5YB 3ZI0A 3RKWA 1Z05A 2MC3A 1K79A 2FMYA 1J7KA 4S04A 2XIGA 1FBUA 2JPCA 4R8HA 3I58A 4TV7A 2EV6A 4LGWA 3CTAA 1I6XA 2A61A 5FLXZ 3RASA 3GFLA 4IRIA 3WODF 1MDMA 3TQNA 3DPTA 2Y1FA 2BBYA 2MD5A 4F7ZA 5L3GA 1YS7A 3A14A 3S2WA 4PZJA 2Y1DA 3HRTA 1TNTA 1U78A 1RIOH 2ISZA 4AICA 2NAZA 4OIPF 1JE8A 2CWEA 1R5GA 3HRMA 3E3VA 4WF2A 5DV5A 1K7AA 4MTEA 4NB5A 3LA2A 2EB7A 4R79A 3C7JA 4IPAA 4L9VA 4FLRA 1QNTA 3KP4A 1A04A 3ZN1A 2O03A 5JI6A 2EV0A 1R1UA 4WX9A 2XVCA 2DQRA 3IL2A 3W6JB 4ZN6A 5JFRA 4Q4ZF 4UXNA 2OQRA 4LJZF 2FBHA 4M6YA 5HLGA 1E2XA 1T38A 3LAJA 1FPQA 3FM5A 2RC4A 1PDNC 4WXHA 2OD5A 1IXCA 2JRTA 2BE5F 2PBIA 3MZHA 2ETHA 1D8JA 5E8GA 5A2QK 1ODDA 2DU9A 1KYZA 1LVAA 2UXXA 3I59B 1E17A 4Y13A 1IN5A 2V1UA 3DF8A 1H9TA 1UFMA 4EGZA 2V9VA 3R4KA 2EFOA 3F6OA 4HBLA 3GW2A 4ZZLA 4HLXA 3DPLC 3NRVA 2O6GE 4ZYEA 1ZH5A 1H9GA 5DUIA 3RKYA 2V6CA 4L9TA 3CZEA 3K1MA 1OKRA 3QOPA 2Z9OA 5DCMA 1YQAA 1J2XA 3L09A 2HR3A 3LA7A 1R23A 2EGHA 2P6TA 3DP7A 4HF1A 2M1BA 5BQTA 2G7UA 1USTA 3E6CC 1ONOA 2WWYA 1W5TA 3WTTC 1XDUA 4A0XA 4L9JA 3AAFA 5CVJA 1B9MA 2MH9A 1ZLKA 1XDSA 3F23A 4BQAA 4EJVA 3EQLF 3ZHYA 3GF2A 4OOEA 2HZTA 3J80Z 3MCZA 1HW5A 1XMAA 4CYDA 1QPMA 3BDDA 5JMPA 2DK8A 1RUNA 4MTDA 5LGTA 1T6SA 3WTSC 3P7NA 5HDNA 4RB0A 3CUOA 3R61A 2W57A 5D8LB 4KIFA 4RS8A 3RJPA 3IKTA 1K78A 2HYFA 5IT9Z 3KZZA 4KN7X 4LLNA 4A5MA 1T0FA 1LEAA 2Y0MA 1ZG5A 1D3YA 3QPTA 1FYLA 1FSHA 2DAOA 2CGPA 4KP7A 1IXRC 4G9YA 3TO7A 1ZG3A 4I98B 3F8FA 3ZMSA 2VT2A 4WK8F 4IRHA 2O7GA 3TOBA 3K2ZA 5H6QA 3R6SA 3FXQA 1XB4A 3FMRA 3SHFA 3BP8A 2L02A 1Z91A 1U5TA 3VEPA 2HGCA 2HS5A 3P9CA 2HDCA 3F6VA 1SD6A 2COMA 4KA4A 3IWZA 3M1EA 1BC8C 4GYIA 2QYOA 4HA8A 1R36A 4MEXF 1DPUA 1GXQA 3I4PA 2PJPA 4IF4A 4KMUX 4I02A 4LB6B 4Q5SF 2O0YA 1R22A 1ULYA 5LRSA 2CSOA 3UERA 2ESNA 4GCVA 3F21A 1P2FA 4RCVA 2ZFWA 3VB2A 3TO9A 1IZ1A 2IW5A 5JAZA 2XAQA 3KP2A 3U2RA 2RNJA 1S6LA 3HIFA 2YSRA 2DT5A 3FX3A 4UVBA 5BS6A 2Q0OA 3NQOA 3M8FA 1SFEA 2FU4A 3AU9A 2PLYA 1B6AA 1ZAOA 3KCCA 4EJOA 1WKMA 4UHTA 4KFCA 2JSCA 1V4RA 1Z1DA 2R7FA 4OIOF 4FLOA 3GVAA 1MW0A 4M73A 3L9FA 2B0LA 2QBYA 2KJBA 1XGNA 2GIVA 4UUVA 1FBSA 1XCBA 4JBAA 5HS9A 3T8TA 2DO7A 5HOOA 2JCYA 1G3TA 4FX0A 1KQ8A 4ZQEA 5KK1A 5LHHA 2MH2A 2P5KA 4Y6PA 3KE2A 3GO5A 1G5AA 5LLQA 2ZJ2A 2HOEA 4IRGA 4Y6SA 1FX7A 3SFZA 3GYHX 2JPBA 1AOYA 2FOKA 4ESBA 4Y17A 2MAOA 2W85A 2P7VB 1UHMA 1TBXA 5ILVA 3CUQB 1SMTA 4YIFA 4P55A 3J81Z 4ZYHA 3RDIA 4L18B 1XGMA 3L7WA 5LGUA 2L4AA 4KDPA 2F5FA 4ZZDA 2NS0A 2W84A 3HOTA 1SFUA 5F1RA 1IUYA 4LG0B 1MJBA 1RNLA 1GXPA 1W5SA 5E1WA 3WTXC 1I1SA 4UNOA 2PQ8A 1U6GA 3I71A 2Z3YA 2XROA 2KJCA 4XSXF 3K1PA 5HLHA 3KEOA 3HTUA 2QUFA 3VOEA 4L0YB 2CO5A 1FWZA 1OYYA 3G73A 5ICFA 1YYVA 2H09A 4HDVA 1S29A 1YW7A 3F22A 4A0ZA 3OOPA 3TGNA 4DNCA 4ASNA 1G4DA 3I0TA 5E8IA 4I7HA 3ECOA 4M9XA 1MDMB 3E6BA 3M9AA 2AS5F 2Y1EA 2F5DA 2STWA 3FM3A 4ON0A 5FFZA 4I09A 1F9NA 3TO6A 5ILUA 1I1GA 3G3ZA 4ZYGA 3HOSA 5FD6A 2ZKZA 2K86A 3O3KA 1MVYA 3CUQA 3GFJA 4HX7A 1RUOA 3ZN0A 1UB9A 1G3WA 3ERED 3FMSA 4EVIA 2FNAA 5FB2A 4G6QA 4GAEA 3KP3A 1O3RA 3GUDA 5J6XA 2ZBKA 2P6SA 4U7BA 2JD0A 4Y67A 4U0VA 1L3LA 1IN7A 4MQ9F 4A2UA 2QQBA 3T1BA 3E5XA 1ZRCA 2FF4A 3LA3A 1BI0A 5E1XA 4H0EA 1G3YA 3TKYA 4N0BA 5HDGA 3ANMA 2XGXA 2XAHA 5BOXA 5E18F 2C82A 1LQ1A 5TJJA 1FYMA 2VODA 1YIOA 1ZN2A 1JGSA 2OU2A 3CJNA 4MGRA 3IRRA 1IF1A 4LUPA 3GFIA 3E5UA 2G7HA 1FZPB 2KIUA 2DLLA 4HV6A 4NHJA 4MQVA 4WWCA 2J5PA 4L0ZB 2DPUA 3RI4A 2VBZA 3O6BB 4Y15A 1IW7F 3FZVA 3FF5A 2M30A 3K0LA 4Q48A 3CO6C 3ANLA 3F8MA 5H6RA 3SQNA 2UZKA 1FOKA 2VE8A 4G94A 4KIGA 5DCMB 4AWXB 1T39A 2Y1CA 3TDUC 3WGGA 4U0WA 5E1ZB 4KMFA 3J80K 2EFNA 4ESFA 3F72A 1XD7A 3ELKA 4HOBA 2J5OA 3KLNA 2X0LA 3FHZA 1ZS2A 3IRQA 4LK1F 2HTSA 2EJRA 2C6YA 3JTHA 1XGSA 3WG9A 5E17F 1XSVA 2JCVA 3ML6A 3HUGA 4BAYA 4JK1X 1JHHA 4BXUA 4CXFA 4AYSA 1HKTA 1FNNA 3FXUA 2OBPA 4LB5A 1SAXA 3BJOA 3ZP5A 3C18A 5LBQA 5CVUA 3EDPA 4FX4A 3ZMDA 2DTRA 2XASA 2ISYA 3QPHA 2Y75A 4UV8A 5BPIA 4UVCA 2WPGA 5D5UB 1JVSA 1CF7A 3WTYC 5D5VB 4RB2C 2L54A 2QLZA 2ZMEA 2RQPA 5AIPA 2ZCWA 2QQAA 3TDZC 4HAMA 2Z99A 1K78B 2LKPA 2VT3A 4LLLA 4N9HA 1ON2A 2Q2EA 3BWGA 3VODA 1B4AA 4UV9A 4K2EA 4BYYA 3H92A 4IHSA 1ON1A 1I27A 5L3EA 4RB3C 4LK0F 2YX7A 5D4RA 1P4WA 3JAMZ 3KFWX 2M5WA 2HKOA 2XAJA 4AIKA 3ZMZA 3BOQA 2FSWA 2XUBA 3PFIA 2FMLA 2ACJA 3WGIA 1YLFA 1W7PA 3ISPA 1SC5A 2A6HF 1U5TB 2IT0A 1IXSB 1S3JA 3IWFA 2WC2A 1MJ9A 1MGTA 4MNUA 3I53A 3GWZA 2ADUA 3D5LA 3IKVA 5CVIA 5HVQC 4NQWA 3GZ6A 2O61A 3LSTA 2O8XA 2AXLA 2XV4S 2VE9A 4CGZA 1FY7A 5JBIA 2QM3A 3GFMA 1Z6TA 4MEYF 4KIBA 1S46A 1XSDA 3CZKA 2PMHA 5D6FA 5D8KB 2D45A 4WXCA 1KU2A 1USSA 1ZREA 4XRFA 3KEQA 4RGSA 4CO8A 3HHGA 1R7JA 1XN7A 3MZYA 1BBYA 3RYRA 1NHAA 3RKXA 5D5WB 2PG4A 5L3BA 2Y1GA 1K6OA 2BEOA 3KLOA 2FQ3A 3WTWC 3F3XA 2GA1A 4EQQA 2A69F 1PUEE 4AD9A 1TLHB 2P5VA 2H27A 2Z33A 4WXDA 3BJ6A 3V8LA 2K7LA 4GO1A 4YG2F 1DPRA 3WQRA 2MLKA 2H94A 1RP3A 2QBYB 1U8RA 2HWVA 1HSJA 4E70A 5LGNA 3BZ6A 5HLIA 4EJWA 5CYVA 4BHPA 4JQFA 2TDXA 3R0JA 1T98A 4GXOA 2L4MA 3WE3A 4AVPA 6PAXA 1W7PD 4RGUA 1WQ2A 1MW1A 2Z5UA 2GZWA 3ROUA 3J81K 3V7CA 3OV8A 4HZFA 2DFIA 2LNBA 4PDKA 3Q5FA 1LJ9A 2IVMA 1BC7C 1RI7A 2YX4A 3MFKA 5L3FA 2XAGA 1R5HA 3W6KB 2NRAC 1U5TC 2JTVA 3V7SA 2NYXA 3ZPLA 3PQJA 4ENJA 3KP5A 5E20A 1QQIA 4QLCU 2IRFG 1B9NA 3DEUA 2DI3A 2JCXA 1QO0D
chains in the Genus database with same CATH superfamily
2DA3A 3BPVA 3L2RA 3HOUJ 5HDKA 2HFHA 2LYCA 3N97A 1HW2A 4ENKA 4R5XA 1XMKA 4PJMA 2H6BA 1W4MA 3GXOA 3H5AA 1R58A 4QIWN 2VOPA 1LDDA 1ZQ3P 4OOFA 1ZR4A 1HXDA 1KU7A 1R0KA 4IHYA 1TQPA 3CDIA 2FA5A 4QWQA 2QWWA 1ZRDA 3PL8A 3SDBA 1WSUA 1VTNC 5GTIC 3HHHA 4BY7J 2JD2A 2QSHX 1FIAA 3KP6A 5TRDA 1T2KA 2VJIA 3I5UA 2HOTA 3TEDA 1EKEA 4DYCA 3HGGA 1QGPA 2HVSA 3WHBA 4J00A 3FUEA 2HKXA 3MZ8A 4M9ZA 2XHKA 3K4JA 3REOA 1R5ID 1V3FA 2JT1A 2OUMA 4LFUA 4M74A 3E6DA 3KEDA 4EJTA 1HBXG 3G4SI 2DJNA 3C2GA 1W0TA 1MBFA 4UVAA 4ZYDA 1ZTRA 1NH3A 2Y0SA 3BQYA 2RN7A 1MJAA 4BS9A 4P9FA 4G7HF 3AG1H 2GA2A 2HPIA 2RKHA 4HDUA 1EH7A 4RBOA 2OV7A 1OPCA 1ZLJA 3BTCA 2WBMA 1OCTC 4EJUA 2GAUA 4CDGA 5ED4A 1ETXA 4E7JA 1V54H 1YS6A 2DMPA 2WA0A 3PQKA 1UJ8A 3M4OJ 4PCQA 4CHUA 4DZJA 1H3LA 2RVCA 3PUFA 1XS9A 1O7FA 4E7KA 3QU3A 4ZW3A 2HQRA 1VQNI 3QP5A 1AA7A 2FBKA 2XKPA 4XO4A 2ELJA 2DOFA 1VQ7I 3COAC 2A5WA 2M3AA 1LB2A 1X3ZB 3LL7A 4O3MA 1QVTA 2DQLA 2QKMB 2FE3A 1TWHJ 4IQ4A 4NBQA 3HOWJ 5C44J 4ENNA 4KUMA 1TQIA 2V79A 4U88A 4AIHA 2KZVA 3TP3A 1ACIA 2OAZA 4I0AA 1ONNA 2GXGA 1I50J 1MNEA 3U9WA 2R7DA 3S1RJ 2CUFA 4BDZA 2NVUB 4CCNA 1VFCA 5FRMA 1MMNA 1J59A 2JA6J 2VOOA 4FASD 1YJ9I 3K69A 2EFQA 2CFXA 3E7LA 4FE4A 1HKSA 2F5CA 2MSYA 5FLXK 1TTYA 2KISA 4HEA2 1J09A 1P92A 4HSRA 4QSHA 2E36A 5IP6A 2W82A 3M7GA 2Y2ZA 3RKQA 5D4SA 3OYEA 1KQ9A 4C2MJ 1OQYA 3EYYA 2IGNA 2F48A 4HYEA 3FKIJ 2V26A 3HOVJ 4XMZA 1YW9A 1WWXA 4HQEA 3NAUA 2GQQA 1YW8A 2VI6A 3WU0A 1HF0A 4KITB 1K4SA 2E7XA 2CYYA 2KRFA 2WV0A 4B8XA 1B59A 1IO2A 4D1QA 1P9QC 4BEHA 5E3NA 4D0PA 3D5RC 3M8EA 1JUMA 4P9UA 2VXZA 3EBHA 2D2WA 2WAQA 4KNYA 3MAJA 3EPZA 1IV6A 1E0EA 3WQSB 1OR7C 3S3OA 1B1BA 3K9TA 3RYPA 3SEZA 1W36C 2WV1A 4KT5C 5DD8A 2PI0A 1CGPA 1TNSA 3AUAA 1LDJA 2BW3A 3S15J 2DOEA 1XG1A 4H4KC 3S14J 1SFKA 4XM3A 5B1AH 2Z2SB 3C1DA 4G7ZF 3WTZA 1KQ0A 1X1BA 1IV8A 1YX5A 2W24A 3CLQA 4IX7A 3RC8A 1MW2A 2Y0SN 5FO5A 1GV5A 3E1SA 2OZUA 4BQQA 1J75A 3D5SC 3P9KA 2LBFB 5CLSA 2DW4A 4A3KJ 4BNCA 1G3SA 3FUNA 1G8XA 2O3FA 1OCRH 3HOXJ 5HS8A 1RZ4A 5JMWA 1AHDP 1G6NA 2DPDA 2R5YA 4C2UA 2R70A 4A3GJ 1K83J 3K7AJ 4IEJA 5AIQA 1KYWA 4OMYA 1GHCA 3E5QA 2ZNYA 4BHCA 1O3QA 2L5QA 3I64A 3ULQB 2E5ZA 2Q8KA 3LFUA 3OIOA 1VQPI 2FQ4A 2K5CA 5J8FA 3QP6A 4IHTA 1G2HA 2FOWA 1OLTA 3C3WA 4WCGA 1MH3A 5JO0A 3GZ5A 2KIFA 4XN2A 3ANNA 3H9QA 4XNBA 4CA0A 3Q0UA 1S7AA 2NNNA 4D5CA 2R7XA 4L5IA 4I0BA 1IAWA 1FBQA 9ANTA 2P4WA 1PP7U 4AYBA 2E1CA 2GOMA 3J7ZI 4UUSA 1TW2A 4LIVA 2CV0A 1GVJA 3DBLB 3CCYA 5IP9J 3NARA 3CO7C 1FOXA 2HU9A 3CF5F 2VBWA 1Y8RB 3G1MA 4J01A 5CKTA 5ICCA 3SXYA 2ELHA 2PJRB 3CZLA 4RSYA 1YJNI 3N4MA 3T0YA 1IN6A 3A06A 3KETA 3VSLA 3CUQC 3ECHA 4HF0A 5GAHJ 2WB1A 5J1UA 3CIAA 3HUGB 3LFKA 5FD5A 4A3CJ 2K27A 3OYKA 3FXLA 2VUMJ 3DCFA 4P96A 3CZGA 4A3MJ 3GTPJ 4F52A 4QTRA 4G7OF 1R0LA 4ARFA 4XMWA 4Z2YA 5LEKA 4ZX5A 2VBYA 4XKCA 1YO5C 2KLOA 1VQLI 3L2CA 2BGCA 5BPDA 1J0RA 2L9SA 2DCEA 2P5LC 1TWAJ 3FXRA 1MNMC 4ZJZA 4XLAA 2WAQN 3HTSB 2OJED 5LEJA 1MMSA 4KN4X 4M72A 3R0IA 1EH6A 4G8XA 1QHGA 1FT9A 4BL0B 2LY9A 2IP2A 4HV5A 3SZPA 4E7ZA 3LOCA 1BI2A 1IDYA 2VXDA 1CF7B 5M5WJ 1D8KA 3FXMA 1FLIA 2CQ7A 1UG2A 1FJLA 1XSXA 1MW3A 5FRNA 2ZMEB 1JTXA 4A3JJ 4ENMA 3QRFF 4B44A 3JAMK 5TISC 3H35A 5DUKA 4GRIA 4E7SA 3ABLH 1ONVA 1Z0XA 2L9NA 1ZARA 5J47A 1O7LA 1SD7A 2O5RA 4NC8A 1F4KA 3PO3J 4QHPA 3WU1B 5CVRA 4RB1A 2RJIA 3K4KA 2IEKA 2XAFA 3O2PE 2Q2EB 4D7NA 4XNDA 1O3TA 2JZYA 4B47A 4CUGA 1A6IA 3QQAA 3GTKJ 2E7WA 4IVNA 3VYRB 2VC1A 2A3SA 1GUUA 4KYWA 2FRHA 4UB6C 2DXIA 2DTZA 1BW5A 2K85A 4FHTA 5DLLA 3F8CA 5DDGA 1C0WA 1KU3A 3J7AO 3LAPA 4XBFA 1WFXA 2BHYA 2NOJB 3BROA 4YFXF 1SC7A 1P7JA 4AU7A 3FWEA 4PGHA 4A5NA 5D6EA 1DP7P 4OMZA 4DBRA 4DZPA 1PJRA 1QZYA 2CS3A 3WTVC 4C3JJ 4ZX3A 3TW6A 1T1SA 3AU8A 2VL8A 2R7OA 3CMMA 3CCRI 4Y6RA 2P7CB 2E60A 1W7PB 3Q9SA 4N9IA 3IC7A 5FJ8J 3GCMA 1H19A 2R5ZA 2QQ8A 2F4MB 3BZKA 2KPMA 3I4NJ 4PW4A 3OS0A 4DQ2A 3ABMH 1OYIA 1VQ4I 3U9GA 3AL0C 3K70C 3FTYA 1BIAA 3GLLA 1QA6A 1L0OC 3MEXA 4M3GA 2XRNA 5EZHA 3SZGA 5FKNA 5IT9K 1HSTA 1ETWA 1GVDA 3D0SA 5EEHA 2DYRH 3V8KA 2WB1N 2EH3A 3T8RA 3JT1A 3BG9A 1UMQA 4EV0A 1S9HA 1JXSA 5EEGA 1NTCA 4NQWB 3JRIA 3Q44A 4Y4RA 4IKFA 3RQIA 2R92J 2K3FA 3OYFA 2IJLA 3H0DA 4ZH4F 3J7AY 4FCAA 2ZJPF 3WGHA 1A31A 1BI3A 2V1XA 5FROA 3ZQIA 4RGXA 2EA2A 2OC6A 1TW3A 1ZGAA 1WI9A 3SJMA 3BR5A 4S05A 3B2PA 3GMEA 3FBIB 4EM2A 2F2EA 5ICEA 5F6FA 3PJRA 2VN2A 3W2VA 3WHCA 1Q0HA 3LSPA 2EV5A 2K4JA 4BHBA 5EG0A 2QQ9A 2YR2A 1U8BA 1UAAA 1FP2A 1JTYA 1FSEA 4HX4A 1F5TA 2QENA 1T8IA 2EZLA 3UEQA 5DCFA 2VONA 4I2OA 1REPC 1XPXA 2BY1A 1JG9A 2EWNA 2VBXA 3KZYA 3BG6A 3WTUC 4PFPA 5EGOB 3H3UA 3VSKA 1FOWA 1EA3A 2E1NA 1OYWA 2VKVA 4IXAA 2P8TA 2M8GX 1J9IA 1LE8A 1F1ZA 5CJ9A 1P6RA 2VJJA 1STZA 2MW8A 3DBHB 3ZQCA 4MHGA 4ZQGA 2M45A 2ESHA 2FEZA 3T5XA 2HXOA 4IOCF 1EV7A 4XICA 3S32A 2DN0A 4A3EJ 2V6EA 2UV1A 3ZQLA 2IGKA 4O6JA 3WG7H 3CCUI 2LY2A 3KP7A 1MMGA 2ZMEC 2EFPA 4DGWB 3JR9A 3GLXA 2K9LA 1J5YA 3V8JA 3FMQA 1ZKGA 3FTWA 4W97A 5EZGA 2X9DA 2L7ZA 2VQGA 4PJLA 5K7ZA 1FP1D 3FTUA 3SZTA 1S7EA 1WGXA 2ECBA 4OU0A 2JRMA 2XF5A 1TQMA 2YU9J 1X3WA 4LLGF 1BJAA 3OOUA 1BIBA 4A3DJ 5J8CA 5IP7J 4P5OA 2OA4A 2V1DA 4XRSG 4QPQA 1SD5A 3I56I 4OIRF 1JHFA 3WU2C 1PYVA 4LIUA 4EEFG 1H89C 3S3NA 1BA5A 3CF2A 4HG2A 2JQ7A 2KRHA 5K1YA 4M6XA 1BW6A 4NUBA 5JLWA 1I39A 2R7ZJ 5M3MJ 2IXSA 1QZZA 4A0YA 2JA2A 1DU0A 4B3XA 4II3A 3RZOJ 2UWMA 1FTZA 1UG0A 5J1RA 1VQ8I 1BOAA 4F93B 3HL2A 2V9PA 2YPRA 4EMSA 1VQOI 3I59A 1KU9A 1S5LC 3B02A 4F55A 1BI1A 1ONPA 2GXAA 3K1NA 1ENHA 4XSZF 1XX5A 2STTA 4NDLA 5DYMA 2E2IJ 4XN1A 4ZX6A 3FTVA 2RV8A 3VDXA 5JC1A 2JA7J 3H3ZA 4BUPA 2C5ZA 2Y48A 3PNTA 2FNPA 4JOMA 5D5XB 1FMWA 5B1BH 1IN4A 4XN4A 2FX0A 2GM4A 1PP8F 1R9TJ 2KIMA 3JSOA 2BZTA 2EINH 5C4JJ 3QAHA 4XMYA 2JD1A 1R1VA 5JHUA 5LHGA 3E0JB 3BLYA 5A2QZ 2QJ1A 3TP0A 2NVQJ 1ORKA 2CW0F 1BR1A 3R0AA 3GTMJ 2GWRA 3HJEA 3MQ0A 2CQQA 2KZGA 1RKTA 3S8PA 5JLXA 1HCRA 3FTSA 1WRJA 1Q0QA 3PUBA 5BMZA 3ERMA 1SMYF 1GV2A 3QYBA 3DV8A 3LSHA 3ZMTA 4PGGA 2CUEA 4BJTA 3ZQFA 1U3EM 2HDWA 1SQMA 3FU0A 3JTGA 1OMIA 4XLPF 1ZR2A 2XKOA 4G6TB 3ZQGA 3E97A 1B72B 3S93A 1HQCA 2WTEA 1S8NA 2DFHA 4ZQHA 2ID6A 1YX3A 4FE7A 1QPIA 5K5RA 1EF4A 3BY6A 4XL9A 3ZCOA 2Y9ZA 4C30A 3HRSA 2L2OA 2NS8A 1F36A 3NEUA 4G6DA 1WPKA 2G9WA 1IRFA 1Q1HA 1S7OA 3A02A 4XKBA 4X1EA 2CQNA 2QKLB 1AWCA 2KDOA 3LSGA 1IRGA 3ZMUA 2RAEA 2NOGA 3DFGA 4HX8A 2IA2A 1ZHFA 3M8JA 3MVPA 2PMUA 4XOPA 3R60A 1Z9CA 3H9GA 2RREA 2FXAA 2RGVA 2X4HA 3EYIA 1SFXA 5KCMA 2BV6A 4UY8I 2HYGD 2IPQX 2ZO4A 2CUZA 2E71A 3HSRA 4V2FA 2KKOA 3JCUC 3P9IA 4RAFA 2YU3A 5CVVA 4AVZA 1T1RA 4YIRX 4NC7A 1MBKA 1ZGJA 2BY2A 2COBA 3ZGKA 2EQRA 2XB5A 1OCZH 2HYJA 2VQHA 2EFWA 1YFHA 3DEEA 4BE1A 1YOVB 1HKQA 2PFBA 4XK4A 3JW4A 1FC3A 1U9OA 2E19A 3FUIA 2K9SA 4EGYA 4MS6A 1SD4A 2KMUA 5DULA 2LMDA 2EA4A 5ERIA 2DBBA 3DKWA 1EH8A 5KVRA 3WE2A 4E7LA 4XNFA 5H2FC 1MBEA 3RPUA 4DPRA 2GOXB 3CLOA 4A6DA 2I10A 2L0KA 3ABUA 5L3CA 1H88C 2EZHA 4AIDA 2NXNB 4J19A 2PEXA 4ESJA 4DW6A 1JKPC 4RAYA 1Y0NA 1D0ZA 4U0YA 3LQRA 4RAZA 4OINF 2XSDC 3ZMVA 3BTLA 2E2JJ 2BYVE 2LDUA 3ABKH 2OQGA 3FK7A 3RIRA 3H0GJ 3IIEA 2WZFA 2XSJC 3EETA 1QVUA 4AR8A 2A6EF 2B63J 5JNLA 1MD0A 1K6YA 2CG4A 1A5JA 1D5VA 2ZNZA 4M3DA 3L00A 4U7DA 3NWSA 3SFIA 2PN6A 4EM0B 2LR8A 2VQLA 1VZ0A 3FH7A 4CICA 1ZYRF 1RKWA 2K02A 1R00A 4RM3A 4YIIA 5F64A 3VFZA 1B72A 1XCVA 2A07F 1FTTA 3TMOA 2CW7A 2DT6A 2HI3A 1K5HA 3CP8A 2LC2A 3B6CA 3N05A 4ZQFA 5JVTA 3VYSB 3EUHA 4HNVA 4OIQF 2DK5A 3B6AA 5FGMA 5K5QA 1ETYA 2MLGA 4BEHB 2LSOA 5EEAA 4FLQA 3VWBA 3HYIA 1BM9A 3ZHZA 1MBJA 5DEQA 1X1AA 5F08A 3LQQA 1Z77A 3BC8A 4XOTA 5ICGA 2EIKH 3B73A 2V4JC 3TBIA 4YFKF 2XQ0A 4DYRA 5K5OA 2EK5A 1G59A 1UHWA 1KA8A 1O3SA 1T95A 4RGRA 3HPGA 2HEOA 4L5JA 2M8EA 2BW3B 4FLSA 2AXTC 2QZ8A 2K4BA 3MWMA 4A6EA 3JRFA 4RLQA 3OSGA 5FFXA 3U1DA 3ZQ7A 2E5NA 2E1MB 2M2EA 1K7AA 2H8RA 1DP3A 3CDHA 1LEBA 1BJZA 3HBLA 1P4XA 4Q47A 1I6HJ 3FUJA 3QPSA 5BNGA 1IN8A 2ME6A 3S17J 1JGIA 2W25A 2IS2A 3GX4X 2XPWA 3OIPA 4K5PA 2R5YB 3V4GA 4M71A 3S3MA 4Y52J 4L9NA 2MC4A 2K9MA 2K3PA 3TW7A 2LP0A 4AIJA 4GYGA 3Q9VA 4OOIA 3B34A 3E6MA 3H5NA 1TWGJ 3CMAI 3GEZA 2LD5A 3DTEA 1U2WA 1X4OA 1KGSA 3BPXA 3FDYA 2N8GA 3HSEA 3CCEI 1DUXC 1VQMI 5DM6F 3HDDA 3G71I 1IRZA 4MKTA 2CMPA 2CJJA 5LRRA 4R5TA 1P7IA 2FD5A 2H6CA 5H20A 4BJ6C 3JSPA 2RDPA 1IJWC 2WZGA 2ME0A 3DQVC 1UCRA 1YG2A 4DOZA 2A68F 1Z7UA 4L2LA 5DM7F 1MSEC 1LNWA 3K4BA 2XAUA 4UUSB 3S1QJ 3KIOA 5IT3A 5GP9A 3CHSA 3F8BA 1R1TA 4I01A 3AKZA 1ERDA 3I54A 1Y0UA 5DD4A 2LF8A 3JRDA 1ZG1A 2L01A 3ABTA 1OR7A 1Y1VJ 5GAGJ 1XTAA 3TOAA 4FT8A 5GADJ 3QJXA 3L2QA 1ZRFA 1HW1A 4O5VA 2KFDA 2RQQA 5F0FA 4IJAA 5CQGA 2MA3A 1X3UA 4ETSA 3OWTA 1S72I 1I5ZA 2NVTJ 2OZ6A 2M0MA 2M87A 1ZELA 4HLYA 2DQMA 1P4AA 2ECCA 2D1VA 2L7FP 4XLNF 2TCTA 3HEFA 3CHPA 3CXBA 2R3SA 4LD5A 4XN0A 4UUTA 5AONA 1POGA 3DXJF 1Q0LA 4M9SA 3HSFA 4HQMA 5EJCA 2R7QA 4CCOA 1YTYA 3HW2A 3V7RA 3OY9A 3LWFA 4K5OA 3S16J 3B7SA 1BN5A 1UZCA 2HQNA 2Z1DA 3OYMA 3VVLA 4C3IJ 2D1HA 3OS2A 2I5UA 3KPHA 2EIMH 3ZHXA 3ZQHA 4BE2A 4HW0A 4R5VA 2PMZA 2LF7A 2NNYA 1Z6RA 2O7OA 3OIQA 1MKMA 2DDBA 4R1HA 3RTRA 5L3DA 2LREA 4F92B 5LHIA 3RC3A 3JREA 1YRNA 4XORA 1R71A 4V19K 2MAPA 1XGOA 4LMYA 2G0EA 1QBJA 4B09A 3DKXA 4XN9A 3UCQA 2V7FA 1YJWI 2QSGX 2YUSA 1WH7A 4OAYA 4NNJA 3WQQA 4C2TA 2DMUA 2CQKA 2HTJA 1O57A 3BJAA 4BH9A 2LKSA 3RPQA 4C9YA 3CP2A 4GGGA 4CZZA 4A12A 2E1MC 1LDKB 4A03A 3SYTA 4EM1A 3DU5A 4BY1J 1YE9A 3HRUA 4B4CA 2HPTA 3IHUA 1DDNA 3EBGA 2CH0A 2F5EA 2IA1A 2IA0A 1MZBA 2UXNA 2DA2A 3F8NA 3CCMI 1H0MA 3OL4A 2Y9YA 2LH9A 1ETOA 2M7BA 4YFNF 1FYKA 4U87A 3IAM2 2E1OA 3VYUB 4LG0A 2L3DA 5ILSA 2D5VA 2FBIA 5HS7A 4X2UA 2VC0A 3QU6A 3HKZA 2WAFA 1ITYA 2GXBA 2ZXJA 2MBFA 3KEYA 5JR3A 2R5ZB 1ETQA 4KICA 3GZNB 3LMMA 2A7OA 5F1JA 2ICWG 3KX2A 4ZYAA 2B7EA 2QVOA 4HF2A 2NS7A 2A5YB 4JX6A 3RKWA 1Z05A 2F4OB 2MC3A 3ZI0A 2VKDA 2OF7A 1Z3YA 1K79A 2FMYA 1J7KA 4B48A 1Y8QB 4S04A 1JKOC 1QU3A 4XN3A 2XIGA 2VPLA 1IUFA 1PUFB 2BXZA 3H3VK 2PL5A 1FBUA 3BZCA 1Q1VA 2QVWA 2JPCA 5IYDJ 5FWQA 4R8HA 3I55I 3I58A 5B5EC 3CD6I 4TV7A 1VQ6I 4BU2A 2EV6A 2F4IA 3LSRA 4LGWA 3CTAA 2GBYA 3QOEA 3W2WA 1I6XA 2A61A 5FLXZ 4PSXA 3RASA 3GFLA 4IRIA 2VB6A 3PM1A 3WODF 1MDMA 5DTDA 2XGDA 3TQNA 3PSFA 3DPTA 4KJZA 3FKJA 3KZIC 1E3OC 3CCSI 2M0CA 4IHWA 2Y1FA 4YRVA 2BBYA 2MD5A 4F7ZA 5EG0B 4PJ0C 5L3GA 2BY0A 4BE0A 4AM3A 1YS7A 3HZJA 5M5XJ 5KAIC 4XN5A 3A14A 3S2WA 3ZOBA 4PZJA 2Y1DA 3HRTA 1LFPA 5IOYA 1TNTA 2PMZN 4OAZA 2R93J 1U78A 1RIOH 2ISZA 3FTZA 2NVXJ 4AICA 2NAZA 4RAGA 1JE8A 2CWEA 2B9SA 4OIPF 1R5GA 3SDGA 3HRMA 3E3VA 4WF2A 5DV5A 3G1LA 5DS9A 3OSFA 4L5EA 4MTEA 1LE8B 4NB5A 3FTXA 1R4MB 3LA2A 2EB7A 4Y3OA 4R79A 2HNHA 1Z7LA 3C7JA 1R4NB 1SVMA 4IPAA 4L9VA 4PFOA 2R4GA 4FLRA 1QNTA 1X1CA 3KP4A 1A04A 2Y31A 4X0GA 3ZN1A 2IGOA 2O03A 5JI6A 2EV0A 1R1UA 4WX9A 3ONQA 2XVCA 1JKQC 2CRGA 5JVGF 4XRMA 3OYLA 2DQRA 1FMVA 4CYCA 3MKZA 1GDTA 1VQ5I 3FULA 4ABZA 3IL2A 3W6JB 1TP4A 3FH8A 4ZN6A 5EF6A 3PNYA 2IAIA 2VPRA 5JFRA 2I8DA 4XMTA 4XKVA 2DQ6A 4Q4ZF 2V9KA 4UXNA 1X3WB 2OQRA 4LJZF 2FBHA 4M6YA 3JRGA 5HLGA 1E2XA 1T38A 3LAJA 1FPQA 4RA2A 2DA1A 5KNLA 1TZLA 3FM5A 2RC4A 1PDNC 1JKRC 4WXHA 2OD5A 3W2AA 1IXCA 3HKZN 1TWFJ 2JRTA 2BE5F 4XMUA 2PBIA 2M4GA 4AR1A 4Y33A 1PUFA 3MZHA 2ETHA 1D8JA 5E8GA 1NG7A 2H1KA 2ELKA 3IH2A 2JVGA 2LTPA 4MFEA 4J3BA 2R7UA 3UR3C 3L2WA 3A01A 5A2QK 1ODDA 2DU9A 1KYZA 1LVAA 2UXXA 3I59B 5IPAA 1E17A 4K5MA 5KHDA 4Y13A 1IN5A 2P81A 4BBRJ 2V1UA 3DF8A 1H9TA 1UFMA 5GAEJ 4EGZA 2V9VA 5HNFA 4E7IA 3R4KA 2EFOA 2M9HA 3CHQA 2W00A 3HG9A 2F5VA 3F6OA 4HBLA 2X6OA 2XGEA 1V55H 3GW2A 2B61A 4ZZLA 4HLXA 2VJ8A 3DPLC 3CDLA 3NRVA 1XMXA 2LRDA 3H5RA 5IY5H 3CHOA 2O6GE 3AG2H 4ZYEA 2W48A 1D1BA 1ZH5A 1YI2I 2ZSIB 5C4XJ 1H9GA 5B66C 5DUIA 3O8GA 3RKYA 2V6CA 1WJEA 1JGGA 3DPUA 4L9TA 3CZEA 3K1MA 1OKRA 3QOPA 3JRAA 4JX4A 2Z9OA 5GPAA 3BTJA 1WJCA 5DCMA 1YQAA 1J2XA 1RPWA 5TGTA 2ZJQF 3BTIA 3OMYA 4LG3A 1GT0C 2LKXA 2BXYA 3L09A 5E3LA 5BPPA 2IBDA 2HR3A 4RMNA 3LA7A 2O9LA 1R23A 2EGHA 2P6TA 3IP4B 3DP7A 4D9JA 4HF1A 4FETA 2M1BA 5BQTA 3QWLA 2G7UA 1USTA 4HSTA 3HOYJ 3B3BA 3EUKL 3G2BA 3E6CC 1ONOA 2WWYA 4IZZA 1W5TA 3FISA 5FKMA 5E79C 2ZC2A 4PSWA 1V5FA 3WTTC 4B1RA 2DMTA 3VPRA 1XDUA 4ZW6A 2R7SA 4XN7A 4A0XA 4L9JA 4ZDOA 3AAFA 3M1CA 5CVJA 1B9MA 2MH9A 2M4KA 1ZLKA 1XDSA 3BR3A 1R6RA 3F23A 4BQAA 4EJVA 3EQLF 4XLFA 4XLHA 3ZHYA 2ZB9A 3GF2A 4OOEA 2HZTA 3J80Z 3MCZA 2DA7A 1XC5A 4ZTJA 3ASOH 1HW5A 1XMAA 1LKXA 4CYDA 3LSKA 1QPMA 3BDDA 5JMPA 2DK8A 2EPFA 2FUG2 3DLAA 4K5LA 4B3AA 1RUNA 4MTDA 5LGTA 1T6SA 1R49A 3WTSC 3P7NA 5HDNA 2MYSA 3CCVI 1V5EA 4RB0A 3OYBA 5EDNA 2KP6A 2ZJRF 3FU3A 4BKXA 2KL4A 3MKYB 4IHXA 3CUOA 2VJ4A 2LOOA 1OCOH 3R61A 4ZX4A 4M6VA 2RNGA 2W57A 3ESWB 2EZKA 3ZRGA 5D8LB 1HLVA 4KIFA 4RS8A 3RJPA 4FISA 2OCEA 4NC6A 3IKTA 1ZGWA 1Y56A 2DA5A 1TC3C 1K4TA 2HYFA 1K78A 1MW7A 3HM5A 4A3FJ 3KZZA 5IT9Z 4KN7X 5HLTA 4A5MA 4LLNA 2V1NA 1T0FA 1LEAA 2Y0MA 4HPQA 1ZG5A 2KT0A 1D3YA 4XLEA 1HOMA 3QPTA 3ZR8X 4CZCA 3Q0WA 1FYLA 1WI3A 1FSHA 2DAOA 2CGPA 3M3YJ 4KP7A 1D0XA 4ZQTA 1IXRC 1B8IA 4G9YA 1N25A 3TO7A 1ZG3A 2GLOA 4I98B 3F8FA 3ZMSA 2VT2A 4WK8F 4IRHA 4OWRB 2O7GA 2EBIA 3K10A 1X2MA 3TOBA 3K2ZA 3S1NJ 1U9NA 2QF7A 5H6QA 5J3LA 3PO2J 3R6SA 3BR1A 4BGDA 3FXQA 1DQUA 3Q0VA 1APLC 1XB4A 3FMRA 2OTJI 3SHFA 3UKGA 3BP8A 4PVBA 1U0JA 4I99C 1TWCJ 3HC7A 2L02A 1Z91A 1U5TA 5K7HA 4GAAA 3VEPA 1IG7A 1OJLA 4BJ5C 2HGCA 3PIPF 1RR8C 2FFLA 2HS5A 3P9CA 1WVRA 4C3HJ 3OYHA 2HDCA 4W1UA 3F6VA 2XPVA 1SD6A 2COMA 3FUDA 4KA4A 1RETA 1OFCX 3IWZA 3JRCA 1HDPA 3M1EA 1RC9A 3UNGC 1BC8C 4GYIA 2QYOA 4HA8A 1R36A 3K4CA 4MEXF 1DPUA 1GXQA 2HDDA 1AKHA 3I4PA 3L2UA 2PJPA 3S2DJ 4IF4A 4KMUX 4I02A 4LB6B 4Q5SF 2MG4A 2O0YA 1R22A 1ULYA 5LRSA 2CSOA 4ZC3A 3UERA 2ESNA 4GCVA 4D7MA 3F21A 3FHEA 1P2FA 4RCVA 2JK3A 1JJ6C 3CC4I 4X6AJ 2ZFWA 3CZ6A 1IDZA 1GW6A 3CCLI 3VB2A 3TO9A 1IZ1A 1HC8A 2XPYA 2IW5A 4XRSA 2JV7A 5JAZA 2XAQA 3KP2A 3U2RA 3DWLE 3G6EI 5JHFA 4HNTA 2X1DA 3FU5A 2RNJA 1S6LA 3HIFA 2BY3A 3FUKA 2YSRA 1BR2A 2DT5A 3LSMA 3LSIA 2DYSH 1IRXA 3FX3A 1TL8A 1RRJA 2R59A 4UVBA 4XO5A 1T56A 2Q1ZB 3H1CA 5BS6A 2KRCA 2Q0OA 3B7UX 1VF9A 3NQOA 2X1CA 3M8FA 1SFEA 2FU4A 4ANJA 3AU9A 3RCOA 5B3SH 1LFUP 2PLYA 1B6AA 3FIWA 1ZAOA 4QMEA 2GTQA 3KCCA 3BG3A 4EJOA 1WKMA 4UHTA 4KFCA 2JSCA 1V4RA 1Z1DA 2JUCA 2X51A 5CPRB 2R7FA 4OIOF 4FLOA 3GVAA 2CUJA 1MW0A 1OCCH 4M73A 2KDZA 2BHZA 4FTHA 3L9FA 2B0LA 2IGMA 2OPTA 2KJBA 3A0BC 1XGNA 2GIVA 2HQ5A 1E3PA 3CESA 2QBYA 2PGGA 4ZW7A 1Y1WJ 3OS1A 4JP0A 1IC8A 4UUVA 1FBSA 1XCBA 4JBAA 1OCPA 5F04A 5HS9A 2QEXI 2CFOA 3T8TA 4ZDLA 2DO7A 4ZDPA 5HOOA 3FUMA 4RM2A 2DOAA 1G3TA 2W7NA 4BACA 2JCYA 4AC0A 4FX0A 1KQ8A 3KYCB 5KK1A 4ZQEA 5LHHA 2XDVA 4JNDA 4IQJA 2MH2A 2P5KA 4Y6PA 1WJFA 3IV5A 3KE2A 5FKOA 1ETVA 2ZSHB 4JX5A 5K7FA 3EUHC 2X85A 1WJBA 3GO5A 1G5AA 5LLQA 5J4VA 2ZJ2A 2HOEA 4IRGA 4Y6SA 1FX7A 3SFZA 4Q4IA 1YRNB 1LFBA 3QYEA 3BQZA 3GYHX 2JPBA 1AOYA 2W4SA 3OYCA 1BR4A 2WY7Q 4HRIA 4XKWA 1JJ8C 2XF6A 2FOKA 3DKYA 4YEJA 4ESBA 1MBGA 3RPUD 4Y17A 5EYRA 2IS1A 2MAOA 2DA6A 4BDYA 2W85A 1LPQA 4BBSJ 1N77A 1BOBA 3BR6A 1LUJB 3HPHA 2K40A 2P7VB 1UHMA 4DIQA 1TBXA 3J7YJ 5ILVA 3CUQB 1SMTA 1FIPA 2W1OA 2Z16A 4MLOA 4A69C 4P55A 4YIFA 3J81Z 3M07A 4ZYHA 3RDIA 4L18B 1XGMA 4G12A 1A35A 3L7WA 5LGUA 4RVBA 2L4AA 4MFDA 2Y69H 2ZFUA 4KDPA 2F5FA 3A03A 3G1OA 4ZZDA 1DGRM 3OYIA 2NS0A 2W84A 3HOTA 1SFUA 5F1RA 1IUYA 4LG0B 1MJBA 1RNLA 1GXPA 1W5SA 5E1WA 3WTXC 3HOZJ 3I9V2 1I1SA 4PK4A 4UNOA 2PQ8A 1U6GA 3I71A 2Z3YA 2XROA 2KJCA 2X6YA 1SAUA 3RSNA 2HPOA 3A0HC 4XSXF 4QPEA 3K1PA 4XMXA 5HLHA 2HXIA 3CMYA 1Z21A 3KEOA 3HTUA 2ZXIA 2QUFA 3VOEA 5DYFA 4L0YB 2CO5A 3FBNB 1H8AC 5E3MA 2R7WA 1FWZA 1OYYA 4M3EA 3G73A 3K6GA 4PUSA 4RLFA 3B37A 5ICFA 4XQFA 1KONA 1YYVA 2H09A 4ZTFA 1DGWY 1HDDC 1S29A 1YW7A 4HDVA 1SVLA 1WJ5A 3F22A 2L9VA 3FK6A 3W6VA 4A0ZA 3OOPA 4GFBA 2M7AA 4LOCA 3TGNA 4DNCA 4ASNA 4R7LA 3GBGA 4CH7A 1G4DA 3I0TA 5IOZA 2E35A 5FKLA 5E8IA 5EV7A 3I3LA 4I7HA 3ECOA 3SEQA 4E7HA 3KYDB 4M9XA 1MDMB 1E3HA 3E6BA 3HGYA 1F43A 3M9AA 1YHQI 2AS5F 2Y1EA 1N75A 2F5DA 2STWA 3CCJI 3FM3A 4XN8A 4CCJA 1UHSA 5IYCJ 3DEWA 4ZW8A 4ON0A 3B2XA 4M3FA 5FFZA 3FU6A 4YELA 4I09A 1F9NA 3BR2A 3H36A 1O4XA 1DU6A 3TO6A 4E4HA 5ILUA 4BXFA 1I1GA 3G3ZA 4ZYGA 3HOSA 3QODA 5FD6A 2ZKZA 4DBQA 2K86A 3O3KA 1X3ZA 3VVMA 1SG7A 4A3BJ 1MVYA 2CQXA 3CUQA 2LY1A 3GFJA 4HX7A 5J1YA 1RUOA 4P1WA 3ZN0A 1X1DA 2JSPA 1UB9A 1G3WA 4F3QA 3FMSA 2X6XA 2KQRA 4EVIA 3ERED 2OTLI 2FNAA 2VKEA 1TT0A 3BG7A 3OL3A 5HODA 5FB2A 4G6QA 4GAEA 2LG4A 1D5YA 3AL0B 3KP3A 1O3RA 2MFZA 1A36A 3GUDA 3GTLJ 5J6XA 2R7VA 2ZBKA 4CYCB 2QCOA 5AENA 3TL4X 2P6SA 2MGQA 4U7BA 3CJTB 3S1MJ 1T33A 2JD0A 1VQ9I 4Y67A 4U0VA 2DDAA 1IN7A 1V5GA 1L3LA 2UUZA 3OR2C 2M34A 3HXLA 2QQBA 4MQ9F 3T1BA 4A2UA 4HNUA 3E5XA 3GTJJ 4Z6YA 1ZRCA 2XB0X 3B7RL 2FF4A 3LA3A 4KISA 1BI0A 1W36D 1VNDA 1ZK8A 4GDFA 2MABA 5E1XA 5M5YJ 4H0EA 1G3YA 1I3QJ 3TKYA 4N0BA 5HDGA 3ANMA 5F0HA 1MMAA 4EATA 4MO7A 1I3AA 2LFBA 3FUHA 2XGXA 2XAHA 4QUOA 5BOXA 1VI0A 2JUGA 4Y7NJ 5E18F 2C82A 4K5NA 1LQ1A 5TJJA 1FYMA 2VODA 1YIOA 1ZN2A 1JGSA 3W3CA 3K2AA 3A01B 1K61A 1Z67A 3H9JA 2ZXWH 2OU2A 3CJNA 3U21A 1Y39A 4MGRA 2JWTA 3IRRA 2X1EA 3JRBA 2HVRA 1IF1A 2R7TA 3OYDA 4LUPA 2E34A 3PNVA 3GFIA 4V2GA 3E5UA 2DODA 2G7HA 3PIOF 1X4PA 2KIUA 1FZPB 1X1PA 2DLLA 2VLAA 4HV6A 1W1WE 2HPMA 4NHJA 4MQVA 5KAFC 4WWCA 2J5PA 2O8KA 3BG5A 2LBFA 1RR7A 4L0ZB 3MD2A 1IGNA 2DPUA 3RI4A 2ZXHA 2H8WA 3P5JA 2VBZA 4IL6C 3O6BB 4Y15A 1IW7F 3FZVA 1X58A 2FJ1A 2HOSA 3BR0A 3FF5A 2M30A 3K0LA 1CQTA 4Q48A 3CO6C 4RDUA 3ANLA 3F8MA 5H6RA 3SQNA 2UZKA 5LD2C 2L9RA 1FOKA 2YS9A 4E6KG 2VE8A 3JSZA 4G94A 1WCMJ 4XR6A 4CCLA 3B7TA 4KIGA 5DCMB 4D5FA 1QZEA 2QSFX 4AWXB 5F27A 1T39A 2Y1CA 3TDUC 3WGGA 4U0WA 2WADA 5E1ZB 4KMFA 4KT6A 3J80K 1YIJI 2EFNA 4ESFA 2WY8Q 3F72A 1XD7A 3ELKA 3IH3A 4II2A 3BT9A 4HOBA 2J5OA 3KLNA 4B43A 3VYTB 3A4CA 2X0LA 2CV1A 1HA8A 3FHZA 3PUUA 1ZS2A 1WJDA 2EZIA 2KHMA 2CU7A 3IRQA 4XLCA 4LK1F 2PJRA 3AG3H 2HTSA 3CC2I 2EJRA 2C6YA 3JTHA 1SFOJ 2AQEA 1XGSA 3WG9A 5E17F 4AYBN 1XSVA 3KYLA 2JCVA 2DJIA 3ML6A 3HUGA 2LK2A 4BAYA 4JK1X 1JHHA 5IYBJ 4BQOA 4BXUA 4FCYA 4CXFA 1SEUA 3FXJA 2ID3A 3C2BA 5E3OA 3A1YA 1W5CC 3RZDJ 4AYSA 1HKTA 3BCAA 2VIXA 5LFAA 1FNNA 3FXUA 2JVHA 3L1PA 2OBPA 3F9KA 5GPCA 4LB5A 1SAXA 3BJOA 4MIMA 3LNQA 3ZP5A 2AHQA 3C18A 5LBQA 3D1NI 5CVUA 3EDPA 2F6CA 3OR1C 2CV2A 4I76A 4FX4A 3ZXSA 3HB9A 2DTRA 2XASA 2ISYA 3QPHA 3ZMDA 1BL0A 2AO9A 3T8VA 4PJNA 2AQFA 2CW8A 2H1LA 2Y75A 3PFYA 4UV8A 5BPIA 3FHNA 2EILH 4UVCA 2WPGA 5D5UB 1JVSA 2BVLA 2LVSA 2JMWA 1CF7A 3WTYC 5D5VB 1JT6A 4RB2C 3A2KA 2L54A 2QLZA 2L7MP 2ZMEA 2HZDA 2RQPA 3C2HA 5J40A 3CC7I 5AIPA 4CCMA 2ZCWA 3IUOA 2QQAA 3TDZC 4HAMA 2Z99A 1K78B 2BVMA 4XNAA 1AU7A 2LKPA 2VT3A 1SVOA 2MD0A 1KZHA 2QGUA 3DU6A 4LLLA 4N9HA 1Z3XA 2VQCA 1MMDA 1ON2A 2Q2EA 3BWGA 4M3BA 3VODA 1SANA 3AFHA 1B4AA 4N4NB 3X2QH 1JUSA 1WZ2A 4UV9A 4DYQA 3GTGJ 4XIDA 1B8IB 4K2EA 4BYYA 3H92A 2IS4A 2IS6A 1RESA 4IHSA 1ON1A 5GTHC 1I27A 5L3EA 4RB3C 3ASNH 2YX7A 4LK0F 5D4RA 3DTKA 3IAS2 3K70D 3MKLA 1P4WA 3RQ4A 3JAMZ 3Q3SA 3KFWX 2M5WA 5C3EJ 5M3FJ 2HKOA 2XAJA 4AIKA 2NVYJ 2PUSA 4A3IJ 5FLMJ 3ZMZA 1A6QA 3BOQA 3FUFA 2FSWA 3U1KA 4QIRA 2XUBA 3PFIA 2DMQA 2FMLA 2ACJA 1EJ9A 3WGIA 1QRYA 1YLFA 1W7PA 3ISPA 3MN2A 1SC5A 3IH4A 2LLKA 1D1CA 3O8HA 3Q43A 2A6HF 1U5TB 1D1AA 1MBHA 1QHHD 1IXSB 1S3JA 1NG6A 2HVQA 2IT0A 1PVEA 3FXOA 3IWFA 2WC2A 4ZW5A 1MJ9A 2BOLA 3LSJA 4ITVA 1MGTA 4MNUA 3JRHA 3I53A 2VASA 3GWZA 4S0HB 2ADUA 1N78A 1W0UA 1Y6IA 3DTIA 3D5LA 3IKVA 5CVIA 5J4YA 4IHVA 3GTOJ 5HNHA 5HVQC 4NQWA 3GZ6A 1WH5A 3PSIA 2O61A 3LSTA 1AKHB 2O8XA 2XF7A 3FXKA 2AXLA 2XV4S 2VE9A 2K9NA 1FY7A 4CCKA 4DJAA 4CGZA 4LITA 5JBIA 3OYNA 3K4MA 2QM3A 2DA4A 3GFMA 1Z6TA 4MEYF 3CMEI 4KIBA 1S46A 3EUAA 2DFFA 1XSDA 4IOAF 3L2VA 2PMHA 3CZKA 1FEXA 5FKKA 5D6FA 4BXXJ 3MMYB 3K4LA 4A3LJ 5D8KB 3CJRB 2D45A 4WXCA 1KU2A 2K9QA 2E2HJ 1USSA 3GTQJ 3OYAA 2WAEA 4Q4EA 2OCCH 1ZREA 2X48A 3KEQA 2TRTA 2HOAA 4RGSA 4XRFA 1WHUA 4CO8A 2EIJH 3HHGA 1R7JA 1XN7A 3MZYA 1BBYA 3RYRA 1NHAA 5EGOA 3RKXA 5D5WB 2A05A 2PG4A 5L3BA 3CHRA 2Y1GA 2XGCA 1K6OA 4XMVA 2BEOA 3KLOA 2FQ3A 3CQZJ 3F3XA 3WTWC 1M1EB 2GA1A 1LVKA 4EQQA 2A69F 4FQGA 1PUEE 4AD9A 3OYGA 3ZQQA 1TLHB 2R7RA 1T08B 2P5VA 2H27A 5FLVA 2Z33A 2R72A 2P0WA 4WXDA 3BJ6A 3V8LA 2K7LA 4GO1A 4YG2F 1DPRA 2ZXGA 4AUXA 3WQRA 3EBIA 2MLKA 2H94A 1MNDA 1TT5B 4F91B 4I6ZA 1JI8A 1RP3A 4CSWA 2X6WA 2DFEA 2HWVA 1U8RA 2QBYB 2JA5J 5CQEA 1HSJA 4E70A 5LGNA 3BZ6A 4AR9A 5HLIA 4EJWA 1T0FC 3QPLA 5CYVA 2JN6A 4BHPA 3CJQB 4JQFA 4UB8C 4PJJA 2TDXA 5F0CA 1OISA 2DMNA 3R0JA 3FH5A 1T98A 4GXOA 3DBRB 2L4MA 3DLLF 1YITI 3WE3A 2HQAA 4IO9F 3NWTA 3BCBA 4AVPA 2R0QC 3V42A 6PAXA 1W7PD 2VKHA 2L7KA 2XPUA 4RGUA 1WJAA 3F0CA 1WQ2A 1MW1A 2Z5UA 1JT0A 1NK3P 2GZWA 3ROUA 4A93J 3J81K 3QYFA 3V7CA 3OV8A 4HZFA 2DFIA 2LNBA 1MSFC 4PDKA 4XONA 3Q5FA 1LJ9A 2IVMA 2XC7A 2XPZA 1BC7C 1D0YA 2VJ5A 1X19A 1RI7A 3K4NA 4XO3A 2YX4A 3MKWB 3OYJA 3MFKA 5L3FA 4JYKA 2KIQA 2XAGA 1R5HA 3W6KB 2NRAC 1MH4A 1X2NA 2A6TA 1UELB 1U5TC 2JTVA 3V7SA 2NYXA 2JA8J 4PU2A 3S2HJ 1NK2P 1JUPA 2GIZA 2DT7B 1GLNA 3PQJA 3ZPLA 4ENJA 3CCQI 2QA4I 2JJ7A 4QPOA 3KP5A 1ETKA 5E20A 1QQIA 2Y30A 4N4OB 4QLCU 2IRFG 1B9NA 3AG4H 2XRLA 3I4MJ 1MIJA 1HS6A 1FOYA 4BQNA 3DEUA 2DI3A 2JCXA 1VQKI 2PX9A 1QO0D
chains in the Genus database with same CATH topology
3BPVA 5HDKA 2HFHA 3N97A 1HW2A 4ENKA 4R5XA 1XMKA 2H6BA 1W4MA 3GXOA 1R58A 2VOPA 1LDDA 4OOFA 1HXDA 1KU7A 1R0KA 1TQPA 2FA5A 4QWQA 2QWWA 1ZRDA 1WSUA 1VTNC 2JD2A 3HHHA 3KP6A 5TRDA 1T2KA 3I5UA 1QGPA 3FUEA 2HKXA 4M9ZA 2XHKA 3REOA 1V3FA 2JT1A 4LFUA 4M74A 3E6DA 3KEDA 4EJTA 1HBXG 4UVAA 4ZYDA 2RN7A 1MJAA 4P9FA 4G7HF 2GA2A 2RKHA 4HDUA 1EH7A 1OPCA 1ZLJA 4EJUA 2GAUA 4CDGA 5ED4A 1YS6A 3PQKA 4PCQA 4CHUA 1H3LA 2RVCA 1O7FA 3QU3A 4ZW3A 2HQRA 3QP5A 2FBKA 2XKPA 4XO4A 3COAC 1LB2A 4O3MA 2DQLA 2FE3A 4ENNA 4KUMA 1TQIA 2V79A 4U88A 4AIHA 2OAZA 4I0AA 1ONNA 2GXGA 3U9WA 2R7DA 1J59A 2VOOA 3K69A 2EFQA 2CFXA 1HKSA 2F5CA 5FLXK 1TTYA 1P92A 3M7GA 5D4SA 1KQ9A 3EYYA 4HYEA 4XMZA 1YW9A 1WWXA 4HQEA 2GQQA 1YW8A 3WU0A 2E7XA 2CYYA 2KRFA 2WV0A 4B8XA 1B59A 4D0PA 3M8EA 4P9UA 2VXZA 3EBHA 2D2WA 4KNYA 3MAJA 3WQSB 1B1BA 3K9TA 3RYPA 4KT5C 5DD8A 2PI0A 1CGPA 1TNSA 3AUAA 1LDJA 3C1DA 4G7ZF 3WTZA 1KQ0A 2W24A 3RC8A 1MW2A 5FO5A 2OZUA 1J75A 4BNCA 3P9KA 5CLSA 2DW4A 1G3SA 3FUNA 2O3FA 5HS8A 1RZ4A 5JMWA 1G6NA 2DPDA 2R70A 5AIQA 1KYWA 4OMYA 1GHCA 3E5QA 2ZNYA 4BHCA 1O3QA 3I64A 3ULQB 2Q8KA 4IHTA 5J8FA 3QP6A 3C3WA 4WCGA 5JO0A 3GZ5A 2KIFA 4XN2A 3ANNA 4XNBA 1S7AA 2NNNA 4L5IA 4I0BA 1IAWA 1FBQA 2P4WA 1PP7U 2E1CA 1TW2A 1GVJA 3CO7C 2VBWA 5ICCA 3SXYA 2ELHA 3CZLA 4RSYA 3N4MA 3T0YA 1IN6A 3A06A 3KETA 3CUQC 3ECHA 4HF0A 3CIAA 3LFKA 5FD5A 2K27A 4P96A 3CZGA 1R0LA 4G7OF 4ARFA 4XMWA 4Z2YA 5LEKA 4ZX5A 2VBYA 1YO5C 3L2CA 2BGCA 5BPDA 1J0RA 2P5LC 3FXRA 3HTSB 5LEJA 4KN4X 4M72A 3R0IA 1EH6A 4G8XA 1FT9A 2IP2A 4HV5A 3SZPA 1BI2A 1CF7B 1D8KA 1FLIA 1XSXA 1MW3A 2ZMEB 3QRFF 4ENMA 3JAMK 5DUKA 1ONVA 1ZARA 1O7LA 1SD7A 4QHPA 1F4KA 3WU1B 5CVRA 4RB1A 2RJIA 3O2PE 2XAFA 4XNDA 1O3TA 2JZYA 2E7WA 4IVNA 2VC1A 2A3SA 4KYWA 2FRHA 4FHTA 5DLLA 3F8CA 5DDGA 1C0WA 1KU3A 3J7AO 3LAPA 4XBFA 4YFXF 3BROA 3FWEA 4PGHA 4A5NA 5D6EA 1DP7P 4OMZA 1QZYA 3WTVC 4ZX3A 1T1SA 3AU8A 4Y6RA 2P7CB 1W7PB 3Q9SA 4N9IA 3IC7A 1H19A 4PW4A 4DQ2A 1OYIA 3U9GA 3FTYA 1BIAA 1L0OC 3MEXA 2XRNA 5IT9K 1HSTA 3D0SA 5EEHA 3V8KA 3T8RA 3JT1A 4EV0A 1JXSA 5EEGA 3Q44A 2IJLA 4ZH4F 4FCAA 3WGHA 1BI3A 2V1XA 4RGXA 2EA2A 1TW3A 1ZGAA 1WI9A 4S05A 3B2PA 4EM2A 2F2EA 5ICEA 5F6FA 2VN2A 1Q0HA 2EV5A 2K4JA 4BHBA 2QQ9A 2YR2A 1FP2A 4HX4A 1FSEA 1F5TA 2QENA 3UEQA 5DCFA 2VONA 4I2OA 1REPC 1JG9A 2EWNA 2VBXA 3KZYA 3WTUC 3H3UA 2E1NA 1OYWA 4IXAA 2P8TA 1J9IA 1F1ZA 5CJ9A 1P6RA 1STZA 4MHGA 4ZQGA 2M45A 2ESHA 2FEZA 3T5XA 1EV7A 4O6JA 3KP7A 2EFPA 3GLXA 1J5YA 3V8JA 3FMQA 3FTWA 1FP1D 3FTUA 3SZTA 4OU0A 1TQMA 1X3WA 4LLGF 1BJAA 1BIBA 5J8CA 4P5OA 2OA4A 2V1DA 1SD5A 4OIRF 1JHFA 5K1YA 4M6XA 1QZZA 4A0YA 2UWMA 1BOAA 2YPRA 4EMSA 3I59A 1KU9A 3B02A 1BI1A 1ONPA 3K1NA 4XSZF 2STTA 5DYMA 4XN1A 4ZX6A 3FTVA 2RV8A 5JC1A 3H3ZA 2C5ZA 2Y48A 5D5XB 2FNPA 1IN4A 4XN4A 1PP8F 2KIMA 3JSOA 3QAHA 2JD1A 1R1VA 5JHUA 5LHGA 5A2QZ 2QJ1A 2CW0F 3R0AA 2GWRA 3MQ0A 3FTSA 1WRJA 1Q0QA 5BMZA 1SMYF 3DV8A 3ZMTA 4PGGA 1U3EM 1SQMA 3FU0A 3JTGA 1OMIA 4XLPF 2XKOA 3E97A 1HQCA 2WTEA 1S8NA 4ZQHA 5K5RA 3BY6A 3HRSA 3NEUA 4G6DA 2G9WA 1IRFA 1Q1HA 1S7OA 1AWCA 1IRGA 3ZMUA 3DFGA 4HX8A 2IA2A 1ZHFA 2PMUA 3R60A 1Z9CA 2X4HA 2FXAA 2RGVA 3EYIA 1SFXA 2BV6A 2HYGD 2IPQX 2ZO4A 3HSRA 2KKOA 3P9IA 5CVVA 2YU3A 1T1RA 1ZGJA 2EFWA 1YFHA 1HKQA 2PFBA 3JW4A 1FC3A 3FUIA 4EGYA 4MS6A 1SD4A 5DULA 2EA4A 5ERIA 2DBBA 3DKWA 1EH8A 5KVRA 3WE2A 3RPUA 4DPRA 3CLOA 4A6DA 3ABUA 5L3CA 2PEXA 4ESJA 4RAYA 4U0YA 3LQRA 4RAZA 4OINF 3ZMVA 2BYVE 2LDUA 2OQGA 3RIRA 3IIEA 2WZFA 3EETA 4AR8A 2A6EF 5JNLA 1MD0A 2CG4A 1D5VA 2ZNZA 4U7DA 3L00A 2PN6A 4EM0B 3FH7A 4CICA 1ZYRF 2K02A 5F64A 1R00A 4YIIA 3VFZA 2A07F 3UCQA 1XCVA 1K5HA 4ZQFA 5JVTA 3EUHA 4OIQF 2DK5A 5K5QA 5FGMA 2MLGA 2LSOA 4FLQA 3HYIA 1BM9A 3ZHZA 5DEQA 3LQQA 5ICGA 3B73A 4YFKF 2XQ0A 5K5OA 2EK5A 1UHWA 1KA8A 1O3SA 4RGRA 2HEOA 4L5JA 2M8EA 4FLSA 2QZ8A 2K4BA 3MWMA 4A6EA 5FFXA 3U1DA 3ZQ7A 3CDHA 1LEBA 1P4XA 4Q47A 3FUJA 1IN8A 1JGIA 2W25A 3GX4X 4K5PA 3V4GA 4M71A 4L9NA 4AIJA 4GYGA 3Q9VA 4OOIA 3B34A 3E6MA 3GEZA 1U2WA 3HSEA 1KGSA 3BPXA 1DUXC 4MKTA 5LRRA 4R5TA 2H6CA 5H20A 3JSPA 2RDPA 2WZGA 3DQVC 1UCRA 1YG2A 2A68F 1Z7UA 4L2LA 1LNWA 5IT3A 3CHSA 3F8BA 1R1TA 4I01A 3I54A 1Y0UA 5DD4A 2LF8A 1ZG1A 2L01A 3ABTA 1OR7A 3TOAA 4FT8A 3QJXA 1ZRFA 1HW1A 4O5VA 4IJAA 2MA3A 1X3UA 4ETSA 1I5ZA 2OZ6A 2M87A 4HLYA 2DQMA 1P4AA 2D1VA 4XLNF 3CHPA 2R3SA 4LD5A 5AONA 3DXJF 1Q0LA 4M9SA 3HSFA 4HQMA 1YTYA 3V7RA 3LWFA 4K5OA 3B7SA 1BN5A 2HQNA 3VVLA 2D1HA 3ZHXA 4HW0A 4R5VA 2LF7A 2NNYA 1Z6RA 1MKMA 4R1HA 3RTRA 5L3DA 5LHIA 3RC3A 2MAPA 1XGOA 4LMYA 1QBJA 4B09A 4XN9A 3WQQA 2CQKA 2HTJA 1O57A 3BJAA 4BH9A 3RPQA 4GGGA 4CZZA 4A12A 1LDKB 4A03A 4EM1A 3HRUA 2HPTA 3IHUA 1DDNA 3EBGA 2F5EA 2IA1A 2IA0A 1MZBA 2UXNA 3F8NA 1H0MA 4YFNF 1FYKA 4LG0A 2L3DA 5ILSA 2FBIA 5HS7A 4X2UA 2VC0A 3QU6A 2GXBA 2ZXJA 2MBFA 5JR3A 4KICA 2A7OA 2QVOA 4HF2A 2A5YB 3ZI0A 3RKWA 1Z05A 2MC3A 1K79A 2FMYA 1J7KA 4S04A 2XIGA 2PL5A 1FBUA 2QVWA 2JPCA 5FWQA 4R8HA 3I58A 4TV7A 2EV6A 4LGWA 3CTAA 1I6XA 2A61A 5FLXZ 3RASA 3GFLA 4IRIA 3WODF 1MDMA 3TQNA 3DPTA 2Y1FA 2BBYA 2MD5A 4F7ZA 5L3GA 1YS7A 4XN5A 3A14A 3S2WA 4PZJA 2Y1DA 3HRTA 1TNTA 1U78A 1RIOH 2ISZA 3FTZA 4AICA 2NAZA 4OIPF 1JE8A 2CWEA 1R5GA 3HRMA 3E3VA 4WF2A 5DV5A 1K7AA 4MTEA 4NB5A 3FTXA 3LA2A 2EB7A 4R79A 3C7JA 4IPAA 4L9VA 4FLRA 1QNTA 3KP4A 1A04A 3ZN1A 2O03A 5JI6A 2EV0A 1R1UA 4WX9A 2XVCA 2DQRA 3FULA 3IL2A 3W6JB 3FH8A 4ZN6A 5JFRA 4XMTA 2DQ6A 4Q4ZF 4UXNA 2OQRA 4LJZF 2FBHA 4M6YA 5HLGA 1E2XA 1T38A 3LAJA 1FPQA 3FM5A 2RC4A 1PDNC 4WXHA 2OD5A 1IXCA 2JRTA 2BE5F 4XMUA 2PBIA 4AR1A 3MZHA 2ETHA 1D8JA 5E8GA 4J3BA 5A2QK 1ODDA 2DU9A 1KYZA 1LVAA 2UXXA 3I59B 1E17A 4K5MA 4Y13A 1IN5A 2V1UA 3DF8A 1H9TA 1UFMA 4EGZA 2V9VA 5HNFA 3R4KA 2EFOA 3CHQA 3F6OA 4HBLA 3GW2A 2B61A 4ZZLA 4HLXA 2VJ8A 3DPLC 3NRVA 3CHOA 2O6GE 4ZYEA 1ZH5A 1H9GA 5DUIA 3RKYA 2V6CA 4L9TA 3CZEA 3K1MA 1OKRA 3QOPA 2Z9OA 5DCMA 1YQAA 1J2XA 3L09A 5BPPA 2HR3A 3LA7A 1R23A 2EGHA 2P6TA 3DP7A 4HF1A 2M1BA 5BQTA 2G7UA 1USTA 3B3BA 3E6CC 1ONOA 2WWYA 1W5TA 3WTTC 1XDUA 4ZW6A 4XN7A 4A0XA 4L9JA 3AAFA 5CVJA 1B9MA 2MH9A 1ZLKA 1XDSA 3F23A 4BQAA 4EJVA 3EQLF 3ZHYA 3GF2A 4OOEA 2HZTA 3J80Z 3MCZA 1HW5A 1XMAA 4CYDA 1QPMA 3BDDA 5JMPA 2DK8A 4K5LA 1RUNA 4MTDA 5LGTA 1T6SA 3WTSC 3P7NA 5HDNA 4RB0A 3FU3A 4BKXA 3CUOA 3R61A 4ZX4A 2W57A 5D8LB 4KIFA 4RS8A 3RJPA 3IKTA 1K78A 2HYFA 5IT9Z 3KZZA 4KN7X 4LLNA 4A5MA 5HLTA 1T0FA 1LEAA 2Y0MA 1ZG5A 1D3YA 3QPTA 1FYLA 1FSHA 2DAOA 2CGPA 4KP7A 4ZQTA 1IXRC 4G9YA 3TO7A 1ZG3A 4I98B 3F8FA 3ZMSA 2VT2A 4WK8F 4IRHA 2O7GA 3TOBA 3K2ZA 5H6QA 3R6SA 3FXQA 1XB4A 3FMRA 3SHFA 3BP8A 4PVBA 2L02A 1Z91A 1U5TA 4GAAA 3VEPA 2HGCA 2FFLA 2HS5A 3P9CA 2HDCA 3F6VA 1SD6A 2COMA 3FUDA 4KA4A 3IWZA 3M1EA 1BC8C 4GYIA 2QYOA 4HA8A 1R36A 4MEXF 1DPUA 1GXQA 3I4PA 2PJPA 4IF4A 4KMUX 4I02A 4LB6B 4Q5SF 2O0YA 1R22A 1ULYA 5LRSA 2CSOA 3UERA 2ESNA 4GCVA 3F21A 3FHEA 1P2FA 4RCVA 1GW6A 2ZFWA 3VB2A 3TO9A 1IZ1A 2XPYA 2IW5A 2JV7A 5JAZA 2XAQA 3KP2A 3U2RA 3FU5A 2RNJA 1S6LA 3HIFA 3FUKA 2YSRA 2DT5A 3FX3A 2R59A 4UVBA 4XO5A 5BS6A 3B7UX 2Q0OA 3NQOA 3M8FA 1SFEA 2FU4A 3AU9A 2PLYA 1B6AA 1ZAOA 4QMEA 2GTQA 3KCCA 4EJOA 1WKMA 4UHTA 4KFCA 2JSCA 1V4RA 1Z1DA 2R7FA 4OIOF 4FLOA 3GVAA 1MW0A 4M73A 3L9FA 2B0LA 2QBYA 2KJBA 2PGGA 1XGNA 2GIVA 4ZW7A 4UUVA 1FBSA 1XCBA 4JBAA 5HS9A 3T8TA 2DO7A 5HOOA 3FUMA 2JCYA 1G3TA 4FX0A 1KQ8A 4ZQEA 5KK1A 5LHHA 4JNDA 2MH2A 2P5KA 4Y6PA 3KE2A 3GO5A 1G5AA 5LLQA 2ZJ2A 2HOEA 4IRGA 4Y6SA 1FX7A 3SFZA 4Q4IA 3GYHX 2JPBA 1AOYA 2FOKA 4ESBA 4Y17A 2MAOA 2W85A 2P7VB 1UHMA 1TBXA 5ILVA 3CUQB 1SMTA 4YIFA 4P55A 3J81Z 4ZYHA 3RDIA 4L18B 1XGMA 3L7WA 5LGUA 4RVBA 2L4AA 4KDPA 2F5FA 4ZZDA 2NS0A 2W84A 3HOTA 1SFUA 5F1RA 1IUYA 4LG0B 1MJBA 1RNLA 1GXPA 1W5SA 5E1WA 3WTXC 1I1SA 4UNOA 2PQ8A 1U6GA 3I71A 2Z3YA 2XROA 2KJCA 2HPOA 4QPEA 4XSXF 4XMXA 3K1PA 5HLHA 3KEOA 3HTUA 2QUFA 3VOEA 5DYFA 4L0YB 2CO5A 1FWZA 1OYYA 3G73A 3B37A 5ICFA 1YYVA 2H09A 4HDVA 1S29A 1YW7A 3F22A 4A0ZA 3OOPA 3TGNA 4DNCA 4ASNA 4R7LA 1G4DA 3I0TA 5E8IA 5EV7A 4I7HA 3ECOA 4M9XA 1MDMB 3E6BA 3M9AA 2AS5F 2Y1EA 2F5DA 2STWA 3FM3A 4XN8A 4ZW8A 4ON0A 3B2XA 5FFZA 3FU6A 4I09A 1F9NA 3TO6A 5ILUA 1I1GA 3G3ZA 4ZYGA 3HOSA 5FD6A 2ZKZA 2K86A 3O3KA 1X3ZA 3VVMA 1SG7A 1MVYA 3CUQA 3GFJA 4HX7A 1RUOA 3ZN0A 1UB9A 1G3WA 3ERED 3FMSA 4EVIA 2FNAA 5FB2A 4G6QA 4GAEA 3KP3A 1O3RA 3GUDA 5J6XA 2ZBKA 5AENA 2P6SA 4U7BA 2JD0A 4Y67A 4U0VA 1L3LA 1IN7A 4MQ9F 4A2UA 2QQBA 3T1BA 3E5XA 1ZRCA 3B7RL 2FF4A 3LA3A 1BI0A 5E1XA 4H0EA 1G3YA 3TKYA 4N0BA 5HDGA 3ANMA 3FUHA 2XGXA 2XAHA 4QUOA 5BOXA 5E18F 2C82A 4K5NA 1LQ1A 5TJJA 1FYMA 2VODA 1YIOA 1ZN2A 1JGSA 2OU2A 3CJNA 4MGRA 3IRRA 1IF1A 4LUPA 3GFIA 3E5UA 2G7HA 1FZPB 2KIUA 2DLLA 2VLAA 4HV6A 4NHJA 4MQVA 4WWCA 2J5PA 4L0ZB 2DPUA 3RI4A 2VBZA 3O6BB 4Y15A 1IW7F 3FZVA 3FF5A 2M30A 3K0LA 4Q48A 3CO6C 3ANLA 3F8MA 5H6RA 3SQNA 2UZKA 1FOKA 2VE8A 3JSZA 4G94A 3B7TA 4KIGA 5DCMB 4AWXB 1T39A 2Y1CA 3TDUC 3WGGA 4U0WA 5E1ZB 4KMFA 3J80K 2EFNA 4ESFA 3F72A 1XD7A 3ELKA 4HOBA 2J5OA 3KLNA 2X0LA 3PUUA 3FHZA 1ZS2A 3IRQA 4LK1F 2HTSA 2EJRA 2C6YA 3JTHA 1XGSA 3WG9A 5E17F 1XSVA 2JCVA 3ML6A 3HUGA 4BAYA 4JK1X 1JHHA 4BXUA 4CXFA 4AYSA 1HKTA 1FNNA 3FXUA 2OBPA 4LB5A 1SAXA 3BJOA 3ZP5A 3C18A 5LBQA 5CVUA 3EDPA 4FX4A 3ZMDA 2DTRA 2XASA 2ISYA 3QPHA 3T8VA 2Y75A 4UV8A 5BPIA 4UVCA 2WPGA 5D5UB 1JVSA 1CF7A 3WTYC 5D5VB 4RB2C 2L54A 2QLZA 2ZMEA 2RQPA 5AIPA 2ZCWA 2QQAA 3TDZC 4HAMA 2Z99A 1K78B 4XNAA 2LKPA 2VT3A 4LLLA 4N9HA 1ON2A 2Q2EA 3BWGA 3VODA 1B4AA 4UV9A 4K2EA 4BYYA 3H92A 4IHSA 1ON1A 1I27A 5L3EA 4RB3C 4LK0F 2YX7A 5D4RA 1P4WA 3JAMZ 3KFWX 2M5WA 2HKOA 2XAJA 4AIKA 2PUSA 3ZMZA 3FUFA 3BOQA 2FSWA 4QIRA 2XUBA 3PFIA 2FMLA 2ACJA 3WGIA 1YLFA 1W7PA 3ISPA 1SC5A 3Q43A 2A6HF 1U5TB 2IT0A 1IXSB 1S3JA 3IWFA 2WC2A 4ZW5A 1MJ9A 1MGTA 4MNUA 3I53A 3GWZA 2ADUA 3D5LA 3IKVA 5CVIA 5HNHA 5HVQC 4NQWA 3GZ6A 2O61A 3LSTA 2O8XA 2AXLA 2XV4S 2VE9A 4CGZA 1FY7A 5JBIA 2QM3A 3GFMA 1Z6TA 4MEYF 4KIBA 1S46A 1XSDA 3CZKA 2PMHA 5D6FA 5D8KB 2D45A 4WXCA 1KU2A 1USSA 4Q4EA 1ZREA 4XRFA 3KEQA 4RGSA 4CO8A 3HHGA 1R7JA 1XN7A 3MZYA 1BBYA 3RYRA 1NHAA 3RKXA 5D5WB 2PG4A