4NQWA

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
148
Chain Sequence
b'DLDALLRRVAHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
total genus 57
structure length 148
sequence length 176
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4nqwA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4nqwA01
3KETA 1YS7A 3E6MA 3G3ZA 4WWCA 2YU3A 3IRRA 2Y1GA 3BJ6A 4Y15A 3DKWA 1KQ0A 3WE2A 4U0YA 4M71A 1ZREA 4MEYF 2OAZA 3F22A 1ZRCA 1D8JA 1U8RA 3K2ZA 2XASA 2ZNZA 3FX3A 1DPUA 2Z3YA 2MH2A 2WPGA 3KP6A 4UVBA 1S6LA 3CUQC 6PAXA 3V7SA 5J8FA 2Q8KA 2P5KA 3F8BA 1XCBA 1G5AA 2HKXA 1MW0A 2VT2A 3I58A 3HIFA 2P5VA 2ADUA 3JSPA 3SQNA 3K1MA 1S7AA 2HGCA 1R23A 3U2RA 3R0IA 1OKRA 2H6BA 3BWGA 4IRGA 5JMPA 3F6VA 4A6EA 1QZZA 5D8LB 4IRIA 2EK5A 3KCCA 2GIVA 5ICCA 5JFRA 3RKWA 1SFXA 1G6NA 5E1ZB 2MAPA 4BH9A 3GW2A 3A06A 3RKYA 5K5RA 1T98A 4JQFA 5D5XB 1T39A 3COAC 1PUEE 4EMSA 1ZARA 1CF7A 2A69F 5K5QA 2A07F 2M87A 2LSOA 2IRFG 3M7GA 3FM5A 1OPCA 1T1RA 2XKOA 3ECHA 1P4XA 4XBFA 2DI3A 2MAOA 4KICA 5TRDA 3AU8A 3Q9VA 1K6OA 1G3WA 2Q0OA 1J59A 5DD8A 2E7XA 2G7UA 2FA5A 2LF7A 4N0BA 4H0EA 2EV5A 1ZRDA 4G6QA 5JVTA 3EDPA 3T5XA 5AIQA 2XGXA 2ISYA 4PGGA 5KVRA 2EB7A 1SMYF 4Y6PA 1I5ZA 2M45A 2EV0A 4YG2F 4CZZA 3ECOA 4GYGA 3K0LA 3P7NA 4U7BA 4L0YB 1LNWA 1ZYRF 4YIIA 4GCVA 2E1NA 1ONOA 3QP5A 1IF1A 1WKMA 4KUMA 5DDGA 3HHGA 4ENNA 2LF8A 3JTHA 3QU6A 1ZH5A 1F9NA 1W7PB 2JD0A 4HDUA 3I0TA 2IP2A 3ZMUA 3IC7A 1IN8A 1QPMA 1FZPB 5E1WA 2NS0A 1U5TA 2W84A 2EJRA 4IXAA 2ACJA 2JCXA 4L9VA 4LK1F 4FLRA 2RNJA 2DO7A 3ABUA 2DK8A 1SFUA 4ZYHA 1ZG1A 3KLNA 4MEXF 5F6FA 1V4RA 1YTYA 4DNCA 2ZBKA 3GFMA 5E18F 4BHBA 3V4GA 1CF7B 2EGHA 1TNSA 2UXNA 1WI9A 4QLCU 2QM3A 3KEQA 3GO5A 3CLOA 1TQMA 2ESHA 1RUNA 5FD6A 5CVIA 3MZYA 3S2WA 4HQEA 3MAJA 4A12A 1ZG3A 4LG0B 3RJPA 2BEOA 1UCRA 4WX9A 4OOIA 1YFHA 3TOAA 4FLQA 1AOYA 4Z2YA 2FMYA 2VC1A 3FXRA 5DUIA 1JGIA 4OIRF 2R7DA 3VEPA 2FQ3A 2BV6A 4EJWA 5HLHA 1RIOH 3IL2A 3F8NA 2CW0F 2BGCA 3T1BA 3ML6A 5ERIA 3BPXA 4EV0A 4HW0A 3FZVA 1YW7A 4NHJA 1WQ2A 4HZFA 2KJCA 2PBIA 5L3FA 4G8XA 3ZN1A 5L3EA 2ELHA 2EWNA 1Q1HA 3G73A 2WTEA 2QBYB 1GHCA 4IF4A 1S8NA 3HSRA 2NNNA 2CFXA 1KU2A 3GWZA 2K4JA 5H6RA 3DFGA 3ZMDA 4Y67A 3I53A 1QQIA 3F8FA 2Y1FA 5FD5A 3CTAA 1DP7P 5AIPA 2MA3A 3GX4X 4HF1A 2OQRA 1J9IA 2VOOA 3CJNA 2Y75A 2MLGA 4KMUX 4UHTA 4U0VA 2DAOA 1BOAA 2ZMEA 5D5UB 4KMFA 4WCGA 4KN4X 1YW8A 3WTWC 1G3SA 2B0LA 5IT9Z 1QO0D 1KU7A 4OIOF 2G9WA 2EA2A 1FBSA 4I98B 1O3TA 4OOEA 2C6YA 5ICEA 1BI2A 2D45A 4FT8A 1XGNA 3F72A 3I59B 3SHFA 2BBYA 2JZYA 3GXOA 2GA2A 3BROA 2DPUA 3ISPA 2FEZA 3QPHA 1EH7A 3NEUA 3C7JA 3WQRA 4HBLA 1FYMA 4P96A 1HW1A 3I71A 1FLIA 1J0RA 2PMUA 1QZYA 4WK8F 4HDVA 5AONA 3HHHA 2FRHA 2MD5A 2IA1A 2A3SA 1BN5A 2RGVA 3U9GA 1Y0UA 2E7WA 1RI7A 5BS6A 4D0PA 3IHUA 3GLXA 3ERED 1U78A 1OYWA 2PJPA 1O7LA 3P9CA 1U5TC 1OR7A 2R3SA 4O3MA 1YW9A 1XGMA 2VBYA 3N4MA 3HUGA 1ULYA 4BNCA 3J80K 2CG4A 1VTNC 1BJAA 4UXNA 3RPQA 4AIJA 3SZTA 3QOPA 4K2EA 3CZLA 4EM2A 2L54A 2P8TA 3ANNA 2YSRA 3GFIA 5KK1A 3JTGA 4FLSA 1ZHFA 4XSZF 4CO8A 1FNNA 3DF8A 4HX4A 3WTZA 1LB2A 5LGNA 3KE2A 3WTXC 2L4MA 3BP8A 4HV5A 4AD9A 4ZZDA 2F5CA 3WODF 5FFZA 3V8KA 2ZO4A 2GQQA 5BPDA 2XKPA 5E20A 4KYWA 5HDKA 3L2CA 4LFUA 5HDGA 3KEOA 1S3JA 4RGXA 5CVRA 4AIHA 1Q0QA 2L01A 5HS9A 5LEJA 4UUVA 3D0SA 5IT9K 1LJ9A 4RAYA 5LGTA 2VBXA 2X0LA 3ANLA 1GXPA 5ILSA 1D8KA 3U1DA 1KQ9A 3VODA 1P4AA 2QWWA 1EH8A 1GVJA 5DCMB 1O3RA 2HR3A 1O57A 4KN7X 1ZGJA 3V8LA 3TO7A 2RDPA 5JMWA 4A0ZA 1KU3A 1R1VA 4EJVA 2EFQA 2VC0A 2V9VA 4O5VA 1DPRA 3K1PA 5ILVA 5CYVA 4A5NA 1D5VA 1I27A 2LKPA 4OMZA 2DT5A 4BQAA 4KIFA 5J6XA 1QBJA 1UFMA 4HYEA 4G7OF 2RVCA 3JAMZ 2OZ6A 3R0AA 3ZPLA 4B09A 2STTA 2KKOA 3BDDA 1KYWA 2D1HA 2Q2EA 1C0WA 2IW5A 2UXXA 2ZNYA 1OYYA 3HTSB 2VONA 3RDIA 1MDMB 5ILUA 3R4KA 2HOEA 1MW3A 1R5GA 5L3CA 1LDJA 3C18A 1W7PA 4ZYDA 2CWEA 2CGPA 4FHTA 5JC1A 5E8IA 5K1YA 1NHAA 3TDUC 1KYZA 3LA3A 1SMTA 2H6CA 1IXSB 4F7ZA 4R1HA 2GA1A 3T8TA 1FYKA 1Z91A 2F5FA 3KZZA 3OOPA 2Y1CA 4JK1X 3WE3A 4WF2A 1XGSA 1IAWA 4I01A 3AAFA 2VT3A 2MLKA 2Y1DA 2RC4A 1E2XA 3CDHA 2O3FA 3PQJA 2ETHA 2P4WA 1X3UA 2LNBA 4B8XA 1ZLJA 2XUBA 2PFBA 2W25A 2EFPA 2IA0A 2O8XA 4O6JA 2PLYA 1HW2A 4RB1A 1OMIA 1REPC 1T6SA 3ZHXA 3UCQA 4I0AA 4UV8A 1V3FA 1YIOA 2HDCA 3RTRA 4LG0A 3EQLF 5EEHA 5HDNA 1H3LA 3RYRA 1WSUA 1LVAA 2HQNA 2KRFA 2GXBA 1FT9A 2F5EA 3DPTA 1O3QA 3HRMA 3O2PE 4RB3C 3O6BB 1G3YA 3KP4A 1Z6TA 1PDNC 1BI0A 5TJJA 1XN7A 3H3ZA 3E3VA 4EM0B 3A14A 5LLQA 4A03A 2DTRA 4Q47A 2MC3A 4XSXF 3CO6C 2QLZA 1W5TA 2HWVA 1QGPA 3WGHA 2X4HA 1O7FA 1R1TA 3JAMK 1IN6A 1G4DA 3DEUA 3JW4A 1R0KA 2QBYA 3MEXA 4UVCA 1EV7A 3E6DA 2QZ8A 2FNAA 1K79A 4WXCA 2HYGD 4PDKA 1FBQA 1MJAA 1GXQA 2W57A 3IRQA 2R7FA 5JI6A 2V1UA 2F5DA 2PEXA 1HSJA 2DQRA 2JSCA 4QWQA 2DK5A 4Y6RA 3DXJF 1KU9A 3ZMSA 2ZKZA 4ASNA 5LHGA 1L0OC 1BC8C 4YFKF 3FXUA 5DV5A 2GAUA 1JG9A 3MWMA 4ZH4F 1PP8F 1TTYA 3TOBA 4EGYA 5BOXA 1B4AA 2FE3A 3Q9SA 1W5SA 3HYIA 1HQCA 2YPRA 1OYIA 3I59A 2RV8A 5HS7A 4RB2C 1SAXA 4U7DA 1T0FA 4CGZA 2KJBA 3E5QA 3LSTA 4I7HA 2M8EA 3WTSC 4IHTA 2A68F 5D6EA 3HOTA 1JE8A 5HOOA 3IWFA 2J5OA 4LLGF 2RQPA 3EUHA 3WU1B 2LDUA 3ROUA 4R8HA 3HRSA 1B6AA 2OZUA 1IZ1A 4GXOA 1R5HA 3JSOA 4A6DA 3L7WA 3LA2A 3VOEA 4LK0F 5DCFA 4EJOA 3MCZA 2DW4A 4ZYGA 2PQ8A 1XD7A 1H9GA 1F4KA 2FXAA 2E1CA 5ICFA 1USSA 4BHPA 1R7JA 3KP5A 5IT3A 1Z9CA 1U2WA 1XSXA 4L9TA 3ZP5A 1T2KA 1ZN2A 2WC2A 3FF5A 4NB5A 4OINF 3RIRA 5E17F 1BC7C 2NRAC 4XLPF 5FB2A 3R0JA 1P6RA 3KP2A 2Y1EA 1LEAA 4ZQEA 3R6SA 3DQVC 1RZ4A 3IIEA 2EFOA 2ZJ2A 2QVOA 4RS8A 2K02A 1MW1A 1UB9A 5D4RA 3GYHX 4KDPA 2GZWA 3SFZA 4ETSA 1MGTA 2XAFA 4ESFA 3UERA 4HOBA 1ZRFA 4EM1A 3M8FA 1EH6A 4P5OA 1MVYA 3EYYA 1J75A 2C82A 1Q0HA 1XMAA 3RASA 2FMLA 1A04A 1IN7A 4HX7A 1SC5A 4M9ZA 1HBXG 2Z99A 1DUXC 1Z6RA 2STWA 4LJZF 2MH9A 5JHUA 3QRFF 2J5PA 1HKSA 3BJOA 4AWXB 1IUYA 3T8RA 1JHHA 5JAZA 2FOKA 4RGSA 3TGNA 3QP6A 5DULA 5HVQC 5DCMA 2QENA 3HRTA 1IRGA 1J2XA 3M1EA 2HTSA 4IVNA 2UWMA 3GF2A 3F21A 2IT0A 5DUKA 3HSFA 2QQBA 4I09A 1SD5A 3WG9A 3Q5FA 3E97A 4ZQHA 2QUFA 1UHMA 1FPQA 1TW3A 3WGIA 5JNLA 4LLLA 3MZHA 1T1SA 4OMYA 1YLFA 2YX4A 5CVVA 4FLOA 3F8MA 4TV7A 3LQQA 4M72A 3DV8A 2DU9A 4FX0A 3FXQA 3QAHA 4HQMA 2DFIA 1K78B 3D5LA 2VODA 2OA4A 4MNUA 3VFZA 2H27A 4GYIA 3SXYA 4S04A 2O03A 1ZLKA 3P9KA 2YX7A 3FM3A 5FO5A 3B73A 2FBKA 1MDMA 1XGOA 4LD5A 4HLXA 2CO5A 3GZ6A 2Y0MA 2DBBA 1B9MA 3NQOA 2EFNA 3LA7A 3CUQB 4CHUA 4Y6SA 2M5WA 4A5MA 4A0XA 2CSOA 2KIUA 1AWCA 1ON2A 2D1VA 4U88A 4S05A 4RGRA 4HF2A 2RKHA 2ESNA 2XAGA 1P92A 4KT5C 4MTDA 1Z7UA 5JR3A 2PN6A 2OU2A 5H6QA 2QQ9A 1JXSA 2QYOA 3V7CA 1I1GA 2RN7A 4P55A 4PZJA 2WWYA 1PP7U 3T0YA 3IWZA 1MJ9A 5K5OA 1J5YA 2FBHA 4ON0A 4M6XA 4WXDA 2ISZA 2K4BA 1K5HA 3WTYC 2FU4A 3K9TA 3RYPA 3O3KA 4AVPA 4HF0A 1XB4A 4AIKA 1J7KA 2KIMA 3ULQB 2JT1A 2DLLA 1TNTA 3LAPA 2K7LA 1R22A 4ZN6A 1H0MA 3F6OA 1YYVA 4Q5SF 3UEQA 1R1UA 1LQ1A 2BYVE 4IHSA 4UVAA 3WTVC 5FGMA 2CQKA 4HX8A 4MQVA 2JTVA 2M30A 4HLYA 2L3DA 2OQGA 1ZGAA 4YIFA 1SD7A 5D5WB 4RGUA 3WTUC 2JPBA 4A2UA 5D8KB 4L18B 3RKXA 1B9NA 2GWRA 2NYXA 1ZG5A 3LQRA 3KLOA 3K69A 2JCVA 5EEGA 2XVCA 1P4WA 2O0YA 3CO7C 4EJTA 2P7CB 3MQ0A 1E17A 4XLNF 4HV6A 5H20A 4Y17A 4ZZLA 3W6JB 3HRUA 3W6KB 2K86A 2FF4A 4IJAA 3TDZC 5CLSA 4Q4ZF 1ONPA 2HKOA 4L5IA 1U6GA 3FWEA 1XSDA 3OV8A 3J7AO 1FBUA 3WTTC 1USTA 1KGSA 2M1BA 3ABTA 4M73A 1MW2A 1R36A 4RCVA 3MFKA 4BXUA 4P9FA 5ICGA 5D5VB 2HFHA 3ZI0A 4OIQF 3AUAA 3AU9A 1ZS2A 1HKTA 3CZEA 4RAZA 4UV9A 4E70A 4GAEA 3RPUA 3CZKA 2VOPA 1XSVA 4IRHA 1B1BA 2BE5F 2IPQX 1QNTA 3ZHZA 1G3TA 4CYDA 1IXRC 4Q48A 1KQ8A 1TW2A 1T38A 4GGGA 3EYIA 3ZQ7A 5CVJA 3GFLA 2EFWA 3KP7A 4OIPF 3F23A 2PMHA 1ONNA 4L9NA 4L5JA 2XIGA 5L3BA 4LLNA 3KFWX 3LWFA 5D4SA 4KA4A 2VXZA 3QPTA 3PFIA 5F1RA 4CICA 2NNYA 2P7VB 4HA8A 2VN2A 4LGWA 2JD1A 1WWXA 3TQNA 2F2EA 4HAMA 5DD4A 4I2OA 2VBWA 1BIBA 2TDXA 4M9XA 3BPVA 4LUPA 4WXHA 5LHHA 1JVSA 2ZFWA 4ENMA 1RUOA 4XRFA 3CUOA 5HLIA 2A6HF 3HSEA 2HYFA 2IVMA 1LDKB 2UZKA 2CYYA 5LRSA 4KNYA 2XHKA 1S29A 3DP7A 4G94A 3FMRA 4OU0A 4YFXF 2FNPA 3L00A 3GUDA 1DDNA 4KFCA 3H92A 1TQPA 4UNOA 2MBFA 3IKVA 1BI3A 1SFEA 1R58A 3B02A 4P9UA 2W85A 4LMYA 2PG4A 3FHZA 4G7ZF 1TBXA 1MKMA 3WQQA 3J81Z 2YR2A 1TLHB 1HSTA 2PI0A 3SZPA 2H94A 1RP3A 2VE9A 2HTJA 4MGRA 4N9HA 3KP3A 4RB0A 1BI1A 2H09A 1D3YA 3CZGA 3L09A 1IRFA 1JHFA 5HLGA 4EGZA 1XDUA 1R0LA 2COMA 2V79A 2O7GA 3C3WA 2O6GE 2XAJA 1F1ZA 2V1DA 3EETA 3J80Z 2ZXJA 2K27A 4I0BA 3RI4A 4M6YA 1HKQA 4Y13A 4ZQGA 1R00A 4L0ZB 3I4PA 1Z05A 1W7PD 1U5TB 2ZCWA 1YQAA 3FMSA 2XAHA 5LBQA 4DQ2A 1FC3A 3GZ5A 1K78A 4IPAA 2QQAA 1S7OA 1FYLA 1SD4A 3KZYA 1FP2A 2XV4S 1FOKA 5FFXA 3M9AA 1ON1A 4ZYEA 1IN4A 5A2QZ 3ZN0A 2OBPA 3H3UA 5LHIA 1BM9A 1IW7F 2JRTA 2HZTA 1K7AA 3TKYA 2Z5UA 5J8CA 4MTEA 3TO6A 4CDGA 2HQRA 3R61A 3CUQA 2L02A 4BAYA 3N97A 3I64A 2XROA 3LFKA 2EV6A 3BJAA 5LRRA 4EQQA 2WV0A 4BHCA 5F64A 2A5YB 1FX7A 2A61A 2FSWA 2XRNA 1I1SA 1XCVA 4G9YA 2EA4A 3HTUA 4KIGA 2IA2A 1MD0A 5BQTA 2JCYA 5E8GA 5HS8A 1CGPA 1P2FA 1Z1DA 2FBIA 4GO1A 4FX4A 2G7HA 1BIAA 5D6FA 4MHGA 5DEQA 1L3LA 1YG2A 2IJLA 1ODDA 1MJBA 1UHWA 1XMKA 4N9IA 2Z33A 2NAZA 2GXGA 5FLXZ 4M9SA 3J81K 2Y48A 3L9FA 3REOA 4EVIA 4LB6B 4ENJA 1YO5C 2A6EF 3M8EA 4OOFA 4YFNF 4I02A 2P6SA 1RNLA 1TQIA 3TO9A 3ZMVA 2OD5A 3WGGA 1FP1D 5CJ9A 4KIBA 1JGSA 1SD6A 2VBZA 1ZAOA 5ED4A 4EJUA 5CVUA 1IXCA 2P5LC 1ONVA 3BY6A 4U0WA 2P6TA 3R60A 2JD2A 1H9TA 2L4AA 4AYSA 4JBAA 3E6CC 3WQSB 1XDSA 4KP7A 4ZQFA 1FWZA 3QU3A 2W24A 3LAJA 5BPIA 4CXFA 3IKTA 3ANMA 2KIFA 4NQWA 2HEOA 1KA8A 1I6XA 4ESBA 1BBYA 3I54A 3VB2A 1B59A 1FSEA 5BMZA 2ZMEB 4AICA 2D2WA 4A0YA 3P9IA 3DPLC 3E5XA 2DPDA 5DYMA 3E5UA 3ZHYA 4G6DA 5LGUA 3FMQA 1Q0LA 2V6CA 5A2QK 4PGHA 1IN5A 1FSHA 3WU0A 3HOSA 3ELKA 4ESJA 3F8CA 3ZMTA 2Z9OA 5L3GA 3GFJA 2DQLA 1HW5A 4R79A 4M74A 1F5TA 2V1XA 1FY7A 2AS5F 2VE8A 5JBIA 2HS5A 3C1DA 2XAQA 2AXLA 3V8JA 4BYYA 1LDDA 1U3EM 3NRVA 1STZA 3PQKA 3BOQA 5LEKA 3K1NA 1O3SA 4PCQA 3E6BA 3GEZA 1MZBA 1YS6A 2O61A 4ENKA 4L9JA 4G7HF 3GVAA 3ZMZA 5JO0A 2JPCA 4MQ9F 1S46A 4LB5A 5L3DA 1W4MA 3I5UA 3F3XA 3V7RA 1LEBA 1HXDA 5E1XA 3BZ6A 1WRJA 5FLXK
chains in the Genus database with same CATH superfamily
3KETA 1YS7A 3E6MA 3G3ZA 4WWCA 2YU3A 3IRRA 3QPSA 2Y1GA 3VVMA 3BJ6A 4ZW3A 3DLAA 3HUGB 4Y15A 3JR9A 3DKWA 2DJNA 1KQ0A 3WE2A 2L7ZA 4E7SA 3K4KA 3OYGA 3EUAA 4U0YA 1TWHJ 3TP3A 2ZC2A 4M71A 1ZREA 4MEYF 2OAZA 3F22A 1ZRCA 1D8JA 1U8RA 3K2ZA 4XN8A 1G59A 2XASA 2ZNZA 3FX3A 3LSJA 1T33A 1TP4A 3S17J 1DPUA 1AU7A 2Z3YA 1VQ5I 2PUSA 2MH2A 3VYUB 2WPGA 3L2WA 4XOPA 3KP6A 4UVBA 1S6LA 4L5EA 4C3JJ 3BR5A 3CUQC 6PAXA 3V7SA 5J8FA 4XN0A 2Q8KA 1F36A 2ECCA 2E1OA 4RM2A 3GTQJ 2P5KA 3F8BA 1XCBA 1G5AA 4F3QA 2B9SA 3CC7I 1MBEA 3SDBA 2HKXA 1B72A 1MW0A 2VT2A 2FD5A 3I58A 4BDZA 1OJLA 3HIFA 2P5VA 3A03A 1SC7A 2CW8A 3IUOA 3OYJA 3S1NJ 2ADUA 3JSPA 3GMEA 1E0EA 4PJMA 3SQNA 3K1MA 1SVOA 4BU2A 4NUBA 2UV1A 1S7AA 2HGCA 3E1SA 3DTKA 2QA4I 4QUOA 1R23A 3U2RA 1EA3A 3FUMA 3R0IA 1OKRA 2H6BA 3BWGA 4IRGA 2KT0A 5JMPA 2IGKA 3BR0A 3F6VA 1RKTA 1D1CA 4A6EA 3D5SC 1QZZA 5D8LB 4IRIA 5GADJ 2EK5A 2HDWA 1QZEA 3KCCA 1FMWA 2GIVA 4XNBA 1RC9A 5C4XJ 1GDTA 5ICCA 4Q4IA 4Z6YA 2DFHA 2HPOA 3GCMA 5JFRA 2NVQJ 3RKWA 5GTIC 1SFXA 4AVZA 1G6NA 5E1ZB 3OL3A 2MAPA 4BH9A 3GW2A 3IH3A 3RKYA 3K10A 5K5RA 2ZSHB 1T98A 2V4JC 3A06A 4JQFA 2X6WA 5D5XB 1T39A 3COAC 4PUSA 1PUEE 4EMSA 2KISA 4BY7J 1ZARA 1CF7A 3FU6A 2A69F 2ELJA 3FK7A 5K5QA 1IDZA 1K83J 2LMDA 1H88C 2A07F 4BKXA 2M87A 3SEZA 2L0KA 2LSOA 2IRFG 2DJIA 3M7GA 1EF4A 3PFYA 3FM5A 4X0GA 2LRDA 4JP0A 1OPCA 3TW6A 1T1RA 2FJ1A 2XKOA 3VSKA 4MFDA 4A3EJ 3ECHA 1P4XA 4XBFA 4HSTA 2DI3A 2MAOA 3DTIA 2LG4A 5IPAA 4KICA 1WVRA 5TRDA 3AU8A 3Q9VA 3NAUA 2QKMB 5HNFA 1YIJI 1K6OA 1G3WA 2Q0OA 1J59A 5DD8A 4XMZA 2JVGA 2E7XA 2M8GX 3I4MJ 2CUJA 2G7UA 5GAGJ 3CHOA 2DDBA 2FA5A 3LSIA 2LF7A 3MD2A 4N0BA 4H0EA 1P7JA 1NH3A 2EV5A 1ZRDA 4G6QA 5JVTA 2E35A 3EDPA 3T5XA 4BXXJ 2QF7A 2XGXA 2BOLA 2ISYA 4PGGA 5AIQA 5KVRA 2DQMA 2EB7A 1SMYF 1WJ5A 4Y6PA 4DYQA 1I5ZA 2M45A 2EV0A 3PNTA 4YG2F 1MBHA 4CZZA 3ECOA 4GYGA 3A02A 1D0XA 3OL4A 3K0LA 3P7NA 1HS6A 4U7BA 4L0YB 1LNWA 2DT7B 2Q2EB 3IP4B 1VQ7I 1ZYRF 2CW7A 4GCVA 4YIIA 1YRNA 1X3WA 2E1NA 1ONOA 3F0CA 4Y4RA 1LE8B 1T8IA 1VQ9I 4IL6C 3QP5A 1IF1A 1WKMA 4KUMA 3HHGA 5DDGA 3CMAI 4ENNA 2LF8A 3JTHA 2MG4A 3QU6A 2OUMA 2DA3A 1Y8RB 1FOXA 1ZH5A 2G0EA 1F9NA 1W7PB 2JD0A 4HDUA 2HVSA 3I0TA 1B72B 2V9PA 2IP2A 2VLAA 3OS0A 2CFOA 3ZMUA 3IAM2 5HLTA 3IC7A 2QQ8A 2Y0SN 2GBYA 4CA0A 1IN8A 5J4YA 1QPMA 1FZPB 1P7IA 4AR1A 5E1WA 2NS0A 1DU6A 1U5TA 2W84A 1NK2P 4KJZA 4V2FA 2KZVA 2EJRA 4IXAA 2JUGA 2ACJA 2JCXA 2W00A 5CPRB 3ZGKA 4L9VA 3HOVJ 1K4SA 4LK1F 2VQGA 2XSJC 4FLRA 3BQZA 4HSRA 4HEA2 2RNJA 4KT6A 4LIVA 3V42A 3PNVA 2DO7A 3ABUA 4AR8A 3FTSA 2R4GA 3CCJI 1FIAA 3H0GJ 2DK8A 2HQ5A 1SFUA 4ZYHA 1ZG1A 1VQ6I 2QJ1A 1RPWA 3FXMA 1BR2A 2WY8Q 3KLNA 4IQ4A 1Z21A 5IYCJ 4MEXF 3SJMA 3FXJA 4DZPA 5F6FA 2UUZA 1V4RA 1YTYA 2VJIA 1Q1VA 4DNCA 3CC2I 2ZXHA 2ZBKA 3DTEA 3GFMA 5E18F 4BHBA 4QMEA 3V4GA 2DMNA 1CF7B 2EGHA 1TNSA 2Z16A 5EZGA 2KHMA 2DA1A 3EPZA 2UXNA 3BLYA 1YHQI 4Y7NJ 1QPIA 1WI9A 1MNEA 4QLCU 2QM3A 3KEQA 2X85A 1LKXA 3GO5A 3CLOA 1TQMA 2ESHA 2OPTA 2NOJB 1RUNA 5FD6A 4ZW7A 1VQOI 5CVIA 3MZYA 3S2WA 4HQEA 3MAJA 4A12A 2K9QA 3B7RL 1ZG3A 1UHSA 1UG0A 2DFFA 2AHQA 3HOXJ 3ASNH 2CJJA 3BG9A 2BEOA 4M3EA 3RJPA 4LG0B 1UCRA 1TWAJ 3EBHA 4XO4A 3GLLA 4WX9A 4OOIA 1YFHA 3TOAA 1XS9A 4ZX5A 2F4IA 4KITB 4FLQA 4G12A 1AOYA 3PSFA 4FCAA 4Z2YA 2FMYA 2VC1A 3FXRA 5DUIA 2VQLA 3HOWJ 2XGCA 2ZSIB 1JGIA 4OIRF 5HNHA 2R7WA 1A36A 2R7DA 2CUFA 4QPQA 3VEPA 2DODA 2FQ3A 4XMYA 4AU7A 2GLOA 3HL2A 2BV6A 4EJWA 5HLHA 3D1NI 4XK4A 1RIOH 2KZGA 3IL2A 3F8NA 2CW0F 4DGWB 2HPMA 3EBGA 1Y8QB 2BGCA 1HCRA 2DMTA 5M5XJ 2VJ5A 3T1BA 5C3EJ 3ML6A 2XC7A 4IZZA 4XKBA 2R7UA 5FKMA 5ERIA 3JRDA 1VQPI 3BPXA 2PX9A 4HW0A 2XB5A 4EV0A 1IDYA 4GAAA 3FZVA 1YW7A 4NHJA 2KJCA 1WQ2A 4HZFA 2PBIA 5L3FA 4G8XA 3ZN1A 5L3EA 2ELHA 3ERMA 2EWNA 1Q1HA 3G73A 2M2EA 3TL4X 2DCEA 2WTEA 2QBYB 4IF4A 1GHCA 2IBDA 2ZFUA 3BR3A 1PJRA 1S8NA 3HSRA 3QYEA 2IS1A 1X2MA 2NNNA 2CFXA 1KU2A 3OYEA 3FISA 1JTYA 3GWZA 3HG9A 2K4JA 3G1OA 4PK4A 5H6RA 1V5GA 2CV2A 5E3NA 3DFGA 3ZMDA 4Y67A 3I53A 1QQIA 3F8FA 1W0TA 2Y1FA 5FD5A 3CTAA 1DP7P 5AIPA 2MA3A 3GX4X 4HF1A 2MW8A 2E2JJ 2OQRA 5FJ8J 1J9IA 4PFPA 1MH3A 2VOOA 3FIWA 3CJNA 2Y75A 2B61A 2MLGA 1A35A 4KMUX 4UHTA 4II2A 4U0VA 2DAOA 3TMOA 1BOAA 4IHWA 2ZMEA 3Q0VA 1X1DA 5D5UB 4KMFA 1X4OA 3OS2A 4M3BA 4WCGA 4KN4X 2HNHA 1YW8A 2E2IJ 4MFEA 4D1QA 3WTWC 3O8GA 1G3SA 2B0LA 5IT9Z 1QO0D 1G8XA 1KU7A 4OIOF 4AYBN 2G9WA 2EA2A 1FBSA 3QJXA 4I98B 1O3TA 1RESA 3JCUC 4OOEA 2C6YA 5ICEA 2IEKA 4W1UA 3RC8A 1BI2A 2VIXA 4FT8A 1XC5A 2D45A 1XGNA 3BR6A 1OLTA 3F72A 3I59B 3SHFA 3OYBA 2BBYA 2JZYA 5F04A 1IO2A 3GXOA 2GA2A 2Y0SA 3BROA 3AG1H 3FXLA 4XN5A 2CQNA 1K4TA 3UR3C 2DPUA 3ISPA 3FH5A 2F4OB 2FEZA 3CZ6A 3QPHA 1EH7A 4DPRA 3NWTA 2X1CA 3C7JA 3NEUA 3WQRA 4HBLA 1FYMA 4P96A 1HW1A 5KAIC 2V9KA 3RPUD 3I71A 1AKHA 2VUMJ 2WZGA 1R5ID 1FLIA 2E60A 2ME0A 1V54H 3DLLF 2EH3A 4E7KA 3BG3A 1J0RA 2PMUA 1QZYA 1SQMA 3OR1C 4UUTA 2EZHA 4WK8F 4HDVA 1TT0A 2HXOA 5AONA 3GTOJ 3HHHA 2GIZA 2FRHA 2MD5A 2ZJRF 3LSRA 2KRCA 3HBLA 2IA1A 2FQ4A 3J7AY 4J00A 4K5NA 2A3SA 1BN5A 2RGVA 3LOCA 5IYBJ 4UUSA 3U9GA 3OYHA 3CQZJ 1Y0UA 3SEQA 3SZGA 3HGYA 3FTXA 4B3AA 2E7WA 2JN6A 3HEFA 4IHVA 2E5ZA 3E7LA 1QVTA 4J01A 1RI7A 4XN3A 5BS6A 4D0PA 3IHUA 1Y0NA 4B44A 3GLXA 3ERED 1LFPA 2BW3B 1U78A 1SANA 3FKJA 3B6AA 2VI6A 1OYWA 5IOZA 2PJPA 3H5NA 4MS6A 1O7LA 2LR8A 3P9CA 3H5RA 3FXKA 1U5TC 1OR7A 3BG7A 2R3SA 4ZW6A 2K5CA 4O3MA 1YW9A 1XGMA 3HB9A 4BBSJ 2IS4A 2VBYA 4YEJA 3N4MA 1IV8A 3HUGA 1ULYA 1Y1WJ 4BNCA 2M3AA 1VZ0A 3J80K 2CG4A 1VTNC 2EIJH 1BJAA 4B47A 1T56A 1MW7A 1UZCA 3OYNA 2HOSA 4UXNA 1B8IA 3RPQA 3AFHA 4AIJA 3SZTA 1D1BA 4ZX4A 4I6ZA 4ITVA 4JOMA 3QOPA 4K2EA 3CZLA 4EM2A 2L54A 2P8TA 3BTIA 2K3PA 2LD5A 2HVRA 3ANNA 2YSRA 3S1MJ 3CLQA 3GFIA 5KK1A 2X9DA 1BA5A 3JTGA 4FLSA 1ZHFA 4XSZF 4N4OB 3T8VA 4CO8A 1FNNA 1MBJA 3DF8A 4HX4A 2E1MB 3K4NA 3WTZA 1LB2A 1GW6A 4N4NB 5LGNA 3DBHB 3KE2A 2LBFB 3WTXC 2EILH 2L4MA 3H9GA 2P0WA 3BP8A 4HV5A 2LY1A 4DJAA 2VB6A 4AD9A 1MMSA 2M7AA 4ZZDA 2F5CA 4ARFA 2V26A 3WODF 2LTPA 5FFZA 2DMUA 3V8KA 4RBOA 2ZO4A 2GQQA 5BPDA 4E6KG 2XKPA 5GPAA 5E20A 4IKFA 3PM1A 4KYWA 5HDKA 3L2CA 1TWGJ 4LFUA 5HDGA 3KEOA 3M4OJ 1S3JA 4RGXA 5CVRA 4PSXA 2DMQA 4AIHA 1Q0QA 4Y3OA 2L01A 2K9LA 4YELA 2E19A 4XN7A 5HS9A 5LEJA 5FROA 4UUVA 3D0SA 3OY9A 3ZOBA 1HDDC 5IT9K 1LJ9A 4RAYA 5LGTA 3MKZA 1MMNA 2I8DA 2EPFA 4XN2A 2VBXA 4XORA 2X0LA 3ANLA 1GXPA 2BY1A 1JTXA 3JRHA 5ILSA 1D8KA 3U1DA 1KQ9A 3VODA 1P4AA 2QWWA 1EH8A 2M9HA 4BXFA 3MKWB 2WB1N 2VJ4A 1Y1VJ 4ZX6A 1GVJA 3EUHC 5DCMB 3K70D 1O3RA 2HR3A 1O57A 5J40A 4KN7X 1ZGJA 2GM4A 3V8LA 3TO7A 4XRMA 2R5ZB 1MIJA 2RDPA 2XGDA 4A0ZA 5JMWA 2VJJA 1FOYA 1ZK8A 1KU3A 1R1VA 2KQRA 4EJVA 4F55A 5C44J 4ABZA 3Q3SA 2EFQA 2VC0A 1X19A 4H4KC 2V9VA 4O5VA 1DPRA 3GTLJ 4AYBA 3K1PA 1V5EA 5ILVA 3GZNB 5CYVA 4A5NA 5M3MJ 1D5VA 1X58A 1I27A 2LKPA 3W6VA 4ZX3A 2EIMH 4OMZA 2DT5A 3CHSA 3MKYB 4BQAA 4KIFA 4CCKA 5M5YJ 2M7BA 4E4HA 5J6XA 4BE0A 1QBJA 1UFMA 4HYEA 5E3LA 4BL0B 4BJ5C 2RREA 4G7OF 2RVCA 3JAMZ 2OZ6A 2V7FA 5JLWA 1B8IB 5HODA 2L9SA 3R0AA 3ZPLA 4B09A 2FUG2 2A5WA 2STTA 1X4PA 2KKOA 3BDDA 2VKDA 1KYWA 2KDZA 2MFZA 2D1HA 2Q2EA 3L2UA 5IP6A 1YJ9I 2MGQA 2M0MA 1BR4A 1C0WA 2IW5A 2UXXA 2ZNYA 1D0YA 1OYYA 1YI2I 1LE8A 3HTSB 2VONA 4RLQA 2VQCA 3CJQB 1RR7A 3RDIA 1MDMB 5ILUA 3R4KA 2HOEA 1MW3A 1R5GA 5EG0B 5L3CA 3S1RJ 1LDJA 1WJBA 2DOEA 3C18A 1W7PA 5FKNA 2ZMEC 4ZYDA 4QIRA 2CWEA 2CGPA 1N77A 4FHTA 5JC1A 5E8IA 5K1YA 1NHAA 4CCNA 3TDUC 3KEYA 3OSFA 1KYZA 2BVLA 1Z67A 2K3FA 5KCMA 2CV0A 3FHNA 3H35A 3QYFA 3LA3A 1SMTA 2CU7A 4IHXA 3CHPA 2H6CA 2KRHA 4RDUA 3L2RA 1IXSB 1WH7A 4F7ZA 1D0ZA 4R1HA 2GA1A 3T8TA 1FYKA 2RNGA 3CD6I 1R4NB 1Z91A 1ORKA 2F5FA 1OCCH 2QCOA 1JT0A 5F0HA 4ZDPA 4BJ6C 2CUZA 1WI3A 2WY7Q 5AENA 3S16J 4X6AJ 4R5VA 2CRGA 1SFKA 3KZZA 2XF6A 3OOPA 2Y1CA 4JK1X 4BY1J 2KFDA 3A01A 3WE3A 1WJFA 4DZJA 3CHRA 4WF2A 2F6CA 3I3LA 3WU2C 4BJTA 1VQ4I 2BY3A 3GTJJ 1VQLI 1GT0C 1ZR2A 1XGSA 1XX5A 1IAWA 5FLMJ 3VVLA 4I01A 3AAFA 2VT3A 1M1EB 3ZRGA 1ERDA 4PJLA 1I39A 4BS9A 3CCEI 2MLKA 1FTZA 1Z7LA 2Y1DA 2O5RA 4A3LJ 2RC4A 1E2XA 3I56I 2XRLA 4II3A 4XR6A 3LNQA 2CV1A 3W2AA 3CDHA 2O3FA 1DQUA 3K4BA 5IOYA 2XPVA 1AA7A 5EEAA 4DOZA 3PQJA 2QEXI 2ETHA 2P4WA 1X3UA 2LNBA 4B8XA 2R7ZJ 1ZLJA 3CHQA 3B7TA 2XUBA 4B43A 2PFBA 2W25A 1WJDA 2EFPA 2IA0A 2O8XA 2FFLA 4O6JA 2PLYA 1HW2A 4E7JA 4OWRB 1OMIA 4RB1A 1REPC 1T6SA 4E7IA 3ZHXA 3UCQA 2XPYA 4I0AA 3AL0C 4UV8A 1V3FA 1YIOA 2HDCA 2WBMA 1I3AA 3HOYJ 3RTRA 4PJNA 3EQLF 4LG0A 4X2UA 5EEHA 1IRZA 5FRNA 5HDNA 4PVBA 1H3LA 2DA5A 3RYRA 3B2XA 3U9WA 3IV5A 4B1RA 2MSYA 3CF2A 1MNMC 1WSUA 3JRFA 1OR7C 1LVAA 1X1BA 2HQNA 2KRFA 2GXBA 3JT1A 3UKGA 2W48A 1FT9A 1WJEA 2F5EA 3DPTA 2X6OA 2K85A 2Z2SB 1O3QA 2LFBA 3HRMA 1HDPA 3O2PE 1BOBA 4RB3C 1GUUA 3QYBA 3QOEA 3O6BB 5KHDA 1G3YA 4QSHA 3KP4A 1FOWA 2F48A 5F0CA 3JRAA 1ZKGA 3OOUA 2CQ7A 1Z6TA 1PDNC 1BI0A 2FX0A 5TJJA 4M3GA 1XN7A 3FUHA 2M4KA 2IXSA 1JJ6C 3H3ZA 2R7XA 1PVEA 2E34A 3E3VA 4EM0B 3A14A 5LLQA 4A03A 2DTRA 2HU9A 3FH7A 4Q47A 2MC3A 4XSXF 3CO6C 2QLZA 5B66C 4BEHB 1W5TA 5J3LA 2C5ZA 2HWVA 1QGPA 1ETWA 1K6YA 5CQEA 2X4HA 3WGHA 2IGOA 2OTLI 1A5JA 1MSEC 2XQ0A 3A2KA 2WB1A 2L7KA 3CP8A 1O7FA 3JRCA 1Y39A 3GTGJ 4ZW5A 4D9JA 1R1TA 3JAMK 1A31A 1IN6A 4K5LA 2VL8A 2AQEA 1G4DA 3DEUA 3JW4A 1R0KA 4KISA 2QBYA 3MEXA 3JRIA 3CMYA 2QSFX 2Y2ZA 2D5VA 1MMGA 4UVCA 1EV7A 4M6VA 2H8RA 3E6DA 2LVSA 2QZ8A 2FNAA 1K79A 3WHBA 4GFBA 2R7SA 4WXCA 2HYGD 4PDKA 2EZKA 2DA7A 2V1NA 2VPLA 1FBQA 1MJAA 3LSGA 3DCFA 1GXQA 2W57A 3IRQA 2R7FA 5JI6A 2Y9ZA 3DBRB 2JJ7A 4XLCA 2V1UA 2F5DA 2PEXA 3Q43A 1HSJA 5EJCA 1K61A 1U9OA 4J19A 3ZQCA 3A01B 2X1DA 2DQRA 5J47A 2JSCA 4QTRA 4QWQA 2DK5A 1YJWI 3HZJA 4Y6RA 3DXJF 4LIUA 1KU9A 3ZMSA 2ZKZA 4ASNA 4JNDA 3HPHA 5F1JA 5LHGA 1L0OC 2ZXWH 3BR1A 4XNFA 1BC8C 4YFKF 2KLOA 3RZDJ 3FXUA 1IC8A 2MD0A 4V19K 5DV5A 2JV7A 2GAUA 3BCAA 1JG9A 5F27A 3CXBA 3MWMA 3CCLI 4ZH4F 1WJCA 3IAS2 3I4NJ 2VKVA 1TTYA 1PP8F 4A3DJ 1V5FA 2A7OA 3TOBA 4NC7A 3OIQA 3A4CA 3CIAA 4EGYA 5BOXA 1B4AA 2XF5A 1S5LC 3JREA 3B2PA 2FE3A 2IGMA 3Q9SA 1W5SA 4D5FA 3H3VK 3HYIA 4A69C 1HQCA 1TWFJ 1TWCJ 2YPRA 3CCVI 1T95A 5GAEJ 1OYIA 2NVYJ 3I59A 3RQ4A 4QHPA 1MNDA 2RV8A 5IP7J 3VWBA 5HS7A 4RB2C 2VKHA 1SAXA 3LSPA 1RR8C 2MABA 4U7DA 3CESA 1T0FA 4CGZA 1WGXA 1JUSA 4LG3A 2ME6A 2L7FP 2KJBA 3E5QA 3N05A 2EBIA 2JSPA 1D1AA 3LSTA 4I7HA 4ZTJA 3RC3A 5FRMA 2Y69H 2M8EA 3WTSC 4IHTA 3BZKA 2A68F 4XM3A 4XICA 2QSHX 3Q44A 4HPQA 5D6EA 1I6HJ 3C2BA 3MZ8A 3W2VA 1IG7A 3HOTA 2HYJA 1JE8A 2EINH 5HOOA 5TISC 3IWFA 2J5OA 3K7AJ 2JK3A 1ZTRA 4LLGF 2RQPA 3EUHA 1H19A 1BR1A 1I3QJ 4XIDA 3WU1B 1T08B 2I10A 2K40A 3C2GA 2LDUA 3ROUA 4R8HA 3HRSA 1B6AA 3HJEA 2OZUA 1IZ1A 4GXOA 4EATA 2R92J 4D7NA 1R5HA 5DTDA 1YJNI 3JSOA 4A6DA 2AXTC 2NS7A 3L7WA 3LA2A 4E7LA 2F4MB 4LK0F 3VOEA 5DCFA 1MH4A 2DN0A 2PJRB 4EJOA 2BW3A 3MCZA 3NWSA 3CCYA 1WZ2A 2GTQA 2DW4A 4EEFG 5EYRA 1OISA 4ZDOA 3VYRB 5K7HA 3GTKJ 4ZYGA 2PQ8A 2B7EA 4OAZA 1XD7A 1H9GA 4CH7A 4A93J 3OYDA 1F4KA 1LPQA 3CP2A 2FXAA 3M3YJ 3DEEA 2E1CA 3LMMA 5ICFA 3QQAA 1USSA 4BHPA 3WHCA 4IO9F 2CMPA 1R7JA 3KP5A 3OIOA 5IT3A 1U2WA 1XSXA 4L9TA 3ZP5A 1Z9CA 1T2KA 1ZN2A 2WC2A 3FF5A 3H36A 4NB5A 3LL7A 4OINF 3RIRA 1DU0A 1BC7C 2NRAC 5E17F 4XN9A 4XLPF 5FB2A 3R0JA 4XLAA 1P6RA 3KP2A 2Y1EA 1LEAA 2DT6A 3R6SA 3DQVC 4ZQEA 1RZ4A 3IIEA 2FOWA 2EFOA 2ZJ2A 5J1YA 4DBQA 3BG6A 2QVOA 3S32A 4RS8A 2AQFA 2K02A 1IV6A 3G1LA 3S93A 1MW1A 1UB9A 5D4RA 3GYHX 3VYSB 1UAAA 4NDLA 1TT5B 4KDPA 2GZWA 2A6TA 2HPIA 2E36A 3FULA 4XNAA 2ICWG 3KYCB 3SFZA 4ETSA 1MGTA 2LBFA 2XAFA 1V55H 4ZDLA 4ESFA 3UERA 1U0JA 4HOBA 4DBRA 1ZRFA 1VQNI 4EM1A 3M8FA 1EH6A 3S2HJ 5C4JJ 4P5OA 5JLXA 4A3JJ 1MVYA 3EYYA 1J75A 2C82A 3S2DJ 9ANTA 1Q0HA 1SG7A 1XMAA 3RASA 2FMLA 1W1WE 1A04A 1IN7A 4HX7A 1SC5A 2LH9A 3CMEI 4M9ZA 3MMYB 1HBXG 2Z99A 1DUXC 4CCJA 4XLFA 1MMAA 1J09A 1Z6RA 2STWA 2E5NA 3Q0WA 1JJ8C 4LJZF 3K4LA 2X1EA 2MH9A 3CCQI 4UY8I 4K5PA 1UG2A 3PUFA 4G6TB 5JHUA 3FK6A 4I76A 5B5EC 4FASD 3QRFF 2J5PA 3FTZA 1HKSA 2EZIA 5CQGA 3BJOA 4AWXB 1IUYA 3T8RA 1JHHA 5JAZA 2FOKA 2DQ6A 4RGSA 2F5VA 2LC2A 4U87A 3TGNA 1H8AC 2ID3A 1HA8A 3ASOH 3QP6A 5DULA 4ZW8A 5HVQC 2BVMA 5IY5H 1XG1A 5DCMA 5J1RA 2QENA 1UJ8A 3OSGA 3ABKH 3HRTA 1E3HA 1J2XA 1IRGA 2XPUA 3M1EA 2HTSA 2Y30A 4IVNA 3X2QH 2UWMA 2R5ZA 1UELB 3GF2A 3F21A 2IT0A 5DUKA 3HSFA 2QQBA 3ZQLA 4I09A 1SD5A 3CJRB 3WG9A 3Q5FA 1MBGA 1ZGWA 2N8GA 3E97A 1OCTC 4ZQHA 2QUFA 2VXDA 2LK2A 1UHMA 1FPQA 1TW3A 1RKWA 3WGIA 4MKTA 5JNLA 4LLLA 1QVUA 3MZHA 1T1SA 2MYSA 4OMYA 1YLFA 1VNDA 2YX4A 4ZJZA 1JT6A 4A3GJ 4XKCA 5CVVA 5E3MA 4F91B 1SFOJ 1JI8A 4FLOA 3F8MA 4TV7A 3LQQA 4M72A 3DV8A 2DU9A 3CC4I 1FTTA 4FX0A 3FXQA 5IYDJ 3QAHA 4HQMA 2DFIA 4GDFA 1K78B 3D5LA 3KZIC 2VODA 3GTPJ 1EKEA 2OA4A 4MNUA 3S1QJ 3PJRA 2W4SA 2JA5J 3VFZA 1PUFB 3JRBA 2H27A 4GYIA 4XKWA 4XKVA 2XGEA 2O03A 3SXYA 4S04A 1ZLKA 3P9KA 4RA2A 5DM6F 2YX7A 1SVMA 3FM3A 5FO5A 1SEUA 3B73A 2FBKA 1MDMA 4C2TA 3D5RC 1XGOA 2OV7A 1OFCX 4LD5A 4HLXA 2CO5A 5EG0A 3GZ6A 2Y0MA 2DBBA 3M1CA 1B9MA 3NQOA 2EFNA 2NVTJ 3LA7A 3CUQB 1XPXA 4CHUA 3DU6A 4Y6SA 5EGOA 2M5WA 4PJJA 4UB6C 4A5MA 4A0XA 2CSOA 2KIUA 4JYKA 1AWCA 1WJAA 1ON2A 2D1VA 4U88A 4S05A 4FETA 1W36C 3CCSI 4RGRA 1R71A 4HF2A 2NVUB 2RKHA 1ETOA 2ESNA 3CDIA 1VQMI 1JKQC 2K9SA 4IQJA 2XAGA 1NTCA 2LREA 1R49A 4XMVA 1P92A 1JUMA 4KT5C 3BG5A 2DFEA 4S0HB 3ZQQA 2L7MP 4MTDA 1X1PA 1Z7UA 2Y31A 1T0FC 2X6XA 4NBQA 5B1AH 5JR3A 5KNLA 2R93J 2PN6A 4E7ZA 3CDLA 2OU2A 3CCRI 4RVBA 2DOFA 5H6QA 2QQ9A 3L2VA 1JXSA 2QYOA 3V7CA 1I1GA 2RN7A 2CQQA 2XPZA 3AG2H 2Y9YA 4P55A 3PIPF 5E3OA 4PZJA 3G1MA 2BY0A 1NG7A 4XRSA 2IS6A 2WWYA 1PP7U 4PU2A 5EDNA 1VQ8I 3T0YA 2IGNA 1Z0XA 3IWZA 1MJ9A 5K5OA 3I55I 4FQGA 1ETYA 1J5YA 2HVQA 3K70C 2FBHA 4FCYA 3I9V2 4ON0A 3ZQHA 4XMTA 4M6XA 4YIRX 4WXDA 1OCOH 2ISZA 2Z1DA 2K4BA 4BQNA 2L9VA 2LKXA 1K5HA 3WTYC 2KPMA 2AO9A 4JX6A 2FU4A 3K9TA 4J3BA 3O8HA 3Q0UA 3RYPA 3O3KA 1CQTA 4AVPA 4HF0A 3FHEA 1XB4A 4BDYA 1JKRC 1X1CA 2DA2A 2R7TA 4AIKA 2LYCA 1J7KA 2KIMA 3PNYA 1U9NA 3ULQB 2XB0X 2JT1A 2DLLA 2OC6A 1TNTA 4BE2A 1JKPC 3LAPA 2K7LA 1R22A 3HOUJ 4ZN6A 2OJED 1H0MA 3F6OA 1YYVA 4R7LA 3G4SI 4Q5SF 3KX2A 3UEQA 1R1UA 1LQ1A 2BYVE 4IHSA 4UVAA 4Y33A 3WTVC 2R70A 2PMZN 2DYSH 2JMWA 5FGMA 2RQQA 4DW6A 2CQKA 2HDDA 2M34A 4HX8A 4MQVA 3ZQGA 2JTVA 2R7VA 1LFBA 2M30A 4ANJA 4HLYA 3FUNA 2L3DA 3IH2A 2OQGA 3BTLA 2YS9A 1ZGAA 3FU5A 4AIDA 4YIFA 1SD7A 3G71I 5D5WB 3OS1A 4RGUA 3B3BA 1ETXA 3DEWA 3WTUC 4RAGA 3TW7A 3VPRA 4RMNA 5DS9A 3CCMI 2JPBA 4A2UA 5D8KB 3OYIA 4L18B 1HOMA 3LSMA 3RKXA 2CS3A 1B9NA 4NQWB 4BEHA 2GWRA 2XSDC 1POGA 2JRMA 1WPKA 4CYCB 5KAFC 2NYXA 1ZG5A 3LQRA 5EGOB 4B48A 3LSHA 1R4MB 3KLOA 2E1MC 2P81A 3K69A 4FE7A 2JCVA 5EEGA 2OTJI 2XVCA 1P4WA 2O0YA 3CO7C 4EJTA 3ZR8X 3HC7A 2LY2A 3DKYA 4MLOA 2P7CB 2XDVA 3MQ0A 4XNDA 1LVKA 1E17A 1A6QA 3AKZA 4XLNF 4M3DA 2JUCA 3K4MA 4HV6A 5H20A 4Y17A 4ZZLA 2O8KA 2BHZA 3W6JB 3HRUA 3RKQA 3A1YA 4JX4A 3W6KB 3RCOA 1MBKA 2ZB9A 2K86A 2FF4A 4IJAA 3TDZC 5CLSA 4Q4ZF 1ONPA 2HKOA 2L2OA 4L5IA 1U6GA 2BXYA 3FWEA 4V2GA 4XL9A 1XSDA 1YOVB 3OV8A 3J7YJ 3J7AO 1FBUA 3KYDB 2B63J 3WTTC 4C2MJ 1USTA 1KGSA 2M1BA 3ABTA 3FBNB 3OYKA 4M73A 3SDGA 5B1BH 3KYLA 1MW2A 1X2NA 2W82A 4BQQA 1R36A 2R5YB 3PUBA 5E79C 4XN1A 3F9KA 4RCVA 3MFKA 4BXUA 4P9FA 5ICGA 3L2QA 1IUFA 4CCLA 5D5VB 4FE4A 3FUKA 2EQRA 2X48A 2HFHA 2CH0A 2LOOA 2JA7J 4F92B 3ZI0A 1FMVA 4OIQF 1KZHA 3BTJA 3KPHA 3TEDA 1ITYA 1DGRM 3PO3J 1OCPA 2KIQA 3AUAA 3AU9A 1ZS2A 5FLVA 3KEDA 4C2UA 1HKTA 4BQOA 1ZR4A 3CZEA 3HW2A 4RAZA 4UV9A 4E70A 4F93B 4GAEA 3RPUA 4AUXA 3VSLA 3CZKA 4DYRA 2IS2A 1X3ZB 2ID6A 2VOPA 1XSVA 1G2HA 1Z77A 4IRHA 1B1BA 2BE5F 3BC8A 2IPQX 1QNTA 3ZHZA 1G3TA 1YX5A 4CYDA 4RSYA 1IXRC 4Q48A 1KQ8A 1TW2A 2VKEA 1T38A 4GGGA 3EYIA 3OYLA 3ZQ7A 1QA6A 4BGDA 3FKIJ 5GTHC 1N25A 3OR2C 2R7OA 2M4GA 4PFOA 3GFLA 5CVJA 3B37A 4XMUA 2EFWA 3KP7A 4OIPF 3F23A 2PMHA 3RQIA 2ZJPF 1ONNA 4L9NA 3S14J 4L5JA 2XIGA 5L3BA 4LLNA 5BPPA 3KFWX 3LWFA 4IEJA 2W1OA 3IH4A 4CCOA 3EBIA 5D4SA 4KA4A 2VXZA 4XO5A 3QPTA 2IAIA 2X51A 2ZJQF 1APLC 2DOAA 4D5CA 4FTHA 4DYCA 3PFIA 1XMXA 3M07A 2PJRA 5F1RA 4CICA 2NNYA 2P7VB 4HA8A 4OAYA 1N78A 2VN2A 5J4VA 4LGWA 2JD1A 1WWXA 2E2HJ 2HQAA 2WADA 3QPLA 3JRGA 3TQNA 2F2EA 3M8JA 3ABMH 1FIPA 4HAMA 5DD4A 5GP9A 4I2OA 3ZQIA 2VBWA 4HNUA 1BIBA 3S8PA 4Y52J 2TDXA 4M9XA 2NS8A 1DP3A 2NVXJ 3BPVA 1S72I 4LUPA 4WXHA 1Y56A 4RM3A 5LHHA 4XRSG 2BY2A 1JVSA 4IX7A 2BXZA 2ZFWA 4ENMA 3A0HC 1D5YA 3OYFA 3GTMJ 1P9QC 1RUOA 4QIWN 4XRFA 1FJLA 3CUOA 5HLIA 2A6HF 4F52A 1UMQA 4HNTA 3HSEA 4ZC3A 3CMMA 1BW5A 2L5QA 2HYFA 3ZHYA 2PMZA 3UNGC 3BZCA 2IVMA 1LDKB 2ZXIA 2UZKA 4A3CJ 1NK3P 2CYYA 5LRSA 4KNYA 2XHKA 1S29A 3DP7A 2I5UA 4RAFA 4G94A 2R72A 3FMRA 4LOCA 4OU0A 3ZXSA 1GVDA 2CQXA 4YFXF 1VF9A 2FNPA 3L00A 4DIQA 3DWLE 3GUDA 4QPOA 5F08A 1DDNA 4KFCA 1SVLA 3DBLB 2PGGA 3FBIB 2GOXB 3H92A 1TQPA 2RAEA 4UNOA 4C30A 4K5MA 3MKLA 3J7ZI 4PJ0C 2O9LA 2MBFA 3IKVA 1BI3A 1SFEA 5TGTA 1R58A 2GOMA 3B02A 1N75A 4P9UA 3VDXA 2W85A 4XLHA 2JWTA 2A05A 5FKKA 4LMYA 2PG4A 2VASA 3FHZA 4A3KJ 4G7ZF 1TBXA 3HM5A 1MKMA 3LSKA 4BACA 3WQQA 2WAEA 4K5OA 1U8BA 2H1LA 3J81Z 2KMUA 1LUJB 3LFUA 3TP0A 1BJZA 2K9MA 2YR2A 4BUPA 1TLHB 2TRTA 5GPCA 1HSTA 2PI0A 2WAQN 3SZPA 1LFUP 2H94A 1SAUA 4XLEA 1ENHA 2R7QA 1E3OC 1RP3A 2R59A 3U1KA 2MC4A 2VE9A 1Z3YA 2HTJA 4MGRA 3OMYA 4XMXA 2EIKH 4N9HA 3KP3A 4RB0A 4ZQTA 1BI1A 2H09A 3BTCA 5FKLA 2JA6J 5DYFA 3ABLH 1D3YA 5K7FA 4X1EA 3CZGA 3L09A 1IRFA 1JHFA 1W5CC 2JVHA 2W7NA 3RZOJ 3FU3A 3FUFA 1YRNB 2TCTA 3BR2A 1X3WB 5HLGA 4EGZA 1XDUA 3K4JA 2OF7A 2WZFA 4A3BJ 1R0LA 2COMA 4MIMA 2V79A 2O7GA 3C3WA 5J1UA 2O6GE 3OWTA 4NC8A 1ZQ3P 4XOTA 2XAJA 1F1ZA 2V1DA 2WA0A 4IOCF 3EUKL 3EETA 1MSFC 3J80Z 1VFCA 2ZXJA 5EV7A 2YUSA 2K27A 3MN2A 4I0BA 3RI4A 4M6YA 4AC0A 1HKQA 3W2WA 4Y13A 5K7ZA 1YE9A 4ZQGA 1R00A 4L0ZB 1F43A 3TBIA 1ACIA 3I4PA 5LD2C 1Z05A 1W7PD 2V6EA 1U5TB 2ZCWA 1YQAA 3HDDA 1YITI 1RETA 2LP0A 3FMSA 3FTVA 1ETQA 2XAHA 5LBQA 3GBGA 4DQ2A 1FC3A 3GZ5A 4JX5A 1K78A 4IPAA 1EJ9A 2QQAA 4A3MJ 1S7OA 3U21A 1FYLA 1SD4A 3KZYA 3JSZA 1GLNA 1FP2A 2XV4S 1PUFA 1FOKA 3A0BC 3M9AA 5FFXA 1ON1A 2KL4A 3VYTB 4ZYEA 2HPTA 1IN4A 2DA6A 5A2QZ 3ZN0A 2OBPA 1WH5A 2L9NA 3H3UA 3H9JA 5LHIA 1BM9A 1DGWY 2HOAA 1JKOC 1IW7F 2JRTA 2HZTA 4XONA 1K7AA 3TKYA 3SFIA 2Z5UA 3FXOA 5J8CA 4MTEA 3TO6A 5B3SH 4CDGA 4XN4A 5FWQA 4B4CA 2JA2A 2O7OA 2HQRA 3R61A 4A3IJ 3CUQA 2L02A 4BAYA 3N97A 3FDYA 3K4CA 3HKZN 3W3CA 3I64A 2XROA 3FUEA 3LFKA 2HI3A 1IGNA 1ZELA 2NXNB 2EV6A 5FKOA 5CKTA 3ZQFA 3K2AA 3AG4H 5EF6A 2WAFA 3BJAA 5LRRA 4EQQA 2WV0A 3FUJA 4IHYA 1QU3A 4ZYAA 2X6YA 1E3PA 4BHCA 4C9YA 3CCUI 1QHGA 2A5YB 5F64A 1FX7A 2A61A 1A6IA 1MBFA 4B3XA 4HRIA 2FSWA 2XRNA 3HGGA 1I1SA 2LY9A 1XCVA 4G9YA 2DA4A 4CSWA 2EA4A 3HTUA 4KIGA 3FH8A 2DYRH 4GRIA 2IA2A 4XMWA 2YU9J 1MD0A 3ESWB 5BQTA 2JCYA 4NNJA 2OCEA 5E8GA 5HS8A 1CGPA 1P2FA 3OYMA 1Z1DA 4FISA 2FBIA 4GO1A 4FX4A 1ETVA 2G7HA 2GXAA 1BIAA 5D6FA 4MHGA 5DEQA 1L3LA 4Q4EA 1YG2A 5BNGA 5EZHA 3P5JA 4NC6A 2IJLA 1ODDA 3PL8A 4W97A 1MJBA 2XF7A 1UHWA 1XMKA 1GV2A 4N9IA 1X1AA 1VI0A 2XPWA 4BE1A 1Z3XA 2M0CA 2Z33A 2DXIA 2E71A 2NAZA 2GXGA 4P1WA 5FLXZ 4M9SA 2HOTA 1KONA 2Y48A 3L9FA 3J81K 1S7EA 3REOA 4EVIA 1FEXA 4LB6B 5M5WJ 4LITA 4ENJA 1YO5C 2A6EF 3PSIA 3M8EA 2VQHA 4ZTFA 3B7SA 3HOZJ 1HLVA 4OOFA 4C3IJ 4YFNF 5DM7F 4I02A 3PIOF 4RLFA 1NG6A 2P6SA 5JHFA 1RNLA 5LFAA 2XAUA 1TQIA 3TO9A 4I99C 3ZMVA 3B34A 4R5XA 2OD5A 3WGGA 2ECBA 3CF5F 1FP1D 5CJ9A 3G6EI 4KIBA 1WCMJ 4IOAF 1JGSA 2HZDA 3DPUA 3QODA 1SD6A 2VBZA 1ZAOA 5ED4A 4EJUA 1I50J 3PUUA 2QSGX 3S3MA 2ZXGA 3C2HA 5CVUA 1IXCA 2VPRA 2R7RA 4A3FJ 1IJWC 2Q1ZB 3DU5A 2P5LC 5M3FJ 2JA8J 2H8WA 1ONVA 3BY6A 1XTAA 3H0DA 4U0WA 1O4XA 4XO3A 2QVWA 2P6TA 2DDAA 3R60A 2JD2A 2DMPA 4YRVA 4R5TA 3FTUA 1R9TJ 3PO2J 2ELKA 1H9TA 2L4AA 4AYSA 3K6GA 4JBAA 3E6CC 3WQSB 1XDSA 1H89C 4KP7A 4ZQFA 1FWZA 1PYVA 3QU3A 2W24A 3L1PA 1OCRH 3ZCOA 2WAQA 3LAJA 1QHHD 5BPIA 4CXFA 3IKTA 5GAHJ 5F0FA 3ANMA 2KIFA 4NQWA 2HEOA 3RSNA 3BQYA 1KA8A 1I6XA 4ESBA 2QGUA 1BBYA 2KP6A 2R0QC 4CYCA 3H9QA 2KDOA 3I54A 3VB2A 4C3HJ 1B59A 1FSEA 5BMZA 3OYAA 3FUIA 4PW4A 1AHDP 2DTZA 2ZMEB 3ONQA 3CJTB 4PSWA 4AICA 2D2WA 4A0YA 1MMDA 3P9IA 3DPLC 3E5XA 3WG7H 2DPDA 2VJ8A 5DYMA 3E5UA 4CUGA 4G6DA 4HG2A 5LGUA 3FTYA 4QPEA 3FMQA 1GV5A 1YX3A 1Q0LA 4HNVA 2V6CA 1TC3C 3S3NA 1BL0A 3B7UX 3MVPA 1VQKI 3NARA 4PGHA 5A2QK 1IN5A 3H5AA 1FSHA 1HC8A 3WU0A 3HOSA 3ELKA 1S9HA 3DKXA 4XQFA 2RJIA 4ESJA 1TZLA 4UB8C 3F8CA 3ZMTA 1W0UA 3FTWA 1W36D 5L3GA 3GFJA 2Z9OA 3FU0A 2DQLA 2LKSA 1HW5A 4R79A 2K9NA 4AR9A 4M74A 4MO7A 1JGGA 1F5TA 2BZTA 2V1XA 4BBRJ 1FY7A 2AS5F 2VE8A 5JBIA 2HS5A 3AG3H 3S3OA 3C1DA 2XAQA 2AXLA 3OIPA 3SYTA 3V8JA 1JUPA 1WFXA 2EZLA 4BYYA 1HF0A 1LDDA 3HPGA 1U3EM 3NRVA 2QKLB 1RRJA 3S15J 1ETKA 1TL8A 3KIOA 5IP9J 1AKHB 1STZA 1BW6A 3PQKA 2R5YA 3BOQA 3BT9A 1R6RA 5LEKA 3K1NA 2CUEA 1QRYA 2COBA 5JVGF 3H1CA 1O3SA 1OCZH 3FUDA 4PCQA 2WV1A 3E6BA 2NOGA 1WHUA 3GEZA 1MZBA 1YS6A 2L9RA 2O61A 2H1KA 4UUSB 1Y6IA 4ENKA 5DLLA 1OQYA 4L9JA 5H2FC 4G7HF 2BHYA 3GVAA 2OCCH 3G2BA 3ZMZA 4E7HA 2JPCA 4L2LA 5JO0A 3HKZA 4MQ9F 1S46A 4LB5A 5L3DA 1W4MA 2HXIA 1IRXA 3I5UA 4D7MA 3HXLA 4CCMA 4M3FA 3F3XA 3V7RA 2JQ7A 3AL0B 3QWLA 2PL5A 2LLKA 4AM3A 1LEBA 1HXDA 3B6CA 3BZ6A 5E1XA 3E0JB 3OYCA 3BCBA 1X3ZA 4CZCA 1WRJA 5FLXK
chains in the Genus database with same CATH topology
3KETA 1YS7A 3E6MA 3G3ZA 4WWCA 2YU3A 3IRRA 2Y1GA 3VVMA 3BJ6A 4ZW3A 4Y15A 3DKWA 1KQ0A 3WE2A 4U0YA 4M71A 1ZREA 4MEYF 2OAZA 3F22A 1ZRCA 1D8JA 1U8RA 3K2ZA 4XN8A 2XASA 2ZNZA 3FX3A 1DPUA 2Z3YA 2PUSA 2MH2A 2WPGA 3KP6A 4UVBA 1S6LA 3CUQC 6PAXA 3V7SA 5J8FA 2Q8KA 2P5KA 3F8BA 1XCBA 1G5AA 2HKXA 1MW0A 2VT2A 3I58A 3HIFA 2P5VA 2ADUA 3JSPA 3SQNA 3K1MA 1S7AA 2HGCA 4QUOA 1R23A 3U2RA 3FUMA 3R0IA 1OKRA 2H6BA 3BWGA 4IRGA 5JMPA 3F6VA 4A6EA 1QZZA 5D8LB 4IRIA 2EK5A 3KCCA 2GIVA 4XNBA 5ICCA 4Q4IA 2HPOA 5JFRA 3RKWA 1SFXA 1G6NA 5E1ZB 2MAPA 4BH9A 3GW2A 3A06A 3RKYA 5K5RA 1T98A 4JQFA 5D5XB 1T39A 3COAC 1PUEE 4EMSA 1ZARA 1CF7A 3FU6A 2A69F 5K5QA 2A07F 4BKXA 2M87A 2LSOA 2IRFG 3M7GA 3FM5A 1OPCA 1T1RA 2XKOA 3ECHA 1P4XA 4XBFA 2DI3A 2MAOA 4KICA 5TRDA 3AU8A 3Q9VA 5HNFA 1K6OA 1G3WA 2Q0OA 1J59A 5DD8A 4XMZA 2E7XA 2G7UA 3CHOA 2FA5A 2LF7A 4N0BA 4H0EA 2EV5A 1ZRDA 4G6QA 5JVTA 3EDPA 3T5XA 5AIQA 2XGXA 2ISYA 4PGGA 5KVRA 2DQMA 2EB7A 1SMYF 4Y6PA 1I5ZA 2M45A 2EV0A 4YG2F 4CZZA 3ECOA 4GYGA 3K0LA 3P7NA 1HS6A 4U7BA 4L0YB 1LNWA 1ZYRF 4YIIA 4GCVA 1X3WA 2E1NA 1ONOA 3QP5A 1IF1A 1WKMA 4KUMA 5DDGA 3HHGA 4ENNA 2LF8A 3JTHA 3QU6A 1ZH5A 1F9NA 1W7PB 2JD0A 4HDUA 3I0TA 2IP2A 2VLAA 3ZMUA 5HLTA 3IC7A 1IN8A 1QPMA 1FZPB 4AR1A 5E1WA 2NS0A 1U5TA 2W84A 2EJRA 4IXAA 2ACJA 2JCXA 4L9VA 4LK1F 4FLRA 2RNJA 2DO7A 3ABUA 4AR8A 3FTSA 2DK8A 1SFUA 4ZYHA 1ZG1A 2QJ1A 3KLNA 4MEXF 5F6FA 1V4RA 1YTYA 4DNCA 2ZBKA 3GFMA 5E18F 4QMEA 4BHBA 3V4GA 1CF7B 2EGHA 1TNSA 2UXNA 1WI9A 4QLCU 2QM3A 3KEQA 3GO5A 3CLOA 1TQMA 2ESHA 1RUNA 5FD6A 4ZW7A 5CVIA 3MZYA 3S2WA 4HQEA 3MAJA 4A12A 3B7RL 1ZG3A 4LG0B 3RJPA 2BEOA 1UCRA 3EBHA 4XO4A 4WX9A 4OOIA 1YFHA 3TOAA 4ZX5A 4FLQA 1AOYA 4FCAA 4Z2YA 2FMYA 2VC1A 3FXRA 5DUIA 1JGIA 4OIRF 5HNHA 2R7DA 3VEPA 2FQ3A 2BV6A 4EJWA 5HLHA 1RIOH 3IL2A 3F8NA 2CW0F 3EBGA 2BGCA 3T1BA 3ML6A 5ERIA 3BPXA 4EV0A 4HW0A 4GAAA 3FZVA 1YW7A 4NHJA 1WQ2A 4HZFA 2KJCA 2PBIA 5L3FA 4G8XA 3ZN1A 5L3EA 2ELHA 2EWNA 1Q1HA 3G73A 2WTEA 2QBYB 1GHCA 4IF4A 1S8NA 3HSRA 2NNNA 2CFXA 1KU2A 3GWZA 2K4JA 5H6RA 3DFGA 3ZMDA 4Y67A 3I53A 1QQIA 3F8FA 2Y1FA 5FD5A 3CTAA 1DP7P 5AIPA 2MA3A 3GX4X 4HF1A 2OQRA 1J9IA 2VOOA 3CJNA 2Y75A 2B61A 2MLGA 4KMUX 4UHTA 4U0VA 2DAOA 1BOAA 2ZMEA 5D5UB 4KMFA 4WCGA 4KN4X 1YW8A 3WTWC 1G3SA 2B0LA 5IT9Z 1QO0D 1KU7A 4OIOF 2G9WA 2EA2A 1FBSA 3QJXA 4I98B 1O3TA 4OOEA 2C6YA 5ICEA 3RC8A 1BI2A 2D45A 4FT8A 1XGNA 3F72A 3I59B 3SHFA 2BBYA 2JZYA 3GXOA 2GA2A 3BROA 4XN5A 2DPUA 3ISPA 3FH5A 2FEZA 3QPHA 1EH7A 4DPRA 3NEUA 3C7JA 3WQRA 4HBLA 1FYMA 4P96A 1HW1A 3I71A 2WZGA 1FLIA 1J0RA 2PMUA 1QZYA 1SQMA 4WK8F 4HDVA 5AONA 3HHHA 2FRHA 2MD5A 2IA1A 4K5NA 2A3SA 1BN5A 2RGVA 3U9GA 1Y0UA 3FTXA 2E7WA 1RI7A 5BS6A 4D0PA 3IHUA 3GLXA 3ERED 1U78A 1OYWA 2PJPA 4MS6A 1O7LA 3P9CA 1U5TC 1OR7A 2R3SA 4ZW6A 4O3MA 1YW9A 1XGMA 2VBYA 3N4MA 3HUGA 1ULYA 4BNCA 3J80K 2CG4A 1VTNC 1BJAA 4UXNA 3RPQA 4AIJA 3SZTA 4ZX4A 3QOPA 4K2EA 3CZLA 4EM2A 2L54A 2P8TA 3ANNA 2YSRA 3GFIA 5KK1A 3JTGA 4FLSA 1ZHFA 4XSZF 3T8VA 4CO8A 1FNNA 3DF8A 4HX4A 3WTZA 1LB2A 1GW6A 5LGNA 3KE2A 3WTXC 2L4MA 3BP8A 4HV5A 4AD9A 4ZZDA 2F5CA 4ARFA 3WODF 5FFZA 3V8KA 2ZO4A 2GQQA 5BPDA 2XKPA 5E20A 4KYWA 5HDKA 3L2CA 4LFUA 5HDGA 3KEOA 1S3JA 4RGXA 5CVRA 4AIHA 1Q0QA 2L01A 4XN7A 5HS9A 5LEJA 4UUVA 3D0SA 5IT9K 1LJ9A 4RAYA 5LGTA 4XN2A 2VBXA 2X0LA 3ANLA 1GXPA 5ILSA 1D8KA 3U1DA 1KQ9A 3VODA 1P4AA 2QWWA 1EH8A 4ZX6A 1GVJA 5DCMB 1O3RA 2HR3A 1O57A 4KN7X 1ZGJA 3V8LA 3TO7A 2RDPA 5JMWA 4A0ZA 1KU3A 1R1VA 4EJVA 2EFQA 2VC0A 2V9VA 4O5VA 1DPRA 3K1PA 5ILVA 5CYVA 4A5NA 1D5VA 1I27A 2LKPA 4ZX3A 4OMZA 2DT5A 3CHSA 4BQAA 4KIFA 5J6XA 1QBJA 1UFMA 4HYEA 4G7OF 2RVCA 3JAMZ 2OZ6A 3R0AA 3ZPLA 4B09A 2STTA 2KKOA 3BDDA 1KYWA 2D1HA 2Q2EA 1C0WA 2IW5A 2UXXA 2ZNYA 1OYYA 3HTSB 2VONA 3RDIA 1MDMB 5ILUA 3R4KA 2HOEA 1MW3A 1R5GA 5L3CA 1LDJA 3C18A 1W7PA 4ZYDA 4QIRA 2CWEA 2CGPA 4FHTA 5JC1A 5E8IA 5K1YA 1NHAA 3TDUC 1KYZA 3LA3A 1SMTA 3CHPA 2H6CA 1IXSB 4F7ZA 4R1HA 2GA1A 3T8TA 1FYKA 1Z91A 2F5FA 5AENA 4R5VA 3KZZA 3OOPA 2Y1CA 4JK1X 3WE3A 3CHRA 4WF2A 1XGSA 1IAWA 4I01A 3AAFA 2VT3A 2MLKA 2Y1DA 2RC4A 1E2XA 3CDHA 2O3FA 3PQJA 2ETHA 2P4WA 1X3UA 2LNBA 4B8XA 1ZLJA 3CHQA 3B7TA 2XUBA 2PFBA 2W25A 2EFPA 2IA0A 2O8XA 2FFLA 4O6JA 2PLYA 1HW2A 4RB1A 1OMIA 1REPC 1T6SA 3ZHXA 3UCQA 2XPYA 4I0AA 4UV8A 1V3FA 1YIOA 2HDCA 3RTRA 4LG0A 3EQLF 4X2UA 5EEHA 5HDNA 4PVBA 1H3LA 3RYRA 3B2XA 3U9WA 1WSUA 1LVAA 2HQNA 2KRFA 2GXBA 3JT1A 1FT9A 2F5EA 3DPTA 1O3QA 3HRMA 3O2PE 4RB3C 3O6BB 1G3YA 3KP4A 1Z6TA 1PDNC 1BI0A 5TJJA 1XN7A 3FUHA 3H3ZA 3E3VA 4EM0B 3A14A 5LLQA 4A03A 2DTRA 3FH7A 4Q47A 2MC3A 4XSXF 3CO6C 2QLZA 1W5TA 2C5ZA 2HWVA 1QGPA 3WGHA 2X4HA 2XQ0A 1O7FA 4ZW5A 1R1TA 3JAMK 1IN6A 4K5LA 1G4DA 3DEUA 3JW4A 1R0KA 2QBYA 3MEXA 4UVCA 1EV7A 3E6DA 2QZ8A 2FNAA 1K79A 4WXCA 2HYGD 4PDKA 1FBQA 1MJAA 1GXQA 2W57A 3IRQA 2R7FA 5JI6A 2V1UA 2F5DA 2PEXA 3Q43A 1HSJA 2DQRA 2JSCA 4QWQA 2DK5A 4Y6RA 3DXJF 1KU9A 3ZMSA 2ZKZA 4ASNA 4JNDA 5LHGA 1L0OC 1BC8C 4YFKF 3FXUA 5DV5A 2JV7A 2GAUA 1JG9A 3MWMA 4ZH4F 1PP8F 1TTYA 2A7OA 3TOBA 3CIAA 4EGYA 5BOXA 1B4AA 3B2PA 2FE3A 3Q9SA 1W5SA 3HYIA 1HQCA 2YPRA 1OYIA 3I59A 4QHPA 2RV8A 5HS7A 4RB2C 1SAXA 4U7DA 1T0FA 4CGZA 2KJBA 3E5QA 3LSTA 4I7HA 3RC3A 2M8EA 3WTSC 4IHTA 2A68F 3Q44A 5D6EA 3HOTA 1JE8A 5HOOA 3IWFA 2J5OA 4LLGF 2RQPA 3EUHA 1H19A 3WU1B 2LDUA 3ROUA 4R8HA 3HRSA 1B6AA 2OZUA 1IZ1A 4GXOA 1R5HA 3JSOA 4A6DA 3L7WA 3LA2A 3VOEA 4LK0F 5DCFA 4EJOA 3MCZA 2GTQA 2DW4A 4ZYGA 2PQ8A 1XD7A 1H9GA 1F4KA 2FXAA 2E1CA 5ICFA 1USSA 4BHPA 1R7JA 3KP5A 5IT3A 1Z9CA 1U2WA 1XSXA 4L9TA 3ZP5A 1T2KA 1ZN2A 2WC2A 3FF5A 4NB5A 4OINF 3RIRA 5E17F 1BC7C 2NRAC 4XN9A 4XLPF 5FB2A 3R0JA 1P6RA 3KP2A 2Y1EA 1LEAA 4ZQEA 3R6SA 3DQVC 1RZ4A 3IIEA 2EFOA 2ZJ2A 2QVOA 4RS8A 2K02A 1MW1A 1UB9A 5D4RA 3GYHX 4KDPA 2GZWA 3FULA 4XNAA 3SFZA 4ETSA 1MGTA 2XAFA 4ESFA 3UERA 4HOBA 1ZRFA 4EM1A 3M8FA 1EH6A 4P5OA 1MVYA 3EYYA 1J75A 2C82A 1Q0HA 1SG7A 1XMAA 3RASA 2FMLA 1A04A 1IN7A 4HX7A 1SC5A 4M9ZA 1HBXG 2Z99A 1DUXC 1Z6RA 2STWA 4LJZF 2MH9A 4K5PA 5JHUA 3QRFF 2J5PA 3FTZA 1HKSA 3BJOA 4AWXB 1IUYA 3T8RA 1JHHA 5JAZA 2FOKA 2DQ6A 4RGSA 3TGNA 3QP6A 5DULA 4ZW8A 5HVQC 5DCMA 2QENA 3HRTA 1IRGA 1J2XA 3M1EA 2HTSA 4IVNA 2UWMA 3GF2A 3F21A 2IT0A 5DUKA 3HSFA 2QQBA 4I09A 1SD5A 3WG9A 3Q5FA 3E97A 4ZQHA 2QUFA 1UHMA 1FPQA 1TW3A 3WGIA 4MKTA 5JNLA 4LLLA 3MZHA 1T1SA 4OMYA 1YLFA 2YX4A 5CVVA 4FLOA 3F8MA 4TV7A 3LQQA 4M72A 3DV8A 2DU9A 4FX0A 3FXQA 3QAHA 4HQMA 2DFIA 1K78B 3D5LA 2VODA 2OA4A 4MNUA 3VFZA 2H27A 4GYIA 3SXYA 4S04A 2O03A 1ZLKA 3P9KA 2YX7A 3FM3A 5FO5A 3B73A 2FBKA 1MDMA 1XGOA 4LD5A 4HLXA 2CO5A 3GZ6A 2Y0MA 2DBBA 1B9MA 3NQOA 2EFNA 3LA7A 3CUQB 4CHUA 4Y6SA 2M5WA 4A5MA 4A0XA 2CSOA 2KIUA 1AWCA 1ON2A 2D1VA 4U88A 4S05A 4RGRA 4HF2A 2RKHA 2ESNA 2XAGA 4XMVA 1P92A 4KT5C 4MTDA 1Z7UA 5JR3A 2PN6A 2OU2A 4RVBA 5H6QA 2QQ9A 1JXSA 2QYOA 3V7CA 1I1GA 2RN7A 2XPZA 4P55A 4PZJA 2WWYA 1PP7U 4PU2A 3T0YA 3IWZA 1MJ9A 5K5OA 1J5YA 2FBHA 4ON0A 4XMTA 4M6XA 4WXDA 2ISZA 2K4BA 1K5HA 3WTYC 2FU4A 3K9TA 4J3BA 3RYPA 3O3KA 4AVPA 4HF0A 3FHEA 1XB4A 4AIKA 1J7KA 2KIMA 3ULQB 2JT1A 2DLLA 1TNTA 3LAPA 2K7LA 1R22A 4ZN6A 1H0MA 3F6OA 1YYVA 4R7LA 4Q5SF 3UEQA 1R1UA 1LQ1A 2BYVE 4IHSA 4UVAA 3WTVC 2R70A 5FGMA 2CQKA 4HX8A 4MQVA 2JTVA 2M30A 4HLYA 3FUNA 2L3DA 2OQGA 3FU5A 1ZGAA 4YIFA 1SD7A 5D5WB 4RGUA 3B3BA 3WTUC 2JPBA 4A2UA 5D8KB 4L18B 3RKXA 1B9NA 2GWRA 2NYXA 1ZG5A 3LQRA 3KLOA 3K69A 2JCVA 5EEGA 2XVCA 1P4WA 2O0YA 3CO7C 4EJTA 2P7CB 3MQ0A 4XNDA 1E17A 4XLNF 4HV6A 5H20A 4Y17A 4ZZLA 3W6JB 3HRUA 3W6KB 2K86A 2FF4A 4IJAA 3TDZC 5CLSA 4Q4ZF 1ONPA 2HKOA 4L5IA 1U6GA 3FWEA 1XSDA 3OV8A 3J7AO 1FBUA 3WTTC 1USTA 1KGSA 2M1BA 3ABTA 4M73A 1MW2A 1R36A 4XN1A 4RCVA 3MFKA 4BXUA 4P9FA 5ICGA 5D5VB 3FUKA 2HFHA 3ZI0A 4OIQF 3AUAA 3AU9A 1ZS2A 3KEDA 1HKTA 3CZEA 4RAZA 4UV9A 4E70A 4GAEA 3RPUA 3CZKA 2VOPA 1XSVA 4IRHA 1B1BA 2BE5F 2IPQX 1QNTA 3ZHZA 1G3TA 4CYDA 4RSYA 1IXRC 4Q48A 1KQ8A 1TW2A 1T38A 4GGGA 3EYIA 3ZQ7A 5CVJA 3GFLA 3B37A 4XMUA 2EFWA 3KP7A 4OIPF 3F23A 2PMHA 1ONNA 4L9NA 4L5JA 2XIGA 5L3BA 4LLNA 5BPPA 3KFWX 3LWFA 3EBIA 5D4SA 4KA4A 2VXZA 4XO5A 3QPTA 3PFIA 5F1RA 4CICA 2NNYA 2P7VB 4HA8A 2VN2A 4LGWA 2JD1A 1WWXA 3TQNA 2F2EA 4HAMA 5DD4A 4I2OA 2VBWA 1BIBA 2TDXA 4M9XA 3BPVA 4LUPA 4WXHA 5LHHA 1JVSA 2ZFWA 4ENMA 1RUOA 4XRFA 3CUOA 5HLIA 2A6HF 3HSEA 2HYFA 2IVMA 1LDKB 2UZKA 2CYYA 5LRSA 4KNYA 2XHKA 1S29A 3DP7A 4G94A 2R72A 3FMRA 4OU0A 4YFXF 2FNPA 3L00A 3GUDA 1DDNA 4KFCA 2PGGA 3H92A 1TQPA 4UNOA 4K5MA 2MBFA 3IKVA 1BI3A 1SFEA 1R58A 3B02A 4P9UA 2W85A 4LMYA 2PG4A 3FHZA 4G7ZF 1TBXA 1MKMA 3WQQA 4K5OA 3J81Z 2YR2A 1TLHB 1HSTA 2PI0A 3SZPA 2H94A 2R59A 1RP3A 2VE9A 2HTJA 4MGRA 4XMXA 4N9HA 3KP3A 4RB0A 4ZQTA 1BI1A 2H09A 5DYFA 1D3YA 3CZGA 3L09A 1IRFA 1JHFA 3FU3A 3FUFA 5HLGA 4EGZA 1XDUA 2WZFA 1R0LA 2COMA 2V79A 2O7GA 3C3WA 2O6GE 2XAJA 1F1ZA 2V1DA 3EETA 3J80Z 2ZXJA 5EV7A 2K27A 4I0BA 3RI4A 4M6YA 1HKQA 4Y13A 4ZQGA 1R00A 4L0ZB 3I4PA 1Z05A 1W7PD 1U5TB 2ZCWA 1YQAA 3FMSA 3FTVA 2XAHA 5LBQA 4DQ2A 1FC3A 3GZ5A 1K78A 4IPAA 2QQAA 1S7OA 1FYLA 1SD4A 3KZYA 3JSZA 1FP2A 2XV4S 1FOKA 5FFXA 3M9AA 1ON1A 4ZYEA 2HPTA 1IN4A 5A2QZ 3ZN0A 2OBPA 3H3UA 5LHIA 1BM9A 1IW7F 2JRTA 2HZTA 1K7AA 3TKYA 2Z5UA 5J8CA 4MTEA 3TO6A 4CDGA 4XN4A 5FWQA 2HQRA 3R61A 3CUQA 2L02A 4BAYA 3N97A 3I64A 2XROA 3FUEA 3LFKA 2EV6A 3BJAA 5LRRA 4EQQA 2WV0A 3FUJA 4BHCA 5F64A 2A5YB 1FX7A 2A61A 2FSWA 2XRNA 1I1SA 1XCVA 4G9YA 2EA4A 3HTUA 4KIGA 3FH8A 2IA2A 4XMWA 1MD0A 5BQTA 2JCYA 5E8GA 5HS8A 1CGPA 1P2FA 1Z1DA 2FBIA 4GO1A 4FX4A 2G7HA 1BIAA 5D6FA 4MHGA 5DEQA 1L3LA 4Q4EA 1YG2A 2IJLA 1ODDA 1MJBA 1UHWA 1XMKA 4N9IA 2Z33A 2NAZA 2GXGA 5FLXZ 4M9SA 3J81K 2Y48A 3L9FA 3REOA 4EVIA 4LB6B 4ENJA 1YO5C 2A6EF 3M8EA 3B7SA 4OOFA 4YFNF 4I02A 2P6SA 1RNLA 1TQIA 3TO9A 3ZMVA 3B34A 4R5XA 2OD5A 3WGGA 1FP1D 5CJ9A 4KIBA 1JGSA 1SD6A 2VBZA 1ZAOA 5ED4A 4EJUA 3PUUA 2ZXGA 5CVUA 1IXCA 2P5LC 1ONVA 3BY6A 4XO3A 4U0WA 2QVWA 2P6TA 3R60A 2JD2A 4R5TA 3FTUA 1H9TA 2L4AA 4AYSA 4JBAA 3E6CC 3WQSB 1XDSA 4KP7A 4ZQFA 1FWZA 3QU3A 2W24A 3LAJA 5BPIA 4CXFA 3IKTA 3ANMA 2KIFA 4NQWA 2HEOA 1KA8A 1I6XA 4ESBA 1BBYA