5HNFA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 108
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnfA02
5HNHA 2VLAA 5HNFA 5HLTA
chains in the Genus database with same CATH superfamily
2L01A 2ISYA 4XN7A 4XO3A 1GUUA 3F9KA 1ACIA 4JNDA 4A6EA 4AUXA 2DYRH 1OCOH 4FHTA 2A69F 3F8BA 2DFIA 1RUNA 4K5MA 3TKYA 4PVBA 2NVTJ 4G6DA 3FUHA 4XO4A 1H9GA 2MLGA 2E2HJ 5IP7J 2JA2A 4A5MA 3E6MA 2LK2A 2LMDA 2XAJA 3FF5A 4HX4A 2P7VB 1QPIA 1DGRM 3H3VK 1HF0A 5DYMA 3JRGA 4MS6A 1LVAA 3K9TA 2R7TA 2A6HF 3WE2A 2FRHA 3A4CA 4XORA 3CO6C 3C2HA 2KZGA 2W4SA 5L3FA 3GTLJ 4A0YA 5KCMA 1HKTA 3WTZA 2HXIA 1WI9A 2HXOA 2ISZA 2COMA 4AC0A 4G7HF 1TWGJ 3PUBA 1MSEC 2LH9A 4Y6RA 3P7NA 3ANMA 4LLGF 4KNYA 1ZREA 2IA1A 3N97A 2JD2A 2FX0A 4B44A 4XRSG 2VT3A 3ZQLA 1X1DA 1G3YA 2ZKZA 3ZHYA 5CLSA 4KT5C 2GXGA 1K83J 2OTJI 1X3WA 1UG0A 1HOMA 1TBXA 4IJAA 2XC7A 1MH4A 4WXDA 3JT1A 3ZXSA 3W6JB 2EZKA 2H6CA 4A3LJ 5EJCA 3LQRA 5H20A 3CIAA 2DK5A 3ASNH 2M34A 2AHQA 3WGIA 1SMYF 3B37A 1Z3XA 3FMRA 1E0EA 1QVUA 1Y1VJ 2VJJA 3MZYA 1X3ZA 3KLNA 1VQLI 3TP3A 1AKHA 2XPZA 1VQKI 4I7HA 4RGSA 2VODA 1FP1D 3TO6A 3LA3A 1OJLA 1T6SA 2R4GA 1BL0A 3RSNA 1M1EB 4N4OB 3I64A 2ZB9A 3V8LA 1BI0A 3NRVA 4HOBA 3OOUA 1Z77A 1DU0A 1W1WE 1SMTA 3TDZC 3IWZA 2KZVA 2P6TA 2HOSA 3PFYA 2H1KA 5E8GA 4MIMA 4ZDLA 3DEEA 4B4CA 1J0RA 2ID3A 3SFIA 5ICFA 3RKWA 4KITB 5JLWA 2PLYA 4U0VA 2ME6A 2LD5A 2K9LA 4UVAA 5GP9A 1N77A 2K4JA 3DPTA 3FHZA 3PJRA 3S2HJ 2ESNA 2OJED 2MABA 1FZPB 5DLLA 1ZRDA 1VQ4I 1W0TA 2HPOA 4GAAA 5LHHA 4DYQA 3CCYA 2R5YB 5DYFA 1MKMA 4IHXA 1Z6RA 5FKLA 1S7EA 3SXYA 5J1YA 2Q2EB 3L2RA 1H9TA 1TWHJ 2BE5F 3P9KA 1AOYA 4A6DA 1KYZA 2V4JC 2E2JJ 5JR3A 3DKXA 3I59A 1JGIA 4XK4A 4CXFA 2VKEA 3ABMH 2ZJPF 4PUSA 3HOZJ 4L18B 3DF8A 4DBQA 2ZC2A 4WWCA 5EG0B 1R58A 2ELHA 3H9JA 4IX7A 2VJ4A 1WFXA 3IH3A 2FF4A 2JVGA 3BQYA 3PUFA 4PSXA 5HLGA 1MBFA 4Y33A 2EJRA 3F8MA 3KEQA 5HVQC 3LA2A 3I0TA 4ZC3A 4S05A 1TQMA 5E20A 3K2AA 3S1QJ 4XSXF 2KHMA 2LG4A 4B8XA 1Z91A 3ONQA 2EPFA 1FMWA 4WX9A 4HLYA 3T5XA 2O8KA 3MQ0A 4LD5A 1FTZA 4DOZA 4XN1A 1KQ0A 1FEXA 2P81A 1O7LA 1STZA 3M8FA 1JTYA 3AG2H 3K70C 4HNUA 1FOWA 4XRMA 1ZGJA 4X6AJ 2R70A 1MBEA 3WGGA 2LYCA 1ONVA 3A1YA 5LHGA 2N8GA 1EKEA 1P9QC 1T2KA 4B43A 2P8TA 3E1SA 2WV0A 3EPZA 3K7AJ 3UNGC 4AYBN 4ZQTA 2R5YA 4OIQF 5J1UA 1IXRC 4ZYGA 2ELJA 3HOXJ 1SFOJ 1WI3A 3KZZA 5E8IA 2Q2EA 5KNLA 1T8IA 2ZMEB 4HX8A 1AHDP 1GVDA 4ITVA 1ETVA 5CJ9A 2XPUA 1J59A 4XMZA 3CZLA 4IL6C 4CZCA 2OU2A 2VT2A 1K79A 3WHBA 1S7AA 1DP3A 3RZDJ 2OPTA 1UG2A 1BR4A 3CESA 4O6JA 1ZK8A 2WB1N 4HV5A 3MKLA 3SQNA 4B09A 4ESFA 3SDGA 3BJAA 3E5QA 3F8FA 2F2EA 3NWSA 3T8RA 1T0FA 5IT3A 3EBGA 2PMUA 1VQ5I 3DPUA 1X4PA 1OISA 2GQQA 1LE8A 3I4PA 4X0GA 1FJLA 4NQWB 3OYJA 2XKOA 3FUIA 1J5YA 3OL4A 1ZLJA 3ZR8X 2L9RA 4PJLA 2V1NA 4E6KG 3KP6A 2KP6A 4LLLA 1FWZA 3L2WA 2K27A 3CMAI 3GXOA 1A6QA 2VPLA 2Y0SN 1MW3A 1B6AA 3G1LA 5A2QZ 1W5CC 3VB2A 4ENNA 4YEJA 1GXQA 4F55A 1W5TA 2WA0A 3F6OA 4BY1J 2VONA 1BBYA 1YOVB 1JUPA 2P6SA 3ZQ7A 1OCZH 3QYFA 3DTKA 4MLOA 3HJEA 4S0HB 4GXOA 3AU9A 1HSTA 4AU7A 4FLSA 2NS0A 4UUVA 2A05A 2DU9A 2DAOA 5D5UB 2FJ1A 1W7PA 2FFLA 4L2LA 4GAEA 3W2WA 3CZEA 1B59A 1HQCA 2W48A 2ZSHB 3PFIA 1D0ZA 4M73A 3ZHXA 2A5YB 1MNEA 4AR1A 4RB1A 2W57A 2DMQA 5F0FA 3FXUA 1YG2A 3H92A 4RM2A 2KJBA 3GZ6A 5CQGA 2EA4A 3CC7I 2GZWA 1P92A 3OYKA 3JRFA 5FD5A 2EZLA 2BOLA 1IV6A 4RM3A 4XRFA 3DLLF 4BE1A 4HNTA 3C2BA 2EV0A 3GZ5A 4A3EJ 2XV4S 5E18F 1BIAA 1FT9A 2VE8A 5LGNA 3K1MA 5GAGJ 4S04A 2AQEA 5M5WJ 2HYFA 3IP4B 1NTCA 2VC0A 2E1OA 1YJWI 1EF4A 1XMKA 2W82A 4MHGA 4ZX5A 4IQ4A 5GTIC 4RA2A 5DD4A 2O3FA 2L9NA 4HW0A 4HX7A 2OTLI 2M4KA 3H5RA 1IRZA 3E0JB 3OYAA 4FTHA 1FTTA 5TISC 2EA2A 4RB3C 2XPYA 2DFHA 2P5VA 2A6TA 4XOPA 3CC2I 5D5VB 3ABLH 1GV2A 2F5DA 2X6XA 1SEUA 4QMEA 4LFUA 3R0JA 3KP5A 1R1TA 4LMYA 5FLXK 1R5ID 4GDFA 2DA3A 1I3AA 3BR2A 2R7QA 3V4GA 3V8JA 2V9KA 3BTLA 1YW9A 4N4NB 3MAJA 2D1HA 3HC7A 3OYBA 1VF9A 2BW3B 3GYHX 1P4AA 1ODDA 2K3PA 1POGA 2RKHA 2VUMJ 1MJ9A 1F4KA 2BY1A 5GTHC 4DPRA 3PNVA 1HBXG 4KICA 1VQ8I 2B7EA 3DLAA 2R0QC 3HL2A 3B2PA 4BU2A 1Q0LA 2X1EA 2DMPA 3WU2C 3BCBA 4G6TB 1RESA 3IUOA 3V7RA 3MZ8A 1XD7A 2O7OA 2K9MA 3QPSA 4A3DJ 3OIPA 2F5EA 1IO2A 4XNDA 4FCYA 4CYCA 4KT6A 2STTA 3ANLA 4JK1X 3WU0A 1JT0A 1H89C 4XLHA 1FY7A 3J80K 4M9SA 2Z3YA 2K3FA 3T8TA 4Y3OA 2QQ9A 2VQHA 5KVRA 2LKXA 2LNBA 1MMDA 2LOOA 2V9VA 4F52A 5K7HA 3EUHA 1ON1A 3GO5A 3MEXA 1JG9A 5HS8A 4HBLA 1JUSA 2CSOA 5H2FC 1I5ZA 1WJAA 2L7FP 1JHFA 3OYNA 3JRIA 3AUAA 1MBGA 4RCVA 3ZMDA 1OR7C 2QSGX 1SFXA 1IW7F 3FH8A 3ABUA 4ZYEA 5EGOA 4K5PA 2Y1EA 3U9GA 4AM3A 2DQMA 3BZ6A 1V55H 3PNYA 5D8LB 4C3IJ 1SC7A 4IZZA 3CHOA 5JBIA 4MFEA 2JRMA 3TO7A 2X6WA 2JA7J 5D5XB 4JQFA 4Y6PA 1MW7A 1X3UA 4ESBA 1SD6A 2QBYA 1S5LC 1IDYA 2VJIA 1VQ9I 1UMQA 1LB2A 3F72A 1USTA 2R7DA 3OS0A 3KE2A 6PAXA 3GTMJ 5AONA 2VL8A 4HZFA 1B1BA 5J40A 1K6OA 2WPGA 3CO7C 4CO8A 5ICGA 2WBMA 4CICA 4ENKA 5DUIA 2E1NA 2CV0A 2MG4A 1U6GA 3M1CA 2LBFA 4II2A 4XMXA 1MDMB 2BHYA 2MC3A 3CZGA 1RUOA 1UHSA 4L9TA 3K70D 3HDDA 2R93J 1ONOA 4GGGA 4BQOA 1SC5A 4AVZA 2I8DA 1RC9A 4ETSA 3BJ6A 4CCOA 5DCMA 3ZRGA 3ML6A 1ZTRA 5BPIA 2HEOA 1ZELA 2YX7A 4ZTJA 4UVBA 2Y0MA 2ZXJA 5FKMA 3FTVA 1YITI 1O3QA 2PEXA 2QF7A 3IKTA 2O8XA 1D5VA 5EZHA 4R8HA 4UNOA 2HOEA 3JRBA 3B7UX 4ON0A 1HDPA 3B6CA 2LY2A 1WRJA 4MNUA 4R7LA 1P4XA 4DYRA 3JSOA 1ON2A 2OV7A 1K78A 1RIOH 4I0BA 2ECBA 1XB4A 3Q5FA 5GADJ 3AG3H 2E71A 4II3A 2AQFA 3ZQQA 4E7ZA 4KIGA 4MKTA 4ZQGA 2Y69H 5JHUA 2VLAA 1FOYA 3C1DA 3K4LA 3R0AA 3BDDA 2YUSA 1ETOA 2JQ7A 3WG9A 3GZNB 4J3BA 4FE7A 4BQQA 4CZZA 2I10A 4LK1F 2E60A 1MDMA 2VBWA 5D6EA 1VFCA 2QVOA 4E7JA 4PW4A 1NH3A 1ERDA 1ETYA 3OR1C 3S93A 1U9NA 3TQNA 1X1AA 5JFRA 2VKVA 2PQ8A 2BY2A 2UZKA 2IVMA 3ZCOA 4XNFA 3L2UA 3FUKA 2EZHA 4BJ6C 2R7XA 4K5LA 2M5WA 2Y30A 4EJOA 4BH9A 2DOEA 1HC8A 1U5TC 3RC3A 2WADA 3FXLA 1KZHA 1ZAOA 1YQAA 4I99C 5B66C 4QWQA 4DW6A 1C0WA 4WXCA 1IN8A 4PJMA 4BS9A 1JT6A 2FD5A 3H0DA 2EWNA 1I39A 2ECCA 2DLLA 4R5VA 1OMIA 3C2GA 4I0AA 1E2XA 1YW8A 1SVLA 3BR3A 2R92J 5DCFA 2DA5A 3F23A 1G5AA 3OYMA 3FTUA 1TLHB 2DMUA 3QODA 5J4VA 2TDXA 4OOIA 2CW7A 2HKXA 5LEKA 2XDVA 2JMWA 4Y17A 1KYWA 4B48A 4Y13A 2XRNA 3NEUA 1YFHA 2B63J 2ZXGA 5BQTA 2D5VA 4HQEA 3VYUB 1HXDA 3H3UA 1JGGA 1XGOA 3FXQA 5J6XA 4YIFA 3RPUA 3OYEA 2ZXHA 1VQOI 2EGHA 3UEQA 3FXMA 2MAPA 3WGHA 3U2RA 4IEJA 2O7GA 1FX7A 2E7WA 1Z1DA 3HGYA 2GBYA 3S1RJ 2Y48A 5D6FA 2M2EA 3RCOA 2DCEA 3OWTA 1JKPC 5KK1A 2V7FA 1BJAA 3FULA 5IT9Z 2H27A 1BW6A 2RQQA 4N9HA 4ABZA 4G9YA 2VB6A 3CC4I 1V5EA 4IHWA 1ONNA 4HYEA 3N05A 2VC1A 1QO0D 1SAXA 2BXZA 2KIFA 1NHAA 3CUOA 5E3MA 1DDNA 4XLFA 3SHFA 2Y1FA 4BXFA 2QJ1A 5L3BA 3GF2A 1R1UA 1TTYA 1IUFA 1ORKA 4QLCU 4O3MA 1HCRA 2FSWA 5JO0A 4K5OA 1Z9CA 1Y1WJ 5K5QA 3NAUA 4EATA 3QP5A 4TV7A 2CV1A 3Q0VA 1T0FC 3JCUC 1U8BA 5HDGA 4BE0A 5J47A 4U7DA 5HDNA 2NVXJ 3BR1A 4ESJA 2HPIA 2V26A 4D7NA 1R00A 1YLFA 4Y52J 2XASA 3HKZA 2XQ0A 1TW3A 1Y0NA 2VBZA 4XLEA 1S29A 4UXNA 2GTQA 1VQ7I 3QP6A 4M3FA 2KMUA 1APLC 2JWTA 2R72A 3DKYA 3VYTB 3BP8A 2XVCA 3S2WA 3OL3A 3E6DA 5DD8A 3BTJA 5FJ8J 1ITYA 1PP7U 4EM0B 2PMZA 4PJNA 1Z21A 2IAIA 5DEQA 2XB5A 2XSJC 2E35A 3FXKA 3GMEA 4K5NA 3CLOA 3FTXA 2HZTA 2IXSA 2KRFA 1U8RA 5ILVA 3T0YA 3VEPA 1ZHFA 1OLTA 2QSHX 4OIOF 3K1PA 2BY0A 1A5JA 1QPMA 5M3FJ 4F93B 2JPBA 2VBYA 3K1NA 1MVYA 2Z9OA 2BGCA 1MMGA 3CCQI 2EIKH 3QOEA 5F1RA 3X2QH 2DO7A 3EUAA 5C3EJ 2QYOA 2LLKA 5FGMA 3FU6A 4EJUA 2JRTA 2MC4A 2E1MB 1TC3C 4R5TA 3L09A 4EGYA 1T33A 1WH7A 4NC8A 1MBHA 1QZYA 2Q1ZB 2XF7A 4Q5SF 3QYEA 1EH7A 4BJTA 2XHKA 3PSIA 4GFBA 1X58A 1MJBA 2W24A 3RZOJ 3QJXA 1RP3A 5C4XJ 4ZW5A 3OSFA 4E7IA 1XG1A 5E3NA 1MNDA 3MWMA 1R49A 1YJNI 2VI6A 1R71A 2Y2ZA 5B5EC 4CCNA 1S3JA 5BMZA 2W25A 2CV2A 3CHSA 2ZNYA 5FFXA 1P2FA 2DPUA 4PZJA 2M87A 3CP8A 2GXBA 3COAC 4AR9A 4OAZA 5HODA 9ANTA 4P55A 3SZGA 4D9JA 1OPCA 2KT0A 4I01A 4NC7A 1Z67A 2R7VA 5IOYA 4BEHB 5FKOA 3EBIA 4XMVA 3VWBA 1MMNA 2XGXA 2FNAA 5L3DA 2VXZA 1GLNA 3CHQA 1LVKA 3FUDA 3VOEA 5FLMJ 2DPDA 4JOMA 3HIFA 1TP4A 4XIDA 4IQJA 3K4JA 3OYIA 2O6GE 3V42A 3KIOA 3P9CA 4G12A 4XKVA 2YSRA 4WK8F 3A2KA 2DA1A 3E6CC 3B73A 1BOAA 3GWZA 1KONA 1L3LA 3N4MA 3LSPA 2PG4A 1ZGAA 3CMEI 1U5TB 2KRCA 2EIMH 4EEFG 3Q43A 1R5HA 1J7KA 2ETHA 2EZIA 2OAZA 3O3KA 3WODF 2YS9A 3JTHA 4EM1A 1SD7A 2D2WA 4XMTA 1TW2A 1HW5A 2F5CA 2VBXA 2AXTC 1VQ6I 2G7UA 4LG0B 1WZ2A 3SYTA 1IN6A 3SDBA 2FE3A 2QZ8A 4MFDA 4RLQA 2ZJQF 3CZKA 1P6RA 4RAYA 2RVCA 4BHPA 3FHNA 1S9HA 4EVIA 1JKOC 3PIPF 3FTWA 4JX4A 5CVJA 5FROA 2HWVA 1IAWA 1QBJA 4DGWB 2DQ6A 4ZW8A 1V4RA 2FUG2 1D1AA 2DA7A 3EUHC 3W3CA 4XR6A 1KU2A 2A61A 2AXLA 3BQZA 5DM7F 4HSTA 3A0HC 2FU4A 3KCCA 5J8CA 3CJTB 2OF7A 4QHPA 2Y9ZA 4G6QA 3CQZJ 3S3NA 3GLLA 3AU8A 3O8GA 1D1BA 2HS5A 3KP3A 2JA8J 1BI2A 5HDKA 2QKLB 4XLAA 2CGPA 2IA2A 1IXCA 4IXAA 4FCAA 3WQRA 5IYDJ 2UUZA 3T1BA 2JV7A 3DFGA 5D8KB 2L4AA 2DK8A 4KN7X 2IGKA 1G3SA 4WCGA 3ZMVA 3BOQA 3UR3C 5DDGA 2R5ZB 2JN6A 4HF0A 2QEXI 1ZGWA 1J2XA 2ZJRF 2A07F 4LG0A 2QA4I 3RYRA 3S1MJ 1RR8C 3LFKA 1D3YA 3RYPA 3JREA 3BR0A 4HG2A 3ZN0A 2HOAA 1FIPA 2V6CA 4YFXF 1RKTA 1WQ2A 2OCCH 2IW5A 4W97A 4PFPA 5J3LA 1BR2A 2CUFA 5C4JJ 2E2IJ 3GFJA 1S6LA 3HOYJ 3K69A 4P9FA 2UXXA 4DIQA 4CYDA 4RSYA 3DTEA 4CCMA 1CQTA 3TL4X 3PO2J 2JSCA 3FXOA 4HA8A 3C3WA 1Z3YA 3HOVJ 4IRGA 4ZX4A 3K4KA 4LB6B 3F21A 2EBIA 2EQRA 3H5AA 1FPQA 3HB9A 3KP4A 5EG0A 3CD6I 4LIVA 2R3SA 3CUQB 2YPRA 3EYYA 3M8JA 2IPQX 2VOPA 3GFMA 1HKSA 5F0CA 2DQLA 2VQCA 1UB9A 2E34A 1T98A 3LSTA 4M72A 2L9VA 3QPLA 4BBSJ 4XKWA 1ZG1A 1AA7A 3I71A 4HQMA 1IN5A 1UELB 3BT9A 2EB7A 4OOFA 3K4CA 2K85A 3KP2A 1HW1A 5L3GA 2QQBA 1U3EM 1GXPA 1OYWA 2X6OA 5DM6F 3OYLA 5BPDA 3K0LA 2FA5A 3HHGA 1UHMA 2BBYA 1Q1HA 2ZXWH 2VASA 2JCYA 1SVMA 4KISA 1Z7UA 4LUPA 2NXNB 1Z7LA 2CH0A 3W6VA 2L54A 3B2XA 2CQ7A 4JX5A 4FASD 2PJRB 5EDNA 5GPAA 1QQIA 3FXJA 3V7SA 2MAOA 5F0HA 1KU3A 2HDWA 1MSFC 4RS8A 3R60A 2WAFA 1SFUA 4ZQHA 1O3SA 2ZMEA 2K5CA 1IF1A 5BS6A 1ZYRF 2PN6A 2Z99A 3KZYA 4UUSB 2R7ZJ 2KLOA 1FSHA 2JCVA 3B7TA 1G3TA 1LDJA 1RZ4A 2K02A 5LGTA 1SAUA 5F1JA 3KLOA 5FD6A 5TGTA 4QTRA 4M71A 4HNVA 2GOMA 1WKMA 3QOPA 2IBDA 4XICA 3CUQA 2ICWG 4ZYHA 1H3LA 1IV8A 4OIRF 3DCFA 4IHSA 2RNGA 1TQIA 2M4GA 3S16J 3WQSB 2LKSA 4IHYA 1Z05A 2O61A 1QZEA 4XBFA 4HDVA 3I4NJ 3LAJA 2WY8Q 3ANNA 4UUTA 5HNFA 4ZDOA 3VFZA 3EBHA 1FBSA 2BYVE 2DT6A 4NQWA 2BZTA 5K5RA 2E5NA 1SANA 3BPXA 3HGGA 4UHTA 5FLXZ 1S46A 2IS4A 3PQJA 5ICEA 4NNJA 3M7GA 2CU7A 2EILH 2CFOA 3IAM2 4OMZA 4ENMA 3AG4H 1XGSA 1ZKGA 4PCQA 3B3BA 4QIRA 4XSZF 3NARA 2KRHA 1P7IA 1WWXA 3RKQA 3ECHA 1Y56A 2X4HA 2XAUA 3NWTA 4XMWA 5EV7A 4AIJA 3OYCA 1NG7A 3S2DJ 4PGGA 4Z6YA 4KIBA 4U88A 2ACJA 2W1OA 3BROA 2X48A 1LEAA 3IWFA 3O2PE 1ZG3A 2QVWA 1SFEA 3RASA 4BDYA 1GV5A 3AG1H 3L7WA 1TL8A 2RGVA 1BN5A 2VKDA 3EDPA 4DQ2A 2J5OA 3J80Z 1D0YA 4L9JA 3O6BB 3R4KA 1BIBA 3BC8A 4MGRA 3BJOA 2LF7A 1R1VA 3FBNB 2W7NA 2HYGD 2ZJ2A 3D5SC 4YIIA 3HPGA 3KP7A 1VNDA 3J81K 1YI2I 3G6EI 3H36A 1PJRA 2C82A 1YW7A 1OCTC 2ESHA 2KQRA 4D5CA 1OYYA 2A6EF 3A01B 4XO5A 2Z2SB 3HRUA 2RQPA 3IC7A 2H6BA 1W5SA 3BG5A 1N75A 3OMYA 4ZQEA 2L02A 2X6YA 4XOTA 3E7LA 2QUFA 3AKZA 3WTYC 2TCTA 3IHUA 4QPEA 1JGSA 1DGWY 2XAHA 2BVMA 3D5RC 3MVPA 4F3QA 3IH4A 1PVEA 2GLOA 3OS1A 2KFDA 3F6VA 5E1ZB 1BC7C 2GIVA 4G7ZF 2VOOA 3TOBA 4AIDA 1X19A 3HRSA 4BHCA 5LFAA 1J75A 1O7FA 5FLVA 2JTVA 3G1OA 3CCMI 2HPMA 4XQFA 2H8RA 3J7AO 2JZYA 2NVYJ 5K1YA 1ETQA 1XSVA 1XX5A 2ZNZA 3Q0WA 3A06A 1XMAA 3R61A 4YELA 3TGNA 5J8FA 2H1LA 5FRMA 3MZHA 4BHBA 3SFZA 2WY7Q 3DBLB 3GTKJ 4Q4ZF 3FK6A 3Q44A 5L3CA 3PQKA 4IVNA 1Q1VA 3BZCA 2BW3A 2DTRA 1B4AA 2GA1A 3CDHA 4Y6SA 3ASOH 3F8NA 3OIQA 1B8IB 1V5FA 3PNTA 4CH7A 1XC5A 2HNHA 3L1PA 4J01A 3CJNA 3LL7A 2STWA 4A69C 2DOAA 2LFBA 3CCLI 4A3IJ 4JX6A 4KJZA 1ETWA 2E7XA 4P9UA 2NVQJ 1I6HJ 4RGRA 3HOSA 3G73A 3DU6A 1FYLA 3FU3A 1JKRC 3WQQA 2IGMA 5D4SA 4ZYDA 2IRFG 3T8VA 2F4OB 5FB2A 2IEKA 5M3MJ 3A14A 3GTJJ 4ZYAA 3TEDA 3KEYA 1QVTA 4HF2A 3JTGA 2FBIA 2ZBKA 3LWFA 2HQAA 3DQVC 2DDAA 1VI0A 3ZQIA 3KYLA 2NOGA 3SEQA 1CGPA 4EJVA 2GM4A 1LDDA 1H88C 1X4OA 2ID6A 3KYCB 5D4RA 2LKPA 2M30A 3V8KA 4I6ZA 4E70A 3HTSB 3LA7A 1F9NA 2PJPA 3GFLA 4DYCA 2F4MB 2MLKA 1D5YA 2H8WA 4WF2A 1J09A 1NK2P 1IDZA 1WGXA 4UV8A 2YX4A 1FBUA 5EF6A 1PUFB 2H94A 2UWMA 2PFBA 4Q48A 4IKFA 5GAEJ 2FOWA 3FWEA 4YRVA 4FX4A 1A36A 1XMXA 3E6BA 2WAQA 2DTZA 3HM5A 3SJMA 3LOCA 4N9IA 1TT0A 2KIQA 3DKWA 5AIQA 2Y1CA 2OA4A 2XRLA 4A2UA 2OUMA 1YE9A 1TWCJ 2MSYA 3HRTA 2WAEA 3FX3A 1KQ8A 3H9GA 2M45A 3ZMTA 2L5QA 2L3DA 3RI4A 2P7CB 4DBRA 5IP6A 4Q4IA 2V79A 3VSLA 1K7AA 4KYWA 2MD5A 1Y6IA 4BE2A 5FWQA 5JC1A 1HKQA 4L0YB 3HZJA 4PDKA 2XGCA 3FU5A 2V1XA 5E1WA 2CUZA 3L2CA 1K4SA 2CO5A 4EJWA 4MTEA 3FXRA 1V54H 4XRSA 3FDYA 3IRRA 4E7HA 1XCBA 2KIMA 4UY8I 2R7RA 4EQQA 2HGCA 3DWLE 1F1ZA 2NYXA 3TO9A 1H0MA 1XDSA 2XKPA 4RMNA 3BTIA 3OOPA 4NHJA 2IA0A 3O8HA 3CCVI 2ZCWA 4M6YA 1I3QJ 1FLIA 3M3YJ 2C6YA 2Q0OA 3F8CA 5DUKA 1LEBA 1B72B 2GAUA 2AO9A 3GVAA 3SZPA 2WWYA 3E3VA 3BG6A 3FHEA 2LY1A 3ZP5A 2E1CA 4OIPF 3FUEA 1FBQA 5HNHA 2OBPA 2R7WA 4MTDA 3JSPA 2Y9YA 1T08B 1EH8A 5B1BH 3DV8A 3ZQGA 1HDDC 4I2OA 3ROUA 3JAMZ 4U7BA 1DPRA 2M0CA 1S8NA 3MN2A 4QIWN 5JLXA 1MBKA 3CTAA 1JXSA 5KHDA 3J7YJ 1RKWA 3JRHA 3AL0C 3HUGB 3CZ6A 4B3AA 3KPHA 1ULYA 2A5WA 2OC6A 4A93J 5M5YJ 3ECOA 5CQEA 4LGWA 2ELKA 3HTUA 5H6RA 1AU7A 1OKRA 2Z16A 4G94A 2QGUA 3KEDA 2R7FA 2V9PA 4EGZA 2CQQA 3OIOA 2FXAA 5F08A 1MBJA 1SFKA 4XKCA 2XSDC 2KL4A 4AR8A 2UV1A 1MMAA 2W84A 4RDUA 5ICCA 4RGXA 1VQPI 3ERED 1OQYA 1SD4A 1XS9A 1W0UA 4YFNF 1UZCA 2FMYA 2O0YA 2PI0A 4G7OF 3KETA 3ELKA 5JVTA 1ONPA 1XCVA 2CW0F 2CFXA 2HR3A 1PP8F 5DULA 5L3EA 3GTQJ 1WPKA 5ED4A 3W2VA 2Y1GA 4Y4RA 4A5NA 1U9OA 3F3XA 2CS3A 3ZQCA 4XONA 3VYSB 4DZJA 3BG7A 1MW1A 1MMSA 4HAMA 2NRAC 3ZGKA 3AFHA 4A3KJ 1WJFA 3ZMSA 1OCRH 1GT0C 2F6CA 4M3DA 3ZQHA 4IHVA 5E3LA 2RN7A 4AVPA 1FYMA 3FMQA 2HDDA 3A03A 3P5JA 2P5LC 3HW2A 2I5UA 1MGTA 1GDTA 5FFZA 3TMOA 4NDLA 5B3SH 2FQ3A 1DQUA 2NNNA 3TBIA 3HYIA 3S1NJ 4XN9A 1R23A 1IJWC 1IUYA 2X51A 5ILUA 1P7JA 1VQMI 3I4MJ 3HKZN 2HOTA 2LTPA 4QSHA 2NVUB 2LREA 4BAYA 4KIFA 4L9VA 3ISPA 3QAHA 4GO1A 3E5UA 5JVGF 4BBRJ 5EEAA 3CMMA 1T1SA 3FTZA 2HVQA 2K9NA 4N0BA 2IS1A 3CCUI 2CG4A 4PGHA 2IS6A 4M3GA 3JRCA 2L9SA 5F64A 1XPXA 5IT9K 2Y31A 3K4MA 4XLCA 5AIPA 2ZMEC 1SG7A 3S15J 1H19A 2PMZN 5C44J 2Z1DA 3GBGA 5F27A 1ZH5A 2Q8KA 1KU9A 4HSRA 5BOXA 1R4NB 5CVVA 1RR7A 5FKNA 2QM3A 1X3WB 3QQAA 4L5IA 3OYGA 1P4WA 2DOFA 5JMPA 3TW6A 1YJ9I 2E5ZA 4H0EA 5CVRA 2HU9A 1LQ1A 2F5VA 4JBAA 3OR2C 1X2NA 2KJCA 1ZG5A 1R9TJ 1YRNB 2HZDA 2F48A 1MW0A 1HSJA 4KUMA 4BDZA 2GA2A 4ZW3A 1B9NA 1IRFA 2X0LA 1I1GA 2E19A 1OR7A 3HOUJ 4IHTA 4RAGA 5LRRA 2CUEA 1PYVA 1OFCX 1X3ZB 1R6RA 2OZ6A 2XAFA 5M5XJ 1AKHB 2V1DA 2XGEA 3HXLA 2XGDA 3LSHA 3OS2A 4XN0A 1JTXA 2P5KA 4P5OA 4GRIA 3BWGA 3C7JA 3QU6A 3FM3A 3FKJA 1N78A 3DU5A 2M7BA 4LOCA 3EETA 2A3SA 1VTNC 2CRGA 5BNGA 3M9AA 5H6QA 2D1VA 1REPC 2QKMB 3I9V2 1DPUA 2RAEA 1Q0HA 3OV8A 3VYRB 3QWLA 2HI3A 4BJ5C 3FK7A 3LSIA 3PUUA 3E5XA 4BUPA 2R59A 3FUNA 1TT5B 4R79A 3RIRA 1R0LA 3RKXA 1Y39A 1FYKA 1UJ8A 3I55I 1F5TA 4M6VA 3NQOA 1YX5A 1TQPA 4AIHA 4ZX3A 1XDUA 3PSFA 2HDCA 3GW2A 3WU1B 2BXYA 2Y1DA 1ZR4A 3WTUC 4X2UA 4YG2F 4XN8A 4XLNF 2MYSA 4Y7NJ 5IY5H 3I56I 4RB0A 2X1CA 3GX4X 3FTSA 4NC6A 5EEGA 1YRNA 2AS5F 4FX0A 5F6FA 3OSGA 2PUSA 3VPRA 5LLQA 3FUMA 4HDUA 3W2AA 5E17F 4AWXB 1R7JA 2HQRA 4ZX6A 1QNTA 3IKVA 4EM2A 1D8JA 3I59B 1R5GA 5TJJA 3L2VA 4OAYA 1EH6A 3M4OJ 2NOJB 1OCPA 3F0CA 2LY9A 2NAZA 5K5OA 4ZQFA 4BNCA 2H09A 3UKGA 3CCRI 4LLNA 2DT7B 4IPAA 4Y15A 1T39A 3WTSC 3ZOBA 2NNYA 1TNTA 4A3CJ 3FUFA 3I53A 4KP7A 4CDGA 5FRNA 3HG9A 2XIGA 4BGDA 3FUJA 3AL0B 3I5UA 2CW8A 4BEHA 4A3GJ 3RQ4A 2VJ8A 4QPQA 4H4KC 1DU6A 3ZQFA 2MH9A 2EFPA 3IH2A 4CCLA 4B1RA 4XMUA 2DDBA 4M3EA 2F5FA 4MEXF 3HSEA 1JHHA 3BTCA 2JK3A 2OQGA 1XSDA 5JI6A 4A12A 2CQNA 2GOXB 5DS9A 4KFCA 4KN4X 3IRQA 2LP0A 3HOTA 1U5TA 5DV5A 2XAGA 1A35A 3G2BA 1ZRCA 3U9WA 5DTDA 2CUJA 2JA6J 3MKYB 2G0EA 3G4SI 3W6KB 3BR5A 3C18A 2FOKA 1IGNA 4FQGA 3VVMA 1H8AC 3K4BA 3S17J 2WTEA 3D0SA 3SZTA 5IPAA 1KA8A 4KA4A 2R7OA 2M8GX 3ZN1A 4L0ZB 4ANJA 1NK3P 2HFHA 1IZ1A 3REOA 1ZQ3P 3FBIB 5D5WB 1SQMA 3FISA 3R6SA 1R36A 1YYVA 4E7KA 4IOCF 4I09A 1KU7A 2QQAA 3K4NA 1LE8B 2K9SA 4BXUA 3FTYA 5KAFC 1IRGA 4UV9A 2Z33A 4L5JA 3LSMA 4AYBA 1Q0QA 3J7AY 1O3RA 1EJ9A 1E3OC 4BKXA 5IYCJ 4M6XA 1RPWA 3ERMA 3LSJA 2JD0A 3HBLA 4X1EA 1MH3A 3F22A 4ZTFA 1YTYA 1TWAJ 2MD0A 3CJRB 3U21A 4ASNA 3WTTC 3RQIA 4D7MA 1G2HA 2VXDA 1RI7A 2COBA 4Z2YA 3MKWB 4A03A 3KYDB 1BI1A 1ZN2A 4M9XA 4CSWA 1YIJI 1X1BA 2WB1A 1CF7B 1O4XA 2G7HA 2P0WA 1W7PB 2R5ZA 2IS2A 1WCMJ 4NBQA 3DBHB 1WJCA 4F91B 4AIKA 1WJEA 2QENA 3GCMA 4BY7J 2EINH 1Y8RB 2L0KA 2HQNA 4U0YA 2TRTA 2MA3A 3BCAA 3WTWC 1AWCA 3B34A 1KGSA 4LIUA 3RTRA 2YU9J 4Q4EA 4XMYA 4DZPA 3I54A 2IGNA 2JUCA 3QPTA 2KIUA 3CDLA 4GCVA 4HEA2 1QA6A 3GEZA 2XAQA 3K10A 3LSGA 1ETXA 3P9IA 1FIAA 1YHQI 2B9SA 1ETKA 2ZSIB 1DP7P 2Y0SA 3CCSI 3WTVC 1T95A 3MKZA 1IN7A 5JHFA 2VN2A 5JAZA 1PDNC 1D8KA 5IYBJ 2QCOA 3HEFA 2LC2A 3MFKA 3QRFF 3TDUC 2RV8A 1Y0UA 3ESWB 2WC2A 1G6NA 5HLIA 1W7PD 2EFNA 2VPRA 2K86A 3GUDA 4PFOA 4IO9F 1QGPA 2XB0X 3CCJI 5CYVA 2HVRA 3H9QA 4OOEA 4FISA 4A0XA 4LK0F 1WHUA 4M3BA 3RKYA 2HQ5A 3AAFA 3FIWA 2PMHA 2UXNA 1CF7A 1Y8QB 4XLPF 3FMSA 4C3HJ 3H3ZA 5LRSA 2DI3A 5TRDA 1WJDA 1E3PA 1K5HA 2DW4A 3ULQB 1J9IA 1OCCH 4ZN6A 4CUGA 4M9ZA 4F92B 3ABKH 1T56A 2D45A 3QU3A 1XSXA 1EA3A 2CWEA 1MZBA 1HA8A 4A3BJ 4ZH4F 1B9MA 3V7CA 3D1NI 3G71I 3CJQB 1R22A 2ZXIA 4CGZA 4RAFA 4UB6C 2HTJA 3HOWJ 3J81Z 4K2EA 4IRHA 1XGMA 2WZGA 2LDUA 1YO5C 2PJRA 3RDIA 4KMFA 3GLXA 5A2QK 4A3JJ 3RC8A 4RLFA 4ZJZA 3ZPLA 1VQNI 1GVJA 3PO3J 4C2TA 4A0ZA 2M7AA 2VJ5A 5CKTA 4HRIA 4A3MJ 2JPCA 2EFQA 4EJTA 2MH2A 4MQVA 2B61A 2KKOA 4XNBA 3FKIJ 4CHUA 4UUSA 1O3TA 4NUBA 2A68F 2PX9A 3CLQA 4AICA 3E97A 4PSWA 4ZW6A 2JCXA 4ZZLA 3H5NA 4E7LA 3CHPA 3OYFA 3GTPJ 4L5EA 3DP7A 1DUXC 4W1UA 4CYCB 4IRIA 1W4MA 5LGUA 3MD2A 1W36C 1ZRFA 3LAPA 3JR9A 3A0BC 1R4MB 4V2FA 2NS8A 2W00A 2GIZA 4CCJA 3H0GJ 2ZO4A 4C2UA 3JRDA 5HLTA 2CQXA 5CVIA 1MW2A 1WJBA 2VKHA 2Y75A 4Y67A 1NG6A 1ZLKA 2R7UA 1BOBA 1E17A 3WTXC 4A3FJ 2BHZA 5EGOB 5HS7A 1U78A 4QUOA 1FOKA 3FM5A 1QHGA 3I3LA 2V1UA 1XGNA 2MW8A 1X1CA 1QZZA 2LF8A 2EV5A 2L7ZA 2R7SA 1JI8A 2EV6A 4C2MJ 1JE8A 2RREA 2X9DA 1N25A 1PUEE 1UAAA 3S8PA 2QBYB 4J00A 1FNNA 3IIEA 3HPHA 1VZ0A 3KEOA 4CCKA 2K7LA 2Z5UA 3G1MA 2DT5A 3MMYB 5IP9J 1S7OA 2BVLA 2WV1A 2OCEA 5HOOA 3H35A 1JVSA 2XF6A 4XM3A 2W85A 3A02A 3BPVA 3Q0UA 4V2GA 1Z6TA 4MQ9F 3Q3SA 2L2OA 4KMUX 4EV0A 2LBFB 2ZFWA 2B0LA 1F43A 2L7KA 2DYSH 1SD5A 3WE3A 3I58A 1S72I 1O57A 4G8XA 1XTAA 1RNLA 4ZZDA 1ZARA 5DCMB 3RJPA 4XNAA 4C9YA 1D1CA 1MJAA 3DTIA 2JA5J 4C3JJ 5CVUA 1MIJA 3L2QA 4IOAF 3B7RL 3LSKA 1G8XA 2ZFUA 4UB8C 4BQNA 4O5VA 2O03A 2HTSA 4ZDPA 4FE4A 3DEUA 3LSRA 3CF5F 3SEZA 4JP0A 4RAZA 1SVOA 3EQLF 3U1DA 1Z0XA 3BG9A 3A01A 4XN2A 1IXSB 2CYYA 2DA4A 4DNCA 1LKXA 4PU2A 3OYDA 3CHRA 2QLZA 1IN4A 3OY9A 2DA2A 3VODA 3S3MA 2IP2A 3Q9VA 4ZW7A 2DXIA 1K78B 4XN3A 4PJJA 1A6IA 2HVSA 3M8EA 1K4TA 3LNQA 3B02A 5J1RA 5E3OA 4RVBA 2DJNA 3BZKA 4XN4A 1ENHA 4PK4A 2X1DA 3UCQA 2FBHA 4B3XA 2DODA 2RJIA 1T1RA 4BL0B 2PBIA 2JSPA 1BR1A 3VDXA 3FU0A 1QU3A 2K9QA 2O9LA 1X2MA 1BJZA 3DXJF 4XL9A 1LUJB 4D0PA 4MO7A 4FLRA 3K2ZA 1GHCA 2XPVA 1FOXA 3BY6A 4AD9A 3DBRB 5KAIC 3WHCA 2O5RA 4XN5A 4J19A 2KPMA 5J4YA 2CMPA 5E1XA 3ZMUA 1LDKB 1UHWA 1LJ9A 5LBQA 2E1MC 2DMTA 1K61A 1B8IA 3ZMZA 1I27A 3DPLC 4I76A 2VE9A 1JJ8C 1ZS2A 1R0KA 4HLXA 2HYJA 1GW6A 2QQ8A 3U1KA 3HSRA 2GWRA 1WSUA 5EEHA 1MD0A 1EV7A 1LFBA 3HSFA 2C5ZA 1JUMA 3GFIA 4F7ZA 1YIOA 2WAQN 4P96A 4UVCA 1BC8C 3GTGJ 3L00A 3S3OA 2EH3A 2LVSA 4L9NA 4RBOA 1MNMC 3FH7A 1I1SA 3FH5A 3VSKA 2VQGA 4LB5A 4LG3A 4U0WA 1F36A 3OYHA 3CCEI 1LFUP 4LJZF 2JJ7A 3HRMA 1YS7A 2J5PA 3BLYA 2XROA 2EIJH 2F4IA 2OQRA 2EFOA 3CDIA 3ZHZA 3CF2A 3QYBA 3ABTA 2M1BA 4I98B 2JD1A 3CMYA 4KDPA 1U2WA 2NS7A 3TP0A 3TW7A 2OD5A 1OYIA 1FMVA 2FBKA 2XF5A 4HV6A 1KQ9A 3KZIC 3S32A 5FO5A 3UERA 1RETA 4GYGA 4BYYA 5E79C 3EYIA 1FP2A 4QPOA 2M0MA 5HS9A 2ADUA 2YU3A 4BQAA 1WH5A 2DQRA 1YX3A 4MEYF 1PUFA 3S14J 1BA5A 1I50J 4D1QA 3PIOF 5F04A 3PL8A 1E3HA 3GTOJ 3Q9SA 2JT1A 3LFUA 5JNLA 2FNPA 3HHHA 3QPHA 4E4HA 5K7ZA 2DA6A 1BM9A 2RDPA 1A31A 1WVRA 2WZFA 1T38A 4E7SA 4XKBA 2E36A 2YR2A 3LMMA 4ARFA 1FC3A 2OZUA 2FEZA 1U0JA 2FQ4A 2VQLA 1WJ5A 3KFWX 4D5FA 1QRYA 5K7FA 1X1PA 5GAHJ 1HLVA 1G4DA 2DFEA 1USSA 3VVLA 5B1AH 2BV6A 2EK5A 4HF1A 4B47A 4AYSA 3RPUD 5FKKA 1V5GA 2IJLA 2DN0A 4WXHA 1BI3A 2M3AA 5CPRB 4BXXJ 2DJIA 1LNWA 3H1CA 2JUGA 2FMLA 2DBBA 3ZI0A 4C30A 3G3ZA 5EZGA 4OWRB 4YIRX 1ZR2A 1FSEA 2X85A 3DEWA 2DMNA 2LRDA 2KDOA 3R0IA 2RC4A 4P1WA 4OINF 1YS6A 3IAS2 4CA0A 3JRAA 2V6EA 4RGUA 4OMYA 2MGQA 2A7OA 2IT0A 1UFMA 5LHIA 1B72A 1G3WA 1K6YA 4M74A 4Q47A 1TWFJ 2LR8A 5HLHA 2MFZA 4EMSA 2CQKA 4GYIA 4FETA 1IC8A 1W36D 3M07A 4FLOA 4HPQA 2QSFX 4R5XA 3B6AA 3JSZA 1I6XA 1L0OC 2XUBA 3JAMK 1IG7A 2L4MA 4PJ0C 3IL2A 2PGGA 3HUGA 2XPWA 3J7ZI 3FZVA 2HPTA 4LITA 5IOZA 4RB2C 2KISA 1TZLA 3D5LA 1HS6A 5LD2C 1TNSA 3B7SA 4IF4A 2L7MP 3IV5A 1JKQC 3CP2A 2G9WA 2M8EA 2KDZA 3BR6A 1IRXA 1A04A 4ENJA 1V3FA 5BPPA 2K4BA 4JYKA 1JJ6C 1LPQA 2ME0A 4V19K 3LQQA 4BACA 3PM1A 4FLQA 4YFKF 2CJJA 2LSOA 2HKOA 4DJAA 1HW2A 3WG7H 4NB5A 5ERIA 1RRJA 5ILSA 5LEJA 2JVHA 4I02A 4OU0A 4FT8A 1QHHD 2IGOA 3JW4A 2QWWA 1G59A 3KX2A 1XN7A 1D0XA 2GXAA 3M1EA 5EYRA 3TOAA 4U87A 4R1HA 1UCRA 2BY3A 3MCZA 3RPQA 3CXBA 2DFFA 2MBFA 3CUQC 2EFWA 5JMWA 5AENA 2RNJA 5GPCA 3EUKL 2P4WA 2PL5A 1BW5A 3L9FA 2K40A 3BG3A 3K6GA 2M9HA 1LFPA 2BEOA 2VIXA
chains in the Genus database with same CATH topology
4J3BA 4BQQA 4XN7A 1SQMA 4XO3A 1D0YA 3BC8A 2E60A 3F9KA 4E7KA 4JNDA 3FBNB 2W7NA 3D5SC 4PVBA 4K5MA 3HPGA 4E7JA 4PW4A 3K4NA 3OR1C 3S93A 1ERDA 3FUHA 3FTYA 1X1AA 4XO4A 2C82A 1PJRA 2JA2A 3LSMA 4AYBA 3ZCOA 1Q0QA 3J7AY 4XNFA 3L2UA 3FUKA 1DGRM 4BJ6C 2KQRA 2R7XA 4K5LA 4BKXA 4MS6A 2JD0A 2R7TA 2Z2SB 4XO5A 3A4CA 3RC3A 2WADA 4ZTFA 2MD0A 4XORA 3CJRB 3C2HA 1N75A 3OMYA 3U21A 4ZQEA 2W4SA 2X6YA 4XOTA 5KCMA 3AKZA 4PJMA 4QPEA 4BS9A 1DGWY 2VXDA 3H0DA 2BVMA 3MKWB 4A03A 3D5RC 4F3QA 3PUBA 4R5VA 2LH9A 4CSWA 3OS1A 1X1BA 2WB1A 4Y6RA 3ANMA 3C2GA 2P0WA 2JD2A 4B44A 2IS2A 1X19A 1X1DA 5LFAA 1G5AA 3OYMA 1WJCA 4F91B 2HPMA 4XQFA 1WJEA 3QODA 3FTUA 3ZHYA 2CW7A 1X3WA 1UG0A 2XDVA 2XC7A 3BCAA 3B34A 4B48A 3JT1A 3A06A 3ZXSA 4LIUA 3RTRA 4Q4EA 4XMYA 2IGNA 4HEA2 4YELA 2ZXGA 3CIAA 5FRMA 3K10A 2WY7Q 3LSGA 3VYUB 3B37A 3Q44A 1Z3XA 3OYEA 2EGHA 1E0EA 2ZXHA 2BW3A 4Y6SA 3UEQA 2VJJA 2ZSIB 2Y0SA 1X3ZA 3MKZA 1T95A 2MAPA 3OIQA 2XPZA 5JHFA 5JAZA 1V5FA 3PNTA 4CH7A 2O7GA 2HNHA 4J01A 3LL7A 2LC2A 3RCOA 2DCEA 3OWTA 2DOAA 2V7FA 4KJZA 3FULA 2RQQA 2R4GA 3HOSA 3FU3A 3DU6A 4PFOA 3RSNA 4OOEA 2VB6A 2IGMA 3H9QA 4N4OB 2HVRA 3T8VA 3WQQA 1V5EA 1ONNA 3N05A 3OOUA 3A14A 4ZYAA 3KEYA 2KZVA 3PFYA 4XLFA 2Y1FA 4BXFA 2QJ1A 4ZDLA 2HQAA 3DEEA 3DQVC 1WJDA 3KYLA 4KITB 1K5HA 5JO0A 3SEQA 4K5OA 2K9LA 1X4OA 4ZN6A 4CUGA 4EATA 4F92B 1N77A 2CV1A 1T0FC 3DPTA 3PJRA 4BE0A 1EA3A 2MABA 5DLLA 1HA8A 2HPOA 2XQ0A 2HPIA 2V26A 4GAAA 3CJQB 2ZXIA 3HKZA 5DYFA 4XLEA 2GTQA 2KMUA 2WZGA 1J09A 2PJRA 2R72A 3RC8A 2Q2EB 3DKYA 3VYTB 4RLFA 4ZJZA 3L2RA 2UWMA 3OL3A 2V4JC 4C2TA 2M7AA 2VJ5A 3DKXA 5CKTA 4IKFA 4YRVA 1JGIA 4HRIA 4CXFA 2WAQA 4PUSA 2B61A 1TT0A 2PMZA 4DBQA 4XNBA 4PJNA 1Z21A 2XSJC 2Y1CA 3H9JA 4NUBA 4IX7A 4AICA 2VJ4A 4PSWA 1WFXA 2JCXA 4K5NA 4ZW6A 2JVGA 3H5NA 1YE9A 2OUMA 4PSXA 3OYFA 4E7LA 3CHPA 3FTXA 2IXSA 2WAEA 4Y33A 3H9GA 2L5QA 4DBRA 5HVQC 3T0YA 4ZC3A 4Q4IA 3MD2A 1OLTA 3VSLA 1W36C 2KHMA 2LG4A 1Y6IA 4BE2A 3ONQA 5FWQA 1FMWA 2W00A 5JC1A 4CCJA 4F93B 4C2UA 4DOZA 1MVYA 5HLTA 3FU5A 4XN1A 1MMGA 1MW2A 1WJBA 3QOEA 3K70C 2VKHA 2CUZA 4Y67A 1NG6A 4HNUA 3EUAA 2R7UA 1BOBA 2R70A 3FU6A 2MC4A 2E1MB 2LYCA 3A1YA 3FDYA 4E7HA 4R5TA 4QUOA 1QHGA 3I3LA 1P9QC 4NC8A 4B43A 2R7RA 2Q1ZB 3E1SA 2XF7A 1X1CA 3DWLE 3QYEA 3EPZA 3UNGC 4BJTA 4ZQTA 2R7SA 4RMNA 3PSIA 1JI8A 2ELJA 3QJXA 2RREA 1UAAA 1RP3A 3S8PA 4ZW5A 5KNLA 4J00A 4E7IA 3IIEA 3HPHA 4ITVA 1VZ0A 3BG6A 3FHEA 1MNDA 2LY1A 4CCKA 3FUEA 5HNHA 4CCNA 4XMZA 3CZLA 4CZCA 3MMYB 2R7WA 1DP3A 2BVLA 2CV2A 5HOOA 3H35A 1JVSA 3CHSA 2XF6A 4XM3A 1BR4A 4U7BA 3CESA 3CP8A 2L2OA 4AR9A 2LBFB 4OAZA 5KHDA 3AL0C 3HUGB 3CZ6A 3SZGA 4D9JA 2A5WA 2L7KA 2OC6A 3NWSA 4NC7A 5CQEA 3EBGA 2R7VA 2Z16A 4BEHB 3KEDA 4XNAA 3EBIA 4XMVA 4C9YA 1MMNA 1D1CA 3VWBA 3DTIA 3DPUA 1X4PA 1SFKA 2VXZA 4XKCA 2KL4A 4AR8A 2UV1A 1GLNA 1MMAA 3L2QA 3B7RL 4X0GA 1LVKA 1G8XA 2ZFUA 3LSKA 3CHQA 3FUDA 4NQWB 3OYJA 4BQNA 3FUIA 4JOMA 3OL4A 3ZR8X 4IQJA 4PJLA 3K4JA 4ZDPA 3OYIA 3V42A 2V1NA 4XKVA 4E6KG 3SEZA 3A2KA 1ONPA 2KP6A 4XN2A 3L2WA 4PU2A 1LKXA 3OYDA 1KONA 3CHRA 2VPLA 3OY9A 1MW3A 5DULA 3S3MA 4ZW7A 2DXIA 4YEJA 2KRCA 4F55A 4XN3A 3Q43A 4PJJA 2WA0A 3W2VA 2HVSA 2Y1GA 4Y4RA 3QYFA 3DTKA 2CS3A 4MLOA 4XONA 3AU9A 4RVBA 4XMTA 3VYSB 4AU7A 4FLSA 4XN4A 3BG7A 3SYTA 2FFLA 4PK4A 1MW1A 4L2LA 2X1DA 3SDBA 4GAEA 3UCQA 3W2WA 3CZEA 4RLQA 4B3XA 2RJIA 2ZSHB 3ZGKA 3CZKA 1T1RA 4BL0B 1D0ZA 3FHNA 1S9HA 3AFHA 2JSPA 1BR1A 3VDXA 1WJFA 1QU3A 3FTWA 1MNEA 5FROA 2F6CA 3FU0A 3ZHXA 4ZW8A 4AR1A 4DGWB 2DQ6A 4XL9A 2FUG2 1D1AA 3EUHC 3W3CA 4XR6A 4FLRA 4HSTA 4RM2A 3TMOA 5CQGA 1DQUA 2O5RA 3OYKA 4XN5A 3TBIA 2KPMA 2BOLA 4QHPA 4XN9A 2CMPA 4RM3A 3S3NA 2X51A 1LDKB 3AU8A 2E1MC 1D1BA 4BE1A 4HNTA 3DPLC 2QKLB 4XLAA 2LREA 1ZS2A 4FCAA 1R0KA 3WQRA 1T1SA 3CMMA 1GW6A 3FTZA 2UUZA 2HVQA 2IS1A 2IS6A 2L9SA 2C5ZA 2JV7A 2AQEA 3K4MA 4XLCA 1SG7A 1H19A 3IP4B 3S3OA 2IGKA 2Z1DA 2W82A 4ZX5A 3GBGA 4IQ4A 3FH7A 3FH5A 3VSKA 2VQGA 4LG3A 3UR3C 2L9NA 3OYHA 4HSRA 3BLYA 2M4KA 3H5RA 3E0JB 3OYAA 2F4IA 3ZHZA 3CF2A 3QYBA 2XPYA 2JD1A 4HG2A 2A6TA 4XOPA 3OYGA 5JMPA 2X6XA 4QMEA 2E5ZA 1FMVA 2HU9A 2F5VA 4PFPA 2XF5A 3OR2C 1MW0A 1BR2A 2HZDA 3S32A 2R7QA 3UERA 2V9KA 4BDZA 4ZW3A 4DIQA 4N4NB 4QPOA 2M0MA 1OR7A 3HC7A 3DTEA 3OYBA 4RSYA 2BW3B 1PYVA 4CCMA 1R6RA 3TL4X 1YX3A 2K3PA 3HXLA 4DPRA 3LSHA 3PNVA 4D1QA 4XN0A 3OS2A 3PL8A 3DLAA 1Z3YA 4P5OA 3HL2A 4GRIA 3B2PA 3K4KA 3LFUA 4BU2A 1Q0LA 4ZX4A 2X1EA 3FKJA 5JNLA 4E4HA 3BCBA 1N78A 3DU5A 4G6TB 2M7BA 3H5AA 3IUOA 2WZFA 4LIVA 4E7SA 4XKBA 2QKMB 3LMMA 3I9V2 4ARFA 2K9MA 3M8JA 3OIPA 1Q0HA 4XNDA 1U0JA 2VQLA 1WJ5A 2VQCA 3VYRB 4KT6A 3ANLA 4BJ5C 3LSIA 4XLHA 3PUUA 4BUPA 2R59A 4XKWA 3FUNA 1R0LA 4R79A 1AA7A 4Y3OA 2VQHA 1UELB 1MMDA 2LOOA 4F52A 4OOFA 3K4CA 3VVLA 1JG9A 4B47A 4AYSA 1YX5A 3RPUD 4ZX3A 3OYLA 1WJAA 1V5GA 3PSFA 3OYNA 3AUAA 2Y1DA 4X2UA 2M3AA 4RCVA 4XN8A 5CPRB 2VASA 2MYSA 1OR7C 2JCYA 2DJIA 2X1CA 3FTSA 2JUGA 4KISA 3FH8A 4LUPA 4K5PA 3ZI0A 2Y1EA 2DQMA 1Z7LA 4C30A 2CH0A 3PNYA 5JBIA 4IZZA 4OWRB 3CHOA 2PUSA 3B2XA 4FASD 2X6WA 2PJRB 2X85A 4JQFA 3FUMA 2LRDA 3W2AA 4Y6PA 2KDOA 3R0IA 4P1WA 2MAOA 1MW7A 3IAS2 4ZX6A 4CA0A 2HDWA 2V6EA 2WAFA 2VJIA 2A7OA 4ZQHA 3L2VA 4OAYA 1K6YA 2NOJB 2K5CA 3OS0A 3B7TA 2MFZA 2KLOA 4ZQFA 2JCVA 2VL8A 2DT7B 1SAUA 4FETA 5TGTA 1W36D 2WPGA 2WBMA 4FLOA 4HPQA 2CV0A 4R5XA 2GOMA 3JSZA 3FUFA 3M1CA 1H3LA 4KP7A 2PGGA 2LBFA 4II2A 5FRNA 4XMXA 2RNGA 3HG9A 3CZGA 4BGDA 2M4GA 3FUJA 3WQSB 3K70D 1ONOA 2HPTA 4LITA 3AL0B 4BQOA 1SC5A 1TZLA 2I8DA 4AVZA 2CW8A 3D5LA 4BEHA 4CCOA 1HS6A 3RQ4A 3ZRGA 5LD2C 2VJ8A 4QPQA 4H4KC 3B7SA 2WY8Q 3ANNA 1ZELA 4ZTJA 5HNFA 4ZDOA 3FTVA 4CCLA 3EBHA 3CP2A 4XMUA 4NQWA 2DT6A 1IRXA 2E5NA 1S46A 2IS4A 5BPPA 3B7UX 4NNJA 4BACA 2LY2A 4FLQA 2CFOA 3IAM2 2GOXB 4DJAA 4R7LA 3B3BA 4QIRA 3HOTA 2JVHA 2OV7A 2KRHA 3U9WA 3G2BA 1QHHD 1Y56A 2CUJA 2IGOA 2XAUA 3NWTA 4XMWA 1G59A 5EV7A 3MKYB 3KX2A 3OYCA 1D0XA 1NG7A 4II3A 2AQFA 3ZQQA 4U87A 4E7ZA 3K4BA 3VVMA 5JMWA 2W1OA 4MKTA 4ZQGA 2R7OA 2VLAA 5AENA 2QVWA 3RASA 4ANJA 4BDYA 3EUKL 2PL5A 3FBIB 3K6GA 3K4LA 1LFPA 2VKDA 2VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  2VLA A;  5HNF A;  5HLT A; 
#chains in the Genus database with same CATH topology
 2L01 A;  2ISY A;  4XN7 A;  4XO3 A;  1GUU A;  3F9K A;  1ACI A;  4JND A;  4A6E A;  4AUX A;  2DYR H;  1OCO H;  4FHT A;  2A69 F;  3F8B A;  2DFI A;  1RUN A;  4K5M A;  3TKY A;  4PVB A;  2NVT J;  4G6D A;  3FUH A;  4XO4 A;  1H9G A;  2MLG A;  2E2H J;  5IP7 J;  2JA2 A;  4A5M A;  3E6M A;  2LK2 A;  2LMD A;  2XAJ A;  3FF5 A;  4HX4 A;  2P7V B;  1QPI A;  1DGR M;  3H3V K;  1HF0 A;  5DYM A;  3JRG A;  4MS6 A;  1LVA A;  3K9T A;  2R7T A;  2A6H F;  3WE2 A;  2FRH A;  3A4C A;  4XOR A;  3CO6 C;  3C2H A;  2KZG A;  2W4S A;  5L3F A;  3GTL J;  4A0Y A;  5KCM A;  1HKT A;  3WTZ A;  2HXI A;  1WI9 A;  2HXO A;  2ISZ A;  2COM A;  4AC0 A;  4G7H F;  1TWG J;  3PUB A;  1MSE C;  2LH9 A;  4Y6R A;  3P7N A;  3ANM A;  4LLG F;  4KNY A;  1ZRE A;  2IA1 A;  3N97 A;  2JD2 A;  2FX0 A;  4B44 A;  4XRS G;  2VT3 A;  3ZQL A;  1X1D A;  1G3Y A;  2ZKZ A;  3ZHY A;  5CLS A;  4KT5 C;  2GXG A;  1K83 J;  2OTJ I;  1X3W A;  1UG0 A;  1HOM A;  1TBX A;  4IJA A;  2XC7 A;  1MH4 A;  4WXD A;  3JT1 A;  3ZXS A;  3W6J B;  2EZK A;  2H6C A;  4A3L J;  5EJC A;  3LQR A;  5H20 A;  3CIA A;  2DK5 A;  3ASN H;  2M34 A;  2AHQ A;  3WGI A;  1SMY F;  3B37 A;  1Z3X A;  3FMR A;  1E0E A;  1QVU A;  1Y1V J;  2VJJ A;  3MZY A;  1X3Z A;  3KLN A;  1VQL I;  3TP3 A;  1AKH A;  2XPZ A;  1VQK I;  4I7H A;  4RGS A;  2VOD A;  1FP1 D;  3TO6 A;  3LA3 A;  1OJL A;  1T6S A;  2R4G A;  1BL0 A;  3RSN A;  1M1E B;  4N4O B;  3I64 A;  2ZB9 A;  3V8L A;  1BI0 A;  3NRV A;  4HOB A;  3OOU A;  1Z77 A;  1DU0 A;  1W1W E;  1SMT A;  3TDZ C;  3IWZ A;  2KZV A;  2P6T A;  2HOS A;  3PFY A;  2H1K A;  5E8G A;  4MIM A;  4ZDL A;  3DEE A;  4B4C A;  1J0R A;  2ID3 A;  3SFI A;  5ICF A;  3RKW A;  4KIT B;  5JLW A;  2PLY A;  4U0V A;  2ME6 A;  2LD5 A;  2K9L A;  4UVA A;  5GP9 A;  1N77 A;  2K4J A;  3DPT A;  3FHZ A;  3PJR A;  3S2H J;  2ESN A;  2OJE D;  2MAB A;  1FZP B;  5DLL A;  1ZRD A;  1VQ4 I;  1W0T A;  2HPO A;  4GAA A;  5LHH A;  4DYQ A;  3CCY A;  2R5Y B;  5DYF A;  1MKM A;  4IHX A;  1Z6R A;  5FKL A;  1S7E A;  3SXY A;  5J1Y A;  2Q2E B;  3L2R A;  1H9T A;  1TWH J;  2BE5 F;  3P9K A;  1AOY A;  4A6D A;  1KYZ A;  2V4J C;  2E2J J;  5JR3 A;  3DKX A;  3I59 A;  1JGI A;  4XK4 A;  4CXF A;  2VKE A;  3ABM H;  2ZJP F;  4PUS A;  3HOZ J;  4L18 B;  3DF8 A;  4DBQ A;  2ZC2 A;  4WWC A;  5EG0 B;  1R58 A;  2ELH A;  3H9J A;  4IX7 A;  2VJ4 A;  1WFX A;  3IH3 A;  2FF4 A;  2JVG A;  3BQY A;  3PUF A;  4PSX A;  5HLG A;  1MBF A;  4Y33 A;  2EJR A;  3F8M A;  3KEQ A;  5HVQ C;  3LA2 A;  3I0T A;  4ZC3 A;  4S05 A;  1TQM A;  5E20 A;  3K2A A;  3S1Q J;  4XSX F;  2KHM A;  2LG4 A;  4B8X A;  1Z91 A;  3ONQ A;  2EPF A;  1FMW A;  4WX9 A;  4HLY A;  3T5X A;  2O8K A;  3MQ0 A;  4LD5 A;  1FTZ A;  4DOZ A;  4XN1 A;  1KQ0 A;  1FEX A;  2P81 A;  1O7L A;  1STZ A;  3M8F A;  1JTY A;  3AG2 H;  3K70 C;  4HNU A;  1FOW A;  4XRM A;  1ZGJ A;  4X6A J;  2R70 A;  1MBE A;  3WGG A;  2LYC A;  1ONV A;  3A1Y A;  5LHG A;  2N8G A;  1EKE A;  1P9Q C;  1T2K A;  4B43 A;  2P8T A;  3E1S A;  2WV0 A;  3EPZ A;  3K7A J;  3UNG C;  4AYB N;  4ZQT A;  2R5Y A;  4OIQ F;  5J1U A;  1IXR C;  4ZYG A;  2ELJ A;  3HOX J;  1SFO J;  1WI3 A;  3KZZ A;  5E8I A;  2Q2E A;  5KNL A;  1T8I A;  2ZME B;  4HX8 A;  1AHD P;  1GVD A;  4ITV A;  1ETV A;  5CJ9 A;  2XPU A;  1J59 A;  4XMZ A;  3CZL A;  4IL6 C;  4CZC A;  2OU2 A;  2VT2 A;  1K79 A;  3WHB A;  1S7A A;  1DP3 A;  3RZD J;  2OPT A;  1UG2 A;  1BR4 A;  3CES A;  4O6J A;  1ZK8 A;  2WB1 N;  4HV5 A;  3MKL A;  3SQN A;  4B09 A;  4ESF A;  3SDG A;  3BJA A;  3E5Q A;  3F8F A;  2F2E A;  3NWS A;  3T8R A;  1T0F A;  5IT3 A;  3EBG A;  2PMU A;  1VQ5 I;  3DPU A;  1X4P A;  1OIS A;  2GQQ A;  1LE8 A;  3I4P A;  4X0G A;  1FJL A;  4NQW B;  3OYJ A;  2XKO A;  3FUI A;  1J5Y A;  3OL4 A;  1ZLJ A;  3ZR8 X;  2L9R A;  4PJL A;  2V1N A;  4E6K G;  3KP6 A;  2KP6 A;  4LLL A;  1FWZ A;  3L2W A;  2K27 A;  3CMA I;  3GXO A;  1A6Q A;  2VPL A;  2Y0S N;  1MW3 A;  1B6A A;  3G1L A;  5A2Q Z;  1W5C C;  3VB2 A;  4ENN A;  4YEJ A;  1GXQ A;  4F55 A;  1W5T A;  2WA0 A;  3F6O A;  4BY1 J;  2VON A;  1BBY A;  1YOV B;  1JUP A;  2P6S A;  3ZQ7 A;  1OCZ H;  3QYF A;  3DTK A;  4MLO A;  3HJE A;  4S0H B;  4GXO A;  3AU9 A;  1HST A;  4AU7 A;  4FLS A;  2NS0 A;  4UUV A;  2A05 A;  2DU9 A;  2DAO A;  5D5U B;  2FJ1 A;  1W7P A;  2FFL A;  4L2L A;  4GAE A;  3W2W A;  3CZE A;  1B59 A;  1HQC A;  2W48 A;  2ZSH B;  3PFI A;  1D0Z A;  4M73 A;  3ZHX A;  2A5Y B;  1MNE A;  4AR1 A;  4RB1 A;  2W57 A;  2DMQ A;  5F0F A;  3FXU A;  1YG2 A;  3H92 A;  4RM2 A;  2KJB A;  3GZ6 A;  5CQG A;  2EA4 A;  3CC7 I;  2GZW A;  1P92 A;  3OYK A;  3JRF A;  5FD5 A;  2EZL A;  2BOL A;  1IV6 A;  4RM3 A;  4XRF A;  3DLL F;  4BE1 A;  4HNT A;  3C2B A;  2EV0 A;  3GZ5 A;  4A3E J;  2XV4 S;  5E18 F;  1BIA A;  1FT9 A;  2VE8 A;  5LGN A;  3K1M A;  5GAG J;  4S04 A;  2AQE A;  5M5W J;  2HYF A;  3IP4 B;  1NTC A;  2VC0 A;  2E1O A;  1YJW I;  1EF4 A;  1XMK A;  2W82 A;  4MHG A;  4ZX5 A;  4IQ4 A;  5GTI C;  4RA2 A;  5DD4 A;  2O3F A;  2L9N A;  4HW0 A;  4HX7 A;  2OTL I;  2M4K A;  3H5R A;  1IRZ A;  3E0J B;  3OYA A;  4FTH A;  1FTT A;  5TIS C;  2EA2 A;  4RB3 C;  2XPY A;  2DFH A;  2P5V A;  2A6T A;  4XOP A;  3CC2 I;  5D5V B;  3ABL H;  1GV2 A;  2F5D A;  2X6X A;  1SEU A;  4QME A;  4LFU A;  3R0J A;  3KP5 A;  1R1T A;  4LMY A;  5FLX K;  1R5I D;  4GDF A;  2DA3 A;  1I3A A;  3BR2 A;  2R7Q A;  3V4G A;  3V8J A;  2V9K A;  3BTL A;  1YW9 A;  4N4N B;  3MAJ A;  2D1H A;  3HC7 A;  3OYB A;  1VF9 A;  2BW3 B;  3GYH X;  1P4A A;  1ODD A;  2K3P A;  1POG A;  2RKH A;  2VUM J;  1MJ9 A;  1F4K A;  2BY1 A;  5GTH C;  4DPR A;  3PNV A;  1HBX G;  4KIC A;  1VQ8 I;  2B7E A;  3DLA A;  2R0Q C;  3HL2 A;  3B2P A;  4BU2 A;  1Q0L A;  2X1E A;  2DMP A;  3WU2 C;  3BCB A;  4G6T B;  1RES A;  3IUO A;  3V7R A;  3MZ8 A;  1XD7 A;  2O7O A;  2K9M A;  3QPS A;  4A3D J;  3OIP A;  2F5E A;  1IO2 A;  4XND A;  4FCY A;  4CYC A;  4KT6 A;  2STT A;  3ANL A;  4JK1 X;  3WU0 A;  1JT0 A;  1H89 C;  4XLH A;  1FY7 A;  3J80 K;  4M9S A;  2Z3Y A;  2K3F A;  3T8T A;  4Y3O A;  2QQ9 A;  2VQH A;  5KVR A;  2LKX A;  2LNB A;  1MMD A;  2LOO A;  2V9V A;  4F52 A;  5K7H A;  3EUH A;  1ON1 A;  3GO5 A;  3MEX A;  1JG9 A;  5HS8 A;  4HBL A;  1JUS A;  2CSO A;  5H2F C;  1I5Z A;  1WJA A;  2L7F P;  1JHF A;  3OYN A;  3JRI A;  3AUA A;  1MBG A;  4RCV A;  3ZMD A;  1OR7 C;  2QSG X;  1SFX A;  1IW7 F;  3FH8 A;  3ABU A;  4ZYE A;  5EGO A;  4K5P A;  2Y1E A;  3U9G A;  4AM3 A;  2DQM A;  3BZ6 A;  1V55 H;  3PNY A;  5D8L B;  4C3I J;  1SC7 A;  4IZZ A;  3CHO A;  5JBI A;  4MFE A;  2JRM A;  3TO7 A;  2X6W A;  2JA7 J;  5D5X B;  4JQF A;  4Y6P A;  1MW7 A;  1X3U A;  4ESB A;  1SD6 A;  2QBY A;  1S5L C;  1IDY A;  2VJI A;  1VQ9 I;  1UMQ A;  1LB2 A;  3F72 A;  1UST A;  2R7D A;  3OS0 A;  3KE2 A;  6PAX A;  3GTM J;  5AON A;  2VL8 A;  4HZF A;  1B1B A;  5J40 A;  1K6O A;  2WPG A;  3CO7 C;  4CO8 A;  5ICG A;  2WBM A;  4CIC A;  4ENK A;  5DUI A;  2E1N A;  2CV0 A;  2MG4 A;  1U6G A;  3M1C A;  2LBF A;  4II2 A;  4XMX A;  1MDM B;  2BHY A;  2MC3 A;  3CZG A;  1RUO A;  1UHS A;  4L9T A;  3K70 D;  3HDD A;  2R93 J;  1ONO A;  4GGG A;  4BQO A;  1SC5 A;  4AVZ A;  2I8D A;  1RC9 A;  4ETS A;  3BJ6 A;  4CCO A;  5DCM A;  3ZRG A;  3ML6 A;  1ZTR A;  5BPI A;  2HEO A;  1ZEL A;  2YX7 A;  4ZTJ A;  4UVB A;  2Y0M A;  2ZXJ A;  5FKM A;  3FTV A;  1YIT I;  1O3Q A;  2PEX A;  2QF7 A;  3IKT A;  2O8X A;  1D5V A;  5EZH A;  4R8H A;  4UNO A;  2HOE A;  3JRB A;  3B7U X;  4ON0 A;  1HDP A;  3B6C A;  2LY2 A;  1WRJ A;  4MNU A;  4R7L A;  1P4X A;  4DYR A;  3JSO A;  1ON2 A;  2OV7 A;  1K78 A;  1RIO H;  4I0B A;  2ECB A;  1XB4 A;  3Q5F A;  5GAD J;  3AG3 H;  2E71 A;  4II3 A;  2AQF A;  3ZQQ A;  4E7Z A;  4KIG A;  4MKT A;  4ZQG A;  2Y69 H;  5JHU A;  2VLA A;  1FOY A;  3C1D A;  3K4L A;  3R0A A;  3BDD A;  2YUS A;  1ETO A;  2JQ7 A;  3WG9 A;  3GZN B;  4J3B A;  4FE7 A;  4BQQ A;  4CZZ A;  2I10 A;  4LK1 F;  2E60 A;  1MDM A;  2VBW A;  5D6E A;  1VFC A;  2QVO A;  4E7J A;  4PW4 A;  1NH3 A;  1ERD A;  1ETY A;  3OR1 C;  3S93 A;  1U9N A;  3TQN A;  1X1A A;  5JFR A;  2VKV A;  2PQ8 A;  2BY2 A;  2UZK A;  2IVM A;  3ZCO A;  4XNF A;  3L2U A;  3FUK A;  2EZH A;  4BJ6 C;  2R7X A;  4K5L A;  2M5W A;  2Y30 A;  4EJO A;  4BH9 A;  2DOE A;  1HC8 A;  1U5T C;  3RC3 A;  2WAD A;  3FXL A;  1KZH A;  1ZAO A;  1YQA A;  4I99 C;  5B66 C;  4QWQ A;  4DW6 A;  1C0W A;  4WXC A;  1IN8 A;  4PJM A;  4BS9 A;  1JT6 A;  2FD5 A;  3H0D A;  2EWN A;  1I39 A;  2ECC A;  2DLL A;  4R5V A;  1OMI A;  3C2G A;  4I0A A;  1E2X A;  1YW8 A;  1SVL A;  3BR3 A;  2R92 J;  5DCF A;  2DA5 A;  3F23 A;  1G5A A;  3OYM A;  3FTU A;  1TLH B;  2DMU A;  3QOD A;  5J4V A;  2TDX A;  4OOI A;  2CW7 A;  2HKX A;  5LEK A;  2XDV A;  2JMW A;  4Y17 A;  1KYW A;  4B48 A;  4Y13 A;  2XRN A;  3NEU A;  1YFH A;  2B63 J;  2ZXG A;  5BQT A;  2D5V A;  4HQE A;  3VYU B;  1HXD A;  3H3U A;  1JGG A;  1XGO A;  3FXQ A;  5J6X A;  4YIF A;  3RPU A;  3OYE A;  2ZXH A;  1VQO I;  2EGH A;  3UEQ A;  3FXM A;  2MAP A;  3WGH A;  3U2R A;  4IEJ A;  2O7G A;  1FX7 A;  2E7W A;  1Z1D A;  3HGY A;  2GBY A;  3S1R J;  2Y48 A;  5D6F A;  2M2E A;  3RCO A;  2DCE A;  3OWT A;  1JKP C;  5KK1 A;  2V7F A;  1BJA A;  3FUL A;  5IT9 Z;  2H27 A;  1BW6 A;  2RQQ A;  4N9H A;  4ABZ A;  4G9Y A;  2VB6 A;  3CC4 I;  1V5E A;  4IHW A;  1ONN A;  4HYE A;  3N05 A;  2VC1 A;  1QO0 D;  1SAX A;  2BXZ A;  2KIF A;  1NHA A;  3CUO A;  5E3M A;  1DDN A;  4XLF A;  3SHF A;  2Y1F A;  4BXF A;  2QJ1 A;  5L3B A;  3GF2 A;  1R1U A;  1TTY A;  1IUF A;  1ORK A;  4QLC U;  4O3M A;  1HCR A;  2FSW A;  5JO0 A;  4K5O A;  1Z9C A;  1Y1W J;  5K5Q A;  3NAU A;  4EAT A;  3QP5 A;  4TV7 A;  2CV1 A;  3Q0V A;  1T0F C;  3JCU C;  1U8B A;  5HDG A;  4BE0 A;  5J47 A;  4U7D A;  5HDN A;  2NVX J;  3BR1 A;  4ESJ A;  2HPI A;  2V26 A;  4D7N A;  1R00 A;  1YLF A;  4Y52 J;  2XAS A;  3HKZ A;  2XQ0 A;  1TW3 A;  1Y0N A;  2VBZ A;  4XLE A;  1S29 A;  4UXN A;  2GTQ A;  1VQ7 I;  3QP6 A;  4M3F A;  2KMU A;  1APL C;  2JWT A;  2R72 A;  3DKY A;  3VYT B;  3BP8 A;  2XVC A;  3S2W A;  3OL3 A;  3E6D A;  5DD8 A;  3BTJ A;  5FJ8 J;  1ITY A;  1PP7 U;  4EM0 B;  2PMZ A;  4PJN A;  1Z21 A;  2IAI A;  5DEQ A;  2XB5 A;  2XSJ C;  2E35 A;  3FXK A;  3GME A;  4K5N A;  3CLO A;  3FTX A;  2HZT A;  2IXS A;  2KRF A;  1U8R A;  5ILV A;  3T0Y A;  3VEP A;  1ZHF A;  1OLT A;  2QSH X;  4OIO F;  3K1P A;  2BY0 A;  1A5J A;  1QPM A;  5M3F J;  4F93 B;  2JPB A;  2VBY A;  3K1N A;  1MVY A;  2Z9O A;  2BGC A;  1MMG A;  3CCQ I;  2EIK H;  3QOE A;  5F1R A;  3X2Q H;  2DO7 A;  3EUA A;  5C3E J;  2QYO A;  2LLK A;  5FGM A;  3FU6 A;  4EJU A;  2JRT A;  2MC4 A;  2E1M B;  1TC3 C;  4R5T A;  3L09 A;  4EGY A;  1T33 A;  1WH7 A;  4NC8 A;  1MBH A;  1QZY A;  2Q1Z B;  2XF7 A;  4Q5S F;  3QYE A;  1EH7 A;  4BJT A;  2XHK A;  3PSI A;  4GFB A;  1X58 A;  1MJB A;  2W24 A;  3RZO J;  3QJX A;  1RP3 A;  5C4X J;  4ZW5 A;  3OSF A;  4E7I A;  1XG1 A;  5E3N A;  1MND A;  3MWM A;  1R49 A;  1YJN I;  2VI6 A;  1R71 A;  2Y2Z A;  5B5E C;  4CCN A;  1S3J A;  5BMZ A;  2W25 A;  2CV2 A;  3CHS A;  2ZNY A;  5FFX A;  1P2F A;  2DPU A;  4PZJ A;  2M87 A;  3CP8 A;  2GXB A;  3COA C;  4AR9 A;  4OAZ A;  5HOD A;  9ANT A;  4P55 A;  3SZG A;  4D9J A;  1OPC A;  2KT0 A;  4I01 A;  4NC7 A;  1Z67 A;  2R7V A;  5IOY A;  4BEH B;  5FKO A;  3EBI A;  4XMV A;  3VWB A;  1MMN A;  2XGX A;  2FNA A;  5L3D A;  2VXZ A;  1GLN A;  3CHQ A;  1LVK A;  3FUD A;  3VOE A;  5FLM J;  2DPD A;  4JOM A;  3HIF A;  1TP4 A;  4XID A;  4IQJ A;  3K4J A;  3OYI A;  2O6G E;  3V42 A;  3KIO A;  3P9C A;  4G12 A;  4XKV A;  2YSR A;  4WK8 F;  3A2K A;  2DA1 A;  3E6C C;  3B73 A;  1BOA A;  3GWZ A;  1KON A;  1L3L A;  3N4M A;  3LSP A;  2PG4 A;  1ZGA A;  3CME I;  1U5T B;  2KRC A;  2EIM H;  4EEF G;  3Q43 A;  1R5H A;  1J7K A;  2ETH A;  2EZI A;  2OAZ A;  3O3K A;  3WOD F;  2YS9 A;  3JTH A;  4EM1 A;  1SD7 A;  2D2W A;  4XMT A;  1TW2 A;  1HW5 A;  2F5C A;  2VBX A;  2AXT C;  1VQ6 I;  2G7U A;  4LG0 B;  1WZ2 A;  3SYT A;  1IN6 A;  3SDB A;  2FE3 A;  2QZ8 A;  4MFD A;  4RLQ A;  2ZJQ F;  3CZK A;  1P6R A;  4RAY A;  2RVC A;  4BHP A;  3FHN A;  1S9H A;  4EVI A;  1JKO C;  3PIP F;  3FTW A;  4JX4 A;  5CVJ A;  5FRO A;  2HWV A;  1IAW A;  1QBJ A;  4DGW B;  2DQ6 A;  4ZW8 A;  1V4R A;  2FUG 2;  1D1A A;  2DA7 A;  3EUH C;  3W3C A;  4XR6 A;  1KU2 A;  2A61 A;  2AXL A;  3BQZ A;  5DM7 F;  4HST A;  3A0H C;  2FU4 A;  3KCC A;  5J8C A;  3CJT B;  2OF7 A;  4QHP A;  2Y9Z A;  4G6Q A;  3CQZ J;  3S3N A;  3GLL A;  3AU8 A;  3O8G A;  1D1B A;  2HS5 A;  3KP3 A;  2JA8 J;  1BI2 A;  5HDK A;  2QKL B;  4XLA A;  2CGP A;  2IA2 A;  1IXC A;  4IXA A;  4FCA A;  3WQR A;  5IYD J;  2UUZ A;  3T1B A;  2JV7 A;  3DFG A;  5D8K B;  2L4A A;  2DK8 A;  4KN7 X;  2IGK A;  1G3S A;  4WCG A;  3ZMV A;  3BOQ A;  3UR3 C;  5DDG A;  2R5Z B;  2JN6 A;  4HF0 A;  2QEX I;  1ZGW A;  1J2X A;  2ZJR F;  2A07 F;  4LG0 A;  2QA4 I;  3RYR A;  3S1M J;  1RR8 C;  3LFK A;  1D3Y A;  3RYP A;  3JRE A;  3BR0 A;  4HG2 A;  3ZN0 A;  2HOA A;  1FIP A;  2V6C A;  4YFX F;  1RKT A;  1WQ2 A;  2OCC H;  2IW5 A;  4W97 A;  4PFP A;  5J3L A;  1BR2 A;  2CUF A;  5C4J J;  2E2I J;  3GFJ A;  1S6L A;  3HOY J;  3K69 A;  4P9F A;  2UXX A;  4DIQ A;  4CYD A;  4RSY A;  3DTE A;  4CCM A;  1CQT A;  3TL4 X;  3PO2 J;  2JSC A;  3FXO A;  4HA8 A;  3C3W A;  1Z3Y A;  3HOV J;  4IRG A;  4ZX4 A;  3K4K A;  4LB6 B;  3F21 A;  2EBI A;  2EQR A;  3H5A A;  1FPQ A;  3HB9 A;  3KP4 A;  5EG0 A;  3CD6 I;  4LIV A;  2R3S A;  3CUQ B;  2YPR A;  3EYY A;  3M8J A;  2IPQ X;  2VOP A;  3GFM A;  1HKS A;  5F0C A;  2DQL A;  2VQC A;  1UB9 A;  2E34 A;  1T98 A;  3LST A;  4M72 A;  2L9V A;  3QPL A;  4BBS J;  4XKW A;  1ZG1 A;  1AA7 A;  3I71 A;  4HQM A;  1IN5 A;  1UEL B;  3BT9 A;  2EB7 A;  4OOF A;  3K4C A;  2K85 A;  3KP2 A;  1HW1 A;  5L3G A;  2QQB A;  1U3E M;  1GXP A;  1OYW A;  2X6O A;  5DM6 F;  3OYL A;  5BPD A;  3K0L A;  2FA5 A;  3HHG A;  1UHM A;  2BBY A;  1Q1H A;  2ZXW H;  2VAS A;  2JCY A;  1SVM A;  4KIS A;  1Z7U A;  4LUP A;  2NXN B;  1Z7L A;  2CH0 A;  3W6V A;  2L54 A;  3B2X A;  2CQ7 A;  4JX5 A;  4FAS D;  2PJR B;  5EDN A;  5GPA A;  1QQI A;  3FXJ A;  3V7S A;  2MAO A;  5F0H A;  1KU3 A;  2HDW A;  1MSF C;  4RS8 A;  3R60 A;  2WAF A;  1SFU A;  4ZQH A;  1O3S A;  2ZME A;  2K5C A;  1IF1 A;  5BS6 A;  1ZYR F;  2PN6 A;  2Z99 A;  3KZY A;  4UUS B;  2R7Z J;  2KLO A;  1FSH A;  2JCV A;  3B7T A;  1G3T A;  1LDJ A;  1RZ4 A;  2K02 A;  5LGT A;  1SAU A;  5F1J A;  3KLO A;  5FD6 A;  5TGT A;  4QTR A;  4M71 A;  4HNV A;  2GOM A;  1WKM A;  3QOP A;  2IBD A;  4XIC A;  3CUQ A;  2ICW G;  4ZYH A;  1H3L A;  1IV8 A;  4OIR F;  3DCF A;  4IHS A;  2RNG A;  1TQI A;  2M4G A;  3S16 J;  3WQS B;  2LKS A;  4IHY A;  1Z05 A;  2O61 A;  1QZE A;  4XBF A;  4HDV A;  3I4N J;  3LAJ A;  2WY8 Q;  3ANN A;  4UUT A;  5HNF A;  4ZDO A;  3VFZ A;  3EBH A;  1FBS A;  2BYV E;  2DT6 A;  4NQW A;  2BZT A;  5K5R A;  2E5N A;  1SAN A;  3BPX A;  3HGG A;  4UHT A;  5FLX Z;  1S46 A;  2IS4 A;  3PQJ A;  5ICE A;  4NNJ A;  3M7G A;  2CU7 A;  2EIL H;  2CFO A;  3IAM 2;  4OMZ A;  4ENM A;  3AG4 H;  1XGS A;  1ZKG A;  4PCQ A;  3B3B A;  4QIR A;  4XSZ F;  3NAR A;  2KRH A;  1P7I A;  1WWX A;  3RKQ A;  3ECH A;  1Y56 A;  2X4H A;  2XAU A;  3NWT A;  4XMW A;  5EV7 A;  4AIJ A;  3OYC A;  1NG7 A;  3S2D J;  4PGG A;  4Z6Y A;  4KIB A;  4U88 A;  2ACJ A;  2W1O A;  3BRO A;  2X48 A;  1LEA A;  3IWF A;  3O2P E;  1ZG3 A;  2QVW A;  1SFE A;  3RAS A;  4BDY A;  1GV5 A;  3AG1 H;  3L7W A;  1TL8 A;  2RGV A;  1BN5 A;  2VKD A;  3EDP A;  4DQ2 A;  2J5O A;  3J80 Z;  1D0Y A;  4L9J A;  3O6B B;  3R4K A;  1BIB A;  3BC8 A;  4MGR A;  3BJO A;  2LF7 A;  1R1V A;  3FBN B;  2W7N A;  2HYG D;  2ZJ2 A;  3D5S C;  4YII A;  3HPG A;  3KP7 A;  1VND A;  3J81 K;  1YI2 I;  3G6E I;  3H36 A;  1PJR A;  2C82 A;  1YW7 A;  1OCT C;  2ESH A;  2KQR A;  4D5C A;  1OYY A;  2A6E F;  3A01 B;  4XO5 A;  2Z2S B;  3HRU A;  2RQP A;  3IC7 A;  2H6B A;  1W5S A;  3BG5 A;  1N75 A;  3OMY A;  4ZQE A;  2L02 A;  2X6Y A;  4XOT A;  3E7L A;  2QUF A;  3AKZ A;  3WTY C;  2TCT A;  3IHU A;  4QPE A;  1JGS A;  1DGW Y;  2XAH A;  2BVM A;  3D5R C;  3MVP A;  4F3Q A;  3IH4 A;  1PVE A;  2GLO A;  3OS1 A;  2KFD A;  3F6V A;  5E1Z B;  1BC7 C;  2GIV A;  4G7Z F;  2VOO A;  3TOB A;  4AID A;  1X19 A;  3HRS A;  4BHC A;  5LFA A;  1J75 A;  1O7F A;  5FLV A;  2JTV A;  3G1O A;  3CCM I;  2HPM A;  4XQF A;  2H8R A;  3J7A O;  2JZY A;  2NVY J;  5K1Y A;  1ETQ A;  1XSV A;  1XX5 A;  2ZNZ A;  3Q0W A;  3A06 A;  1XMA A;  3R61 A;  4YEL A;  3TGN A;  5J8F A;  2H1L A;  5FRM A;  3MZH A;  4BHB A;  3SFZ A;  2WY7 Q;  3DBL B;  3GTK J;  4Q4Z F;  3FK6 A;  3Q44 A;  5L3C A;  3PQK A;  4IVN A;  1Q1V A;  3BZC A;  2BW3 A;  2DTR A;  1B4A A;  2GA1 A;  3CDH A;  4Y6S A;  3ASO H;  3F8N A;  3OIQ A;  1B8I B;  1V5F A;  3PNT A;  4CH7 A;  1XC5 A;  2HNH A;  3L1P A;  4J01 A;  3CJN A;  3LL7 A;  2STW A;  4A69 C;  2DOA A;  2LFB A;  3CCL I;  4A3I J;  4JX6 A;  4KJZ A;  1ETW A;  2E7X A;  4P9U A;  2NVQ J;  1I6H J;  4RGR A;  3HOS A;  3G73 A;  3DU6 A;  1FYL A;  3FU3 A;  1JKR C;  3WQQ A;  2IGM A;  5D4S A;  4ZYD A;  2IRF G;  3T8V A;  2F4O B;  5FB2 A;  2IEK A;  5M3M J;  3A14 A;  3GTJ J;  4ZYA A;  3TED A;  3KEY A;  1QVT A;  4HF2 A;  3JTG A;  2FBI A;  2ZBK A;  3LWF A;  2HQA A;  3DQV C;  2DDA A;  1VI0 A;  3ZQI A;  3KYL A;  2NOG A;  3SEQ A;  1CGP A;  4EJV A;  2GM4 A;  1LDD A;  1H88 C;  1X4O A;  2ID6 A;  3KYC B;  5D4R A;  2LKP A;  2M30 A;  3V8K A;  4I6Z A;  4E70 A;  3HTS B;  3LA7 A;  1F9N A;  2PJP A;  3GFL A;  4DYC A;  2F4M B;  2MLK A;  1D5Y A;  2H8W A;  4WF2 A;  1J09 A;  1NK2 P;  1IDZ A;  1WGX A;  4UV8 A;  2YX4 A;  1FBU A;  5EF6 A;  1PUF B;  2H94 A;  2UWM A;  2PFB A;  4Q48 A;  4IKF A;  5GAE J;  2FOW A;  3FWE A;  4YRV A;  4FX4 A;  1A36 A;  1XMX A;  3E6B A;  2WAQ A;  2DTZ A;  3HM5 A;  3SJM A;  3LOC A;  4N9I A;  1TT0 A;  2KIQ A;  3DKW A;  5AIQ A;  2Y1C A;  2OA4 A;  2XRL A;  4A2U A;  2OUM A;  1YE9 A;  1TWC J;  2MSY A;  3HRT A;  2WAE A;  3FX3 A;  1KQ8 A;  3H9G A;  2M45 A;  3ZMT A;  2L5Q A;  2L3D A;  3RI4 A;  2P7C B;  4DBR A;  5IP6 A;  4Q4I A;  2V79 A;  3VSL A;  1K7A A;  4KYW A;  2MD5 A;  1Y6I A;  4BE2 A;  5FWQ A;  5JC1 A;  1HKQ A;  4L0Y B;  3HZJ A;  4PDK A;  2XGC A;  3FU5 A;  2V1X A;  5E1W A;  2CUZ A;  3L2C A;  1K4S A;  2CO5 A;  4EJW A;  4MTE A;  3FXR A;  1V54 H;  4XRS A;  3FDY A;  3IRR A;  4E7H A;  1XCB A;  2KIM A;  4UY8 I;  2R7R A;  4EQQ A;  2HGC A;  3DWL E;  1F1Z A;  2NYX A;  3TO9 A;  1H0M A;  1XDS A;  2XKP A;  4RMN A;  3BTI A;  3OOP A;  4NHJ A;  2IA0 A;  3O8H A;  3CCV I;  2ZCW A;  4M6Y A;  1I3Q J;  1FLI A;  3M3Y J;  2C6Y A;  2Q0O A;  3F8C A;  5DUK A;  1LEB A;  1B72 B;  2GAU A;  2AO9 A;  3GVA A;  3SZP A;  2WWY A;  3E3V A;  3BG6 A;  3FHE A;  2LY1 A;  3ZP5 A;  2E1C A;  4OIP F;  3FUE A;  1FBQ A;  5HNH A;  2OBP A;  2R7W A;  4MTD A;  3JSP A;  2Y9Y A;  1T08 B;  1EH8 A;  5B1B H;  3DV8 A;  3ZQG A;  1HDD C;  4I2O A;  3ROU A;  3JAM Z;  4U7B A;  1DPR A;  2M0C A;  1S8N A;  3MN2 A;  4QIW N;  5JLX A;  1MBK A;  3CTA A;  1JXS A;  5KHD A;  3J7Y J;  1RKW A;  3JRH A;  3AL0 C;  3HUG B;  3CZ6 A;  4B3A A;  3KPH A;  1ULY A;  2A5W A;  2OC6 A;  4A93 J;  5M5Y J;  3ECO A;  5CQE A;  4LGW A;  2ELK A;  3HTU A;  5H6R A;  1AU7 A;  1OKR A;  2Z16 A;  4G94 A;  2QGU A;  3KED A;  2R7F A;  2V9P A;  4EGZ A;  2CQQ A;  3OIO A;  2FXA A;  5F08 A;  1MBJ A;  1SFK A;  4XKC A;  2XSD C;  2KL4 A;  4AR8 A;  2UV1 A;  1MMA A;  2W84 A;  4RDU A;  5ICC A;  4RGX A;  1VQP I;  3ERE D;  1OQY A;  1SD4 A;  1XS9 A;  1W0U A;  4YFN F;  1UZC A;  2FMY A;  2O0Y A;  2PI0 A;  4G7O F;  3KET A;  3ELK A;  5JVT A;  1ONP A;  1XCV A;  2CW0 F;  2CFX A;  2HR3 A;  1PP8 F;  5DUL A;  5L3E A;  3GTQ J;  1WPK A;  5ED4 A;  3W2V A;  2Y1G A;  4Y4R A;  4A5N A;  1U9O A;  3F3X A;  2CS3 A;  3ZQC A;  4XON A;  3VYS B;  4DZJ A;  3BG7 A;  1MW1 A;  1MMS A;  4HAM A;  2NRA C;  3ZGK A;  3AFH A;  4A3K J;  1WJF A;  3ZMS A;  1OCR H;  1GT0 C;  2F6C A;  4M3D A;  3ZQH A;  4IHV A;  5E3L A;  2RN7 A;  4AVP A;  1FYM A;  3FMQ A;  2HDD A;  3A03 A;  3P5J A;  2P5L C;  3HW2 A;  2I5U A;  1MGT A;  1GDT A;  5FFZ A;  3TMO A;  4NDL A;  5B3S H;  2FQ3 A;  1DQU A;  2NNN A;  3TBI A;  3HYI A;  3S1N J;  4XN9 A;  1R23 A;  1IJW C;  1IUY A;  2X51 A;  5ILU A;  1P7J A;  1VQM I;  3I4M J;  3HKZ N;  2HOT A;  2LTP A;  4QSH A;  2NVU B;  2LRE A;  4BAY A;  4KIF A;  4L9V A;  3ISP A;  3QAH A;  4GO1 A;  3E5U A;  5JVG F;  4BBR J;  5EEA A;  3CMM A;  1T1S A;  3FTZ A;  2HVQ A;  2K9N A;  4N0B A;  2IS1 A;  3CCU I;  2CG4 A;  4PGH A;  2IS6 A;  4M3G A;  3JRC A;  2L9S A;  5F64 A;  1XPX A;  5IT9 K;  2Y31 A;  3K4M A;  4XLC A;  5AIP A;  2ZME C;  1SG7 A;  3S15 J;  1H19 A;  2PMZ N;  5C44 J;  2Z1D A;  3GBG A;  5F27 A;  1ZH5 A;  2Q8K A;  1KU9 A;  4HSR A;  5BOX A;  1R4N B;  5CVV A;  1RR7 A;  5FKN A;  2QM3 A;  1X3W B;  3QQA A;  4L5I A;  3OYG A;  1P4W A;  2DOF A;  5JMP A;  3TW6 A;  1YJ9 I;  2E5Z A;  4H0E A;  5CVR A;  2HU9 A;  1LQ1 A;  2F5V A;  4JBA A;  3OR2 C;  1X2N A;  2KJC A;  1ZG5 A;  1R9T J;  1YRN B;  2HZD A;  2F48 A;  1MW0 A;  1HSJ A;  4KUM A;  4BDZ A;  2GA2 A;  4ZW3 A;  1B9N A;  1IRF A;  2X0L A;  1I1G A;  2E19 A;  1OR7 A;  3HOU J;  4IHT A;  4RAG A;  5LRR A;  2CUE A;  1PYV A;  1OFC X;  1X3Z B;  1R6R A;  2OZ6 A;  2XAF A;  5M5X J;  1AKH B;  2V1D A;  2XGE A;  3HXL A;  2XGD A;  3LSH A;  3OS2 A;  4XN0 A;  1JTX A;  2P5K A;  4P5O A;  4GRI A;  3BWG A;  3C7J A;  3QU6 A;  3FM3 A;  3FKJ A;  1N78 A;  3DU5 A;  2M7B A;  4LOC A;  3EET A;  2A3S A;  1VTN C;  2CRG A;  5BNG A;  3M9A A;  5H6Q A;  2D1V A;  1REP C;  2QKM B;  3I9V 2;  1DPU A;  2RAE A;  1Q0H A;  3OV8 A;  3VYR B;  3QWL A;  2HI3 A;  4BJ5 C;  3FK7 A;  3LSI A;  3PUU A;  3E5X A;  4BUP A;  2R59 A;  3FUN A;  1TT5 B;  4R79 A;  3RIR A;  1R0L A;  3RKX A;  1Y39 A;  1FYK A;  1UJ8 A;  3I55 I;  1F5T A;  4M6V A;  3NQO A;  1YX5 A;  1TQP A;  4AIH A;  4ZX3 A;  1XDU A;  3PSF A;  2HDC A;  3GW2 A;  3WU1 B;  2BXY A;  2Y1D A;  1ZR4 A;  3WTU C;  4X2U A;  4YG2 F;  4XN8 A;  4XLN F;  2MYS A;  4Y7N J;  5IY5 H;  3I56 I;  4RB0 A;  2X1C A;  3GX4 X;  3FTS A;  4NC6 A;  5EEG A;  1YRN A;  2AS5 F;  4FX0 A;  5F6F A;  3OSG A;  2PUS A;  3VPR A;  5LLQ A;  3FUM A;  4HDU A;  3W2A A;  5E17 F;  4AWX B;  1R7J A;  2HQR A;  4ZX6 A;  1QNT A;  3IKV A;  4EM2 A;  1D8J A;  3I59 B;  1R5G A;  5TJJ A;  3L2V A;  4OAY A;  1EH6 A;  3M4O J;  2NOJ B;  1OCP A;  3F0C A;  2LY9 A;  2NAZ A;  5K5O A;  4ZQF A;  4BNC A;  2H09 A;  3UKG A;  3CCR I;  4LLN A;  2DT7 B;  4IPA A;  4Y15 A;  1T39 A;  3WTS C;  3ZOB A;  2NNY A;  1TNT A;  4A3C J;  3FUF A;  3I53 A;  4KP7 A;  4CDG A;  5FRN A;  3HG9 A;  2XIG A;  4BGD A;  3FUJ A;  3AL0 B;  3I5U A;  2CW8 A;  4BEH A;  4A3G J;  3RQ4 A;  2VJ8 A;  4QPQ A;  4H4K C;  1DU6 A;  3ZQF A;  2MH9 A;  2EFP A;  3IH2 A;  4CCL A;  4B1R A;  4XMU A;  2DDB A;  4M3E A;  2F5F A;  4MEX F;  3HSE A;  1JHH A;  3BTC A;  2JK3 A;  2OQG A;  1XSD A;  5JI6 A;  4A12 A;  2CQN A;  2GOX B;  5DS9 A;  4KFC A;  4KN4 X;  3IRQ A;  2LP0 A;  3HOT A;  1U5T A;  5DV5 A;  2XAG A;  1A35 A;  3G2B A;  1ZRC A;  3U9W A;  5DTD A;  2CUJ A;  2JA6 J;  3MKY B;  2G0E A;  3G4S I;  3W6K B;  3BR5 A;  3C18 A;  2FOK A;  1IGN A;  4FQG A;  3VVM A;  1H8A C;  3K4B A;  3S17 J;  2WTE A;  3D0S A;  3SZT A;  5IPA A;  1KA8 A;  4KA4 A;  2R7O A;  2M8G X;  3ZN1 A;  4L0Z B;  4ANJ A;  1NK3 P;  2HFH A;  1IZ1 A;  3REO A;  1ZQ3 P;  3FBI B;  5D5W B;  1SQM A;  3FIS A;  3R6S A;  1R36 A;  1YYV A;  4E7K A;  4IOC F;  4I09 A;  1KU7 A;  2QQA A;  3K4N A;  1LE8 B;  2K9S A;  4BXU A;  3FTY A;  5KAF C;  1IRG A;  4UV9 A;  2Z33 A;  4L5J A;  3LSM A;  4AYB A;  1Q0Q A;  3J7A Y;  1O3R A;  1EJ9 A;  1E3O C;  4BKX A;  5IYC J;  4M6X A;  1RPW A;  3ERM A;  3LSJ A;  2JD0 A;  3HBL A;  4X1E A;  1MH3 A;  3F22 A;  4ZTF A;  1YTY A;  1TWA J;  2MD0 A;  3CJR B;  3U21 A;  4ASN A;  3WTT C;  3RQI A;  4D7M A;  1G2H A;  2VXD A;  1RI7 A;  2COB A;  4Z2Y A;  3MKW B;  4A03 A;  3KYD B;  1BI1 A;  1ZN2 A;  4M9X A;  4CSW A;  1YIJ I;  1X1B A;  2WB1 A;  1CF7 B;  1O4X A;  2G7H A;  2P0W A;  1W7P B;  2R5Z A;  2IS2 A;  1WCM J;  4NBQ A;  3DBH B;  1WJC A;  4F91 B;  4AIK A;  1WJE A;  2QEN A;  3GCM A;  4BY7 J;  2EIN H;  1Y8R B;  2L0K A;  2HQN A;  4U0Y A;  2TRT A;  2MA3 A;  3BCA A;  3WTW C;  1AWC A;  3B34 A;  1KGS A;  4LIU A;  3RTR A;  2YU9 J;  4Q4E A;  4XMY A;  4DZP A;  3I54 A;  2IGN A;  2JUC A;  3QPT A;  2KIU A;  3CDL A;  4GCV A;  4HEA 2;  1QA6 A;  3GEZ A;  2XAQ A;  3K10 A;  3LSG A;  1ETX A;  3P9I A;  1FIA A;  1YHQ I;  2B9S A;  1ETK A;  2ZSI B;  1DP7 P;  2Y0S A;  3CCS I;  3WTV C;  1T95 A;  3MKZ A;  1IN7 A;  5JHF A;  2VN2 A;  5JAZ A;  1PDN C;  1D8K A;  5IYB J;  2QCO A;  3HEF A;  2LC2 A;  3MFK A;  3QRF F;  3TDU C;  2RV8 A;  1Y0U A;  3ESW B;  2WC2 A;  1G6N A;  5HLI A;  1W7P D;  2EFN A;  2VPR A;  2K86 A;  3GUD A;  4PFO A;  4IO9 F;  1QGP A;  2XB0 X;  3CCJ I;  5CYV A;  2HVR A;  3H9Q A;  4OOE A;  4FIS A;  4A0X A;  4LK0 F;  1WHU A;  4M3B A;  3RKY A;  2HQ5 A;  3AAF A;  3FIW A;  2PMH A;  2UXN A;  1CF7 A;  1Y8Q B;  4XLP F;  3FMS A;  4C3H J;  3H3Z A;  5LRS A;  2DI3 A;  5TRD A;  1WJD A;  1E3P A;  1K5H A;  2DW4 A;  3ULQ B;  1J9I A;  1OCC H;  4ZN6 A;  4CUG A;  4M9Z A;  4F92 B;  3ABK H;  1T56 A;  2D45 A;  3QU3 A;  1XSX A;  1EA3 A;  2CWE A;  1MZB A;  1HA8 A;  4A3B J;  4ZH4 F;  1B9M A;  3V7C A;  3D1N I;  3G71 I;  3CJQ B;  1R22 A;  2ZXI A;  4CGZ A;  4RAF A;  4UB6 C;  2HTJ A;  3HOW J;  3J81 Z;  4K2E A;  4IRH A;  1XGM A;  2WZG A;  2LDU A;  1YO5 C;  2PJR A;  3RDI A;  4KMF A;  3GLX A;  5A2Q K;  4A3J J;  3RC8 A;  4RLF A;  4ZJZ A;  3ZPL A;  1VQN I;  1GVJ A;  3PO3 J;  4C2T A;  4A0Z A;  2M7A A;  2VJ5 A;  5CKT A;  4HRI A;  4A3M J;  2JPC A;  2EFQ A;  4EJT A;  2MH2 A;  4MQV A;  2B61 A;  2KKO A;  4XNB A;  3FKI J;  4CHU A;  4UUS A;  1O3T A;  4NUB A;  2A68 F;  2PX9 A;  3CLQ A;  4AIC A;  3E97 A;  4PSW A;  4ZW6 A;  2JCX A;  4ZZL A;  3H5N A;  4E7L A;  3CHP A;  3OYF A;  3GTP J;  4L5E A;  3DP7 A;  1DUX C;  4W1U A;  4CYC B;  4IRI A;  1W4M A;  5LGU A;  3MD2 A;  1W36 C;  1ZRF A;  3LAP A;  3JR9 A;  3A0B C;  1R4M B;  4V2F A;  2NS8 A;  2W00 A;  2GIZ A;  4CCJ A;  3H0G J;  2ZO4 A;  4C2U A;  3JRD A;  5HLT A;  2CQX A;  5CVI A;  1MW2 A;  1WJB A;  2VKH A;  2Y75 A;  4Y67 A;  1NG6 A;  1ZLK A;  2R7U A;  1BOB A;  1E17 A;  3WTX C;  4A3F J;  2BHZ A;  5EGO B;  5HS7 A;  1U78 A;  4QUO A;  1FOK A;  3FM5 A;  1QHG A;  3I3L A;  2V1U A;  1XGN A;  2MW8 A;  1X1C A;  1QZZ A;  2LF8 A;  2EV5 A;  2L7Z A;  2R7S A;  1JI8 A;  2EV6 A;  4C2M J;  1JE8 A;  2RRE A;  2X9D A;  1N25 A;  1PUE E;  1UAA A;  3S8P A;  2QBY B;  4J00 A;  1FNN A;  3IIE A;  3HPH A;  1VZ0 A;  3KEO A;  4CCK A;  2K7L A;  2Z5U A;  3G1M A;  2DT5 A;  3MMY B;  5IP9 J;  1S7O A;  2BVL A;  2WV1 A;  2OCE A;  5HOO A;  3H35 A;  1JVS A;  2XF6 A;  4XM3 A;  2W85 A;  3A02 A;  3BPV A;  3Q0U A;  4V2G A;  1Z6T A;  4MQ9 F;  3Q3S A;  2L2O A;  4KMU X;  4EV0 A;  2LBF B;  2ZFW A;  2B0L A;  1F43 A;  2L7K A;  2DYS H;  1SD5 A;  3WE3 A;  3I58 A;  1S72 I;  1O57 A;  4G8X A;  1XTA A;  1RNL A;  4ZZD A;  1ZAR A;  5DCM B;  3RJP A;  4XNA A;  4C9Y A;  1D1C A;  1MJA A;  3DTI A;  2JA5 J;  4C3J J;  5CVU A;  1MIJ A;  3L2Q A;  4IOA F;  3B7R L;  3LSK A;  1G8X A;  2ZFU A;  4UB8 C;  4BQN A;  4O5V A;  2O03 A;  2HTS A;  4ZDP A;  4FE4 A;  3DEU A;  3LSR A;  3CF5 F;  3SEZ A;  4JP0 A;  4RAZ A;  1SVO A;  3EQL F;  3U1D A;  1Z0X A;  3BG9 A;  3A01 A;  4XN2 A;  1IXS B;  2CYY A;  2DA4 A;  4DNC A;  1LKX A;  4PU2 A;  3OYD A;  3CHR A;  2QLZ A;  1IN4 A;  3OY9 A;  2DA2 A;  3VOD A;  3S3M A;  2IP2 A;  3Q9V A;  4ZW7 A;  2DXI A;  1K78 B;  4XN3 A;  4PJJ A;  1A6I A;  2HVS A;  3M8E A;  1K4T A;  3LNQ A;  3B02 A;  5J1R A;  5E3O A;  4RVB A;  2DJN A;  3BZK A;  4XN4 A;  1ENH A;  4PK4 A;  2X1D A;  3UCQ A;  2FBH A;  4B3X A;  2DOD A;  2RJI A;  1T1R A;  4BL0 B;  2PBI A;  2JSP A;  1BR1 A;  3VDX A;  3FU0 A;  1QU3 A;  2K9Q A;  2O9L A;  1X2M A;  1BJZ A;  3DXJ F;  4XL9 A;  1LUJ B;  4D0P A;  4MO7 A;  4FLR A;  3K2Z A;  1GHC A;  2XPV A;  1FOX A;  3BY6 A;  4AD9 A;  3DBR B;  5KAI C;  3WHC A;  2O5R A;  4XN5 A;  4J19 A;  2KPM A;  5J4Y A;  2CMP A;  5E1X A;  3ZMU A;  1LDK B;  1UHW A;  1LJ9 A;  5LBQ A;  2E1M C;  2DMT A;  1K61 A;  1B8I A;  3ZMZ A;  1I27 A;  3DPL C;  4I76 A;  2VE9 A;  1JJ8 C;  1ZS2 A;  1R0K A;  4HLX A;  2HYJ A;  1GW6 A;  2QQ8 A;  3U1K A;  3HSR A;  2GWR A;  1WSU A;  5EEH A;  1MD0 A;  1EV7 A;  1LFB A;  3HSF A;  2C5Z A;  1JUM A;  3GFI A;  4F7Z A;  1YIO A;  2WAQ N;  4P96 A;  4UVC A;  1BC8 C;  3GTG J;  3L00 A;  3S3O A;  2EH3 A;  2LVS A;  4L9N A;  4RBO A;  1MNM C;  3FH7 A;  1I1S A;  3FH5 A;  3VSK A;  2VQG A;  4LB5 A;  4LG3 A;  4U0W A;  1F36 A;  3OYH A;  3CCE I;  1LFU P;  4LJZ F;  2JJ7 A;  3HRM A;  1YS7 A;  2J5P A;  3BLY A;  2XRO A;  2EIJ H;  2F4I A;  2OQR A;  2EFO A;  3CDI A;  3ZHZ A;  3CF2 A;  3QYB A;  3ABT A;  2M1B A;  4I98 B;  2JD1 A;  3CMY A;  4KDP A;  1U2W A;  2NS7 A;  3TP0 A;  3TW7 A;  2OD5 A;  1OYI A;  1FMV A;  2FBK A;  2XF5 A;  4HV6 A;  1KQ9 A;  3KZI C;  3S32 A;  5FO5 A;  3UER A;  1RET A;  4GYG A;  4BYY A;  5E79 C;  3EYI A;  1FP2 A;  4QPO A;  2M0M A;  5HS9 A;  2ADU A;  2YU3 A;  4BQA A;  1WH5 A;  2DQR A;  1YX3 A;  4MEY F;  1PUF A;  3S14 J;  1BA5 A;  1I50 J;  4D1Q A;  3PIO F;  5F04 A;  3PL8 A;  1E3H A;  3GTO J;  3Q9S A;  2JT1 A;  3LFU A;  5JNL A;  2FNP A;  3HHH A;  3QPH A;  4E4H A;  5K7Z A;  2DA6 A;  1BM9 A;  2RDP A;  1A31 A;  1WVR A;  2WZF A;  1T38 A;  4E7S A;  4XKB A;  2E36 A;  2YR2 A;  3LMM A;  4ARF A;  1FC3 A;  2OZU A;  2FEZ A;  1U0J A;  2FQ4 A;  2VQL A;  1WJ5 A;  3KFW X;  4D5F A;  1QRY A;  5K7F A;  1X1P A;  5GAH J;  1HLV A;  1G4D A;  2DFE A;  1USS A;  3VVL A;  5B1A H;  2BV6 A;  2EK5 A;  4HF1 A;  4B47 A;  4AYS A;  3RPU D;  5FKK A;  1V5G A;  2IJL A;  2DN0 A;  4WXH A;  1BI3 A;  2M3A A;  5CPR B;  4BXX J;  2DJI A;  1LNW A;  3H1C A;  2JUG A;  2FML A;  2DBB A;  3ZI0 A;  4C30 A;  3G3Z A;  5EZG A;  4OWR B;  4YIR X;  1ZR2 A;  1FSE A;  2X85 A;  3DEW A;  2DMN A;  2LRD A;  2KDO A;  3R0I A;  2RC4 A;  4P1W A;  4OIN F;  1YS6 A;  3IAS 2;  4CA0 A;  3JRA A;  2V6E A;  4RGU A;  4OMY A;  2MGQ A;  2A7O A;  2IT0 A;  1UFM A;  5LHI A;  1B72 A;  1G3W A;  1K6Y A;  4M74 A;  4Q47 A;  1TWF J;  2LR8 A;  5HLH A;  2MFZ A;  4EMS A;  2CQK A;  4GYI A;  4FET A;  1IC8 A;  1W36 D;  3M07 A;  4FLO A;  4HPQ A;  2QSF X;  4R5X A;  3B6A A;  3JSZ A;  1I6X A;  1L0O C;  2XUB A;  3JAM K;  1IG7 A;  2L4M A;  4PJ0 C;  3IL2 A;  2PGG A;  3HUG A;  2XPW A;  3J7Z I;  3FZV A;  2HPT A;  4LIT A;  5IOZ A;  4RB2 C;  2KIS A;  1TZL A;  3D5L A;  1HS6 A;  5LD2 C;  1TNS A;  3B7S A;  4IF4 A;  2L7M P;  3IV5 A;  1JKQ C;  3CP2 A;  2G9W A;  2M8E A;  2KDZ A;  3BR6 A;  1IRX A;  1A04 A;  4ENJ A;  1V3F A;  5BPP A;  2K4B A;  4JYK A;  1JJ6 C;  1LPQ A;  2ME0 A;  4V19 K;  3LQQ A;  4BAC A;  3PM1 A;  4FLQ A;  4YFK F;  2CJJ A;  2LSO A;  2HKO A;  4DJA A;  1HW2 A;  3WG7 H;  4NB5 A;  5ERI A;  1RRJ A;  5ILS A;  5LEJ A;  2JVH A;  4I02 A;  4OU0 A;  4FT8 A;  1QHH D;  2IGO A;  3JW4 A;  2QWW A;  1G59 A;  3KX2 A;  1XN7 A;  1D0X A;  2GXA A;  3M1E A;  5EYR A;  3TOA A;  4U87 A;  4R1H A;  1UCR A;  2BY3 A;  3MCZ A;  3RPQ A;  3CXB A;  2DFF A;  2MBF A;  3CUQ C;  2EFW A;  5JMW A;  5AEN A;  2RNJ A;  5GPC A;  3EUK L;  2P4W A;  2PL5 A;  1BW5 A;  3L9F A;  2K40 A;  3BG3 A;  3K6G A;  2M9H A;  1LFP A;  2BEO A;  2VIX A; 
#chains in the Genus database with same CATH homology
 4J3B A;  4BQQ A;  4XN7 A;  1SQM A;  4XO3 A;  1D0Y A;  3BC8 A;  2E60 A;  3F9K A;  4E7K A;  4JND A;  3FBN B;  2W7N A;  3D5S C;  4PVB A;  4K5M A;  3HPG A;  4E7J A;  4PW4 A;  3K4N A;  3OR1 C;  3S93 A;  1ERD A;  3FUH A;  3FTY A;  1X1A A;  4XO4 A;  2C82 A;  1PJR A;  2JA2 A;  3LSM A;  4AYB A;  3ZCO A;  1Q0Q A;  3J7A Y;  4XNF A;  3L2U A;  3FUK A;  1DGR M;  4BJ6 C;  2KQR A;  2R7X A;  4K5L A;  4BKX A;  4MS6 A;  2JD0 A;  2R7T A;  2Z2S B;  4XO5 A;  3A4C A;  3RC3 A;  2WAD A;  4ZTF A;  2MD0 A;  4XOR A;  3CJR B;  3C2H A;  1N75 A;  3OMY A;  3U21 A;  4ZQE A;  2W4S A;  2X6Y A;  4XOT A;  5KCM A;  3AKZ A;  4PJM A;  4QPE A;  4BS9 A;  1DGW Y;  2VXD A;  3H0D A;  2BVM A;  3MKW B;  4A03 A;  3D5R C;  4F3Q A;  3PUB A;  4R5V A;  2LH9 A;  4CSW A;  3OS1 A;  1X1B A;  2WB1 A;  4Y6R A;  3ANM A;  3C2G A;  2P0W A;  2JD2 A;  4B44 A;  2IS2 A;  1X19 A;  1X1D A;  5LFA A;  1G5A A;  3OYM A;  1WJC A;  4F91 B;  2HPM A;  4XQF A;  1WJE A;  3QOD A;  3FTU A;  3ZHY A;  2CW7 A;  1X3W A;  1UG0 A;  2XDV A;  2XC7 A;  3BCA A;  3B34 A;  4B48 A;  3JT1 A;  3A06 A;  3ZXS A;  4LIU A;  3RTR A;  4Q4E A;  4XMY A;  2IGN A;  4HEA 2;  4YEL A;  2ZXG A;  3CIA A;  5FRM A;  3K10 A;  2WY7 Q;  3LSG A;  3VYU B;  3B37 A;  3Q44 A;  1Z3X A;  3OYE A;  2EGH A;  1E0E A;  2ZXH A;  2BW3 A;  4Y6S A;  3UEQ A;  2VJJ A;  2ZSI B;  2Y0S A;  1X3Z A;  3MKZ A;  1T95 A;  2MAP A;  3OIQ A;  2XPZ A;  5JHF A;  5JAZ A;  1V5F A;  3PNT A;  4CH7 A;  2O7G A;  2HNH A;  4J01 A;  3LL7 A;  2LC2 A;  3RCO A;  2DCE A;  3OWT A;  2DOA A;  2V7F A;  4KJZ A;  3FUL A;  2RQQ A;  2R4G A;  3HOS A;  3FU3 A;  3DU6 A;  4PFO A;  3RSN A;  4OOE A;  2VB6 A;  2IGM A;  3H9Q A;  4N4O B;  2HVR A;  3T8V A;  3WQQ A;  1V5E A;  1ONN A;  3N05 A;  3OOU A;  3A14 A;  4ZYA A;  3KEY A;  2KZV A;  3PFY A;  4XLF A;  2Y1F A;  4BXF A;  2QJ1 A;  4ZDL A;  2HQA A;  3DEE A;  3DQV C;  1WJD A;  3KYL A;  4KIT B;  1K5H A;  5JO0 A;  3SEQ A;  4K5O A;  2K9L A;  1X4O A;  4ZN6 A;  4CUG A;  4EAT A;  4F92 B;  1N77 A;  2CV1 A;  1T0F C;  3DPT A;  3PJR A;  4BE0 A;  1EA3 A;  2MAB A;  5DLL A;  1HA8 A;  2HPO A;  2XQ0 A;  2HPI A;  2V26 A;  4GAA A;  3CJQ B;  2ZXI A;  3HKZ A;  5DYF A;  4XLE A;  2GTQ A;  2KMU A;  2WZG A;  1J09 A;  2PJR A;  2R72 A;  3RC8 A;  2Q2E B;  3DKY A;  3VYT B;  4RLF A;  4ZJZ A;  3L2R A;  2UWM A;  3OL3 A;  2V4J C;  4C2T A;  2M7A A;  2VJ5 A;  3DKX A;  5CKT A;  4IKF A;  4YRV A;  1JGI A;  4HRI A;  4CXF A;  2WAQ A;  4PUS A;  2B61 A;  1TT0 A;  2PMZ A;  4DBQ A;  4XNB A;  4PJN A;  1Z21 A;  2XSJ C;  2Y1C A;  3H9J A;  4NUB A;  4IX7 A;  4AIC A;  2VJ4 A;  4PSW A;  1WFX A;  2JCX A;  4K5N A;  4ZW6 A;  2JVG A;  3H5N A;  1YE9 A;  2OUM A;  4PSX A;  3OYF A;  4E7L A;  3CHP A;  3FTX A;  2IXS A;  2WAE A;  4Y33 A;  3H9G A;  2L5Q A;  4DBR A;  5HVQ C;  3T0Y A;  4ZC3 A;  4Q4I A;  3MD2 A;  1OLT A;  3VSL A;  1W36 C;  2KHM A;  2LG4 A;  1Y6I A;  4BE2 A;  3ONQ A;  5FWQ A;  1FMW A;  2W00 A;  5JC1 A;  4CCJ A;  4F93 B;  4C2U A;  4DOZ A;  1MVY A;  5HLT A;  3FU5 A;  4XN1 A;  1MMG A;  1MW2 A;  1WJB A;  3QOE A;  3K70 C;  2VKH A;  2CUZ A;  4Y67 A;  1NG6 A;  4HNU A;  3EUA A;  2R7U A;  1BOB A;  2R70 A;  3FU6 A;  2MC4 A;  2E1M B;  2LYC A;  3A1Y A;  3FDY A;  4E7H A;  4R5T A;  4QUO A;  1QHG A;  3I3L A;  1P9Q C;  4NC8 A;  4B43 A;  2R7R A;  2Q1Z B;  3E1S A;  2XF7 A;  1X1C A;  3DWL E;  3QYE A;  3EPZ A;  3UNG C;  4BJT A;  4ZQT A;  2R7S A;  4RMN A;  3PSI A;  1JI8 A;  2ELJ A;  3QJX A;  2RRE A;  1UAA A;  1RP3 A;  3S8P A;  4ZW5 A;  5KNL A;  4J00 A;  4E7I A;  3IIE A;  3HPH A;  4ITV A;  1VZ0 A;  3BG6 A;  3FHE A;  1MND A;  2LY1 A;  4CCK A;  3FUE A;  5HNH A;  4CCN A;  4XMZ A;  3CZL A;  4CZC A;  3MMY B;  2R7W A;  1DP3 A;  2BVL A;  2CV2 A;  5HOO A;  3H35 A;  1JVS A;  3CHS A;  2XF6 A;  4XM3 A;  1BR4 A;  4U7B A;  3CES A;  3CP8 A;  2L2O A;  4AR9 A;  2LBF B;  4OAZ A;  5KHD A;  3AL0 C;  3HUG B;  3CZ6 A;  3SZG A;  4D9J A;  2A5W A;  2L7K A;  2OC6 A;  3NWS A;  4NC7 A;  5CQE A;  3EBG A;  2R7V A;  2Z16 A;  4BEH B;  3KED A;  4XNA A;  3EBI A;  4XMV A;  4C9Y A;  1MMN A;  1D1C A;  3VWB A;  3DTI A;  3DPU A;  1X4P A;  1SFK A;  2VXZ A;  4XKC A;  2KL4 A;  4AR8 A;  2UV1 A;  1GLN A;  1MMA A;  3L2Q A;  3B7R L;  4X0G A;  1LVK A;  1G8X A;  2ZFU A;  3LSK A;  3CHQ A;  3FUD A;  4NQW B;  3OYJ A;  4BQN A;  3FUI A;  4JOM A;  3OL4 A;  3ZR8 X;  4IQJ A;  4PJL A;  3K4J A;  4ZDP A;  3OYI A;  3V42 A;  2V1N A;  4XKV A;  4E6K G;  3SEZ A;  3A2K A;  1ONP A;  2KP6 A;  4XN2 A;  3L2W A;  4PU2 A;  1LKX A;  3OYD A;  1KON A;  3CHR A;  2VPL A;  3OY9 A;  1MW3 A;  5DUL A;  3S3M A;  4ZW7 A;  2DXI A;  4YEJ A;  2KRC A;  4F55 A;  4XN3 A;  3Q43 A;  4PJJ A;  2WA0 A;  3W2V A;  2HVS A;  2Y1G A;  4Y4R A;  3QYF A;  3DTK A;  2CS3 A;  4MLO A;  4XON A;  3AU9 A;  4RVB A;  4XMT A;  3VYS B;  4AU7 A;  4FLS A;  4XN4 A;  3BG7 A;  3SYT A;  2FFL A;  4PK4 A;  1MW1 A;  4L2L A;  2X1D A;  3SDB A;  4GAE A;  3UCQ A;  3W2W A;  3CZE A;  4RLQ A;  4B3X A;  2RJI A;  2ZSH B;  3ZGK A;  3CZK A;  1T1R A;  4BL0 B;  1D0Z A;  3FHN A;  1S9H A;  3AFH A;  2JSP A;  1BR1 A;  3VDX A;  1WJF A;  1QU3 A;  3FTW A;  1MNE A;  5FRO A;  2F6C A;  3FU0 A;  3ZHX A;  4ZW8 A;  4AR1 A;  4DGW B;  2DQ6 A;  4XL9 A;  2FUG 2;  1D1A A;  3EUH C;  3W3C A;  4XR6 A;  4FLR A;  4HST A;  4RM2 A;  3TMO A;  5CQG A;  1DQU A;  2O5R A;  3OYK A;  4XN5 A;  3TBI A;  2KPM A;  2BOL A;  4QHP A;  4XN9 A;  2CMP A;  4RM3 A;  3S3N A;  2X51 A;  1LDK B;  3AU8 A;  2E1M C;  1D1B A;  4BE1 A;  4HNT A;  3DPL C;  2QKL B;  4XLA A;  2LRE A;  1ZS2 A;  4FCA A;  1R0K A;  3WQR A;  1T1S A;  3CMM A;  1GW6 A;  3FTZ A;  2UUZ A;  2HVQ A;  2IS1 A;  2IS6 A;  2L9S A;  2C5Z A;  2JV7 A;  2AQE A;  3K4M A;  4XLC A;  1SG7 A;  1H19 A;  3IP4 B;  3S3O A;  2IGK A;  2Z1D A;  2W82 A;  4ZX5 A;  3GBG A;  4IQ4 A;  3FH7 A;  3FH5 A;  3VSK A;  2VQG A;  4LG3 A;  3UR3 C;  2L9N A;  3OYH A;  4HSR A;  3BLY A;  2M4K A;  3H5R A;  3E0J B;  3OYA A;  2F4I A;  3ZHZ A;  3CF2 A;  3QYB A;  2XPY A;  2JD1 A;  4HG2 A;  2A6T A;  4XOP A;  3OYG A;  5JMP A;  2X6X A;  4QME A;  2E5Z A;  1FMV A;  2HU9 A;  2F5V A;  4PFP A;  2XF5 A;  3OR2 C;  1MW0 A;  1BR2 A;  2HZD A;  3S32 A;  2R7Q A;  3UER A;  2V9K A;  4BDZ A;  4ZW3 A;  4DIQ A;  4N4N B;  4QPO A;  2M0M A;  1OR7 A;  3HC7 A;  3DTE A;  3OYB A;  4RSY A;  2BW3 B;  1PYV A;  4CCM A;  1R6R A;  3TL4 X;  1YX3 A;  2K3P A;  3HXL A;  4DPR A;  3LSH A;  3PNV A;  4D1Q A;  4XN0 A;  3OS2 A;  3PL8 A;  3DLA A;  1Z3Y A;  4P5O A;  3HL2 A;  4GRI A;  3B2P A;  3K4K A;  3LFU A;  4BU2 A;  1Q0L A;  4ZX4 A;  2X1E A;  3FKJ A;  5JNL A;  4E4H A;  3BCB A;  1N78 A;  3DU5 A;  4G6T B;  2M7B A;  3H5A A;  3IUO A;  2WZF A;  4LIV A;  4E7S A;  4XKB A;  2QKM B;  3LMM A;  3I9V 2;  4ARF A;  2K9M A;  3M8J A;  3OIP A;  1Q0H A;  4XND A;  1U0J A;  2VQL A;  1WJ5 A;  2VQC A;  3VYR B;  4KT6 A;  3ANL A;  4BJ5 C;  3LSI A;  4XLH A;  3PUU A;  4BUP A;  2R59 A;  4XKW A;  3FUN A;  1R0L A;  4R79 A;  1AA7 A;  4Y3O A;  2VQH A;  1UEL B;  1MMD A;  2LOO A;  4F52 A;  4OOF A;  3K4C A;  3VVL A;  1JG9 A;  4B47 A;  4AYS A;  1YX5 A;  3RPU D;  4ZX3 A;  3OYL A;  1WJA A;  1V5G A;  3PSF A;  3OYN A;  3AUA A;  2Y1D A;  4X2U A;  2M3A A;  4RCV A;  4XN8 A;  5CPR B;  2VAS A;  2MYS A;  1OR7 C;  2JCY A;  2DJI A;  2X1C A;  3FTS A;  2JUG A;  4KIS A;  3FH8 A;  4LUP A;  4K5P A;  3ZI0 A;  2Y1E A;  2DQM A;  1Z7L A;  4C30 A;  2CH0 A;  3PNY A;  5JBI A;  4IZZ A;  4OWR B;  3CHO A;  2PUS A;  3B2X A;  4FAS D;  2X6W A;  2PJR B;  2X85 A;  4JQF A;  3FUM A;  2LRD A;  3W2A A;  4Y6P A;  2KDO A;  3R0I A;  4P1W A;  2MAO A;  1MW7 A;  3IAS 2;  4ZX6 A;  4CA0 A;  2HDW A;  2V6E A;  2WAF A;  2VJI A;  2A7O A;  4ZQH A;  3L2V A;  4OAY A;  1K6Y A;  2NOJ B;  2K5C A;  3OS0 A;  3B7T A;  2MFZ A;  2KLO A;  4ZQF A;  2JCV A;  2VL8 A;  2DT7 B;  1SAU A;  4FET A;  5TGT A;  1W36 D;  2WPG A;  2WBM A;  4FLO A;  4HPQ A;  2CV0 A;  4R5X A;  2GOM A;  3JSZ A;  3FUF A;  3M1C A;  1H3L A;  4KP7 A;  2PGG A;  2LBF A;  4II2 A;  5FRN A;  4XMX A;  2RNG A;  3HG9 A;  3CZG A;  4BGD A;  2M4G A;  3FUJ A;  3WQS B;  3K70 D;  1ONO A;  2HPT A;  4LIT A;  3AL0 B;  4BQO A;  1SC5 A;  1TZL A;  2I8D A;  4AVZ A;  2CW8 A;  3D5L A;  4BEH A;  4CCO A;  1HS6 A;  3RQ4 A;  3ZRG A;  5LD2 C;  2VJ8 A;  4QPQ A;  4H4K C;  3B7S A;  2WY8 Q;  3ANN A;  1ZEL A;  4ZTJ A;  5HNF A;  4ZDO A;  3FTV A;  4CCL A;  3EBH A;  3CP2 A;  4XMU A;  4NQW A;  2DT6 A;  1IRX A;  2E5N A;  1S46 A;  2IS4 A;  5BPP A;  3B7U X;  4NNJ A;  4BAC A;  2LY2 A;  4FLQ A;  2CFO A;  3IAM 2;  2GOX B;  4DJA A;  4R7L A;  3B3B A;  4QIR A;  3HOT A;  2JVH A;  2OV7 A;  2KRH A;  3U9W A;  3G2B A;  1QHH D;  1Y56 A;  2CUJ A;  2IGO A;  2XAU A;  3NWT A;  4XMW A;  1G59 A;  5EV7 A;  3MKY B;  3KX2 A;  3OYC A;  1D0X A;  1NG7 A;  4II3 A;  2AQF A;  3ZQQ A;  4U87 A;  4E7Z A;  3K4B A;  3VVM A;  5JMW A;  2W1O A;  4MKT A;  4ZQG A;  2R7O A;  2VLA A;  5AEN A;  2QVW A;  3RAS A;  4ANJ A;  4BDY A;  3EUK L;  2PL5 A;  3FBI B;  3K6G A;  3K4L A;  1LFP A;  2VKD A;  2VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...