5HNFA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 108
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnfA02
2VLAA 5HNHA 5HNFA 5HLTA
chains in the Genus database with same CATH superfamily
2BOLA 1G2HA 3FUDA 5BPDA 3QJXA 2Z33A 1JHHA 2Z16A 4RGSA 2PI0A 1SD7A 2QQ8A 3K4LA 2VC1A 1XG1A 2QJ1A 2P6TA 3M4OJ 2DQLA 3PQKA 3W6VA 2XAJA 1YW9A 4RAZA 1AKHB 5EEHA 1XMAA 2CS3A 1VQ6I 4ON0A 2EFPA 1MW0A 2HZDA 4A3IJ 2X1DA 4BYYA 3SEZA 3HOZJ 3OSFA 2L5QA 2DYRH 4P96A 2X1CA 4ESFA 5EEAA 3OYLA 2RNJA 2DAOA 2PLYA 1Z21A 3OIQA 2IA1A 2XQ0A 3L2VA 1EF4A 3CJRB 3SZGA 3CUQB 3B3BA 1G4DA 2LOOA 3E3VA 2HPMA 1RI7A 3HL2A 4ENKA 3ZMDA 2QYOA 3B7RL 2PX9A 2E5NA 4BAYA 1G59A 3FX3A 3I58A 4BU2A 3Q0UA 4FASD 2R72A 2CO5A 4RLQA 3E5UA 3ISPA 1SMTA 3NARA 2BW3B 4HV6A 5CVRA 5HNHA 3TO9A 4A3BJ 3DKYA 2L7FP 3H92A 2QQAA 3E0JB 4U0VA 4NBQA 3DEUA 2NAZA 2DW4A 1JTXA 3WU0A 2ZXHA 1GT0C 4WK8F 5JHUA 3M9AA 2CYYA 1W36C 4AR1A 4NC6A 1GHCA 1MD0A 1LEAA 3K4CA 3RQIA 2KFDA 1Y0UA 4GYGA 2V1XA 3CLOA 4AUXA 1F36A 3VYRB 2NYXA 3WTVC 3A02A 2VUMJ 2DA3A 2E7WA 2WAFA 3U1KA 2UV1A 3HM5A 4QIRA 4ZW7A 4M6XA 4ESJA 1U78A 4HEA2 2DOAA 1SC7A 3J7AO 1TWAJ 1Q0LA 1IF1A 2W85A 4BNCA 5D8KB 1VQPI 3CCLI 2IJLA 1Z1DA 5IP6A 1Z67A 3REOA 4YEJA 3N97A 1TP4A 4GCVA 4EEFG 1KQ9A 1VQ9I 3L09A 2CW8A 1APLC 4KNYA 3FBIB 4BJTA 1SD4A 2RDPA 1HDPA 3LQRA 4HDUA 3FMSA 1FBQA 1YE9A 1WJFA 2M87A 2XIGA 3BG3A 4AYBA 1Z6RA 2PMZN 5HLGA 3A06A 4ZQTA 5E1WA 1ZH5A 4Y6RA 3H0GJ 3Q0VA 3H3UA 4E70A 4IHSA 2XDVA 4FX4A 5H6RA 3LA7A 1VF9A 3LSTA 3S1NJ 2KIMA 5HS8A 2I10A 4D7MA 4BQAA 2FBIA 9ANTA 2XASA 3GO5A 3TMOA 4EM2A 2IEKA 5DULA 3VSLA 4PZJA 1DPUA 1R6RA 3G1MA 4F93B 2R92J 4YFKF 3RYRA 4UNOA 2ZNZA 1SG7A 1QZEA 3G2BA 3NWSA 4LJZF 2MD0A 4JBAA 2MH9A 2VKHA 4B3XA 1GVDA 1N25A 2VBZA 4B43A 1VQ7I 3O8HA 3ZHXA 3GWZA 3CHSA 4XN4A 2G9WA 1GXPA 2A3SA 2K9QA 5GADJ 3AG3H 2UXNA 2VT3A 3CCSI 4E7ZA 2YPRA 3H5RA 3M07A 3GTMJ 1KGSA 3C1DA 4YFNF 1XMXA 1PUFA 3J80K 4Y33A 3PO3J 2MAPA 4S04A 1P4XA 1QNTA 4A0YA 2NRAC 3RPUD 4XO3A 3FK7A 5J1YA 4F52A 2B63J 1MVYA 2X6OA 3O2PE 5LEJA 3IH2A 1TQPA 4RGXA 3BPVA 3E1SA 2BY3A 1X1BA 2VKEA 1ONVA 4LB6B 5CKTA 1O57A 4L18B 1ETOA 3HTUA 4G8XA 3VODA 4B48A 5FLXZ 3ESWB 3ECHA 1JKQC 2C82A 4QPOA 5E3NA 1E17A 4QPEA 4HSRA 2VKDA 4HQMA 2X1EA 4HBLA 4M9ZA 1YRNB 3RCOA 1LDDA 1L3LA 1S5LC 2W24A 1R23A 1YOVB 3BR1A 2K4JA 5ICGA 4CYCB 1FOYA 3LMMA 2C5ZA 1IUFA 2F48A 3H9QA 1SAXA 1I6HJ 4KP7A 2M2EA 2O03A 2X4HA 1MBGA 2Y48A 4C30A 3Q44A 2AXLA 3GXOA 2NOJB 3N4MA 5TRDA 1FYLA 4HX7A 4GAEA 4A3MJ 4ZTJA 3ASNH 1QA6A 2JA8J 2O7GA 2AQEA 4G12A 5J8CA 4R79A 3BTJA 2P5VA 4MO7A 3OYAA 1TZLA 4XBFA 4HF2A 4BE0A 2ETHA 1E3HA 1O7FA 3IWZA 2R4GA 4PJ0C 2A6EF 5JMWA 3HJEA 2PMHA 1WH7A 3OYDA 1H8AC 3QODA 4A3JJ 4JYKA 3OYMA 3GTJJ 1ZAOA 3UR3C 1HKSA 2O0YA 4XN0A 4N4OB 4XO5A 3BY6A 3HEFA 3FUEA 2NNYA 1UMQA 1HSJA 5DLLA 2Z2SB 2AQFA 1FSHA 2M30A 4C2MJ 2KL4A 2YUSA 1X2MA 5GTHC 4IF4A 5F04A 1K4SA 4K5LA 3SYTA 1R4MB 3GF2A 4D0PA 4E7IA 4XORA 2CMPA 3A1YA 5C3EJ 2TRTA 2EV5A 2LC2A 2CFOA 1BIBA 1T1RA 3A03A 3OYHA 5JMPA 1TWGJ 1JGGA 2W48A 4HLYA 1MIJA 2DJIA 4XKBA 4GRIA 4MS6A 3A01B 3FBNB 1H9TA 5F0CA 2IAIA 4M6YA 4I76A 2OJED 1ORKA 1RIOH 2M4KA 3S1QJ 2K4BA 4MNUA 3PSIA 3CF5F 2VL8A 3ZGKA 4RM3A 2ZB9A 3GLLA 3HUGA 2VODA 1SD5A 2KIFA 1BI3A 1S8NA 4OMZA 2OZ6A 1MSEC 1K7AA 1FTZA 3CJQB 2WTEA 3DLAA 2GIZA 5B1BH 1A36A 3ZOBA 2E36A 3HW2A 2D1HA 1FOXA 2EZHA 3BP8A 3PQJA 2P6SA 2XAFA 2Y9ZA 3KX2A 5JR3A 2XPYA 4EATA 4HA8A 1T33A 4LFUA 5KNLA 1SVOA 3BZKA 4B09A 2R7WA 5FFZA 5ILSA 1EH8A 3VDXA 5D8LB 5IOYA 2KRHA 4ZZDA 4JK1X 1IW7F 3GFLA 2A69F 1SVLA 2OPTA 4ZQEA 4XN1A 3AAFA 5DCMA 1W4MA 2L9RA 1O3SA 2MC3A 3BT9A 1S29A 2A05A 3ZMUA 5LGNA 5IPAA 1I27A 4G9YA 3U2RA 4KFCA 2MG4A 3FUHA 4H0EA 3FK6A 4F91B 1ZG1A 4YG2F 2P0WA 2R5ZB 1T8IA 3TBIA 1REPC 1X4OA 2IA2A 3KEDA 4Y15A 5F27A 2I5UA 4WCGA 1D8JA 1OJLA 3FKJA 2DFFA 2M9HA 4L0ZB 2K02A 3A0HC 2DPUA 3HG9A 1UG2A 3FKIJ 1X3ZA 2LF8A 2FD5A 1WSUA 1SD6A 3FHEA 3ZHZA 4X2UA 1ZRFA 4AR8A 3OOPA 4A12A 2XVCA 3VYSB 5EF6A 5GTIC 4X0GA 3F6OA 3IKVA 2FNAA 3BR0A 2Y9YA 1R49A 2OD5A 2QEXI 1KA8A 1T08B 2NVUB 2DMNA 2HDDA 2E7XA 4EV0A 3LAPA 1WHUA 3HRMA 1RP3A 2O8XA 3SZTA 1YW7A 1X3UA 5LHIA 3GTLJ 5FLMJ 2CRGA 4WXCA 1OCZH 2YSRA 5JFRA 4FISA 5KCMA 3FH5A 1U5TA 3LA2A 2K3FA 2CU7A 4K5NA 2LBFB 1OYYA 3DTKA 3WTZA 2ME0A 1MBJA 2E1OA 2ZNYA 3HKZN 1Z77A 2FRHA 4BKXA 4Y13A 4XQFA 3RZDJ 1K6YA 1W7PA 4BXXJ 3OS0A 4HYEA 4AIJA 3G1OA 3CZLA 2JCVA 4KIFA 1EKEA 4FLSA 3HOUJ 5DYMA 1JVSA 2O61A 2PBIA 1Z7UA 3CJNA 5LRRA 1OYWA 4C3HJ 1HOMA 4XONA 1USTA 1ZYRF 3FDYA 2QSHX 1I3AA 2LKSA 3I0TA 1MSFC 2EGHA 2D1VA 2DBBA 3FMQA 2WA0A 4EJOA 4CXFA 2L4AA 3OSGA 2X51A 3MKZA 1TNSA 1FBSA 3JT1A 5IP9J 2ZMEC 5LFAA 2HKOA 2VONA 4UVAA 1SC5A 4BY1J 5HDGA 3CO7C 1FOWA 2LMDA 3I54A 3B6AA 3I59B 3WQRA 4C3IJ 3UERA 2KMUA 2Q2EA 2F6CA 4I0BA 4M3EA 2IGNA 2JSCA 5J1RA 1RUNA 1HA8A 2DMTA 2RVCA 3Q9VA 1QPMA 2HQRA 3VWBA 3LL7A 4N0BA 4FQGA 3S2HJ 4A3CJ 4GGGA 1W5CC 1FWZA 2L0KA 4HG2A 2COMA 2GXBA 1NG7A 5C4XJ 1I3QJ 2LKPA 4XM3A 3CCYA 1MBHA 3HZJA 4CCLA 4U7DA 2H27A 5IYDJ 4BXUA 4NC7A 1R9TJ 4NUBA 1BR1A 1Z91A 3LAJA 2QA4I 4RS8A 2M34A 1RUOA 3CZGA 3MEXA 3B73A 3TL4X 4V2FA 2QGUA 4E4HA 5IYBJ 3FXRA 2Y0MA 4CDGA 5LEKA 1IRXA 3DCFA 4ENNA 2DA7A 3W6KB 2BY2A 1OLTA 1QO0D 2R7UA 4RSYA 2CUJA 1FX7A 2D45A 2ECCA 4MFEA 1USSA 1SFUA 3C2GA 4KICA 2DFIA 5GP9A 3TEDA 1YS7A 4ASNA 1EJ9A 2H1LA 3MVPA 1LDJA 3OYJA 4YIIA 1DUXC 4EGYA 5L3GA 1BIAA 4KN4X 1QHHD 5D4RA 3K7AJ 3FIWA 2ECBA 4Q48A 3HOYJ 1AKHA 3J7AY 2AHQA 4OOEA 3G1LA 1PP8F 2JCYA 4OOFA 5ERIA 2JZYA 3ZR8X 2LDUA 1N77A 1HC8A 3FXKA 1BA5A 4CCOA 1V5FA 2JT1A 2DA4A 4P55A 5J47A 3LSPA 4UHTA 3QYFA 4CCNA 1DP7P 3I64A 4PVBA 5DD4A 1VFCA 2DMPA 1JE8A 4CSWA 1RETA 3B34A 3EETA 4IPAA 3S2WA 3ZQQA 1B6AA 3TP3A 3KZYA 2BVLA 3F23A 4F7ZA 4HNUA 1S7OA 3MFKA 1ZGWA 4CA0A 2ZXJA 2BW3A 2Z9OA 3CCUI 3S3OA 3JCUC 1B8IB 1FBUA 1J9IA 2MAOA 3JW4A 3GW2A 1KZHA 1Q0HA 1NHAA 2O5RA 3IUOA 4E6KG 4KITB 2E1MC 2KP6A 2R93J 5DUKA 3B7TA 2PJPA 1RNLA 2RQQA 3QPHA 4P9UA 2V1UA 2AS5F 1XTAA 1XCVA 4BACA 4AM3A 2EV6A 3Q5FA 1GXQA 2H8RA 5FRNA 4P5OA 1JKPC 4LLLA 3ECOA 2HVQA 2L2OA 5GAGJ 3JRCA 3SJMA 1R5ID 1N78A 4XKVA 4YIFA 3EQLF 1NK2P 3T8RA 2Y1EA 4AVZA 5H2FC 4L0YB 2YX4A 2IGKA 3QAHA 2K3PA 2XGCA 3NAUA 4RAFA 4I01A 2DO7A 3CDHA 3JRIA 3B2XA 1E3PA 1X2NA 1FTTA 4ZYAA 5E79C 1AHDP 2EFQA 1O4XA 2IVMA 2PUSA 3BOQA 3FH8A 2FMYA 2XC7A 2LKXA 4RB2C 1WJBA 4U88A 3OYIA 1LPQA 5F0HA 1Q1VA 4UB6C 3CZ6A 4CUGA 4HSTA 5AIQA 3PNTA 3IHUA 4HDVA 2EILH 2KZVA 3KZZA 3RC3A 4LUPA 1YQAA 2MGQA 4MHGA 3WGHA 4ZDOA 2VLAA 1BI1A 3OMYA 3Q0WA 1VQMI 4NNJA 4DPRA 2FJ1A 3CESA 2EZLA 5GAHJ 1R1VA 1V55H 1TWFJ 2YU3A 1PVEA 4IRGA 5HS9A 1OISA 4LG0B 3WQSB 5F6FA 1I6XA 5D4SA 4JX5A 4ZYGA 4ZYEA 4PU2A 2MFZA 2IS1A 3WGIA 4JOMA 2JRMA 2LR8A 4XN5A 3CXBA 3K70C 1FP2A 3S3MA 2W84A 2X9DA 2KJBA 1FSEA 4M71A 4O5VA 4HX4A 5LHHA 1B72A 3DXJF 4LLNA 3H5NA 4FT8A 2R7ZJ 2LK2A 1AWCA 4CO8A 3PUFA 1UJ8A 2JK3A 5KAFC 2DFHA 3J80Z 2PJRB 4DZJA 3K6GA 1QBJA 1ITYA 3CHRA 5HODA 4XNBA 2EH3A 3PM1A 2ZJQF 3SQNA 1D0ZA 4PUSA 3GLXA 2ACJA 1STZA 2DU9A 1MBEA 4J19A 2BHYA 2FUG2 2M8GX 3BPXA 3ZQIA 3M1EA 2QSGX 1OR7A 1DU6A 1JTYA 1RKWA 4BY7J 3GTOJ 1XSXA 2NOGA 4AU7A 3ERED 1JXSA 1Y1WJ 2CH0A 2MC4A 3GBGA 1UCRA 3MZHA 1XS9A 3I53A 4MTEA 3DF8A 3CCMI 2R7RA 1G3WA 2QUFA 5EEGA 1PP7U 3KP4A 2LVSA 3AU9A 1OCOH 2ID3A 3SDGA 3CDLA 3S16J 5A2QK 2JCXA 4EM0B 1IG7A 3T0YA 3BTCA 1E2XA 2JA6J 4V2GA 1VQKI 3DKXA 2GXAA 4RB1A 2A7OA 2RNGA 2JUCA 3ML6A 3R0IA 2HPTA 3FTZA 5BOXA 2H94A 1JJ8C 4M3DA 2RN7A 1WJCA 3ZN0A 4I2OA 1WJEA 2KRCA 3TOBA 2FFLA 1WJ5A 3FTVA 5J6XA 2MH2A 5CLSA 4CYCA 2DTZA 3L00A 3PSFA 1J59A 3BG9A 3PJRA 1LE8A 2XF7A 1UZCA 3VB2A 2HTJA 2QENA 3ASOH 1WVRA 2QVOA 2EA4A 1YJWI 4UUVA 3OY9A 3GFJA 1MW3A 1LFPA 2EIMH 5FD6A 2HKXA 2ID6A 3MWMA 4DYRA 3OYEA 1XB4A 3GVAA 2XGXA 1ERDA 1LNWA 2LFBA 2O6GE 3F8MA 2HYJA 2KHMA 1MMGA 4OWRB 1R0LA 2XPZA 2EIJH 1U5TC 1JKRC 5IY5H 5K7HA 4XRMA 4JNDA 3R61A 2R3SA 2HGCA 3I71A 4FHTA 3AL0B 2P5KA 3NEUA 1V5EA 1P6RA 5IT3A 1ZG5A 2WBMA 4OAYA 3FTUA 3FXQA 3PFYA 3ZQFA 2HXOA 2NVXJ 4XMWA 2QCOA 3CIAA 3BR5A 2P7VB 5HLIA 3G4SI 3SXYA 1TTYA 2ZMEA 2DOFA 3NWTA 3K10A 4Y7NJ 3R0JA 1R00A 3H35A 1TWCJ 3KYCB 2E34A 2B9SA 1XGSA 3ZQLA 4O6JA 1F43A 1BW5A 3KIOA 5DDGA 5EDNA 5EJCA 3S15J 3LQQA 4ZQGA 1J2XA 2K5CA 1ZRCA 3A01A 1DGRM 4G94A 2F5VA 3HPHA 4UXNA 4BS9A 2ISZA 3B7UX 3HOWJ 4BEHB 1FT9A 2KDOA 3HRUA 2M4GA 3IRRA 2Z99A 1LB2A 3RKWA 1E3OC 2UWMA 4G6DA 4RLFA 2PQ8A 3DEEA 1IRGA 4XMYA 3CC7I 3A2KA 1J09A 1I50J 2L9SA 3DU5A 1T38A 3PNYA 1EH6A 1FLIA 3W3CA 3GZ5A 1XDUA 2IS2A 4EJUA 2OCCH 3OYNA 1XGMA 5TISC 3K69A 2IS4A 4X6AJ 4W97A 5HOOA 4XICA 2DODA 3KEOA 2O7OA 1YW8A 3ONQA 1SMYF 3C2BA 1T0FA 4XNAA 3UEQA 2IGOA 2FOWA 3BLYA 5IP7J 1MNDA 3IAM2 2Y1CA 1SAUA 1TL8A 1A5JA 2K7LA 4XLAA 4I0AA 4KUMA 2WAQA 3S3NA 4YFXF 5DS9A 1MMAA 4DBRA 2E1CA 3RI4A 4RAYA 5JLWA 2R5ZA 2VJ5A 2ZJPF 2UUZA 4AICA 4XOPA 1WFXA 1ZKGA 5DD8A 3B6CA 1BBYA 4DYQA 2FA5A 3HIFA 3LSGA 4PK4A 4ENJA 2LG4A 3DEWA 4XMXA 2JD1A 4I09A 1D3YA 2DFEA 1FOKA 4IRIA 3V8LA 1IRZA 2M0CA 3F3XA 3HGGA 1YO5C 3ABUA 3TP0A 2HFHA 2E5ZA 3MD2A 1T95A 4NQWA 5IYCJ 1DPRA 2RAEA 1FY7A 1ZARA 3AU8A 4ZJZA 2XKOA 3FXMA 1LDKB 4ZDPA 1I5ZA 2VBYA 3ZRGA 2H6CA 2Q1ZB 3JR9A 1XSVA 2HQAA 2Y0SA 2DTRA 2FE3A 1Z05A 5ICEA 1FYMA 3A14A 2P4WA 2ELKA 3HHHA 3M7GA 3ZCOA 3F8BA 2LBFA 4ZZLA 1DGWY 1UHSA 3ERMA 2AXTC 4PSWA 2CSOA 4MTDA 4ZX3A 3VYUB 2CFXA 4LLGF 5J40A 4DNCA 2X0LA 5J1UA 4RM2A 5D5VB 2F2EA 3WTUC 1JGIA 3BZCA 4I6ZA 2JA2A 5FKOA 1JUMA 4A2UA 5M5WJ 3P9KA 3CC2I 1ON1A 1XDSA 2W82A 2DCEA 2X48A 2NS0A 3B2PA 1Z7LA 2VBXA 4BGDA 4D5CA 4XLEA 2E2IJ 1X58A 3WTSC 1JT0A 4H4KC 2E71A 1IRFA 1UAAA 2CQXA 5EGOA 2CG4A 1OCCH 3WHBA 1TBXA 2WB1A 1G3YA 1X3WB 3E6BA 1ZRDA 1WQ2A 2A68F 4ZQFA 3WGGA 3RPUA 2NVTJ 1IXCA 3HSFA 3RDIA 3TKYA 3FISA 2WPGA 3JAMK 2XPUA 3FUNA 4MKTA 2XSJC 3ABTA 2JRTA 3DQVC 4OINF 2V79A 4XKCA 3F21A 4WF2A 3CD6I 3VOEA 3KYLA 2VB6A 2DXIA 2PFBA 2TDXA 3I59A 3JSOA 1HBXG 5JC1A 1R36A 4HOBA 1NK3P 2K86A 2VOOA 2OF7A 2E1NA 1OYIA 4GFBA 2M3AA 2Y1GA 5JNLA 1K6OA 4NHJA 1EA3A 2ZSHB 4B3AA 3K4JA 1QVTA 2X6XA 3LSMA 5FKNA 2MD5A 3HGYA 4QTRA 4JQFA 1FIAA 1S7EA 1AU7A 4L5JA 2FQ4A 1I1GA 5E1XA 3HTSB 4ZDLA 1D1AA 1ZN2A 2DPDA 2LY9A 4DQ2A 2QZ8A 4N9HA 2LY2A 1SVMA 3CZKA 3B7SA 3FHZA 5H20A 1MNEA 1NG6A 1ZGJA 3DKWA 3FXJA 3Q9SA 5LGUA 2IW5A 2EZKA 2PMUA 3HHGA 2HWVA 3TW6A 5HLHA 4Q4ZF 3CC4I 4M3BA 4LD5A 2V9VA 2WADA 1F5TA 3VFZA 2F4OB 1OCRH 2OU2A 3KCCA 2R70A 3R0AA 1A31A 2M7AA 4ITVA 3FU0A 2MABA 3DPTA 1Y1VJ 5E8IA 1LJ9A 4KMUX 3DTEA 4ANJA 1WPKA 2VBWA 3BG6A 4XLFA 2DT7B 1B4AA 2W00A 4GO1A 2RREA 4RB0A 4KA4A 1AOYA 4D1QA 5FKLA 3PIPF 4BHPA 2EV0A 2FQ3A 2VE9A 2KJCA 3QU3A 3EDPA 1C0WA 2W1OA 1R71A 1OR7C 4IVNA 1BL0A 2Z5UA 5CQEA 5CYVA 5LGTA 2I8DA 4NB5A 3RKQA 5M5XJ 4AD9A 2CQKA 3EUHA 4EM1A 4Q4EA 2EIKH 5ICCA 2HTSA 3FXLA 3WU1B 2DQRA 3LSHA 2XB0X 2IXSA 1W36D 3QPTA 2N8GA 2R7TA 3MZYA 4CCKA 5EG0B 2WC2A 4X1EA 4I99C 4UUSB 5JHFA 3I3LA 1KU7A 3BJAA 4G7HF 1H0MA 1PDNC 5BNGA 1TWHJ 2MLKA 1MMDA 4AWXB 3ZQ7A 5D5UB 1TNTA 1WKMA 3OS1A 2R0QC 1S7AA 2EBIA 2VC0A 2DLLA 5ICFA 1PUFB 2RJIA 3ZQCA 1XD7A 1WCMJ 3PFIA 3L2WA 4ZYDA 2FEZA 3SFIA 3GYHX 2L3DA 1GV2A 2VXZA 2L4MA 2HVSA 4WXHA 4ZW5A 4XK4A 1TQIA 3IH3A 4A3EJ 3CF2A 3E5QA 4BBSJ 4HPQA 2CQQA 2HNHA 3SEQA 4Q47A 4PCQA 4F3QA 1XX5A 4EJTA 2ISYA 2G7UA 2DQ6A 3V8KA 4Z6YA 2R7XA 4DBQA 4PW4A 4IHVA 1GLNA 5FKMA 4II2A 4FE4A 5BS6A 2IT0A 2E1MB 1TW3A 4IRHA 2F4IA 2FOKA 3RC8A 3QWLA 3IL2A 3H9GA 4QUOA 1ZTRA 2F5CA 4BDZA 2R7SA 2XB5A 1SANA 5TJJA 4LMYA 2JA7J 3E6MA 1OCTC 2VASA 1T6SA 3BCBA 4ZW3A 2ZFUA 1ZR2A 1KONA 1IO2A 4IO9F 3ZMTA 3U21A 1ZK8A 2XKPA 3C7JA 1QU3A 2QLZA 2A07F 4LG0A 2OQGA 1JUSA 4CGZA 2LREA 3CJTB 3IP4B 2XSDC 1ZLKA 2BYVE 2Z1DA 5D5XB 4EMSA 3FXOA 4ARFA 2JPBA 3I56I 2JUGA 5J3LA 3L2RA 3ULQB 3QPLA 1DDNA 4L9NA 2QQBA 5LD2C 2VJ8A 2HEOA 1YX5A 1A04A 1U0JA 2COBA 4DYCA 4HW0A 1IN5A 4AIDA 3HRTA 4DGWB 3QRFF 2XRLA 2EZIA 3ABMH 2PJRA 4K5OA 2L01A 1ETWA 3MZ8A 1J7KA 4J01A 1Q0QA 1KU3A 3CDIA 4M6VA 2J5OA 1FMWA 3L2QA 1K83J 2OC6A 3M8JA 1VQ4I 1SEUA 2R7VA 1O7LA 1MH3A 1B1BA 1BR4A 3OIPA 2R5YB 2DN0A 2IPQX 3P5JA 1X19A 4KT6A 1T2KA 1T0FC 4A0ZA 2O3FA 1ULYA 3K1NA 1GDTA 1U8RA 2VN2A 1RR7A 1G3TA 3CP2A 3H3VK 5A2QZ 1RRJA 1R5GA 5FO5A 1LFBA 4K2EA 2KKOA 4BH9A 1CF7B 4HLXA 1IN6A 3HUGB 5KVRA 2B61A 2DA6A 2XAHA 4A3LJ 1MH4A 3V8JA 4XNFA 3K4BA 5CVVA 1DU0A 3RZOJ 5HVQC 3ZMZA 2WV1A 3LWFA 4G7ZF 2QF7A 3BR3A 3N05A 2WAEA 5K7ZA 1W0UA 1F9NA 2CUZA 4ZX4A 2VPRA 3AUAA 1FMVA 1VNDA 5ILVA 3GTQJ 4BHCA 4N4NB 2XPWA 3QPSA 4BQOA 3FF5A 1W5TA 4AYBN 2X6WA 4XSXF 5JLXA 4E7KA 3ZPLA 1WJAA 1LUJB 3CUQA 3H3ZA 3CUOA 4HX8A 3KP5A 4A03A 2FX0A 2ZCWA 1YIJI 1U9NA 2KIQA 3V4GA 5BQTA 1QPIA 5LHGA 4O3MA 4DW6A 4DZPA 1HCRA 2BXZA 4A5NA 2Z3YA 3TGNA 3K0LA 3BQZA 1CQTA 2CUEA 4ZYHA 1K78B 1HSTA 3UNGC 1O3TA 3DBHB 2NVYJ 4TV7A 2GZWA 2L9NA 2XRNA 3KYDB 3H0DA 4PJJA 1G5AA 3W6JB 3BROA 4Y3OA 1MKMA 4PDKA 2FBKA 2KIUA 2HQNA 2E35A 2WAQN 3FUFA 2WV0A 4KMFA 3J7ZI 1G6NA 1P2FA 1X3ZB 2CV0A 3MKLA 5M5YJ 3C2HA 3HOSA 2FU4A 4A3KJ 3SHFA 4BL0B 2H6BA 2RKHA 4R7LA 1BC7C 5DV5A 3FTSA 4ENMA 3FU3A 3DTIA 2F5EA 2GA2A 5FKKA 1WI3A 2A5YB 3JTHA 2BY1A 1ETKA 5D6FA 4B47A 4C9YA 4E7HA 1YHQI 1ONNA 1UB9A 4FLRA 3PUUA 4CH7A 3FTXA 4JP0A 1FP1D 3U9GA 2QBYB 3PNVA 2ZXIA 1FC3A 2HOEA 4MQ9F 4MGRA 3CCEI 3F6VA 4KJZA 4IL6C 1KU2A 4D5FA 1SQMA 3C18A 1BJAA 3D0SA 2ICWG 1XPXA 1YITI 1S6LA 3HB9A 1U5TB 2BE5F 1ZREA 2JVHA 4C3JJ 4GXOA 4BEHA 4XN2A 2CGPA 4OIRF 4Y6SA 1ONOA 2QVWA 5CVUA 2W7NA 4RBOA 1LVKA 3PUBA 2CW0F 5F1RA 4E7SA 5E18F 2Q0OA 6PAXA 1WWXA 1Y8QB 1V3FA 2CQNA 1UG0A 3KFWX 3DPLC 2PGGA 4WWCA 4A3FJ 4M3FA 2LTPA 3H1CA 3V7CA 2VXDA 4HNTA 1P7IA 1JI8A 2HU9A 3WODF 3LSIA 3CCVI 1TW2A 1DP3A 3BTLA 1KYWA 3GZNB 3MAJA 2IGMA 3GUDA 5HS7A 4OU0A 1RPWA 1P92A 2LP0A 2M8EA 3KP7A 1D1CA 1OPCA 3EBGA 2ME6A 4YELA 1MW2A 4W1UA 2LLKA 2WB1N 2XF5A 2OTJI 2EB7A 2XGEA 1W5SA 4L5EA 3DLLF 2JD2A 3TDZC 3RSNA 3CHOA 3OYBA 1MW1A 3RPQA 3OYFA 2Q2EB 3WTYC 1QZYA 2R7DA 4MLOA 2GXGA 2ESHA 4EVIA 3Q43A 3QYBA 2V7FA 2ZXWH 2LY1A 1JT6A 3CHPA 3O8GA 3L7WA 5GPAA 4FLOA 1FEXA 4FETA 3COAC 4F55A 5KK1A 2BXYA 4IHTA 1KYZA 4B1RA 3CMYA 3BR6A 1P4AA 5BMZA 5AONA 1XSDA 5E3MA 1BN5A 3RTRA 2W4SA 3DP7A 4PFOA 4OAZA 4XRSG 1CGPA 4Q5SF 1XMKA 4LIVA 5D6EA 2DYSH 3JREA 4EJWA 1U8BA 1T1SA 3FUMA 5D5WB 5DYFA 2UZKA 2PEXA 3P7NA 1K5HA 3WHCA 3CO6C 1Y39A 1S72I 1YRNA 4XSZF 5EZGA 3EUHC 2OQRA 4WX9A 4MEXF 1PUEE 2OZUA 1HS6A 3CMEI 2CW7A 2DDBA 3HYIA 2JA5J 1YI2I 2QKLB 1HW1A 4Y52J 1H3LA 2KLOA 5HNFA 1YIOA 4XIDA 3MKYB 2MLGA 5F08A 2V26A 1N75A 1NTCA 4CYDA 4JX4A 5H6QA 3RQ4A 4Y6PA 3BDDA 1X1DA 2VOPA 1MW7A 2LF7A 4MQVA 3ZI0A 1Z9CA 3S17J 3ZQHA 1ETQA 3JRGA 3JAMZ 1X3WA 2KDZA 2KQRA 1Z0XA 1K79A 4G7OF 1UELB 2HOAA 4FLQA 1FIPA 4LG3A 1L0OC 2KISA 3B37A 2OBPA 2W57A 1YTYA 1MBFA 5JVGF 1V4RA 1MZBA 3RJPA 1Y8RB 3BJ6A 4HQEA 3FHNA 3K4KA 3VVLA 2VKVA 2EFNA 1H88C 4Y17A 2V1NA 4B44A 2KZGA 4NDLA 4M9SA 2BBYA 2GM4A 2XAGA 4R1HA 4UVCA 3WG7H 4BQNA 1S46A 4ETSA 1BI0A 3FU5A 5DEQA 3R60A 1S9HA 3L2CA 3AKZA 1D5YA 1ENHA 5F64A 4RGRA 2F4MB 2HOSA 4RDUA 2FXAA 2L7MP 1VZ0A 4XLHA 5C44J 2YU9J 3M8EA 4L5IA 5K7FA 4U0YA 1IGNA 3ANNA 2OUMA 1F1ZA 4HNVA 3EUAA 2JVGA 1XGOA 2OAZA 3S32A 4PJNA 1MDMB 2IRFG 2GQQA 2F5FA 4RMNA 4A5MA 1MGTA 1PYVA 3K4NA 1FPQA 3X2QH 4OMYA 3F22A 2MA3A 3MKWB 3T8VA 4E7JA 3D5LA 1ZS2A 3K4MA 2Y2ZA 1MMNA 1Z3XA 1HKQA 3SFZA 4L9VA 5KAIC 2R7QA 4Z2YA 1OFCX 3L9FA 2G7HA 4PFPA 3IKTA 1FYKA 4CCJA 2V9PA 3CP8A 3CMMA 2C6YA 5FD5A 4QPQA 4A0XA 3M1CA 2L9VA 5JAZA 2PG4A 1W1WE 2EINH 2VQCA 4I98B 4AIKA 1MJBA 2Y1DA 4G6TB 1ON2A 1BOAA 3KP3A 3QOPA 4ABZA 3WTWC 3J81Z 2WWYA 3DU6A 3BZ6A 2YX7A 5E3LA 4XMZA 2J5PA 4BJ5C 5F1JA 3IC7A 3OL4A 1QRYA 4ZW8A 4PJMA 5DTDA 4IHYA 3AFHA 1B9MA 3K2ZA 4E7LA 2G0EA 2HS5A 3VSKA 1WRJA 1FZPB 3P9CA 1HXDA 3VPRA 5L3CA 4M74A 4FCYA 3HPGA 4A6EA 1LFUP 3D5RC 1HQCA 5FFXA 5B66C 1B72B 2O8KA 5EG0A 4B8XA 3W2VA 1YJ9I 2H1KA 4ZC3A 2YR2A 3LFUA 2HI3A 4UUSA 3FULA 5GAEJ 4CZCA 3RKXA 2M1BA 2EFOA 4C2TA 1Y0NA 4M72A 2H8WA 2FF4A 3QYEA 1QHGA 1NH3A 2E2HJ 5ED4A 5CQGA 2DT5A 5IT9K 3OWTA 2XF6A 5CJ9A 3CCJI 3FUIA 2KPMA 3OV8A 4RB3C 2L02A 4UVBA 2VQHA 5J4VA 1QZZA 2Y31A 5EZHA 2OV7A 3KLOA 2CJJA 1X1PA 2BEOA 4G6QA 2DA5A 2DOEA 2K40A 2RGVA 3CUQC 5JBIA 2XPVA 1H89C 1IUYA 5CPRB 3W2AA 3FH7A 1J5YA 2IBDA 3WTTC 1R1UA 3BR2A 1T56A 5HLTA 3F0CA 5E17F 1VQNI 2HPIA 4A3DJ 1F4KA 2RQPA 3FM5A 1P4WA 3HC7A 4QIWN 4MFDA 5L3EA 2XAQA 1IDYA 3K9TA 3KEYA 4M73A 1VQOI 4RA2A 1P7JA 1MBKA 3AL0C 1O3RA 2D5VA 3HSEA 2ZBKA 3BC8A 3HOTA 5L3FA 1ZGAA 1R1TA 1BW6A 1IN8A 1DQUA 5E1ZB 4NC8A 2HYFA 3U1DA 3KLNA 3DBLB 2JTVA 1LE8B 5CVIA 1D1BA 2XGDA 3K70D 3K1MA 4L9JA 1TLHB 3B02A 3FZVA 1QGPA 2AO9A 2W25A 3FU6A 5CVJA 2HPOA 4XN8A 4IOCF 1D5VA 1VQ5I 2STTA 4AYSA 1YYVA 4II3A 3OS2A 5DUIA 3JRHA 1A6IA 2JJ7A 3OYKA 3OR1C 3A0BC 4ZX6A 2A61A 1R5HA 1QQIA 1KQ8A 1XC5A 3O3KA 3RYPA 4BE1A 3MMYB 2D2WA 3LNQA 5FJ8J 3CMAI 2CV2A 2P7CB 3F8CA 4QSHA 5B5EC 3CCRI 1IXRC 2MW8A 5L3BA 2HZTA 1A35A 4BJ6C 1ETYA 2Q8KA 4IKFA 5AENA 1HDDC 4IX7A 4D7NA 2ESNA 3QP5A 2YS9A 2GA1A 2HVRA 4HF1A 3CQZJ 4A69C 3R6SA 4L2LA 5FWQA 2ZMEB 3S93A 2FSWA 2VJIA 4BBRJ 2EA2A 1OQYA 4JX6A 2R5YA 3K2AA 2QM3A 3WTXC 3I5UA 2VJ4A 4EJVA 1IXSB 2XAUA 2EFWA 2RC4A 1ZQ3P 5LLQA 1SFKA 3DBRB 1BI2A 3O6BB 4XL9A 1YJNI 1UHMA 2DK8A 2VQLA 3E5XA 5J8FA 2L7ZA 3FUJA 3PL8A 1HW5A 1WH5A 4XRFA 2PN6A 5TGTA 5FB2A 1CF7A 3ABKH 3RIRA 1RR8C 2KT0A 4FCAA 3MCZA 4IEJA 4ZW6A 3I55I 1ZG3A 3AG4H 3I4PA 1RKTA 1ZLJA 4UUTA 5FROA 4QLCU 1MMSA 3DV8A 1JG9A 4IXAA 5BPIA 3DFGA 1A6QA 4V19K 3GEZA 4RCVA 4XOTA 2FMLA 4BE2A 3I4NJ 2X6YA 2BVMA 3BQYA 4DOZA 3VYTB 2L54A 3F72A 3V7RA 4RVBA 1VQLI 1HKTA 1R7JA 4F92B 1V54H 2ELJA 4HAMA 2RV8A 3J81K 5FRMA 1IJWC 3GMEA 3PO2J 3L2UA 4XN9A 5JVTA 1D8KA 4XLPF 3KEQA 1FNNA 3JRFA 3RASA 5K5QA 2STWA 1XN7A 4LB5A 4CHUA 1E0EA 1R4NB 4R5VA 2BGCA 4Y67A 3LSKA 3P9IA 3ROUA 2Y75A 1K78A 1SFOJ 3DWLE 1BJZA 1B8IA 5K5RA 1W7PD 2NVQJ 2WZGA 2K27A 4EGZA 4ESBA 4IJAA 4A3GJ 1B59A 4KIBA 3CTAA 4A6DA 3CZEA 3CHQA 2HDCA 1VI0A 2CWEA 3DPUA 3JTGA 2Y69H 3M3YJ 4ZX5A 4CCMA 3G3ZA 4HRIA 5E8GA 4YIRX 2V9KA 2LSOA 1JKOC 2K9NA 1X1AA 3D1NI 2O9LA 2EWNA 4DJAA 3KP6A 2WZFA 2DA2A 3FUKA 2EPFA 4WXDA 1GVJA 4PSXA 3S1RJ 1UFMA 2CV1A 4IHWA 2HQ5A 2GIVA 4XLNF 3E6CC 4NQWB 1MJAA 4IQJA 2QBYA 2H09A 1TT5B 2V1DA 2V6CA 3T8TA 3BG5A 4IQ4A 3EYYA 4IZZA 3LOCA 3FWEA 1PJRA 4B4CA 3SDBA 2DJNA 2QQ9A 2GOMA 4GYIA 2GLOA 1R22A 3KP2A 4PGGA 2PMZA 3H5AA 3WG9A 1X1CA 1GUUA 3HDDA 3PIOF 1IZ1A 4HZFA 1QVUA 2BZTA 1G3SA 5FLXK 3GTGJ 5EV7A 4BUPA 2EQRA 2P81A 2GTQA 3OL3A 4I02A 3BCAA 3LSJA 3I4MJ 4CICA 2LNBA 1LKXA 1EV7A 5B3SH 1I1SA 2XV4S 1LEBA 1BC8C 3FMRA 2ELHA 3IAS2 3EYIA 3JRBA 1GW6A 5EGOB 2ZSIB 1ETVA 5B1AH 3GCMA 1SFEA 2WY8Q 4XMVA 3Q3SA 3EBIA 1X4PA 1WJDA 2K9LA 4BQQA 1HW2A 5FGMA 3CCQI 2GAUA 2M7BA 3RKYA 3K1PA 3UKGA 3OYCA 1IV6A 1I39A 5L3DA 2QKMB 4XO4A 3QP6A 3TO6A 1K61A 1S3JA 1SFXA 1J0RA 2MYSA 4UB8C 5DM6F 2P5LC 1VTNC 2JSPA 3D5SC 1FJLA 3C3WA 4AR9A 2JWTA 1R58A 3TO7A 1BR2A 1BOBA 1LVAA 1UHWA 5K5OA 1IV8A 2VE8A 4S0HB 4LK1F 3F8NA 2NXNB 4C2UA 2B7EA 2V4JC 4J00A 1YG2A 2DQMA 2JD0A 2GBYA 4HF0A 1D0XA 2OA4A 3IIEA 4A93J 3T1BA 2LD5A 3SZPA 3TDUC 4U87A 2NNNA 3ZP5A 3JSPA 3JSZA 3UCQA 1IN7A 2P8TA 3S14J 4LK0F 3FTYA 1ZELA 2BHZA 4XNDA 3T5XA 3G71I 1WZ2A 2IA0A 3ZQGA 3ZXSA 1V5GA 3HRSA 5M3MJ 1TQMA 4LOCA 3S1MJ 3BG7A 2UXXA 3FTWA 2VPLA 4ZH4F 1M1EB 5JI6A 4KN7X 1WI9A 4RGUA 1ACIA 1G8XA 4PJLA 4KIGA 1ONPA 3CLQA 2VIXA 2IS6A 3EBHA 2CUFA 3H36A 4BDYA 4XMUA 5LRSA 3OYGA 5DM7F 1T39A 5E20A 4OIOF 3TQNA 4U7BA 2E2JJ 5FLVA 2LH9A 3IWFA 1GV5A 5BPPA 3G73A 5J4YA 2Y1FA 2GWRA 1BM9A 2BV6A 1JUPA 1OKRA 2EJRA 3NQOA 1POGA 5DCMB 3EPZA 3ANMA 2HDWA 4K5MA 1WGXA 3R4KA 3EUKL 4N9IA 4BXFA 1D0YA 2M5WA 3J7YJ 3F8FA 3HBLA 5F0FA 3F9KA 3GZ6A 4OOIA 2JN6A 2ZXGA 1Y6IA 4FX0A 2XROA 1JHFA 3QOEA 3V42A 1VQ8I 4UY8I 2HYGD 1U3EM 4U0WA 1HLVA 2HXIA 3HXLA 4AC0A 3KZIC 4LITA 4M9XA 2E60A 1ZHFA 4EQQA 4KDPA 1U2WA 3KE2A 1B9NA 2DMQA 1T98A 4K5PA 1H9GA 3ZMSA 4DIQA 2R7FA 1JJ6C 2E19A 4XR6A 3AG2H 4QHPA 4S05A 3U9WA 5HDNA 2X85A 3JRDA 4R8HA 4MIMA 3IV5A 3VVMA 5IOZA 2FBHA 3ELKA 4FTHA 4P9FA 1P9QC 1YFHA 5ILUA 5DCFA 1R0KA 2BY0A 1IAWA 1MNMC 3S2DJ 3I9V2 5HDKA 1KQ0A 1XCBA 1MJ9A 3TOAA 2A5WA 1ZR4A 3E6DA 1IC8A 1YX3A 1RESA 3ZMVA 3JRAA 2EK5A 5AIPA 4XN7A 2PL5A 5JO0A 3MQ0A 4FE7A 4M3GA 1MDMA 4IHXA 3BTIA 3LA3A 3GTPJ 3OR2C 2DA1A 4XKWA 3GX4X 3FXUA 4GDFA 2ZJ2A 2Y0SN 3H9JA 4LIUA 3WE3A 1YS6A 4QWQA 2NS7A 1W0TA 1W7PB 4L9TA 4AIHA 2K9SA 2WY7Q 4QMEA 4D9JA 2DT6A 3BJOA 3AG1H 4PGHA 3KPHA 4ZTFA 1AA7A 2LYCA 1O3QA 1XGNA 2VT2A 3KETA 4Q4IA 3IH4A 4KISA 2TCTA 3A4CA 2JPCA 3ABLH 3GTKJ 3WE2A 1Q1HA 3HSRA 2QSFX 4BHBA 3ANLA 3GFIA 2DK5A 5C4JJ 4R5XA 2A6HF 3BWGA 2ZO4A 2VI6A 2A6TA 2HOTA 3WU2C 2DDAA 4P1WA 2VJJA 3OOUA 2B0LA 2Y30A 2KRFA 3VEPA 1YLFA 4CZZA 1RC9A 4I7HA 2M0MA 2DMUA 4YRVA 3S8PA 5KHDA 3HOVJ 2R59A 1OMIA 1J75A 2L7KA 2ADUA 1HF0A 1IN4A 2DI3A 4R5TA 4XMTA 1KU9A 1TC3C 2ZJRF 4RAGA 4Y4RA 2MSYA 4OIQF 5M3FJ 2R7OA 1LQ1A 3ZHYA 2JMWA 3IRQA 1ETXA 1JGSA 2JV7A 2IP2A 1OCPA 1K4TA 2GOXB 3LSRA 5E3OA 2XHKA 3L1PA 4XLCA 1EH7A 2NS8A 5IT9Z 3ZN1A 2OCEA 2ZKZA 2ZC2A 4UV9A 4J3BA 2LRDA 2CQ7A 2ZFWA 3NRVA 4LGWA 3QQAA 3E97A 2VQGA 3E7LA 3TW7A 2JQ7A 3G6EI 1IDZA 4MEYF 3GFMA 3HOXJ 3MN2A 5GPCA 4OIPF 1U9OA 2FNPA 1TT0A 2HR3A 3HKZA 3QU6A 3LFKA 4KT5C 5LBQA 4IOAF 1U6GA 3OIOA 3W2WA 4ZN6A 4AVPA 1Z3YA 1Z6TA 5EYRA 3V7SA 2XUBA 3FM3A 4XN3A 2F5DA 4UV8A 4HV5A 2K9MA 2MBFA 3M8FA 2V6EA 4KYWA 5K1YA 1RZ4A 2M45A 4GAAA 4ZQHA 3WQQA 4XRSA 2OTLI 2K85A 1H19A 1ODDA 1Y56A 2QWWA
chains in the Genus database with same CATH topology
2BOLA 1N77A 3FUDA 2VQHA 1W36D 3QJXA 4Q4EA 3LSHA 2Z16A 2IXSA 4CCOA 2OV7A 1V5FA 2R7TA 4CCKA 3ZR8X 3K4LA 5JHFA 3I3LA 3QYFA 4CCNA 2QJ1A 5JBIA 4PVBA 3B34A 4CSWA 5CPRB 3W2AA 1MMDA 3FH7A 2CS3A 3ZQQA 1MW0A 2HZDA 3OS1A 2X1DA 2BVLA 3SEZA 5HLTA 2L5QA 2RJIA 2X1CA 2HPIA 3OYLA 4HNUA 4CA0A 2BW3A 3S3OA 3L2WA 1Z21A 3OIQA 2XQ0A 3L2VA 3HC7A 2MAOA 3CJRB 3SZGA 1Q0HA 3B3BA 2LOOA 2O5RA 3IUOA 3KEYA 4E6KG 2VXZA 3HL2A 2HPMA 3B7RL 4KITB 2E1MC 2KP6A 3B7TA 2E5NA 2HVSA 3AL0C 2RQQA 1G59A 4BU2A 4FASD 3BC8A 3HOTA 4ZW5A 2R72A 4BACA 4RLQA 1DQUA 3CF2A 4HPQA 4NC8A 2HNHA 2BW3B 3SEQA 5HNHA 4F3QA 5FRNA 4P5OA 3DKYA 3E0JB 2DQ6A 1D1BA 2HVQA 2L2OA 4DBQA 2R7XA 3K70D 4PW4A 1GLNA 1N78A 4II2A 4XKVA 2ZXHA 2E1MB 2F4IA 3RC8A 3H9GA 1W36C 4AVZA 2Y1EA 4QUOA 4AR1A 3FU6A 2IGKA 2HPOA 4BDZA 3K4CA 4XN8A 2K3PA 2R7SA 4AYSA 3VYRB 3B2XA 4II3A 2VASA 3BCBA 3OS2A 4ZW3A 2WAFA 2ZFUA 4ZYAA 3OYKA 1KONA 3OR1C 4ZX6A 2UV1A 4QIRA 2PUSA 4ZW7A 3U21A 1QU3A 3FH8A 2XC7A 4BE1A 3MMYB 4HEA2 1WJBA 3OYIA 2CV2A 2DOAA 1Q0LA 3CZ6A 2LREA 4HSTA 4CUGA 3PNTA 4BJ6C 2KZVA 3IP4B 3RC3A 4IKFA 5AENA 4LUPA 4IX7A 2Z1DA 4ARFA 4YEJA 4ZDOA 2VLAA 2JUGA 2HVRA 3OMYA 4L2LA 3L2RA 5FWQA 4NNJA 5LD2C 4DPRA 3CESA 3S93A 2VJ8A 1YX5A 2CW8A 2VJIA 1U0JA 3FBIB 4BJTA 3WQSB 4PU2A 1YE9A 1WJFA 2VJ4A 2XAUA 2MFZA 4DGWB 4AYBA 2PJRA 2IS1A 4K5OA 4JOMA 1SFKA 1H19A 3A06A 4XL9A 4J01A 4ZQTA 1Q0QA 4XN5A 3K70C 3S3MA 1FMWA 2VQLA 4Y6RA 3L2QA 2OC6A 3M8JA 2R7VA 2XDVA 3PL8A 3FUJA 5TGTA 4FCAA 1BR4A 3H5NA 3OIPA 4ZW6A 5FROA 4KT6A 1X19A 1JG9A 3TMOA 1T0FC 2PJRB 3CHRA 3K6GA 5DULA 3VSLA 4RCVA 1R6RA 4XOTA 3CP2A 4F93B 4XNBA 1SG7A 4BE2A 2X6YA 2BVMA 4DOZA 1D0ZA 3G2BA 3VYTB 4PUSA 3NWSA 2MD0A 4B3XA 2VKHA 4RVBA 4B43A 3ZHXA 4F92B 3HUGB 2B61A 3CHSA 2ELJA 2FUG2 4XN4A 1OR7A 5FRMA 4AU7A 4XNFA 3K4BA 3L2UA 4XN9A 5HVQC 2CH0A 1MW2A 2MC4A 3GBGA 4E7ZA 3RASA 3H5RA 1E0EA 3N05A 2WAEA 4ZX4A 2R7RA 4R5VA 2CUZA 4Y67A 3LSKA 3AUAA 4Y33A 1FMVA 2MAPA 3AU9A 3DWLE 4N4NB 4BQOA 2JCXA 2WZGA 2X6WA 4E7KA 1WJAA 3T0YA 4A03A 3RPUD 3DKXA 3CZEA 3CHQA 4XO3A 2A7OA 3DPUA 2RNGA 4ZX5A 4F52A 4CCMA 1MVYA 3FTZA 4HRIA 3R0IA 2HPTA 1WJCA 2V9KA 1WJEA 2KRCA 1X1AA 3E1SA 1WJ5A 1X1BA 2FFLA 3FTVA 3UNGC 5CKTA 3PSFA 2L9NA 4DJAA 3H0DA 3PJRA 2WZFA 4PJJA 1G5AA 3FUKA 2XF7A 4PSXA 4Y3OA 4B48A 2CV1A 4NQWB 2C82A 1MW3A 1LFPA 4QPOA 4QPEA 3FUFA 4IQJA 4HSRA 2VKDA 2X1EA 3RCOA 3OYEA 2CV0A 1ERDA 3C2HA 3HOSA 2C5ZA 4IQ4A 2KHMA 1MMGA 3LMMA 4OWRB 3H9QA 4IZZA 1PJRA 1R0LA 4BL0B 3SDBA 2XPZA 4KP7A 4R7LA 4C30A 3Q44A 3FTSA 2GOMA 3FU3A 2NOJB 3DTIA 4GAEA 4B47A 4C9YA 2PMZA 3H5AA 4E7HA 4JNDA 4ZTJA 1X1CA 3AL0B 1ONNA 1V5EA 3PUUA 4FLRA 4CH7A 3FTXA 2WBMA 2AQEA 2O7GA 4OAYA 4R79A 3PNVA 2ZXIA 3OYAA 3FTUA 3PFYA 5EV7A 1TZLA 4BUPA 4XMWA 2GTQA 3OL3A 4KJZA 3CIAA 3BCAA 1SQMA 4BE0A 1LKXA 2R4GA 3NWTA 3K10A 5JMWA 2JVHA 3H35A 4BEHA 3IAS2 4XN2A 3OYDA 4Y6SA 1ONOA 3QODA 1GW6A 2QVWA 2ZSIB 3OYMA 2W7NA 3UR3C 2WY8Q 4XMVA 4XN0A 4N4OB 3EBIA 1X4PA 1LVKA 3PUBA 1WJDA 4XO5A 2K9LA 4BQQA 3FUEA 4E7SA 4ZQGA 2K5CA 5DLLA 1DGRM 2F5VA 2Z2SB 3HPHA 1UG0A 2AQFA 2M7BA 4BS9A 3DPLC 2KL4A 3OYCA 3B7UX 2PGGA 4BEHB 2KDOA 2M4GA 2QKMB 4K5LA 3SYTA 4XO4A 2UWMA 4RLFA 4XORA 4E7IA 3DEEA 2VXDA 4HNTA 2CMPA 3A1YA 1JI8A 2HU9A 4XMYA 3LSIA 2MYSA 2LC2A 2CFOA 3A2KA 1T1RA 3OYHA 5JMPA 2JSPA 3D5SC 1J09A 1DP3A 2L9SA 3DU5A 4AR9A 2DJIA 2IGMA 4GRIA 1BR2A 4XKBA 3PNYA 4MS6A 1BOBA 3FBNB 1D1CA 3W3CA 2IS2A 2M4KA 3OYNA 3EBGA 3PSIA 4YELA 4C2UA 2VL8A 3ZGKA 2V4JC 2XF5A 4RM3A 4J00A 2IS4A 5HOOA 2DQMA 2JD0A 2JD2A 1D0XA 3RSNA 3CHOA 3IIEA 3CJQB 3ONQA 3DLAA 3UCQA 3OYBA 1MW1A 4XNAA 4U87A 3OYFA 3FUIA 2Q2EB 3JSZA 2IGOA 3BLYA 3UEQA 1MNDA 4MLOA 3FTYA 3IAM2 1ZELA 2Y1CA 1SAUA 3KX2A 2XPYA 4XLAA 4EATA 3Q43A 2WAQA 3S3NA 4XNDA 5KNLA 3QYBA 2V7FA 3ZXSA 1MMAA 4DBRA 1V5GA 2R7WA 2LY1A 3CHPA 3BG7A 3VDXA 3FTWA 2VPLA 2VJ5A 2KRHA 2UUZA 4FLOA 4AICA 4XOPA 4FETA 4F55A 1WFXA 1G8XA 4PJLA 4ZQEA 4XN1A 1ONPA 4PK4A 2VIXA 3LSGA 2IS6A 2LG4A 3EBHA 4XMXA 2JD1A 4BDYA 4XMUA 3RTRA 2W4SA 3OYGA 4PFOA 4OAZA 3FUHA 4F91B 4LIVA 2P0WA 4U7BA 1T1SA 3TBIA 3FUMA 2LH9A 5DYFA 2E5ZA 1X4OA 3MD2A 3KEDA 5BPPA 1T95A 2Y1FA 4NQWA 1K5HA 3FKJA 3AU8A 3EPZA 4ZJZA 3ANMA 2HDWA 3HG9A 4K5MA 1LDKB 4ZDPA 3EUKL 3EUHC 4BXFA 1D0YA 3OY9A 1HS6A 1X3ZA 2CW7A 3F9KA 3ZRGA 3FHEA 2QKLB 3ZHZA 2Q1ZB 1H3LA 2ZXGA 2KLOA 4X2UA 1Y6IA 5HNFA 4AR8A 2HQAA 3QOEA 3VYSB 2Y0SA 3V42A 3MKYB 4X0GA 2V26A 3A14A 3HXLA 3ZCOA 1N75A 4LITA 2LBFA 1DGWY 2E60A 3RQ4A 4Y6PA 1X1DA 1MW7A 4PSWA 1RP3A 4ZX3A 3VYUB 1JGIA 4K5PA 3ZI0A 4RM2A 4DIQA 4XR6A 2JA2A 4QHPA 3U9WA 1X3WA 2X85A 2W82A 5KCMA 2KQRA 2DCEA 3B2PA 1UELB 1Z7LA 3FH5A 4FLQA 4LG3A 4BGDA 3VVMA 3B37A 4XLEA 4K5NA 2LBFB 3DTKA 4H4KC 1P9QC 1UAAA 1R0KA 3FHNA 3K4KA 3VVLA 3I9V2 2WB1A 4BKXA 4XQFA 2V1NA 2A5WA 4B44A 1K6YA 1YX3A 4ZQFA 3OS0A 3CZLA 4XN7A 2JCVA 4BQNA 1S46A 2PL5A 2WPGA 5JO0A 4FLSA 3FUNA 4MKTA 2XSJC 1JVSA 3FU5A 3DQVC 4XKCA 1S9HA 3AKZA 3OR2C 4XKWA 3KYLA 2VB6A 4XONA 2DXIA 3H9JA 4LIUA 3FDYA 1VZ0A 5JC1A 2EGHA 4XLHA 2WY7Q 4QMEA 4D9JA 2DT6A 3ANNA 2WA0A 2OUMA 4CXFA 3EUAA 2JVGA 3S32A 2Y1GA 2M3AA 4ZTFA 1AA7A 2LYCA 2X51A 4PJNA 3MKZA 3JT1A 5JNLA 1EA3A 2ZSHB 4RMNA 3K4JA 2X6XA 5LFAA 3LSMA 4Q4IA 4KISA 3K4NA 1PYVA 3A4CA 1SC5A 4JQFA 3ANLA 3WQRA 3UERA 3MKWB 2KMUA 3T8VA 2F6CA 1HA8A 4E7JA 2IGNA 4ZDLA 4R5XA 1D1AA 3D5LA 1ZS2A 2A6TA 3K4MA 1MMNA 2LY2A 1Z3XA 3CZKA 4P1WA 3VWBA 3B7SA 2VJJA 3LL7A 1MNEA 1NG6A 3OOUA 2R7QA 4PFPA 2M0MA 4HG2A 4YRVA 4CCJA 3S8PA 5KHDA 2R59A 3CP8A 1NG7A 3CMMA 2L7KA 4XM3A 4CCLA 4XMTA 4R5TA 4QPQA 3M1CA 2WADA 4NC7A 5JAZA 2VQCA 4Y4RA 4NUBA 1BR1A 2Y1DA 4G6TB 2R7OA 3ZHYA 2JV7A 3CZGA 2R70A 3TL4X 3DU6A 2M7AA 4E4HA 4ITVA 3FU0A 4XMZA 2MABA 2GOXB 3DPTA 4BJ5C 1IRXA 3OL4A 4XLCA 3DTEA 4ANJA 4PJMA 4ZW8A 3AFHA 1OLTA 4E7LA 4J3BA 2R7UA 2LRDA 4XLFA 3BG6A 2CUJA 2DT7B 4RSYA 3VSKA 2W00A 3C2GA 2RREA 2VQGA 3HPGA 4D1QA 3OYJA 3D5RC 1TT0A 3HKZA 4ZN6A 3W2VA 1QHHD 3W2WA 4ZC3A 1Z3YA 3LFUA 3FULA 2W1OA 4CZCA 1OR7C 4XN3A 5CQEA 4C2TA 2I8DA 2K9MA 2V6EA 3J7AY 4GAAA 4OOEA 3QYEA 4ZQHA 3WQQA 1QHGA 2JCYA 4OOFA 5CQGA 3OWTA 2XF6A 1Y56A 2KPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLA A;  5HNH A;  5HNF A;  5HLT A; 
#chains in the Genus database with same CATH topology
 2BOL A;  1G2H A;  3FUD A;  5BPD A;  3QJX A;  2Z33 A;  1JHH A;  2Z16 A;  4RGS A;  2PI0 A;  1SD7 A;  2QQ8 A;  3K4L A;  2VC1 A;  1XG1 A;  2QJ1 A;  2P6T A;  3M4O J;  2DQL A;  3PQK A;  3W6V A;  2XAJ A;  1YW9 A;  4RAZ A;  1AKH B;  5EEH A;  1XMA A;  2CS3 A;  1VQ6 I;  4ON0 A;  2EFP A;  1MW0 A;  2HZD A;  4A3I J;  2X1D A;  4BYY A;  3SEZ A;  3HOZ J;  3OSF A;  2L5Q A;  2DYR H;  4P96 A;  2X1C A;  4ESF A;  5EEA A;  3OYL A;  2RNJ A;  2DAO A;  2PLY A;  1Z21 A;  3OIQ A;  2IA1 A;  2XQ0 A;  3L2V A;  1EF4 A;  3CJR B;  3SZG A;  3CUQ B;  3B3B A;  1G4D A;  2LOO A;  3E3V A;  2HPM A;  1RI7 A;  3HL2 A;  4ENK A;  3ZMD A;  2QYO A;  3B7R L;  2PX9 A;  2E5N A;  4BAY A;  1G59 A;  3FX3 A;  3I58 A;  4BU2 A;  3Q0U A;  4FAS D;  2R72 A;  2CO5 A;  4RLQ A;  3E5U A;  3ISP A;  1SMT A;  3NAR A;  2BW3 B;  4HV6 A;  5CVR A;  5HNH A;  3TO9 A;  4A3B J;  3DKY A;  2L7F P;  3H92 A;  2QQA A;  3E0J B;  4U0V A;  4NBQ A;  3DEU A;  2NAZ A;  2DW4 A;  1JTX A;  3WU0 A;  2ZXH A;  1GT0 C;  4WK8 F;  5JHU A;  3M9A A;  2CYY A;  1W36 C;  4AR1 A;  4NC6 A;  1GHC A;  1MD0 A;  1LEA A;  3K4C A;  3RQI A;  2KFD A;  1Y0U A;  4GYG A;  2V1X A;  3CLO A;  4AUX A;  1F36 A;  3VYR B;  2NYX A;  3WTV C;  3A02 A;  2VUM J;  2DA3 A;  2E7W A;  2WAF A;  3U1K A;  2UV1 A;  3HM5 A;  4QIR A;  4ZW7 A;  4M6X A;  4ESJ A;  1U78 A;  4HEA 2;  2DOA A;  1SC7 A;  3J7A O;  1TWA J;  1Q0L A;  1IF1 A;  2W85 A;  4BNC A;  5D8K B;  1VQP I;  3CCL I;  2IJL A;  1Z1D A;  5IP6 A;  1Z67 A;  3REO A;  4YEJ A;  3N97 A;  1TP4 A;  4GCV A;  4EEF G;  1KQ9 A;  1VQ9 I;  3L09 A;  2CW8 A;  1APL C;  4KNY A;  3FBI B;  4BJT A;  1SD4 A;  2RDP A;  1HDP A;  3LQR A;  4HDU A;  3FMS A;  1FBQ A;  1YE9 A;  1WJF A;  2M87 A;  2XIG A;  3BG3 A;  4AYB A;  1Z6R A;  2PMZ N;  5HLG A;  3A06 A;  4ZQT A;  5E1W A;  1ZH5 A;  4Y6R A;  3H0G J;  3Q0V A;  3H3U A;  4E70 A;  4IHS A;  2XDV A;  4FX4 A;  5H6R A;  3LA7 A;  1VF9 A;  3LST A;  3S1N J;  2KIM A;  5HS8 A;  2I10 A;  4D7M A;  4BQA A;  2FBI A;  9ANT A;  2XAS A;  3GO5 A;  3TMO A;  4EM2 A;  2IEK A;  5DUL A;  3VSL A;  4PZJ A;  1DPU A;  1R6R A;  3G1M A;  4F93 B;  2R92 J;  4YFK F;  3RYR A;  4UNO A;  2ZNZ A;  1SG7 A;  1QZE A;  3G2B A;  3NWS A;  4LJZ F;  2MD0 A;  4JBA A;  2MH9 A;  2VKH A;  4B3X A;  1GVD A;  1N25 A;  2VBZ A;  4B43 A;  1VQ7 I;  3O8H A;  3ZHX A;  3GWZ A;  3CHS A;  4XN4 A;  2G9W A;  1GXP A;  2A3S A;  2K9Q A;  5GAD J;  3AG3 H;  2UXN A;  2VT3 A;  3CCS I;  4E7Z A;  2YPR A;  3H5R A;  3M07 A;  3GTM J;  1KGS A;  3C1D A;  4YFN F;  1XMX A;  1PUF A;  3J80 K;  4Y33 A;  3PO3 J;  2MAP A;  4S04 A;  1P4X A;  1QNT A;  4A0Y A;  2NRA C;  3RPU D;  4XO3 A;  3FK7 A;  5J1Y A;  4F52 A;  2B63 J;  1MVY A;  2X6O A;  3O2P E;  5LEJ A;  3IH2 A;  1TQP A;  4RGX A;  3BPV A;  3E1S A;  2BY3 A;  1X1B A;  2VKE A;  1ONV A;  4LB6 B;  5CKT A;  1O57 A;  4L18 B;  1ETO A;  3HTU A;  4G8X A;  3VOD A;  4B48 A;  5FLX Z;  3ESW B;  3ECH A;  1JKQ C;  2C82 A;  4QPO A;  5E3N A;  1E17 A;  4QPE A;  4HSR A;  2VKD A;  4HQM A;  2X1E A;  4HBL A;  4M9Z A;  1YRN B;  3RCO A;  1LDD A;  1L3L A;  1S5L C;  2W24 A;  1R23 A;  1YOV B;  3BR1 A;  2K4J A;  5ICG A;  4CYC B;  1FOY A;  3LMM A;  2C5Z A;  1IUF A;  2F48 A;  3H9Q A;  1SAX A;  1I6H J;  4KP7 A;  2M2E A;  2O03 A;  2X4H A;  1MBG A;  2Y48 A;  4C30 A;  3Q44 A;  2AXL A;  3GXO A;  2NOJ B;  3N4M A;  5TRD A;  1FYL A;  4HX7 A;  4GAE A;  4A3M J;  4ZTJ A;  3ASN H;  1QA6 A;  2JA8 J;  2O7G A;  2AQE A;  4G12 A;  5J8C A;  4R79 A;  3BTJ A;  2P5V A;  4MO7 A;  3OYA A;  1TZL A;  4XBF A;  4HF2 A;  4BE0 A;  2ETH A;  1E3H A;  1O7F A;  3IWZ A;  2R4G A;  4PJ0 C;  2A6E F;  5JMW A;  3HJE A;  2PMH A;  1WH7 A;  3OYD A;  1H8A C;  3QOD A;  4A3J J;  4JYK A;  3OYM A;  3GTJ J;  1ZAO A;  3UR3 C;  1HKS A;  2O0Y A;  4XN0 A;  4N4O B;  4XO5 A;  3BY6 A;  3HEF A;  3FUE A;  2NNY A;  1UMQ A;  1HSJ A;  5DLL A;  2Z2S B;  2AQF A;  1FSH A;  2M30 A;  4C2M J;  2KL4 A;  2YUS A;  1X2M A;  5GTH C;  4IF4 A;  5F04 A;  1K4S A;  4K5L A;  3SYT A;  1R4M B;  3GF2 A;  4D0P A;  4E7I A;  4XOR A;  2CMP A;  3A1Y A;  5C3E J;  2TRT A;  2EV5 A;  2LC2 A;  2CFO A;  1BIB A;  1T1R A;  3A03 A;  3OYH A;  5JMP A;  1TWG J;  1JGG A;  2W48 A;  4HLY A;  1MIJ A;  2DJI A;  4XKB A;  4GRI A;  4MS6 A;  3A01 B;  3FBN B;  1H9T A;  5F0C A;  2IAI A;  4M6Y A;  4I76 A;  2OJE D;  1ORK A;  1RIO H;  2M4K A;  3S1Q J;  2K4B A;  4MNU A;  3PSI A;  3CF5 F;  2VL8 A;  3ZGK A;  4RM3 A;  2ZB9 A;  3GLL A;  3HUG A;  2VOD A;  1SD5 A;  2KIF A;  1BI3 A;  1S8N A;  4OMZ A;  2OZ6 A;  1MSE C;  1K7A A;  1FTZ A;  3CJQ B;  2WTE A;  3DLA A;  2GIZ A;  5B1B H;  1A36 A;  3ZOB A;  2E36 A;  3HW2 A;  2D1H A;  1FOX A;  2EZH A;  3BP8 A;  3PQJ A;  2P6S A;  2XAF A;  2Y9Z A;  3KX2 A;  5JR3 A;  2XPY A;  4EAT A;  4HA8 A;  1T33 A;  4LFU A;  5KNL A;  1SVO A;  3BZK A;  4B09 A;  2R7W A;  5FFZ A;  5ILS A;  1EH8 A;  3VDX A;  5D8L B;  5IOY A;  2KRH A;  4ZZD A;  4JK1 X;  1IW7 F;  3GFL A;  2A69 F;  1SVL A;  2OPT A;  4ZQE A;  4XN1 A;  3AAF A;  5DCM A;  1W4M A;  2L9R A;  1O3S A;  2MC3 A;  3BT9 A;  1S29 A;  2A05 A;  3ZMU A;  5LGN A;  5IPA A;  1I27 A;  4G9Y A;  3U2R A;  4KFC A;  2MG4 A;  3FUH A;  4H0E A;  3FK6 A;  4F91 B;  1ZG1 A;  4YG2 F;  2P0W A;  2R5Z B;  1T8I A;  3TBI A;  1REP C;  1X4O A;  2IA2 A;  3KED A;  4Y15 A;  5F27 A;  2I5U A;  4WCG A;  1D8J A;  1OJL A;  3FKJ A;  2DFF A;  2M9H A;  4L0Z B;  2K02 A;  3A0H C;  2DPU A;  3HG9 A;  1UG2 A;  3FKI J;  1X3Z A;  2LF8 A;  2FD5 A;  1WSU A;  1SD6 A;  3FHE A;  3ZHZ A;  4X2U A;  1ZRF A;  4AR8 A;  3OOP A;  4A12 A;  2XVC A;  3VYS B;  5EF6 A;  5GTI C;  4X0G A;  3F6O A;  3IKV A;  2FNA A;  3BR0 A;  2Y9Y A;  1R49 A;  2OD5 A;  2QEX I;  1KA8 A;  1T08 B;  2NVU B;  2DMN A;  2HDD A;  2E7X A;  4EV0 A;  3LAP A;  1WHU A;  3HRM A;  1RP3 A;  2O8X A;  3SZT A;  1YW7 A;  1X3U A;  5LHI A;  3GTL J;  5FLM J;  2CRG A;  4WXC A;  1OCZ H;  2YSR A;  5JFR A;  4FIS A;  5KCM A;  3FH5 A;  1U5T A;  3LA2 A;  2K3F A;  2CU7 A;  4K5N A;  2LBF B;  1OYY A;  3DTK A;  3WTZ A;  2ME0 A;  1MBJ A;  2E1O A;  2ZNY A;  3HKZ N;  1Z77 A;  2FRH A;  4BKX A;  4Y13 A;  4XQF A;  3RZD J;  1K6Y A;  1W7P A;  4BXX J;  3OS0 A;  4HYE A;  4AIJ A;  3G1O A;  3CZL A;  2JCV A;  4KIF A;  1EKE A;  4FLS A;  3HOU J;  5DYM A;  1JVS A;  2O61 A;  2PBI A;  1Z7U A;  3CJN A;  5LRR A;  1OYW A;  4C3H J;  1HOM A;  4XON A;  1UST A;  1ZYR F;  3FDY A;  2QSH X;  1I3A A;  2LKS A;  3I0T A;  1MSF C;  2EGH A;  2D1V A;  2DBB A;  3FMQ A;  2WA0 A;  4EJO A;  4CXF A;  2L4A A;  3OSG A;  2X51 A;  3MKZ A;  1TNS A;  1FBS A;  3JT1 A;  5IP9 J;  2ZME C;  5LFA A;  2HKO A;  2VON A;  4UVA A;  1SC5 A;  4BY1 J;  5HDG A;  3CO7 C;  1FOW A;  2LMD A;  3I54 A;  3B6A A;  3I59 B;  3WQR A;  4C3I J;  3UER A;  2KMU A;  2Q2E A;  2F6C A;  4I0B A;  4M3E A;  2IGN A;  2JSC A;  5J1R A;  1RUN A;  1HA8 A;  2DMT A;  2RVC A;  3Q9V A;  1QPM A;  2HQR A;  3VWB A;  3LL7 A;  4N0B A;  4FQG A;  3S2H J;  4A3C J;  4GGG A;  1W5C C;  1FWZ A;  2L0K A;  4HG2 A;  2COM A;  2GXB A;  1NG7 A;  5C4X J;  1I3Q J;  2LKP A;  4XM3 A;  3CCY A;  1MBH A;  3HZJ A;  4CCL A;  4U7D A;  2H27 A;  5IYD J;  4BXU A;  4NC7 A;  1R9T J;  4NUB A;  1BR1 A;  1Z91 A;  3LAJ A;  2QA4 I;  4RS8 A;  2M34 A;  1RUO A;  3CZG A;  3MEX A;  3B73 A;  3TL4 X;  4V2F A;  2QGU A;  4E4H A;  5IYB J;  3FXR A;  2Y0M A;  4CDG A;  5LEK A;  1IRX A;  3DCF A;  4ENN A;  2DA7 A;  3W6K B;  2BY2 A;  1OLT A;  1QO0 D;  2R7U A;  4RSY A;  2CUJ A;  1FX7 A;  2D45 A;  2ECC A;  4MFE A;  1USS A;  1SFU A;  3C2G A;  4KIC A;  2DFI A;  5GP9 A;  3TED A;  1YS7 A;  4ASN A;  1EJ9 A;  2H1L A;  3MVP A;  1LDJ A;  3OYJ A;  4YII A;  1DUX C;  4EGY A;  5L3G A;  1BIA A;  4KN4 X;  1QHH D;  5D4R A;  3K7A J;  3FIW A;  2ECB A;  4Q48 A;  3HOY J;  1AKH A;  3J7A Y;  2AHQ A;  4OOE A;  3G1L A;  1PP8 F;  2JCY A;  4OOF A;  5ERI A;  2JZY A;  3ZR8 X;  2LDU A;  1N77 A;  1HC8 A;  3FXK A;  1BA5 A;  4CCO A;  1V5F A;  2JT1 A;  2DA4 A;  4P55 A;  5J47 A;  3LSP A;  4UHT A;  3QYF A;  4CCN A;  1DP7 P;  3I64 A;  4PVB A;  5DD4 A;  1VFC A;  2DMP A;  1JE8 A;  4CSW A;  1RET A;  3B34 A;  3EET A;  4IPA A;  3S2W A;  3ZQQ A;  1B6A A;  3TP3 A;  3KZY A;  2BVL A;  3F23 A;  4F7Z A;  4HNU A;  1S7O A;  3MFK A;  1ZGW A;  4CA0 A;  2ZXJ A;  2BW3 A;  2Z9O A;  3CCU I;  3S3O A;  3JCU C;  1B8I B;  1FBU A;  1J9I A;  2MAO A;  3JW4 A;  3GW2 A;  1KZH A;  1Q0H A;  1NHA A;  2O5R A;  3IUO A;  4E6K G;  4KIT B;  2E1M C;  2KP6 A;  2R93 J;  5DUK A;  3B7T A;  2PJP A;  1RNL A;  2RQQ A;  3QPH A;  4P9U A;  2V1U A;  2AS5 F;  1XTA A;  1XCV A;  4BAC A;  4AM3 A;  2EV6 A;  3Q5F A;  1GXQ A;  2H8R A;  5FRN A;  4P5O A;  1JKP C;  4LLL A;  3ECO A;  2HVQ A;  2L2O A;  5GAG J;  3JRC A;  3SJM A;  1R5I D;  1N78 A;  4XKV A;  4YIF A;  3EQL F;  1NK2 P;  3T8R A;  2Y1E A;  4AVZ A;  5H2F C;  4L0Y B;  2YX4 A;  2IGK A;  3QAH A;  2K3P A;  2XGC A;  3NAU A;  4RAF A;  4I01 A;  2DO7 A;  3CDH A;  3JRI A;  3B2X A;  1E3P A;  1X2N A;  1FTT A;  4ZYA A;  5E79 C;  1AHD P;  2EFQ A;  1O4X A;  2IVM A;  2PUS A;  3BOQ A;  3FH8 A;  2FMY A;  2XC7 A;  2LKX A;  4RB2 C;  1WJB A;  4U88 A;  3OYI A;  1LPQ A;  5F0H A;  1Q1V A;  4UB6 C;  3CZ6 A;  4CUG A;  4HST A;  5AIQ A;  3PNT A;  3IHU A;  4HDV A;  2EIL H;  2KZV A;  3KZZ A;  3RC3 A;  4LUP A;  1YQA A;  2MGQ A;  4MHG A;  3WGH A;  4ZDO A;  2VLA A;  1BI1 A;  3OMY A;  3Q0W A;  1VQM I;  4NNJ A;  4DPR A;  2FJ1 A;  3CES A;  2EZL A;  5GAH J;  1R1V A;  1V55 H;  1TWF J;  2YU3 A;  1PVE A;  4IRG A;  5HS9 A;  1OIS A;  4LG0 B;  3WQS B;  5F6F A;  1I6X A;  5D4S A;  4JX5 A;  4ZYG A;  4ZYE A;  4PU2 A;  2MFZ A;  2IS1 A;  3WGI A;  4JOM A;  2JRM A;  2LR8 A;  4XN5 A;  3CXB A;  3K70 C;  1FP2 A;  3S3M A;  2W84 A;  2X9D A;  2KJB A;  1FSE A;  4M71 A;  4O5V A;  4HX4 A;  5LHH A;  1B72 A;  3DXJ F;  4LLN A;  3H5N A;  4FT8 A;  2R7Z J;  2LK2 A;  1AWC A;  4CO8 A;  3PUF A;  1UJ8 A;  2JK3 A;  5KAF C;  2DFH A;  3J80 Z;  2PJR B;  4DZJ A;  3K6G A;  1QBJ A;  1ITY A;  3CHR A;  5HOD A;  4XNB A;  2EH3 A;  3PM1 A;  2ZJQ F;  3SQN A;  1D0Z A;  4PUS A;  3GLX A;  2ACJ A;  1STZ A;  2DU9 A;  1MBE A;  4J19 A;  2BHY A;  2FUG 2;  2M8G X;  3BPX A;  3ZQI A;  3M1E A;  2QSG X;  1OR7 A;  1DU6 A;  1JTY A;  1RKW A;  4BY7 J;  3GTO J;  1XSX A;  2NOG A;  4AU7 A;  3ERE D;  1JXS A;  1Y1W J;  2CH0 A;  2MC4 A;  3GBG A;  1UCR A;  3MZH A;  1XS9 A;  3I53 A;  4MTE A;  3DF8 A;  3CCM I;  2R7R A;  1G3W A;  2QUF A;  5EEG A;  1PP7 U;  3KP4 A;  2LVS A;  3AU9 A;  1OCO H;  2ID3 A;  3SDG A;  3CDL A;  3S16 J;  5A2Q K;  2JCX A;  4EM0 B;  1IG7 A;  3T0Y A;  3BTC A;  1E2X A;  2JA6 J;  4V2G A;  1VQK I;  3DKX A;  2GXA A;  4RB1 A;  2A7O A;  2RNG A;  2JUC A;  3ML6 A;  3R0I A;  2HPT A;  3FTZ A;  5BOX A;  2H94 A;  1JJ8 C;  4M3D A;  2RN7 A;  1WJC A;  3ZN0 A;  4I2O A;  1WJE A;  2KRC A;  3TOB A;  2FFL A;  1WJ5 A;  3FTV A;  5J6X A;  2MH2 A;  5CLS A;  4CYC A;  2DTZ A;  3L00 A;  3PSF A;  1J59 A;  3BG9 A;  3PJR A;  1LE8 A;  2XF7 A;  1UZC A;  3VB2 A;  2HTJ A;  2QEN A;  3ASO H;  1WVR A;  2QVO A;  2EA4 A;  1YJW I;  4UUV A;  3OY9 A;  3GFJ A;  1MW3 A;  1LFP A;  2EIM H;  5FD6 A;  2HKX A;  2ID6 A;  3MWM A;  4DYR A;  3OYE A;  1XB4 A;  3GVA A;  2XGX A;  1ERD A;  1LNW A;  2LFB A;  2O6G E;  3F8M A;  2HYJ A;  2KHM A;  1MMG A;  4OWR B;  1R0L A;  2XPZ A;  2EIJ H;  1U5T C;  1JKR C;  5IY5 H;  5K7H A;  4XRM A;  4JND A;  3R61 A;  2R3S A;  2HGC A;  3I71 A;  4FHT A;  3AL0 B;  2P5K A;  3NEU A;  1V5E A;  1P6R A;  5IT3 A;  1ZG5 A;  2WBM A;  4OAY A;  3FTU A;  3FXQ A;  3PFY A;  3ZQF A;  2HXO A;  2NVX J;  4XMW A;  2QCO A;  3CIA A;  3BR5 A;  2P7V B;  5HLI A;  3G4S I;  3SXY A;  1TTY A;  2ZME A;  2DOF A;  3NWT A;  3K10 A;  4Y7N J;  3R0J A;  1R00 A;  3H35 A;  1TWC J;  3KYC B;  2E34 A;  2B9S A;  1XGS A;  3ZQL A;  4O6J A;  1F43 A;  1BW5 A;  3KIO A;  5DDG A;  5EDN A;  5EJC A;  3S15 J;  3LQQ A;  4ZQG A;  1J2X A;  2K5C A;  1ZRC A;  3A01 A;  1DGR M;  4G94 A;  2F5V A;  3HPH A;  4UXN A;  4BS9 A;  2ISZ A;  3B7U X;  3HOW J;  4BEH B;  1FT9 A;  2KDO A;  3HRU A;  2M4G A;  3IRR A;  2Z99 A;  1LB2 A;  3RKW A;  1E3O C;  2UWM A;  4G6D A;  4RLF A;  2PQ8 A;  3DEE A;  1IRG A;  4XMY A;  3CC7 I;  3A2K A;  1J09 A;  1I50 J;  2L9S A;  3DU5 A;  1T38 A;  3PNY A;  1EH6 A;  1FLI A;  3W3C A;  3GZ5 A;  1XDU A;  2IS2 A;  4EJU A;  2OCC H;  3OYN A;  1XGM A;  5TIS C;  3K69 A;  2IS4 A;  4X6A J;  4W97 A;  5HOO A;  4XIC A;  2DOD A;  3KEO A;  2O7O A;  1YW8 A;  3ONQ A;  1SMY F;  3C2B A;  1T0F A;  4XNA A;  3UEQ A;  2IGO A;  2FOW A;  3BLY A;  5IP7 J;  1MND A;  3IAM 2;  2Y1C A;  1SAU A;  1TL8 A;  1A5J A;  2K7L A;  4XLA A;  4I0A A;  4KUM A;  2WAQ A;  3S3N A;  4YFX F;  5DS9 A;  1MMA A;  4DBR A;  2E1C A;  3RI4 A;  4RAY A;  5JLW A;  2R5Z A;  2VJ5 A;  2ZJP F;  2UUZ A;  4AIC A;  4XOP A;  1WFX A;  1ZKG A;  5DD8 A;  3B6C A;  1BBY A;  4DYQ A;  2FA5 A;  3HIF A;  3LSG A;  4PK4 A;  4ENJ A;  2LG4 A;  3DEW A;  4XMX A;  2JD1 A;  4I09 A;  1D3Y A;  2DFE A;  1FOK A;  4IRI A;  3V8L A;  1IRZ A;  2M0C A;  3F3X A;  3HGG A;  1YO5 C;  3ABU A;  3TP0 A;  2HFH A;  2E5Z A;  3MD2 A;  1T95 A;  4NQW A;  5IYC J;  1DPR A;  2RAE A;  1FY7 A;  1ZAR A;  3AU8 A;  4ZJZ A;  2XKO A;  3FXM A;  1LDK B;  4ZDP A;  1I5Z A;  2VBY A;  3ZRG A;  2H6C A;  2Q1Z B;  3JR9 A;  1XSV A;  2HQA A;  2Y0S A;  2DTR A;  2FE3 A;  1Z05 A;  5ICE A;  1FYM A;  3A14 A;  2P4W A;  2ELK A;  3HHH A;  3M7G A;  3ZCO A;  3F8B A;  2LBF A;  4ZZL A;  1DGW Y;  1UHS A;  3ERM A;  2AXT C;  4PSW A;  2CSO A;  4MTD A;  4ZX3 A;  3VYU B;  2CFX A;  4LLG F;  5J40 A;  4DNC A;  2X0L A;  5J1U A;  4RM2 A;  5D5V B;  2F2E A;  3WTU C;  1JGI A;  3BZC A;  4I6Z A;  2JA2 A;  5FKO A;  1JUM A;  4A2U A;  5M5W J;  3P9K A;  3CC2 I;  1ON1 A;  1XDS A;  2W82 A;  2DCE A;  2X48 A;  2NS0 A;  3B2P A;  1Z7L A;  2VBX A;  4BGD A;  4D5C A;  4XLE A;  2E2I J;  1X58 A;  3WTS C;  1JT0 A;  4H4K C;  2E71 A;  1IRF A;  1UAA A;  2CQX A;  5EGO A;  2CG4 A;  1OCC H;  3WHB A;  1TBX A;  2WB1 A;  1G3Y A;  1X3W B;  3E6B A;  1ZRD A;  1WQ2 A;  2A68 F;  4ZQF A;  3WGG A;  3RPU A;  2NVT J;  1IXC A;  3HSF A;  3RDI A;  3TKY A;  3FIS A;  2WPG A;  3JAM K;  2XPU A;  3FUN A;  4MKT A;  2XSJ C;  3ABT A;  2JRT A;  3DQV C;  4OIN F;  2V79 A;  4XKC A;  3F21 A;  4WF2 A;  3CD6 I;  3VOE A;  3KYL A;  2VB6 A;  2DXI A;  2PFB A;  2TDX A;  3I59 A;  3JSO A;  1HBX G;  5JC1 A;  1R36 A;  4HOB A;  1NK3 P;  2K86 A;  2VOO A;  2OF7 A;  2E1N A;  1OYI A;  4GFB A;  2M3A A;  2Y1G A;  5JNL A;  1K6O A;  4NHJ A;  1EA3 A;  2ZSH B;  4B3A A;  3K4J A;  1QVT A;  2X6X A;  3LSM A;  5FKN A;  2MD5 A;  3HGY A;  4QTR A;  4JQF A;  1FIA A;  1S7E A;  1AU7 A;  4L5J A;  2FQ4 A;  1I1G A;  5E1X A;  3HTS B;  4ZDL A;  1D1A A;  1ZN2 A;  2DPD A;  2LY9 A;  4DQ2 A;  2QZ8 A;  4N9H A;  2LY2 A;  1SVM A;  3CZK A;  3B7S A;  3FHZ A;  5H20 A;  1MNE A;  1NG6 A;  1ZGJ A;  3DKW A;  3FXJ A;  3Q9S A;  5LGU A;  2IW5 A;  2EZK A;  2PMU A;  3HHG A;  2HWV A;  3TW6 A;  5HLH A;  4Q4Z F;  3CC4 I;  4M3B A;  4LD5 A;  2V9V A;  2WAD A;  1F5T A;  3VFZ A;  2F4O B;  1OCR H;  2OU2 A;  3KCC A;  2R70 A;  3R0A A;  1A31 A;  2M7A A;  4ITV A;  3FU0 A;  2MAB A;  3DPT A;  1Y1V J;  5E8I A;  1LJ9 A;  4KMU X;  3DTE A;  4ANJ A;  1WPK A;  2VBW A;  3BG6 A;  4XLF A;  2DT7 B;  1B4A A;  2W00 A;  4GO1 A;  2RRE A;  4RB0 A;  4KA4 A;  1AOY A;  4D1Q A;  5FKL A;  3PIP F;  4BHP A;  2EV0 A;  2FQ3 A;  2VE9 A;  2KJC A;  3QU3 A;  3EDP A;  1C0W A;  2W1O A;  1R71 A;  1OR7 C;  4IVN A;  1BL0 A;  2Z5U A;  5CQE A;  5CYV A;  5LGT A;  2I8D A;  4NB5 A;  3RKQ A;  5M5X J;  4AD9 A;  2CQK A;  3EUH A;  4EM1 A;  4Q4E A;  2EIK H;  5ICC A;  2HTS A;  3FXL A;  3WU1 B;  2DQR A;  3LSH A;  2XB0 X;  2IXS A;  1W36 D;  3QPT A;  2N8G A;  2R7T A;  3MZY A;  4CCK A;  5EG0 B;  2WC2 A;  4X1E A;  4I99 C;  4UUS B;  5JHF A;  3I3L A;  1KU7 A;  3BJA A;  4G7H F;  1H0M A;  1PDN C;  5BNG A;  1TWH J;  2MLK A;  1MMD A;  4AWX B;  3ZQ7 A;  5D5U B;  1TNT A;  1WKM A;  3OS1 A;  2R0Q C;  1S7A A;  2EBI A;  2VC0 A;  2DLL A;  5ICF A;  1PUF B;  2RJI A;  3ZQC A;  1XD7 A;  1WCM J;  3PFI A;  3L2W A;  4ZYD A;  2FEZ A;  3SFI A;  3GYH X;  2L3D A;  1GV2 A;  2VXZ A;  2L4M A;  2HVS A;  4WXH A;  4ZW5 A;  4XK4 A;  1TQI A;  3IH3 A;  4A3E J;  3CF2 A;  3E5Q A;  4BBS J;  4HPQ A;  2CQQ A;  2HNH A;  3SEQ A;  4Q47 A;  4PCQ A;  4F3Q A;  1XX5 A;  4EJT A;  2ISY A;  2G7U A;  2DQ6 A;  3V8K A;  4Z6Y A;  2R7X A;  4DBQ A;  4PW4 A;  4IHV A;  1GLN A;  5FKM A;  4II2 A;  4FE4 A;  5BS6 A;  2IT0 A;  2E1M B;  1TW3 A;  4IRH A;  2F4I A;  2FOK A;  3RC8 A;  3QWL A;  3IL2 A;  3H9G A;  4QUO A;  1ZTR A;  2F5C A;  4BDZ A;  2R7S A;  2XB5 A;  1SAN A;  5TJJ A;  4LMY A;  2JA7 J;  3E6M A;  1OCT C;  2VAS A;  1T6S A;  3BCB A;  4ZW3 A;  2ZFU A;  1ZR2 A;  1KON A;  1IO2 A;  4IO9 F;  3ZMT A;  3U21 A;  1ZK8 A;  2XKP A;  3C7J A;  1QU3 A;  2QLZ A;  2A07 F;  4LG0 A;  2OQG A;  1JUS A;  4CGZ A;  2LRE A;  3CJT B;  3IP4 B;  2XSD C;  1ZLK A;  2BYV E;  2Z1D A;  5D5X B;  4EMS A;  3FXO A;  4ARF A;  2JPB A;  3I56 I;  2JUG A;  5J3L A;  3L2R A;  3ULQ B;  3QPL A;  1DDN A;  4L9N A;  2QQB A;  5LD2 C;  2VJ8 A;  2HEO A;  1YX5 A;  1A04 A;  1U0J A;  2COB A;  4DYC A;  4HW0 A;  1IN5 A;  4AID A;  3HRT A;  4DGW B;  3QRF F;  2XRL A;  2EZI A;  3ABM H;  2PJR A;  4K5O A;  2L01 A;  1ETW A;  3MZ8 A;  1J7K A;  4J01 A;  1Q0Q A;  1KU3 A;  3CDI A;  4M6V A;  2J5O A;  1FMW A;  3L2Q A;  1K83 J;  2OC6 A;  3M8J A;  1VQ4 I;  1SEU A;  2R7V A;  1O7L A;  1MH3 A;  1B1B A;  1BR4 A;  3OIP A;  2R5Y B;  2DN0 A;  2IPQ X;  3P5J A;  1X19 A;  4KT6 A;  1T2K A;  1T0F C;  4A0Z A;  2O3F A;  1ULY A;  3K1N A;  1GDT A;  1U8R A;  2VN2 A;  1RR7 A;  1G3T A;  3CP2 A;  3H3V K;  5A2Q Z;  1RRJ A;  1R5G A;  5FO5 A;  1LFB A;  4K2E A;  2KKO A;  4BH9 A;  1CF7 B;  4HLX A;  1IN6 A;  3HUG B;  5KVR A;  2B61 A;  2DA6 A;  2XAH A;  4A3L J;  1MH4 A;  3V8J A;  4XNF A;  3K4B A;  5CVV A;  1DU0 A;  3RZO J;  5HVQ C;  3ZMZ A;  2WV1 A;  3LWF A;  4G7Z F;  2QF7 A;  3BR3 A;  3N05 A;  2WAE A;  5K7Z A;  1W0U A;  1F9N A;  2CUZ A;  4ZX4 A;  2VPR A;  3AUA A;  1FMV A;  1VND A;  5ILV A;  3GTQ J;  4BHC A;  4N4N B;  2XPW A;  3QPS A;  4BQO A;  3FF5 A;  1W5T A;  4AYB N;  2X6W A;  4XSX F;  5JLX A;  4E7K A;  3ZPL A;  1WJA A;  1LUJ B;  3CUQ A;  3H3Z A;  3CUO A;  4HX8 A;  3KP5 A;  4A03 A;  2FX0 A;  2ZCW A;  1YIJ I;  1U9N A;  2KIQ A;  3V4G A;  5BQT A;  1QPI A;  5LHG A;  4O3M A;  4DW6 A;  4DZP A;  1HCR A;  2BXZ A;  4A5N A;  2Z3Y A;  3TGN A;  3K0L A;  3BQZ A;  1CQT A;  2CUE A;  4ZYH A;  1K78 B;  1HST A;  3UNG C;  1O3T A;  3DBH B;  2NVY J;  4TV7 A;  2GZW A;  2L9N A;  2XRN A;  3KYD B;  3H0D A;  4PJJ A;  1G5A A;  3W6J B;  3BRO A;  4Y3O A;  1MKM A;  4PDK A;  2FBK A;  2KIU A;  2HQN A;  2E35 A;  2WAQ N;  3FUF A;  2WV0 A;  4KMF A;  3J7Z I;  1G6N A;  1P2F A;  1X3Z B;  2CV0 A;  3MKL A;  5M5Y J;  3C2H A;  3HOS A;  2FU4 A;  4A3K J;  3SHF A;  4BL0 B;  2H6B A;  2RKH A;  4R7L A;  1BC7 C;  5DV5 A;  3FTS A;  4ENM A;  3FU3 A;  3DTI A;  2F5E A;  2GA2 A;  5FKK A;  1WI3 A;  2A5Y B;  3JTH A;  2BY1 A;  1ETK A;  5D6F A;  4B47 A;  4C9Y A;  4E7H A;  1YHQ I;  1ONN A;  1UB9 A;  4FLR A;  3PUU A;  4CH7 A;  3FTX A;  4JP0 A;  1FP1 D;  3U9G A;  2QBY B;  3PNV A;  2ZXI A;  1FC3 A;  2HOE A;  4MQ9 F;  4MGR A;  3CCE I;  3F6V A;  4KJZ A;  4IL6 C;  1KU2 A;  4D5F A;  1SQM A;  3C18 A;  1BJA A;  3D0S A;  2ICW G;  1XPX A;  1YIT I;  1S6L A;  3HB9 A;  1U5T B;  2BE5 F;  1ZRE A;  2JVH A;  4C3J J;  4GXO A;  4BEH A;  4XN2 A;  2CGP A;  4OIR F;  4Y6S A;  1ONO A;  2QVW A;  5CVU A;  2W7N A;  4RBO A;  1LVK A;  3PUB A;  2CW0 F;  5F1R A;  4E7S A;  5E18 F;  2Q0O A;  6PAX A;  1WWX A;  1Y8Q B;  1V3F A;  2CQN A;  1UG0 A;  3KFW X;  3DPL C;  2PGG A;  4WWC A;  4A3F J;  4M3F A;  2LTP A;  3H1C A;  3V7C A;  2VXD A;  4HNT A;  1P7I A;  1JI8 A;  2HU9 A;  3WOD F;  3LSI A;  3CCV I;  1TW2 A;  1DP3 A;  3BTL A;  1KYW A;  3GZN B;  3MAJ A;  2IGM A;  3GUD A;  5HS7 A;  4OU0 A;  1RPW A;  1P92 A;  2LP0 A;  2M8E A;  3KP7 A;  1D1C A;  1OPC A;  3EBG A;  2ME6 A;  4YEL A;  1MW2 A;  4W1U A;  2LLK A;  2WB1 N;  2XF5 A;  2OTJ I;  2EB7 A;  2XGE A;  1W5S A;  4L5E A;  3DLL F;  2JD2 A;  3TDZ C;  3RSN A;  3CHO A;  3OYB A;  1MW1 A;  3RPQ A;  3OYF A;  2Q2E B;  3WTY C;  1QZY A;  2R7D A;  4MLO A;  2GXG A;  2ESH A;  4EVI A;  3Q43 A;  3QYB A;  2V7F A;  2ZXW H;  2LY1 A;  1JT6 A;  3CHP A;  3O8G A;  3L7W A;  5GPA A;  4FLO A;  1FEX A;  4FET A;  3COA C;  4F55 A;  5KK1 A;  2BXY A;  4IHT A;  1KYZ A;  4B1R A;  3CMY A;  3BR6 A;  1P4A A;  5BMZ A;  5AON A;  1XSD A;  5E3M A;  1BN5 A;  3RTR A;  2W4S A;  3DP7 A;  4PFO A;  4OAZ A;  4XRS G;  1CGP A;  4Q5S F;  1XMK A;  4LIV A;  5D6E A;  2DYS H;  3JRE A;  4EJW A;  1U8B A;  1T1S A;  3FUM A;  5D5W B;  5DYF A;  2UZK A;  2PEX A;  3P7N A;  1K5H A;  3WHC A;  3CO6 C;  1Y39 A;  1S72 I;  1YRN A;  4XSZ F;  5EZG A;  3EUH C;  2OQR A;  4WX9 A;  4MEX F;  1PUE E;  2OZU A;  1HS6 A;  3CME I;  2CW7 A;  2DDB A;  3HYI A;  2JA5 J;  1YI2 I;  2QKL B;  1HW1 A;  4Y52 J;  1H3L A;  2KLO A;  5HNF A;  1YIO A;  4XID A;  3MKY B;  2MLG A;  5F08 A;  2V26 A;  1N75 A;  1NTC A;  4CYD A;  4JX4 A;  5H6Q A;  3RQ4 A;  4Y6P A;  3BDD A;  1X1D A;  2VOP A;  1MW7 A;  2LF7 A;  4MQV A;  3ZI0 A;  1Z9C A;  3S17 J;  3ZQH A;  1ETQ A;  3JRG A;  3JAM Z;  1X3W A;  2KDZ A;  2KQR A;  1Z0X A;  1K79 A;  4G7O F;  1UEL B;  2HOA A;  4FLQ A;  1FIP A;  4LG3 A;  1L0O C;  2KIS A;  3B37 A;  2OBP A;  2W57 A;  1YTY A;  1MBF A;  5JVG F;  1V4R A;  1MZB A;  3RJP A;  1Y8R B;  3BJ6 A;  4HQE A;  3FHN A;  3K4K A;  3VVL A;  2VKV A;  2EFN A;  1H88 C;  4Y17 A;  2V1N A;  4B44 A;  2KZG A;  4NDL A;  4M9S A;  2BBY A;  2GM4 A;  2XAG A;  4R1H A;  4UVC A;  3WG7 H;  4BQN A;  1S46 A;  4ETS A;  1BI0 A;  3FU5 A;  5DEQ A;  3R60 A;  1S9H A;  3L2C A;  3AKZ A;  1D5Y A;  1ENH A;  5F64 A;  4RGR A;  2F4M B;  2HOS A;  4RDU A;  2FXA A;  2L7M P;  1VZ0 A;  4XLH A;  5C44 J;  2YU9 J;  3M8E A;  4L5I A;  5K7F A;  4U0Y A;  1IGN A;  3ANN A;  2OUM A;  1F1Z A;  4HNV A;  3EUA A;  2JVG A;  1XGO A;  2OAZ A;  3S32 A;  4PJN A;  1MDM B;  2IRF G;  2GQQ A;  2F5F A;  4RMN A;  4A5M A;  1MGT A;  1PYV A;  3K4N A;  1FPQ A;  3X2Q H;  4OMY A;  3F22 A;  2MA3 A;  3MKW B;  3T8V A;  4E7J A;  3D5L A;  1ZS2 A;  3K4M A;  2Y2Z A;  1MMN A;  1Z3X A;  1HKQ A;  3SFZ A;  4L9V A;  5KAI C;  2R7Q A;  4Z2Y A;  1OFC X;  3L9F A;  2G7H A;  4PFP A;  3IKT A;  1FYK A;  4CCJ A;  2V9P A;  3CP8 A;  3CMM A;  2C6Y A;  5FD5 A;  4QPQ A;  4A0X A;  3M1C A;  2L9V A;  5JAZ A;  2PG4 A;  1W1W E;  2EIN H;  2VQC A;  4I98 B;  4AIK A;  1MJB A;  2Y1D A;  4G6T B;  1ON2 A;  1BOA A;  3KP3 A;  3QOP A;  4ABZ A;  3WTW C;  3J81 Z;  2WWY A;  3DU6 A;  3BZ6 A;  2YX7 A;  5E3L A;  4XMZ A;  2J5P A;  4BJ5 C;  5F1J A;  3IC7 A;  3OL4 A;  1QRY A;  4ZW8 A;  4PJM A;  5DTD A;  4IHY A;  3AFH A;  1B9M A;  3K2Z A;  4E7L A;  2G0E A;  2HS5 A;  3VSK A;  1WRJ A;  1FZP B;  3P9C A;  1HXD A;  3VPR A;  5L3C A;  4M74 A;  4FCY A;  3HPG A;  4A6E A;  1LFU P;  3D5R C;  1HQC A;  5FFX A;  5B66 C;  1B72 B;  2O8K A;  5EG0 A;  4B8X A;  3W2V A;  1YJ9 I;  2H1K A;  4ZC3 A;  2YR2 A;  3LFU A;  2HI3 A;  4UUS A;  3FUL A;  5GAE J;  4CZC A;  3RKX A;  2M1B A;  2EFO A;  4C2T A;  1Y0N A;  4M72 A;  2H8W A;  2FF4 A;  3QYE A;  1QHG A;  1NH3 A;  2E2H J;  5ED4 A;  5CQG A;  2DT5 A;  5IT9 K;  3OWT A;  2XF6 A;  5CJ9 A;  3CCJ I;  3FUI A;  2KPM A;  3OV8 A;  4RB3 C;  2L02 A;  4UVB A;  2VQH A;  5J4V A;  1QZZ A;  2Y31 A;  5EZH A;  2OV7 A;  3KLO A;  2CJJ A;  1X1P A;  2BEO A;  4G6Q A;  2DA5 A;  2DOE A;  2K40 A;  2RGV A;  3CUQ C;  5JBI A;  2XPV A;  1H89 C;  1IUY A;  5CPR B;  3W2A A;  3FH7 A;  1J5Y A;  2IBD A;  3WTT C;  1R1U A;  3BR2 A;  1T56 A;  5HLT A;  3F0C A;  5E17 F;  1VQN I;  2HPI A;  4A3D J;  1F4K A;  2RQP A;  3FM5 A;  1P4W A;  3HC7 A;  4QIW N;  4MFD A;  5L3E A;  2XAQ A;  1IDY A;  3K9T A;  3KEY A;  4M73 A;  1VQO I;  4RA2 A;  1P7J A;  1MBK A;  3AL0 C;  1O3R A;  2D5V A;  3HSE A;  2ZBK A;  3BC8 A;  3HOT A;  5L3F A;  1ZGA A;  1R1T A;  1BW6 A;  1IN8 A;  1DQU A;  5E1Z B;  4NC8 A;  2HYF A;  3U1D A;  3KLN A;  3DBL B;  2JTV A;  1LE8 B;  5CVI A;  1D1B A;  2XGD A;  3K70 D;  3K1M A;  4L9J A;  1TLH B;  3B02 A;  3FZV A;  1QGP A;  2AO9 A;  2W25 A;  3FU6 A;  5CVJ A;  2HPO A;  4XN8 A;  4IOC F;  1D5V A;  1VQ5 I;  2STT A;  4AYS A;  1YYV A;  4II3 A;  3OS2 A;  5DUI A;  3JRH A;  1A6I A;  2JJ7 A;  3OYK A;  3OR1 C;  3A0B C;  4ZX6 A;  2A61 A;  1R5H A;  1QQI A;  1KQ8 A;  1XC5 A;  3O3K A;  3RYP A;  4BE1 A;  3MMY B;  2D2W A;  3LNQ A;  5FJ8 J;  3CMA I;  2CV2 A;  2P7C B;  3F8C A;  4QSH A;  5B5E C;  3CCR I;  1IXR C;  2MW8 A;  5L3B A;  2HZT A;  1A35 A;  4BJ6 C;  1ETY A;  2Q8K A;  4IKF A;  5AEN A;  1HDD C;  4IX7 A;  4D7N A;  2ESN A;  3QP5 A;  2YS9 A;  2GA1 A;  2HVR A;  4HF1 A;  3CQZ J;  4A69 C;  3R6S A;  4L2L A;  5FWQ A;  2ZME B;  3S93 A;  2FSW A;  2VJI A;  4BBR J;  2EA2 A;  1OQY A;  4JX6 A;  2R5Y A;  3K2A A;  2QM3 A;  3WTX C;  3I5U A;  2VJ4 A;  4EJV A;  1IXS B;  2XAU A;  2EFW A;  2RC4 A;  1ZQ3 P;  5LLQ A;  1SFK A;  3DBR B;  1BI2 A;  3O6B B;  4XL9 A;  1YJN I;  1UHM A;  2DK8 A;  2VQL A;  3E5X A;  5J8F A;  2L7Z A;  3FUJ A;  3PL8 A;  1HW5 A;  1WH5 A;  4XRF A;  2PN6 A;  5TGT A;  5FB2 A;  1CF7 A;  3ABK H;  3RIR A;  1RR8 C;  2KT0 A;  4FCA A;  3MCZ A;  4IEJ A;  4ZW6 A;  3I55 I;  1ZG3 A;  3AG4 H;  3I4P A;  1RKT A;  1ZLJ A;  4UUT A;  5FRO A;  4QLC U;  1MMS A;  3DV8 A;  1JG9 A;  4IXA A;  5BPI A;  3DFG A;  1A6Q A;  4V19 K;  3GEZ A;  4RCV A;  4XOT A;  2FML A;  4BE2 A;  3I4N J;  2X6Y A;  2BVM A;  3BQY A;  4DOZ A;  3VYT B;  2L54 A;  3F72 A;  3V7R A;  4RVB A;  1VQL I;  1HKT A;  1R7J A;  4F92 B;  1V54 H;  2ELJ A;  4HAM A;  2RV8 A;  3J81 K;  5FRM A;  1IJW C;  3GME A;  3PO2 J;  3L2U A;  4XN9 A;  5JVT A;  1D8K A;  4XLP F;  3KEQ A;  1FNN A;  3JRF A;  3RAS A;  5K5Q A;  2STW A;  1XN7 A;  4LB5 A;  4CHU A;  1E0E A;  1R4N B;  4R5V A;  2BGC A;  4Y67 A;  3LSK A;  3P9I A;  3ROU A;  2Y75 A;  1K78 A;  1SFO J;  3DWL E;  1BJZ A;  1B8I A;  5K5R A;  1W7P D;  2NVQ J;  2WZG A;  2K27 A;  4EGZ A;  4ESB A;  4IJA A;  4A3G J;  1B59 A;  4KIB A;  3CTA A;  4A6D A;  3CZE A;  3CHQ A;  2HDC A;  1VI0 A;  2CWE A;  3DPU A;  3JTG A;  2Y69 H;  3M3Y J;  4ZX5 A;  4CCM A;  3G3Z A;  4HRI A;  5E8G A;  4YIR X;  2V9K A;  2LSO A;  1JKO C;  2K9N A;  1X1A A;  3D1N I;  2O9L A;  2EWN A;  4DJA A;  3KP6 A;  2WZF A;  2DA2 A;  3FUK A;  2EPF A;  4WXD A;  1GVJ A;  4PSX A;  3S1R J;  1UFM A;  2CV1 A;  4IHW A;  2HQ5 A;  2GIV A;  4XLN F;  3E6C C;  4NQW B;  1MJA A;  4IQJ A;  2QBY A;  2H09 A;  1TT5 B;  2V1D A;  2V6C A;  3T8T A;  3BG5 A;  4IQ4 A;  3EYY A;  4IZZ A;  3LOC A;  3FWE A;  1PJR A;  4B4C A;  3SDB A;  2DJN A;  2QQ9 A;  2GOM A;  4GYI A;  2GLO A;  1R22 A;  3KP2 A;  4PGG A;  2PMZ A;  3H5A A;  3WG9 A;  1X1C A;  1GUU A;  3HDD A;  3PIO F;  1IZ1 A;  4HZF A;  1QVU A;  2BZT A;  1G3S A;  5FLX K;  3GTG J;  5EV7 A;  4BUP A;  2EQR A;  2P81 A;  2GTQ A;  3OL3 A;  4I02 A;  3BCA A;  3LSJ A;  3I4M J;  4CIC A;  2LNB A;  1LKX A;  1EV7 A;  5B3S H;  1I1S A;  2XV4 S;  1LEB A;  1BC8 C;  3FMR A;  2ELH A;  3IAS 2;  3EYI A;  3JRB A;  1GW6 A;  5EGO B;  2ZSI B;  1ETV A;  5B1A H;  3GCM A;  1SFE A;  2WY8 Q;  4XMV A;  3Q3S A;  3EBI A;  1X4P A;  1WJD A;  2K9L A;  4BQQ A;  1HW2 A;  5FGM A;  3CCQ I;  2GAU A;  2M7B A;  3RKY A;  3K1P A;  3UKG A;  3OYC A;  1IV6 A;  1I39 A;  5L3D A;  2QKM B;  4XO4 A;  3QP6 A;  3TO6 A;  1K61 A;  1S3J A;  1SFX A;  1J0R A;  2MYS A;  4UB8 C;  5DM6 F;  2P5L C;  1VTN C;  2JSP A;  3D5S C;  1FJL A;  3C3W A;  4AR9 A;  2JWT A;  1R58 A;  3TO7 A;  1BR2 A;  1BOB A;  1LVA A;  1UHW A;  5K5O A;  1IV8 A;  2VE8 A;  4S0H B;  4LK1 F;  3F8N A;  2NXN B;  4C2U A;  2B7E A;  2V4J C;  4J00 A;  1YG2 A;  2DQM A;  2JD0 A;  2GBY A;  4HF0 A;  1D0X A;  2OA4 A;  3IIE A;  4A93 J;  3T1B A;  2LD5 A;  3SZP A;  3TDU C;  4U87 A;  2NNN A;  3ZP5 A;  3JSP A;  3JSZ A;  3UCQ A;  1IN7 A;  2P8T A;  3S14 J;  4LK0 F;  3FTY A;  1ZEL A;  2BHZ A;  4XND A;  3T5X A;  3G71 I;  1WZ2 A;  2IA0 A;  3ZQG A;  3ZXS A;  1V5G A;  3HRS A;  5M3M J;  1TQM A;  4LOC A;  3S1M J;  3BG7 A;  2UXX A;  3FTW A;  2VPL A;  4ZH4 F;  1M1E B;  5JI6 A;  4KN7 X;  1WI9 A;  4RGU A;  1ACI A;  1G8X A;  4PJL A;  4KIG A;  1ONP A;  3CLQ A;  2VIX A;  2IS6 A;  3EBH A;  2CUF A;  3H36 A;  4BDY A;  4XMU A;  5LRS A;  3OYG A;  5DM7 F;  1T39 A;  5E20 A;  4OIO F;  3TQN A;  4U7B A;  2E2J J;  5FLV A;  2LH9 A;  3IWF A;  1GV5 A;  5BPP A;  3G73 A;  5J4Y A;  2Y1F A;  2GWR A;  1BM9 A;  2BV6 A;  1JUP A;  1OKR A;  2EJR A;  3NQO A;  1POG A;  5DCM B;  3EPZ A;  3ANM A;  2HDW A;  4K5M A;  1WGX A;  3R4K A;  3EUK L;  4N9I A;  4BXF A;  1D0Y A;  2M5W A;  3J7Y J;  3F8F A;  3HBL A;  5F0F A;  3F9K A;  3GZ6 A;  4OOI A;  2JN6 A;  2ZXG A;  1Y6I A;  4FX0 A;  2XRO A;  1JHF A;  3QOE A;  3V42 A;  1VQ8 I;  4UY8 I;  2HYG D;  1U3E M;  4U0W A;  1HLV A;  2HXI A;  3HXL A;  4AC0 A;  3KZI C;  4LIT A;  4M9X A;  2E60 A;  1ZHF A;  4EQQ A;  4KDP A;  1U2W A;  3KE2 A;  1B9N A;  2DMQ A;  1T98 A;  4K5P A;  1H9G A;  3ZMS A;  4DIQ A;  2R7F A;  1JJ6 C;  2E19 A;  4XR6 A;  3AG2 H;  4QHP A;  4S05 A;  3U9W A;  5HDN A;  2X85 A;  3JRD A;  4R8H A;  4MIM A;  3IV5 A;  3VVM A;  5IOZ A;  2FBH A;  3ELK A;  4FTH A;  4P9F A;  1P9Q C;  1YFH A;  5ILU A;  5DCF A;  1R0K A;  2BY0 A;  1IAW A;  1MNM C;  3S2D J;  3I9V 2;  5HDK A;  1KQ0 A;  1XCB A;  1MJ9 A;  3TOA A;  2A5W A;  1ZR4 A;  3E6D A;  1IC8 A;  1YX3 A;  1RES A;  3ZMV A;  3JRA A;  2EK5 A;  5AIP A;  4XN7 A;  2PL5 A;  5JO0 A;  3MQ0 A;  4FE7 A;  4M3G A;  1MDM A;  4IHX A;  3BTI A;  3LA3 A;  3GTP J;  3OR2 C;  2DA1 A;  4XKW A;  3GX4 X;  3FXU A;  4GDF A;  2ZJ2 A;  2Y0S N;  3H9J A;  4LIU A;  3WE3 A;  1YS6 A;  4QWQ A;  2NS7 A;  1W0T A;  1W7P B;  4L9T A;  4AIH A;  2K9S A;  2WY7 Q;  4QME A;  4D9J A;  2DT6 A;  3BJO A;  3AG1 H;  4PGH A;  3KPH A;  4ZTF A;  1AA7 A;  2LYC A;  1O3Q A;  1XGN A;  2VT2 A;  3KET A;  4Q4I A;  3IH4 A;  4KIS A;  2TCT A;  3A4C A;  2JPC A;  3ABL H;  3GTK J;  3WE2 A;  1Q1H A;  3HSR A;  2QSF X;  4BHB A;  3ANL A;  3GFI A;  2DK5 A;  5C4J J;  4R5X A;  2A6H F;  3BWG A;  2ZO4 A;  2VI6 A;  2A6T A;  2HOT A;  3WU2 C;  2DDA A;  4P1W A;  2VJJ A;  3OOU A;  2B0L A;  2Y30 A;  2KRF A;  3VEP A;  1YLF A;  4CZZ A;  1RC9 A;  4I7H A;  2M0M A;  2DMU A;  4YRV A;  3S8P A;  5KHD A;  3HOV J;  2R59 A;  1OMI A;  1J75 A;  2L7K A;  2ADU A;  1HF0 A;  1IN4 A;  2DI3 A;  4R5T A;  4XMT A;  1KU9 A;  1TC3 C;  2ZJR F;  4RAG A;  4Y4R A;  2MSY A;  4OIQ F;  5M3F J;  2R7O A;  1LQ1 A;  3ZHY A;  2JMW A;  3IRQ A;  1ETX A;  1JGS A;  2JV7 A;  2IP2 A;  1OCP A;  1K4T A;  2GOX B;  3LSR A;  5E3O A;  2XHK A;  3L1P A;  4XLC A;  1EH7 A;  2NS8 A;  5IT9 Z;  3ZN1 A;  2OCE A;  2ZKZ A;  2ZC2 A;  4UV9 A;  4J3B A;  2LRD A;  2CQ7 A;  2ZFW A;  3NRV A;  4LGW A;  3QQA A;  3E97 A;  2VQG A;  3E7L A;  3TW7 A;  2JQ7 A;  3G6E I;  1IDZ A;  4MEY F;  3GFM A;  3HOX J;  3MN2 A;  5GPC A;  4OIP F;  1U9O A;  2FNP A;  1TT0 A;  2HR3 A;  3HKZ A;  3QU6 A;  3LFK A;  4KT5 C;  5LBQ A;  4IOA F;  1U6G A;  3OIO A;  3W2W A;  4ZN6 A;  4AVP A;  1Z3Y A;  1Z6T A;  5EYR A;  3V7S A;  2XUB A;  3FM3 A;  4XN3 A;  2F5D A;  4UV8 A;  4HV5 A;  2K9M A;  2MBF A;  3M8F A;  2V6E A;  4KYW A;  5K1Y A;  1RZ4 A;  2M45 A;  4GAA A;  4ZQH A;  3WQQ A;  4XRS A;  2OTL I;  2K85 A;  1H19 A;  1ODD A;  1Y56 A;  2QWW A; 
#chains in the Genus database with same CATH homology
 2BOL A;  1N77 A;  3FUD A;  2VQH A;  1W36 D;  3QJX A;  4Q4E A;  3LSH A;  2Z16 A;  2IXS A;  4CCO A;  2OV7 A;  1V5F A;  2R7T A;  4CCK A;  3ZR8 X;  3K4L A;  5JHF A;  3I3L A;  3QYF A;  4CCN A;  2QJ1 A;  5JBI A;  4PVB A;  3B34 A;  4CSW A;  5CPR B;  3W2A A;  1MMD A;  3FH7 A;  2CS3 A;  3ZQQ A;  1MW0 A;  2HZD A;  3OS1 A;  2X1D A;  2BVL A;  3SEZ A;  5HLT A;  2L5Q A;  2RJI A;  2X1C A;  2HPI A;  3OYL A;  4HNU A;  4CA0 A;  2BW3 A;  3S3O A;  3L2W A;  1Z21 A;  3OIQ A;  2XQ0 A;  3L2V A;  3HC7 A;  2MAO A;  3CJR B;  3SZG A;  1Q0H A;  3B3B A;  2LOO A;  2O5R A;  3IUO A;  3KEY A;  4E6K G;  2VXZ A;  3HL2 A;  2HPM A;  3B7R L;  4KIT B;  2E1M C;  2KP6 A;  3B7T A;  2E5N A;  2HVS A;  3AL0 C;  2RQQ A;  1G59 A;  4BU2 A;  4FAS D;  3BC8 A;  3HOT A;  4ZW5 A;  2R72 A;  4BAC A;  4RLQ A;  1DQU A;  3CF2 A;  4HPQ A;  4NC8 A;  2HNH A;  2BW3 B;  3SEQ A;  5HNH A;  4F3Q A;  5FRN A;  4P5O A;  3DKY A;  3E0J B;  2DQ6 A;  1D1B A;  2HVQ A;  2L2O A;  4DBQ A;  2R7X A;  3K70 D;  4PW4 A;  1GLN A;  1N78 A;  4II2 A;  4XKV A;  2ZXH A;  2E1M B;  2F4I A;  3RC8 A;  3H9G A;  1W36 C;  4AVZ A;  2Y1E A;  4QUO A;  4AR1 A;  3FU6 A;  2IGK A;  2HPO A;  4BDZ A;  3K4C A;  4XN8 A;  2K3P A;  2R7S A;  4AYS A;  3VYR B;  3B2X A;  4II3 A;  2VAS A;  3BCB A;  3OS2 A;  4ZW3 A;  2WAF A;  2ZFU A;  4ZYA A;  3OYK A;  1KON A;  3OR1 C;  4ZX6 A;  2UV1 A;  4QIR A;  2PUS A;  4ZW7 A;  3U21 A;  1QU3 A;  3FH8 A;  2XC7 A;  4BE1 A;  3MMY B;  4HEA 2;  1WJB A;  3OYI A;  2CV2 A;  2DOA A;  1Q0L A;  3CZ6 A;  2LRE A;  4HST A;  4CUG A;  3PNT A;  4BJ6 C;  2KZV A;  3IP4 B;  3RC3 A;  4IKF A;  5AEN A;  4LUP A;  4IX7 A;  2Z1D A;  4ARF A;  4YEJ A;  4ZDO A;  2VLA A;  2JUG A;  2HVR A;  3OMY A;  4L2L A;  3L2R A;  5FWQ A;  4NNJ A;  5LD2 C;  4DPR A;  3CES A;  3S93 A;  2VJ8 A;  1YX5 A;  2CW8 A;  2VJI A;  1U0J A;  3FBI B;  4BJT A;  3WQS B;  4PU2 A;  1YE9 A;  1WJF A;  2VJ4 A;  2XAU A;  2MFZ A;  4DGW B;  4AYB A;  2PJR A;  2IS1 A;  4K5O A;  4JOM A;  1SFK A;  1H19 A;  3A06 A;  4XL9 A;  4J01 A;  4ZQT A;  1Q0Q A;  4XN5 A;  3K70 C;  3S3M A;  1FMW A;  2VQL A;  4Y6R A;  3L2Q A;  2OC6 A;  3M8J A;  2R7V A;  2XDV A;  3PL8 A;  3FUJ A;  5TGT A;  4FCA A;  1BR4 A;  3H5N A;  3OIP A;  4ZW6 A;  5FRO A;  4KT6 A;  1X19 A;  1JG9 A;  3TMO A;  1T0F C;  2PJR B;  3CHR A;  3K6G A;  5DUL A;  3VSL A;  4RCV A;  1R6R A;  4XOT A;  3CP2 A;  4F93 B;  4XNB A;  1SG7 A;  4BE2 A;  2X6Y A;  2BVM A;  4DOZ A;  1D0Z A;  3G2B A;  3VYT B;  4PUS A;  3NWS A;  2MD0 A;  4B3X A;  2VKH A;  4RVB A;  4B43 A;  3ZHX A;  4F92 B;  3HUG B;  2B61 A;  3CHS A;  2ELJ A;  2FUG 2;  4XN4 A;  1OR7 A;  5FRM A;  4AU7 A;  4XNF A;  3K4B A;  3L2U A;  4XN9 A;  5HVQ C;  2CH0 A;  1MW2 A;  2MC4 A;  3GBG A;  4E7Z A;  3RAS A;  3H5R A;  1E0E A;  3N05 A;  2WAE A;  4ZX4 A;  2R7R A;  4R5V A;  2CUZ A;  4Y67 A;  3LSK A;  3AUA A;  4Y33 A;  1FMV A;  2MAP A;  3AU9 A;  3DWL E;  4N4N B;  4BQO A;  2JCX A;  2WZG A;  2X6W A;  4E7K A;  1WJA A;  3T0Y A;  4A03 A;  3RPU D;  3DKX A;  3CZE A;  3CHQ A;  4XO3 A;  2A7O A;  3DPU A;  2RNG A;  4ZX5 A;  4F52 A;  4CCM A;  1MVY A;  3FTZ A;  4HRI A;  3R0I A;  2HPT A;  1WJC A;  2V9K A;  1WJE A;  2KRC A;  1X1A A;  3E1S A;  1WJ5 A;  1X1B A;  2FFL A;  3FTV A;  3UNG C;  5CKT A;  3PSF A;  2L9N A;  4DJA A;  3H0D A;  3PJR A;  2WZF A;  4PJJ A;  1G5A A;  3FUK A;  2XF7 A;  4PSX A;  4Y3O A;  4B48 A;  2CV1 A;  4NQW B;  2C82 A;  1MW3 A;  1LFP A;  4QPO A;  4QPE A;  3FUF A;  4IQJ A;  4HSR A;  2VKD A;  2X1E A;  3RCO A;  3OYE A;  2CV0 A;  1ERD A;  3C2H A;  3HOS A;  2C5Z A;  4IQ4 A;  2KHM A;  1MMG A;  3LMM A;  4OWR B;  3H9Q A;  4IZZ A;  1PJR A;  1R0L A;  4BL0 B;  3SDB A;  2XPZ A;  4KP7 A;  4R7L A;  4C30 A;  3Q44 A;  3FTS A;  2GOM A;  3FU3 A;  2NOJ B;  3DTI A;  4GAE A;  4B47 A;  4C9Y A;  2PMZ A;  3H5A A;  4E7H A;  4JND A;  4ZTJ A;  1X1C A;  3AL0 B;  1ONN A;  1V5E A;  3PUU A;  4FLR A;  4CH7 A;  3FTX A;  2WBM A;  2AQE A;  2O7G A;  4OAY A;  4R79 A;  3PNV A;  2ZXI A;  3OYA A;  3FTU A;  3PFY A;  5EV7 A;  1TZL A;  4BUP A;  4XMW A;  2GTQ A;  3OL3 A;  4KJZ A;  3CIA A;  3BCA A;  1SQM A;  4BE0 A;  1LKX A;  2R4G A;  3NWT A;  3K10 A;  5JMW A;  2JVH A;  3H35 A;  4BEH A;  3IAS 2;  4XN2 A;  3OYD A;  4Y6S A;  1ONO A;  3QOD A;  1GW6 A;  2QVW A;  2ZSI B;  3OYM A;  2W7N A;  3UR3 C;  2WY8 Q;  4XMV A;  4XN0 A;  4N4O B;  3EBI A;  1X4P A;  1LVK A;  3PUB A;  1WJD A;  4XO5 A;  2K9L A;  4BQQ A;  3FUE A;  4E7S A;  4ZQG A;  2K5C A;  5DLL A;  1DGR M;  2F5V A;  2Z2S B;  3HPH A;  1UG0 A;  2AQF A;  2M7B A;  4BS9 A;  3DPL C;  2KL4 A;  3OYC A;  3B7U X;  2PGG A;  4BEH B;  2KDO A;  2M4G A;  2QKM B;  4K5L A;  3SYT A;  4XO4 A;  2UWM A;  4RLF A;  4XOR A;  4E7I A;  3DEE A;  2VXD A;  4HNT A;  2CMP A;  3A1Y A;  1JI8 A;  2HU9 A;  4XMY A;  3LSI A;  2MYS A;  2LC2 A;  2CFO A;  3A2K A;  1T1R A;  3OYH A;  5JMP A;  2JSP A;  3D5S C;  1J09 A;  1DP3 A;  2L9S A;  3DU5 A;  4AR9 A;  2DJI A;  2IGM A;  4GRI A;  1BR2 A;  4XKB A;  3PNY A;  4MS6 A;  1BOB A;  3FBN B;  1D1C A;  3W3C A;  2IS2 A;  2M4K A;  3OYN A;  3EBG A;  3PSI A;  4YEL A;  4C2U A;  2VL8 A;  3ZGK A;  2V4J C;  2XF5 A;  4RM3 A;  4J00 A;  2IS4 A;  5HOO A;  2DQM A;  2JD0 A;  2JD2 A;  1D0X A;  3RSN A;  3CHO A;  3IIE A;  3CJQ B;  3ONQ A;  3DLA A;  3UCQ A;  3OYB A;  1MW1 A;  4XNA A;  4U87 A;  3OYF A;  3FUI A;  2Q2E B;  3JSZ A;  2IGO A;  3BLY A;  3UEQ A;  1MND A;  4MLO A;  3FTY A;  3IAM 2;  1ZEL A;  2Y1C A;  1SAU A;  3KX2 A;  2XPY A;  4XLA A;  4EAT A;  3Q43 A;  2WAQ A;  3S3N A;  4XND A;  5KNL A;  3QYB A;  2V7F A;  3ZXS A;  1MMA A;  4DBR A;  1V5G A;  2R7W A;  2LY1 A;  3CHP A;  3BG7 A;  3VDX A;  3FTW A;  2VPL A;  2VJ5 A;  2KRH A;  2UUZ A;  4FLO A;  4AIC A;  4XOP A;  4FET A;  4F55 A;  1WFX A;  1G8X A;  4PJL A;  4ZQE A;  4XN1 A;  1ONP A;  4PK4 A;  2VIX A;  3LSG A;  2IS6 A;  2LG4 A;  3EBH A;  4XMX A;  2JD1 A;  4BDY A;  4XMU A;  3RTR A;  2W4S A;  3OYG A;  4PFO A;  4OAZ A;  3FUH A;  4F91 B;  4LIV A;  2P0W A;  4U7B A;  1T1S A;  3TBI A;  3FUM A;  2LH9 A;  5DYF A;  2E5Z A;  1X4O A;  3MD2 A;  3KED A;  5BPP A;  1T95 A;  2Y1F A;  4NQW A;  1K5H A;  3FKJ A;  3AU8 A;  3EPZ A;  4ZJZ A;  3ANM A;  2HDW A;  3HG9 A;  4K5M A;  1LDK B;  4ZDP A;  3EUK L;  3EUH C;  4BXF A;  1D0Y A;  3OY9 A;  1HS6 A;  1X3Z A;  2CW7 A;  3F9K A;  3ZRG A;  3FHE A;  2QKL B;  3ZHZ A;  2Q1Z B;  1H3L A;  2ZXG A;  2KLO A;  4X2U A;  1Y6I A;  5HNF A;  4AR8 A;  2HQA A;  3QOE A;  3VYS B;  2Y0S A;  3V42 A;  3MKY B;  4X0G A;  2V26 A;  3A14 A;  3HXL A;  3ZCO A;  1N75 A;  4LIT A;  2LBF A;  1DGW Y;  2E60 A;  3RQ4 A;  4Y6P A;  1X1D A;  1MW7 A;  4PSW A;  1RP3 A;  4ZX3 A;  3VYU B;  1JGI A;  4K5P A;  3ZI0 A;  4RM2 A;  4DIQ A;  4XR6 A;  2JA2 A;  4QHP A;  3U9W A;  1X3W A;  2X85 A;  2W82 A;  5KCM A;  2KQR A;  2DCE A;  3B2P A;  1UEL B;  1Z7L A;  3FH5 A;  4FLQ A;  4LG3 A;  4BGD A;  3VVM A;  3B37 A;  4XLE A;  4K5N A;  2LBF B;  3DTK A;  4H4K C;  1P9Q C;  1UAA A;  1R0K A;  3FHN A;  3K4K A;  3VVL A;  3I9V 2;  2WB1 A;  4BKX A;  4XQF A;  2V1N A;  2A5W A;  4B44 A;  1K6Y A;  1YX3 A;  4ZQF A;  3OS0 A;  3CZL A;  4XN7 A;  2JCV A;  4BQN A;  1S46 A;  2PL5 A;  2WPG A;  5JO0 A;  4FLS A;  3FUN A;  4MKT A;  2XSJ C;  1JVS A;  3FU5 A;  3DQV C;  4XKC A;  1S9H A;  3AKZ A;  3OR2 C;  4XKW A;  3KYL A;  2VB6 A;  4XON A;  2DXI A;  3H9J A;  4LIU A;  3FDY A;  1VZ0 A;  5JC1 A;  2EGH A;  4XLH A;  2WY7 Q;  4QME A;  4D9J A;  2DT6 A;  3ANN A;  2WA0 A;  2OUM A;  4CXF A;  3EUA A;  2JVG A;  3S32 A;  2Y1G A;  2M3A A;  4ZTF A;  1AA7 A;  2LYC A;  2X51 A;  4PJN A;  3MKZ A;  3JT1 A;  5JNL A;  1EA3 A;  2ZSH B;  4RMN A;  3K4J A;  2X6X A;  5LFA A;  3LSM A;  4Q4I A;  4KIS A;  3K4N A;  1PYV A;  3A4C A;  1SC5 A;  4JQF A;  3ANL A;  3WQR A;  3UER A;  3MKW B;  2KMU A;  3T8V A;  2F6C A;  1HA8 A;  4E7J A;  2IGN A;  4ZDL A;  4R5X A;  1D1A A;  3D5L A;  1ZS2 A;  2A6T A;  3K4M A;  1MMN A;  2LY2 A;  1Z3X A;  3CZK A;  4P1W A;  3VWB A;  3B7S A;  2VJJ A;  3LL7 A;  1MNE A;  1NG6 A;  3OOU A;  2R7Q A;  4PFP A;  2M0M A;  4HG2 A;  4YRV A;  4CCJ A;  3S8P A;  5KHD A;  2R59 A;  3CP8 A;  1NG7 A;  3CMM A;  2L7K A;  4XM3 A;  4CCL A;  4XMT A;  4R5T A;  4QPQ A;  3M1C A;  2WAD A;  4NC7 A;  5JAZ A;  2VQC A;  4Y4R A;  4NUB A;  1BR1 A;  2Y1D A;  4G6T B;  2R7O A;  3ZHY A;  2JV7 A;  3CZG A;  2R70 A;  3TL4 X;  3DU6 A;  2M7A A;  4E4H A;  4ITV A;  3FU0 A;  4XMZ A;  2MAB A;  2GOX B;  3DPT A;  4BJ5 C;  1IRX A;  3OL4 A;  4XLC A;  3DTE A;  4ANJ A;  4PJM A;  4ZW8 A;  3AFH A;  1OLT A;  4E7L A;  4J3B A;  2R7U A;  2LRD A;  4XLF A;  3BG6 A;  2CUJ A;  2DT7 B;  4RSY A;  3VSK A;  2W00 A;  3C2G A;  2RRE A;  2VQG A;  3HPG A;  4D1Q A;  3OYJ A;  3D5R C;  1TT0 A;  3HKZ A;  4ZN6 A;  3W2V A;  1QHH D;  3W2W A;  4ZC3 A;  1Z3Y A;  3LFU A;  3FUL A;  2W1O A;  4CZC A;  1OR7 C;  4XN3 A;  5CQE A;  4C2T A;  2I8D A;  2K9M A;  2V6E A;  3J7A Y;  4GAA A;  4OOE A;  3QYE A;  4ZQH A;  3WQQ A;  1QHG A;  2JCY A;  4OOF A;  5CQG A;  3OWT A;  2XF6 A;  1Y56 A;  2KPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...