5HNFA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Restriction endonuclease R.BpuJI
total genus 108
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnfA02
5HNHA 5HNFA 2VLAA 5HLTA
chains in the Genus database with same CATH superfamily
1WI3A 4XKBA 3R6SA 3S8PA 4BGDA 4HF1A 2XAQA 1EV7A 4XO3A 3LFUA 5H6RA 2HZTA 4GXOA 2TDXA 3PUFA 4UB8C 1QA6A 1AOYA 1GDTA 1MW0A 2M45A 1BN5A 1QPMA 2X6XA 1QNTA 1V3FA 1QVUA 2F5FA 2CYYA 1JKQC 1DP7P 1MVYA 1C0WA 3K1NA 3DLLF 3T5XA 5FGMA 3Q0UA 1QO0D 5J4VA 1IN5A 1BM9A 4EJWA 2LDUA 4XN4A 3ZN1A 3LSKA 2DMUA 2EFOA 4W97A 3JRCA 2J5OA 1QZEA 1D0XA 4HLYA 4RMNA 2M7AA 3FXRA 3U9GA 3RQIA 2KIMA 2GBYA 2XB0X 2OCEA 3JR9A 2RQPA 4RB1A 4J01A 2VJ4A 2O8KA 1L0OC 5DD8A 4PJ0C 2FU4A 2DK5A 3COAC 1W36C 5KAFC 4WXHA 2K5CA 2BYVE 1IUYA 3IC7A 4R5TA 2AO9A 1RKWA 2HPOA 3I4PA 2HTJA 2K7LA 2ESNA 2XC7A 5JHUA 5BS6A 2HPIA 4ZDLA 2LBFB 1IXRC 3OIPA 3TP0A 5JO0A 1MBJA 2JSCA 4YIFA 5K7FA 2V1XA 1G5AA 3VVMA 3GFLA 3MD2A 2IGKA 1A04A 3GTJJ 4AR8A 3JRGA 3MN2A 1GHCA 1IDZA 1Y0UA 2VJ5A 4IL6C 3OY9A 3O2PE 5JHFA 1I6XA 4XKCA 2CV1A 1X3WB 3ZMTA 4XN1A 1B72A 3ANMA 5EEHA 1Q1VA 4Y67A 1IN4A 1TTYA 3QYFA 2Q0OA 1Z6TA 2MABA 1LVAA 3ABUA 3E0JB 1SD4A 4P55A 5EZGA 1ZRCA 2DFIA 2N8GA 1FBSA 3FXKA 5IPAA 1EF4A 2Z33A 4FLOA 2WB1N 3DCFA 1TWHJ 1YE9A 1MBKA 3F22A 3FUKA 3FULA 3O3KA 1WJCA 2GZWA 1WJDA 3J7ZI 1P4AA 2EFNA 3ZHZA 3N4MA 2R0QC 3M1EA 4B44A 2GWRA 1S72I 3TGNA 5C4JJ 4K5NA 3S16J 4BEHB 4G7OF 4XN3A 4P1WA 1XS9A 1VQ7I 2L7MP 3L00A 2FFLA 2CFOA 3I59B 1JKRC 4BBRJ 4BNCA 4DBQA 5HDGA 3OYCA 3IHUA 2QSHX 2P6SA 1FOWA 3KE2A 3ONQA 2XAHA 3FKIJ 1YW9A 2DT5A 1XCVA 3OL4A 3TOAA 4BYYA 3CZGA 2H1LA 3O6BB 2P5VA 1OKRA 4Y13A 2BXZA 2HQAA 3S15J 4IHWA 2VQCA 2P7CB 2WAEA 2L4MA 1MMAA 4D9JA 4ZYGA 3MKWB 4G7HF 3CCSI 4BY1J 2R5ZA 3FF5A 4B09A 4ZYAA 3FH5A 1BC7C 2KKOA 3L2VA 1R4NB 2MD5A 2GA2A 5A2QK 5KHDA 1B9MA 2CV0A 2NS7A 4EM0B 1I27A 3VYSB 1ONVA 2GXAA 1X58A 1YS7A 2RAEA 4YFKF 3HL2A 2R7SA 2BHZA 1ONOA 5FWQA 3ZQFA 5ICEA 4XN9A 4ZQGA 5CQGA 4BHBA 2E1NA 1JTXA 5ILVA 3H9JA 2JJ7A 4RS8A 3NARA 3QYEA 2HOSA 3DFGA 1K61A 5L3EA 3I56I 3PO3J 2CSOA 4G7ZF 3OS1A 3DBHB 5E1XA 3CMEI 2LOOA 3F8FA 5GAEJ 1H3LA 3E6MA 2GIVA 2ZJ2A 5IT3A 5HLGA 1FT9A 3SQNA 3F8CA 2CS3A 3H0DA 4O3MA 1I39A 1S29A 5M3FJ 1ZARA 4O5VA 4HZFA 3LMMA 4AR1A 3BG9A 3FXUA 2L0KA 2QYOA 4CCJA 2GOMA 2KPMA 4IZZA 4L9JA 1ETXA 1CF7A 1GVJA 3VPRA 3PIPF 1XSXA 2QUFA 3QAHA 1XPXA 5LGUA 4M72A 4XM3A 4ZZDA 4BHCA 1J75A 3QP6A 4IEJA 1LEBA 4JNDA 2QCOA 3LSMA 4PCQA 5F04A 1Z3YA 2A3SA 2HFHA 2E5NA 3SFIA 3H36A 3J81Z 3CHOA 4XR6A 2R7WA 1K4SA 2ZMEA 4FETA 1VQLI 2F6CA 3CXBA 3G1LA 4BL0B 4E7KA 2GIZA 1BI3A 1X1AA 1N25A 3W3CA 4D7NA 4UUSA 3B7RL 1W0UA 2VKHA 5E3MA 1KQ9A 2OZUA 2XGXA 3UNGC 2Y1GA 2DCEA 1XTAA 1W5CC 2QF7A 1FYKA 4AIDA 4L2LA 5EG0A 1X1PA 2L01A 2XDVA 2K9LA 3V42A 4M6XA 1H19A 1R6RA 2WV0A 4XMYA 3IH2A 4BJ6C 3W6JB 4I98B 1UAAA 2BY1A 4EJUA 1DDNA 1ERDA 4I01A 2RN7A 1FTTA 3CLOA 2CRGA 3KIOA 4L9VA 1ZGJA 4RB2C 2XPYA 2D2WA 4CDGA 1KYWA 5EGOB 5A2QZ 3AL0C 1F4KA 2JD1A 2A6EF 3AU8A 5DUIA 2JA8J 2EGHA 1IV8A 4V2FA 1U5TC 2FRHA 3HOXJ 2KRHA 1R1UA 2R5ZB 3QWLA 1AA7A 2DFHA 3QQAA 4PW4A 3IH4A 1HXDA 3QP5A 4DOZA 5F1JA 4XOTA 3DKYA 3BR6A 1ONNA 1XX5A 2VJ8A 1AKHB 2QQ8A 3KYLA 1XMAA 3ELKA 2CU7A 2Y1DA 1T0FA 2FXAA 2E35A 2RNGA 3CUOA 3H1CA 4OAZA 3ZMSA 3JTGA 1MD0A 3HTSB 5K5RA 4LIUA 2EWNA 3FU3A 2VE9A 4PFOA 3GTPJ 2K9NA 3P9KA 1R58A 5M5YJ 4LUPA 1HDPA 2IGNA 3C7JA 3AFHA 1DU6A 2X4HA 2WV1A 4BHPA 3LAPA 3EUAA 3ABMH 5IY5H 1HA8A 1BW6A 2EILH 2PFBA 2Y2ZA 1WZ2A 2QBYB 5FKLA 4ON0A 5J4YA 2QLZA 4FE4A 3J7AY 3HSRA 4RBOA 2LKXA 3M7GA 1KGSA 4K5PA 1IRXA 3KP4A 2A05A 5HDKA 4BY7J 3LSPA 1SC5A 2XPWA 1PUFB 2FD5A 1MBGA 2OAZA 1D5YA 1FSHA 2Y1CA 3W2AA 1GVDA 2P0WA 4M6VA 3HOWJ 3V7CA 2ZO4A 3GZNB 2F4IA 1IC8A 5FKOA 5IT9Z 4Y6RA 2NVYJ 4BS9A 2ZBKA 5F1RA 2JVHA 3DBRB 1DUXC 1BI1A 2BVMA 3MQ0A 3FK7A 5JC1A 4LLGF 3CC4I 2ADUA 2Z2SB 2V1NA 2E36A 5DD4A 2R7TA 2I5UA 3RKWA 4YIRX 1HF0A 3OYNA 4HF2A 5DTDA 4OOIA 4KJZA 3OYKA 1PYVA 2ECCA 2CFXA 3H3VK 1F36A 2FX0A 4RAFA 2K9SA 2PMZN 2QSFX 2CWEA 1FYLA 4ZX4A 3AUAA 1S46A 3GFMA 3WQRA 4XN7A 1X19A 4PFPA 4D5CA 4EJVA 5H2FC 3J81K 2XHKA 1Z6RA 2DA3A 3A01B 2E2IJ 2JPCA 4LLNA 1WRJA 3RKQA 1OCCH 3FKJA 1I6HJ 3CDHA 1G3WA 4N0BA 3GTMJ 1SQMA 3D5RC 5H20A 3D5LA 4OOEA 1U9NA 3H9GA 1Z0XA 2Z99A 2EV0A 4B3AA 1T1SA 5K5OA 3CDLA 4JOMA 2DA1A 1MMNA 4C2MJ 2RREA 4X0GA 3KEOA 2KQRA 4QIRA 4D7MA 4M3GA 3EYYA 5M5XJ 4M3FA 3WGHA 3N97A 1DQUA 1FNNA 3ABKH 2H1KA 3P7NA 2NOGA 2LSOA 1N75A 3ISPA 3KP7A 3K7AJ 2MLKA 1UELB 1TC3C 2PJRA 4G94A 1QGPA 5ED4A 2DT6A 2EZHA 2MC3A 5J1UA 3CJQB 3Q43A 1TQIA 3DWLE 3ZGKA 1APLC 3LSGA 3SEZA 2HNHA 4HQMA 4EJOA 4EATA 1Y6IA 3LSRA 3JRDA 2VT3A 4I7HA 3ZXSA 3CHRA 3HC7A 2JZYA 1IUFA 1POGA 5HOOA 4ENNA 3OWTA 1USSA 2NOJB 1T38A 1ZK8A 3BZKA 4HNTA 1EH6A 2X0LA 2JCYA 1ZGWA 4XO5A 1KYZA 1WJAA 2EINH 3CP2A 3UERA 1EKEA 4LB6B 2ZC2A 2CW7A 2Q2EB 2XAFA 5D8LB 4CUGA 1VQ8I 1BJAA 3GTGJ 2WB1A 4RAZA 1G3TA 3WHBA 3QOPA 4A6EA 4ZH4F 4EGYA 4ZW8A 1K7AA 2CMPA 2Y9YA 5AIPA 1FOXA 3EBIA 3WG9A 2HS5A 1LPQA 3L2WA 2X1CA 2X85A 3OOPA 3SEQA 3GEZA 1U9OA 1JKOC 1BC8C 3LAJA 1U5TA 2HYJA 4XOPA 4ZDPA 5FKMA 5JNLA 1E2XA 5LFAA 2ID6A 1USTA 3RJPA 2ELJA 4NQWA 1BR1A 2LP0A 1X2NA 3J7YJ 1TQMA 3MAJA 1R00A 3OIOA 2CQKA 2W1OA 1JT6A 2OA4A 2ID3A 4IQ4A 4UV8A 3CCUI 3PJRA 2UUZA 4J19A 4DJAA 5HNFA 3K6GA 3OL3A 5DM6F 3CUQC 4I6ZA 2EV5A 3MCZA 5HS8A 3BT9A 2KMUA 3L1PA 2ZJQF 2M8GX 2VQLA 1UJ8A 2VXDA 2XAUA 2MYSA 4RM2A 4NC6A 3RZOJ 1PUFA 3KPHA 1BIAA 1X4OA 3R0AA 5DLLA 2XUBA 4A0YA 1OYWA 4A2UA 1TT5B 3LQRA 1S5LC 1BOBA 2JVGA 2V4JC 3K10A 1TQPA 2HQNA 2VC1A 3ZMZA 5LD2C 5FLMJ 1BR2A 4P96A 3HJEA 2F48A 2M4GA 1YO5C 4NQWB 5TRDA 4XNAA 4GAAA 1FP1D 1MW7A 3C2BA 3TQNA 3QYBA 3E5UA 2XVCA 2B9SA 1V54H 1U2WA 4NB5A 1ZAOA 2LLKA 2E19A 1R1TA 1A36A 3NWTA 2DODA 1OCZH 1D1CA 1MW3A 3RI4A 3CUQB 3EUHA 5HLTA 5IOYA 3CUQA 3J80Z 2IPQX 3F72A 1KZHA 3CZKA 1W7PD 1MNDA 1ENHA 1MH4A 1R7JA 2XB5A 1H88C 2IA2A 2LF8A 4Q4EA 1OPCA 3H3UA 3ESWB 2PMHA 3L2QA 4LITA 1TT0A 5GAHJ 3OYLA 4A3KJ 4GO1A 3GYHX 2HQRA 1VFCA 1X2MA 1IAWA 3FX3A 5L3FA 5GPCA 3C2GA 3G6EI 1FIAA 3PQJA 2F5CA 3GFJA 3W6VA 3MVPA 1TWFJ 3PM1A 4UXNA 1X1BA 3MFKA 3G1MA 3EUHC 5C4XJ 4XLCA 5F27A 4L9NA 1TNTA 2IS4A 2IP2A 1ZLJA 2L9NA 1LB2A 2ESHA 2VJJA 4MQVA 5D6FA 3HIFA 9ANTA 4CICA 4XSXF 3F21A 2ZJRF 4A5MA 4LGWA 5KAIC 2VL8A 2M2EA 3U21A 3WTZA 1AWCA 1LQ1A 5FLVA 2O5RA 3OYIA 2M34A 2V1DA 3GWZA 3T1BA 4GYIA 1YG2A 1Y56A 2CUEA 3BR5A 2LKPA 4BXXJ 1FJLA 1QVTA 2J5PA 4ZW5A 1FLIA 4LMYA 3RKYA 1IV6A 2UWMA 1R0LA 4J3BA 2L54A 2P6TA 4XK4A 5JMPA 1MMGA 2XPVA 3FM3A 4LJZF 4LIVA 3ECHA 3FMSA 4V19K 3CMYA 4HX7A 1U8BA 2DMPA 3TBIA 3RTRA 3LQQA 3HGYA 3L7WA 3FXQA 3BLYA 4A3CJ 1ZG3A 4CCOA 4FLRA 3FZVA 2H09A 3IWFA 3GMEA 1EH7A 3GUDA 3JAMK 1Z91A 2JPBA 4EGZA 1V4RA 2LRDA 1PDNC 2RJIA 1YRNA 1G2HA 1JGSA 1D8KA 3R61A 5D5XB 2ETHA 2LK2A 5HDNA 1G3SA 3RPQA 3FTZA 1EJ9A 2MD0A 3A06A 3M3YJ 3FTYA 3Q5FA 3GVAA 3JSOA 2P4WA 3E7LA 1OMIA 5JI6A 2DQLA 5HNHA 1P4XA 5EEGA 1ETQA 3HOZJ 3BDDA 3IWZA 1FZPB 3CLQA 2HPMA 3AL0B 3BR0A 1BI0A 2XSDC 2WWYA 2C82A 2O0YA 2KIUA 4H0EA 3TMOA 1JUMA 4CCLA 1O4XA 1N78A 2R7OA 4XN2A 4KP7A 3K4NA 5HODA 4IHVA 3PO2J 4FCYA 3H92A 2JD2A 1UHMA 4HSRA 3JSZA 1EH8A 1X3ZA 4CYCB 4UV9A 3QPHA 4IHXA 2EFWA 2E34A 1SG7A 4XNBA 1HW1A 1MIJA 3QPLA 4ZN6A 1S6LA 1G4DA 3WG7H 4ENMA 2C5ZA 4OOFA 3HSFA 2VUMJ 3ZN0A 4XO4A 2LH9A 4HDUA 4XIDA 3LSIA 3BPXA 3MZ8A 2VT2A 4KT6A 1NK3P 2FQ3A 2DLLA 2O03A 4B3XA 2NS0A 2VKDA 4C3JJ 4CCNA 3ABLH 4PZJA 2PL5A 2C6YA 1XG1A 4DNCA 1I50J 1J2XA 5LGNA 4F93B 5CVIA 4B1RA 1MNEA 2D5VA 1B4AA 1KQ0A 4RSYA 3ROUA 1ONPA 3KEDA 3VVLA 5ERIA 1HSJA 1LNWA 1A5JA 4KDPA 3H5AA 3BG6A 1WJ5A 4PVBA 2E1MC 4M6YA 2ZJPF 4HLXA 2GLOA 2CQXA 1R49A 3Q0VA 1U3EM 5M5WJ 5JAZA 2EFQA 3CTAA 5DCFA 3CO6C 5AONA 3O8HA 1JXSA 4QWQA 2RVCA 4BKXA 4IHYA 3HZJA 2VN2A 3GBGA 5EG0B 3EBGA 3JCUC 2JQ7A 4N4OB 2IT0A 3S1QJ 4EJTA 1KONA 3CQZJ 2X6WA 1IW7F 1GLNA 2FNAA 3RASA 2E1CA 5E8IA 2VOPA 2VKVA 3CCLI 1T56A 4M73A 2UXNA 2L5QA 2YUSA 1WHUA 2ZMEB 3FUFA 2LD5A 2DN0A 1T0FC 4A0XA 4XMTA 2MG4A 1ACIA 4BBSJ 1HW5A 2F5EA 2CO5A 1BJZA 2QWWA 4Q4IA 4DGWB 1YJNI 4IOCF 2XAJA 6PAXA 1I1GA 4R1HA 3HOTA 1TWAJ 3TW6A 2PN6A 2DBBA 5J47A 4S05A 4Y6PA 1H89C 2M5WA 1UHSA 3BTJA 4HF0A 4UUTA 4WCGA 4LD5A 1OCRH 1Z21A 1FMWA 1F1ZA 3GCMA 3BJOA 2Z9OA 3MEXA 3GLXA 4KT5C 3C18A 2X1DA 4L5EA 2MGQA 4M9ZA 2XAGA 4YG2F 4YRVA 5IP7J 1MBEA 2VPRA 2ME6A 3L9FA 1XN7A 1TP4A 2ICWG 1W5TA 2EFPA 3ASNH 1BL0A 1UG0A 3MKYB 2Y69H 1ZR2A 3JAMZ 3B02A 4ZQTA 1LEAA 3K2AA 2EZIA 2K40A 3IAS2 3FU6A 5FRMA 2OD5A 1H9TA 3F8MA 4IVNA 5CVUA 2IW5A 4BAYA 3CF2A 3GLLA 2AS5F 1SMTA 4YFXF 3C2HA 2WPGA 1W5SA 3FHZA 3U1DA 1FMVA 1PUEE 3U9WA 2V79A 2CW0F 2GXGA 4Y17A 3L2UA 3B2XA 2OV7A 5JR3A 2MW8A 3RYPA 4YFNF 2MSYA 1ON2A 1QPIA 1JUPA 2AXLA 3WODF 4BDYA 1MJAA 3K0LA 2G7UA 3OR1C 2CUFA 3ZMDA 2JUGA 4A3BJ 3TDUC 2COMA 2LTPA 2ZXHA 3D5SC 4RA2A 4M9SA 3K9TA 4Q5SF 2BE5F 4XMZA 1A6IA 1VTNC 2HEOA 2VKEA 1VQ6I 2FBHA 3LOCA 1CQTA 1D5VA 3DEUA 2MA3A 2VC0A 1IDYA 2OPTA 4I2OA 3PUBA 3DU6A 3CCEI 3VYTB 4ESBA 1P92A 4UUSB 1R9TJ 3T8RA 3JRAA 1JT0A 2CGPA 2PUSA 3B7TA 1ZG1A 1BIBA 2DYSH 1IZ1A 2HXIA 4M9XA 4KMUX 1IN7A 3G3ZA 5J3LA 4X6AJ 3I0TA 4CCKA 3ABTA 2HVRA 1FIPA 2E7WA 3F23A 1W7PA 3CZEA 3FXOA 1OQYA 3HB9A 3ZHYA 4MNUA 3RKXA 3U2RA 2EH3A 3PNVA 4KFCA 2OCCH 3PNYA 4O6JA 1TW2A 3S14J 2XRLA 5DUKA 1J59A 1DPRA 2VPLA 1IF1A 4RCVA 4MLOA 1ZLKA 4C9YA 4F92B 5DYFA 1R36A 1LJ9A 5GPAA 3S3OA 2JTVA 4XKVA 3BG3A 3CD6I 2R7RA 1T1RA 2XPZA 3I9V2 3IP4B 5CVRA 1BA5A 3REOA 4Q47A 3CC2I 5IOZA 2Q2EA 1MMSA 2DTZA 3J7AO 2NAZA 5FD6A 4C30A 1UCRA 4QMEA 4CCMA 3T8TA 4RM3A 3SZGA 5JMWA 1V5EA 1B72B 1P9QC 2VQGA 5EDNA 5JLXA 4PGHA 5B1BH 2A68F 2Y0MA 4AVPA 2EA2A 1FC3A 3CJNA 2F4OB 1RESA 2VB6A 1D1AA 2LY2A 4QPOA 2KIFA 5FROA 4QTRA 3HW2A 4XN0A 4MTDA 4GCVA 2UXXA 2WAQN 3H35A 2L02A 3BC8A 4OMZA 4JK1X 1AKHA 1VQ4I 1I3AA 2DQ6A 1Z3XA 4E6KG 4AD9A 3PFYA 2HVSA 2IS2A 3BR3A 5GTIC 1WH5A 1IXCA 5IP6A 4MO7A 2B0LA 5CYVA 1DPUA 5DDGA 2RV8A 4ANJA 3DTIA 1IRZA 1BW5A 3HOUJ 4UUVA 1Z7UA 5B1AH 2R72A 4HOBA 3KEQA 1IJWC 2JCVA 2LYCA 1SEUA 4MIMA 4AVZA 4R5XA 3WQQA 1SVLA 4ITVA 2KFDA 2LF7A 1VF9A 3E6CC 2BBYA 3J80K 4PK4A 5KK1A 3BR1A 2X6OA 1S8NA 3OMYA 4D0PA 1PVEA 1TZLA 4I0BA 3TOBA 2Y1EA 4XNDA 3E3VA 4ENKA 5DULA 5EGOA 3FIWA 2V9VA 4MGRA 5KVRA 1T8IA 2YU9J 4CGZA 2O9LA 5LLQA 4C2TA 3I53A 4OU0A 2IGMA 3OOUA 4BDZA 2DDAA 2DW4A 2W24A 2D1HA 2Z3YA 2BY0A 4WK8F 5EEAA 2WBMA 4ASNA 3V8KA 4KN4X 2WADA 1E3HA 4KICA 2WTEA 3JRBA 3K2ZA 1G6NA 4RGSA 5DM7F 2R5YB 4FCAA 3KFWX 2W48A 2KLOA 2NVQJ 3CJRB 4MFDA 4BJTA 1HKTA 1LDKB 2QQAA 4G6QA 1DP3A 1V5FA 4IRHA 4I99C 3I64A 4UNOA 3TO6A 4ZX6A 4HSTA 3HUGB 3GF2A 2OQGA 3BCBA 3D1NI 4Y6SA 3SDBA 1Z7LA 3RC8A 3WTSC 1WJFA 3VB2A 3HEFA 3GTLJ 4FISA 5B5EC 2EB7A 2DK8A 3BQZA 4DIQA 3HTUA 1FBUA 3GXOA 3S2WA 5LEJA 3OYAA 5F64A 2JD0A 1WCMJ 2H8RA 3T8VA 5FJ8J 3ZQLA 4KISA 4L0ZB 4A12A 3AG2H 3M8FA 4FE7A 4HG2A 5IYBJ 4ENJA 2GA1A 2R5YA 3S2DJ 3FU0A 1RPWA 4PDKA 1Y39A 5IYCJ 3F3XA 4CHUA 4ZX5A 1XSVA 4CO8A 2R7QA 4E7SA 1P7JA 1SAUA 3HXLA 1MKMA 4IQJA 2HGCA 5CVVA 1Z1DA 1XMXA 2DA2A 1G3YA 2G9WA 2LY1A 5K1YA 4D1QA 1REPC 2H27A 3AAFA 2M7BA 2EIJH 2PX9A 4C3HJ 1RR8C 1HS6A 4XN5A 2OU2A 3CZ6A 5EZHA 5GADJ 1Y8RB 1V55H 2XF6A 3I4MJ 2HPTA 5BPIA 1SD6A 1OFCX 3DV8A 3WE3A 4Z2YA 4F7ZA 4E7JA 1FBQA 3CJTB 3DQVC 4EMSA 4U87A 3K70C 2DQMA 2R7VA 5J8CA 2EZLA 2R7UA 2VBZA 4FX4A 2M9HA 4P5OA 2PLYA 1S7AA 3OYDA 4IJAA 4P9UA 2QZ8A 4A3GJ 2O6GE 2ZMEC 4ETSA 2BGCA 3DEWA 5EF6A 4OIOF 4AR9A 2IBDA 2LKSA 3IUOA 3B6AA 5CLSA 1IGNA 1WJBA 1XGOA 2JUCA 1T95A 3V7SA 4BUPA 2XIGA 1F43A 3VDXA 3E1SA 2GXBA 3M1CA 3BP8A 2X1EA 3R0IA 1Y0NA 2FNPA 1YW7A 1ZQ3P 3OS2A 2L3DA 2PI0A 2L2OA 2CG4A 3ZRGA 2Z16A 3FUHA 1X3ZB 2KHMA 2A69F 2XGDA 2FMLA 4S0HB 2Y48A 4Q4ZF 4Q48A 3EUKL 4E7ZA 4ARFA 2FUG2 2Y30A 4G6TB 2WC2A 2ZSIB 2E1MB 1ZRDA 5TISC 3BROA 1FYMA 3DLAA 1B8IA 3TDZC 3D0SA 4NUBA 3L2RA 4HDVA 3WTYC 1E3OC 2W00A 2XF7A 2ISZA 5EV7A 3HHHA 2QKMB 2TRTA 1LFUP 2HKXA 4ESFA 2HYGD 1NHAA 3DF8A 2V9PA 2STWA 1P6RA 2DOAA 2M30A 3GZ5A 1FPQA 3VFZA 2IAIA 3BJAA 4L5IA 4R79A 3OYJA 4YIIA 2FF4A 5K7HA 1ZRFA 2E71A 2E60A 5E3LA 2L9RA 4AIHA 3JRFA 4IPAA 2DJIA 5CKTA 2ECBA 4Y7NJ 4GAEA 4FLQA 3GZ6A 2DPUA 3FK6A 2QQ9A 3CF5F 3FUNA 1WVRA 2FBIA 2AHQA 3GO5A 1Y8QB 2FA5A 4E4HA 2CUZA 4X1EA 2W7NA 4MS6A 4JX4A 1MGTA 1T33A 3WU1B 3ULQB 5FKNA 4FX0A 4NHJA 1O3QA 1U6GA 5FFXA 2E5ZA 1ZGAA 3AU9A 3B3BA 1ETVA 1QU3A 4BQAA 3FTXA 3W2WA 4XRSG 1F9NA 2QA4I 2V1UA 1ETKA 1R1VA 2VBXA 3SZPA 5HVQC 1BI2A 3I58A 3NRVA 4LK0F 4FHTA 4E70A 2A61A 4B8XA 1SVMA 1K78A 5AENA 2L9VA 4M3EA 1FOKA 4EM2A 3RPUD 1VQKI 3CCMI 2L7KA 2BXYA 4V2GA 4N9IA 2TCTA 5E3NA 2DMTA 1W36D 4I76A 3RYRA 4AIJA 5LRRA 2OC6A 4L9TA 4UY8I 1DU0A 5B66C 4LB5A 1LVKA 3AG1H 4QUOA 5GP9A 1K4TA 4WWCA 2CQ7A 4A3IJ 2VASA 2V26A 3HSEA 2DI3A 3HRUA 2XQ0A 2PJRB 2DOEA 3FWEA 3P9IA 1VQOI 5FB2A 2K86A 1R0KA 1VQNI 2XF5A 1O3RA 3KCCA 4QIWN 3M9AA 2VONA 1HCRA 1STZA 1RKTA 2WY7Q 4HW0A 3ZR8X 4KIGA 1JHHA 3RC3A 5LGTA 2P8TA 3K4KA 5FO5A 3ANLA 2LG4A 4WXDA 2DFEA 2L4AA 2DPDA 2CV2A 1SFKA 2JSPA 2OQRA 1S7EA 4BJ5C 4HRIA 1A6QA 1YQAA 5L3BA 1RRJA 2DFFA 2A7OA 1U8RA 2KIQA 3M8EA 4AC0A 4CYDA 3S1RJ 2STTA 1UG2A 3UR3C 2VODA 4AIKA 1VQMI 1VQ5I 2PBIA 1Q0HA 3LFKA 1KU9A 3S2HJ 2H6BA 5BMZA 3HYIA 4JYKA 4KA4A 2QGUA 3AKZA 2E2HJ 3V4GA 3IH3A 2QVWA 4IX7A 4BU2A 2MBFA 2HR3A 4XKWA 3BTCA 2NS8A 3GW2A 1Q1HA 5ICFA 2QENA 3FUEA 3Q44A 2JV7A 4H4KC 2ZFUA 4FASD 4XRSA 3OS0A 2MH9A 1SFUA 2WZFA 2E7XA 4I0AA 3X2QH 2W82A 1A35A 1OR7A 3EQLF 2K27A 3G1OA 5DCMA 2JA5J 3NQOA 2WAQA 3FU5A 3A0BC 1OCOH 2HZDA 3HOSA 4K5LA 3BPVA 1FOYA 1ZHFA 4HA8A 5LHGA 3Q0WA 2P81A 1CF7B 2HDDA 5F6FA 5K5QA 2X9DA 3PIOF 1W0TA 4BQQA 5DV5A 1O7FA 2YR2A 1TWCJ 3BCAA 3ZI0A 3ZOBA 2A5WA 3HBLA 2PMZA 5DCMB 3HOYJ 4MHGA 3TL4X 3QPTA 4BE2A 5FD5A 4Z6YA 1ZREA 1E0EA 5LBQA 2R7XA 1KA8A 4XLHA 1IXSB 5CPRB 4XMUA 1OISA 3TP3A 3JSPA 4XMXA 2Z1DA 5FLXZ 1OLTA 2EA4A 2ELHA 1RZ4A 1XMKA 1NH3A 1YLFA 1ZKGA 3FISA 5AIQA 3F0CA 3JREA 4RGRA 1JJ8C 2FJ1A 1O7LA 4R5VA 4BXFA 3MWMA 1TBXA 3I4NJ 1XC5A 1LFPA 1W7PB 3HGGA 4U0YA 5M3MJ 3OYHA 3HPGA 2QQBA 2DA4A 4XMVA 3NWSA 1XGNA 3JTHA 2B61A 2G7HA 2P7VB 1BBYA 1T6SA 2M0MA 4QSHA 3WE2A 5CJ9A 3L2CA 1PP7U 1ETYA 1H8AC 3DPTA 2ZXWH 1WQ2A 3KP3A 4ZC3A 3IRQA 4DYQA 5DYMA 1HLVA 4NDLA 3KP6A 5CQEA 3FM5A 4JP0A 3LWFA 1Y1WJ 3DBLB 3FDYA 1FP2A 2AQEA 2DA6A 5E17F 1S7OA 4IO9F 2HQ5A 2LR8A 1Q0LA 1WSUA 2XKPA 2KDOA 3B73A 1MBHA 4G8XA 4BACA 3I5UA 1H0MA 3EETA 1X3UA 4E7HA 1B59A 1MJ9A 3K4LA 5F0CA 1ETWA 1ZR4A 3PUUA 4UB6C 1SFEA 2OF7A 2YPRA 2L9SA 3DEEA 3A14A 3C1DA 4QPEA 4RB0A 2XGEA 2K9MA 4RDUA 3TW7A 5KNLA 1FX7A 4P9FA 1MSEC 2R92J 3ZMUA 3PQKA 3OYFA 4BEHA 5JLWA 3I3LA 1LUJB 4ZYHA 4HQEA 1JE8A 2O7GA 3CO7C 2R70A 3HRSA 4II2A 1HKSA 1YS6A 1MW2A 4K2EA 5FLXK 2CJJA 4W1UA 2BW3A 3H5NA 5EJCA 2COBA 3CDIA 3IAM2 1J9IA 3B37A 2M1BA 5E79C 1QHGA 3BZCA 4PU2A 1I3QJ 4M3DA 4MFEA 2O7OA 1TLHB 3FBNB 1Z05A 1YITI 2VI6A 2F2EA 2FSWA 3GX4X 3FXLA 2KJCA 3B34A 3ZQCA 2YS9A 3A02A 1YJWI 5CVJA 2MFZA 1KU3A 2DJNA 1ON1A 2VE8A 3K4MA 1KU7A 4DW6A 2HOTA 5JVTA 3FBIB 2DO7A 2O3FA 5L3GA 1MJBA 1NG7A 3R60A 2D45A 1B8IB 2V6CA 2DDBA 1J0RA 2K02A 3VODA 3ZCOA 2VLAA 1D0YA 2CW8A 4YEJA 5TJJA 4U0WA 4ZJZA 2K9QA 4ZYEA 5ILUA 1E17A 2MAPA 3KLNA 2L7ZA 2X6YA 3FMQA 2V6EA 4IF4A 5LRSA 4A93J 4RAGA 4UVAA 3P5JA 2K4JA 4KITB 4K5MA 1Z67A 4G6DA 4ZX3A 2IRFG 1AHDP 3VSLA 2LY9A 1SD7A 3VSKA 2DA7A 1T2KA 1LE8B 1JHFA 1T39A 2B63J 4ZTJA 4HNVA 1O3TA 4LG0B 4IHSA 2IS1A 2VJIA 3Q9SA 3FUDA 3MZYA 1KU2A 3F6OA 2K85A 2CQNA 1RUOA 3LA7A 4TV7A 4NC8A 1DGWY 2RNJA 5L3CA 1IRFA 5D5UB 2DA5A 2GQQA 2F5VA 3DP7A 1MH3A 1SVOA 1ZELA 4FT8A 4A0ZA 4RLFA 3EPZA 2ZXJA 2HDCA 2AQFA 4ZQFA 1X4PA 3OIQA 3E6DA 2IXSA 2JMWA 5LEKA 3S1MJ 1R5ID 2EZKA 4B4CA 5HLHA 4XRMA 3CIAA 2MLGA 3EYIA 3KYCB 4A03A 3CHPA 2JA2A 5ICCA 3BR2A 4GFBA 3VEPA 3WGGA 3UCQA 5C3EJ 4DBRA 3K69A 3ZP5A 1GV2A 2EIKH 2XPUA 3A01A 3ZQ7A 1MDMA 1R71A 1K5HA 1T98A 2DQRA 3NEUA 4G9YA 3KZYA 4QLCU 3S3MA 1R22A 5LHHA 1UFMA 5E3OA 5DS9A 2OUMA 3S1NJ 1WKMA 2HOEA 3PSFA 3OYGA 3E97A 2KDZA 4MEYF 2W57A 3OV8A 3A03A 3EDPA 3KX2A 2BV6A 3SJMA 4EEFG 1SANA 4RB3C 4CA0A 2Y75A 2IS6A 1NTCA 4MTEA 3CESA 1MNMC 5C44J 4KIBA 2K4BA 1W4MA 5EYRA 3F6VA 5D4RA 3R0JA 3MZHA 4HV5A 1XGSA 2NRAC 3I71A 4GDFA 3G2BA 2BW3B 3DKXA 1T08B 4L5JA 3SDGA 4AU7A 1JVSA 3ZPLA 1I5ZA 3VYRB 3RPUA 4PJNA 3FUMA 3MKZA 2GTQA 3S3NA 4ZZLA 1ZN2A 4XORA 2ACJA 3Q3SA 2DOFA 5KCMA 2RGVA 2G0EA 3WGIA 3HOVJ 4EVIA 2BHYA 3DPLC 1QBJA 3PFIA 2OJED 1E3PA 2YX7A 2R59A 4OAYA 2CUJA 4A3DJ 3F8NA 5J1YA 1YTYA 3LSTA 4QPQA 3WHCA 1GXPA 3ZHXA 1ZH5A 3SXYA 5ICGA 1QHHD 5HS9A 2EBIA 2W84A 4LG0A 3ANNA 3VYUB 1SC7A 1HSTA 2GM4A 3P9CA 2KISA 5HS7A 4PJJA 4QHPA 3CP8A 3ZMVA 3VOEA 2A07F 4CZCA 2ZNYA 3V8JA 1QZZA 1W1WE 2BZTA 4HPQA 1GW6A 5BOXA 5FFZA 2FE3A 4XONA 2M3AA 4K5OA 1TNSA 1ODDA 1WH7A 1X1CA 3RIRA 3SHFA 1XGMA 3K4CA 1F5TA 4A3LJ 3KYDB 4G12A 1U78A 1D0ZA 3HHGA 1ZTRA 2IA1A 2FMYA 1RC9A 4CYCA 5BQTA 5HLIA 2JCXA 4F52A 2DTRA 3S93A 4J00A 3RSNA 2P5KA 4II3A 2JRMA 3GTKJ 2ZXGA 3B7UX 4PJMA 4FTHA 3FUJA 1WWXA 2EQRA 4KN7X 3WTWC 3HKZN 1B9NA 3CCYA 4KUMA 2LC2A 2RQQA 2K3FA 3PSIA 4AYBA 1Y1VJ 3B7SA 2KRFA 4U7DA 3FH7A 4XLNF 3FHNA 3KP2A 3DTEA 5JFRA 2NVTJ 1LE8A 3BY6A 3HUGA 4RVBA 3MKLA 4A3MJ 1YRNB 3FXMA 3HDDA 4IRIA 1Z77A 2PG4A 3U1KA 3JRIA 1OCTC 2DXIA 2RKHA 2NVUB 1HC8A 3BG7A 4Y52J 1LDDA 5F0HA 1RIOH 2Y0SA 1LFBA 1O57A 5F0FA 4XLPF 1D1BA 3ASOH 3FTUA 2OTJI 1MDMB 3WTXC 3JW4A 2KRCA 3DTKA 4OIRF 4R8HA 5J40A 3S17J 1P2FA 4HAMA 4BQOA 4NNJA 1QZYA 3OYMA 3HKZA 4RGXA 3NAUA 1YHQI 3PNTA 5IT9K 2KZGA 1YX3A 3LSJA 2IVMA 1XB4A 3CCVI 3QOEA 5F08A 4IOAF 2EV6A 1R23A 4N4NB 2HVQA 1XDSA 1JI8A 3MMYB 3K4BA 3WU0A 5J1RA 1U0JA 5LHIA 3UEQA 5FRNA 3I54A 3QJXA 2JA6J 5E20A 3HPHA 2XROA 3IKTA 2X48A 5D6EA 3Q9VA 1ZS2A 1MMDA 3ERED 1OR7C 1FEXA 2JK3A 1JGGA 3G4SI 1GT0C 1IN8A 5E1ZB 2W85A 4NBQA 1ZG5A 2V7FA 4ZW7A 4Y4RA 1NG6A 1UB9A 3FTVA 4LOCA 1D8JA 3CMAI 4MKTA 2DAOA 3DU5A 3N05A 4A5NA 1IO2A 2OZ6A 1K6YA 1ETOA 3K1PA 4B47A 3JRHA 1X1DA 4HBLA 3H9QA 3OYEA 4A69C 4B43A 3I55I 4CXFA 3SZTA 3KLOA 2LFBA 5D5WB 2HXOA 4HNUA 4IHTA 2B7EA 1NK2P 1FWZA 3CCJI 5D5VB 1RP3A 1VZ0A 3CCRI 4AM3A 3IRRA 3V7RA 4ESJA 4IRGA 2WAFA 1FY7A 1QQIA 2H6CA 2IEKA 2NXNB 2O61A 1YIOA 1J09A 3FTSA 2Y31A 2P5LC 3A1YA 3HRTA 3A4CA 1JTYA 2ZNZA 2NVXJ 4AYBN 3BTIA 2ISYA 3ZQIA 5GTHC 4PUSA 2KT0A 2PEXA 2X51A 2NNNA 3IL2A 2VXZA 1OJLA 4XLEA 3SFZA 1A31A 2I8DA 1D3YA 3WU2C 2W4SA 1K6OA 1HKQA 1BR4A 2K3PA 3A0HC 2OTLI 1WI9A 3RCOA 4DYRA 4BE0A 4RLQA 5BPPA 4N9HA 3CHQA 1HDDC 3DPUA 4U88A 4YELA 1HQCA 3B2PA 1G8XA 2MH2A 3W6KB 1WJEA 2QSGX 1R5HA 2XASA 1YYVA 4XSZF 4UVCA 2HTSA 1HOMA 4B48A 2F5DA 3M8JA 4JX6A 3GTQJ 3A2KA 4HYEA 4OINF 3GFIA 4JX5A 1YW8A 3T0YA 3OSGA 2R7FA 2FEZA 1AU7A 3IIEA 3FH8A 4GGGA 4ZDOA 2HYFA 3F9KA 4A3EJ 4L18B 3QPSA 3IKVA 4HX8A 3OSFA 1MZBA 2RC4A 3HRMA 4OMYA 1GUUA 3QRFF 1SFXA 2Q8KA 1TL8A 3GTOJ 1TW3A 2GOXB 4CSWA 1UHWA 2BY2A 2JWTA 1VNDA 4DZJA 2O8XA 2QM3A 2YSRA 3BWGA 1XDUA 5B3SH 2I10A 1EA3A 4WX9A 2ME0A 3FHEA 5ILSA 2M0CA 4A3JJ 3RZDJ 3G73A 2E1OA 1P7IA 1R5GA 1X3WA 4DZPA 1WPKA 1OCPA 1J5YA 1K83J 2R93J 1WFXA 3CCQI 3LA3A 1OYYA 2ZXIA 3KZIC 4UVBA 2LVSA 1SAXA 1VQ9I 3LA2A 4FQGA 2E2JJ 4E7LA 3ZQHA 2R7DA 3KZZA 2VIXA 1SFOJ 2Y9ZA 1TWGJ 2CH0A 2HOAA 1G59A 2PJPA 3CZLA 2XSJC 2OBPA 2W25A 3BJ6A 3BOQA 3IV5A 1R4MB 2A6HF 2WA0A 1ZYRF 1YI2I 4CH7A 3FTWA 3PL8A 3RQ4A 1KQ8A 2A5YB 3K4JA 2Q1ZB 4R7LA 3L09A 4M71A 5JVGF 3ECOA 1ULYA 3WQSB 2NNYA 3BTLA 2F4MB 4HX4A 1LDJA 1Z9CA 4I09A 2EIMH 4ZW6A 5E8GA 2JRTA 5BNGA 4NC7A 2ELKA 2NYXA 1YIJI 1CGPA 3DKWA 1RI7A 2Z5UA 2M87A 4EM1A 4WF2A 4F3QA 3LNQA 3JT1A 4KMFA 4HV6A 2H94A 3QODA 5E1WA 2DT7B 4KIFA 3KP5A 4WXCA 1IG7A 4I02A 4M3BA 2GAUA 1FTZA 2XRNA 4EV0A 4XLAA 2UZKA 2QJ1A 2WY8Q 2VOOA 5K7ZA 5H6QA 1J7KA 2PQ8A 4OIPF 3K1MA 2DMNA 2ZKZA 5D4SA 4U7BA 4F91B 1K79A 4OWRB 3FXJA 5BPDA 4XN8A 3ZQGA 2FOWA 2A6TA 1IN6A 1S3JA 1I1SA 1PJRA 4ZQEA 4RGUA 2BEOA 5IP9J 1SMYF 4MQ9F 2LNBA 3R4KA 2HDWA 5FKKA 3H3ZA 4JQFA 3OYBA 2ZSHB 2MAOA 3TKYA 2JT1A 2ZFWA 3ERMA 2M8EA 4PSXA 1B1BA 4KNYA 5J8FA 3CMMA 3OR2C 4FLSA 4LLLA 1JGIA 2JN6A 4X2UA 4ZYDA 4IKFA 2VBWA 2V9KA 5J6XA 2IGOA 3E5QA 2BOLA 4LG3A 4XBFA 3CHSA 4BE1A 3C3WA 4E7IA 3TO9A 4LFUA 4PJLA 2DYRH 2QVOA 5DEQA 4IXAA 2R7ZJ 2H8WA 4XLFA 3BZ6A 4XRFA 5JBIA 3E6BA 3CC7I 2HU9A 2HKOA 2MC4A 2D1VA 2KL4A 4KYWA 4XNFA 2JA7J 4EQQA 3WTUC 1YOVB 1RNLA 1ORKA 2WZGA 2ZCWA 3KEYA 4AWXB 3KETA 2R4GA 5D8KB 3HM5A 3SYTA 3V8LA 1OYIA 1O3SA 1BOAA 5L3DA 4BXUA 1RETA 2CQQA 4DPRA 2PGGA 3H5RA 1ITYA 1JKPC 4D5FA 2XKOA 1H9GA 3QU3A 3VWBA 2FBKA 4S04A 4GYGA 2QBYA 1Q0QA 1RUNA 4C3IJ 1M1EB 3RDIA 2XGCA 2DMQA 2VQHA 2EPFA 2LBFA 1JJ6C 2XV4S 2Y1FA 4BH9A 4AUXA 3H0GJ 1UMQA 3K70D 2DU9A 3HG9A 4ZQHA 4JBAA 3TEDA 4PSWA 3FMRA 1MBFA 1B6AA 3BG5A 3E5XA 1PP8F 1K78B 3F8BA 2QEXI 4DQ2A 1VQPI 1P4WA 1WGXA 1UZCA 2KP6A 1V5GA 3M07A 4F55A 4PGGA 4LK1F 4ZW3A 4GRIA 4BQNA 2RDPA 3TO7A 3WTTC 3M4OJ 1JG9A 2FQ4A 3WTVC 1LKXA 2HI3A 1XCBA 2EJRA 4XICA 1VI0A 1XD7A 2KZVA 4OIQF 2L7FP 2LMDA 4XQFA 2YX4A 2FOKA 2VBYA 3S32A 3LSHA 2UV1A 3AG3H 1RR7A 1SD5A 4UHTA 4XL9A 4Y33A 1MSFC 1HBXG 1IRGA 3FUIA 5IYDJ 3DXJF 2R3SA 3BQYA 4CZZA 3G71I 3I59A 4C2UA 2KJBA 5TGTA 3W2VA 5GAGJ 2EK5A 4RAYA 1XSDA 2YU3A 4AICA 1MW1A 3EBHA 4Y3OA 1YJ9I 2AXTC 3O8GA 4Y15A 1YX5A 1GV5A 3QU6A 2ZB9A 4HEA2 2BVLA 1QRYA 3ML6A 4ZTFA 3LL7A 2PMUA 3ZQQA 2Y0SN 2HWVA 5E18F 1JUSA 3UKGA 4ABZA 2QKLB 1S9HA 3B6CA 4U0VA 4A6DA 4DYCA 4MEXF 1DGRM 2IJLA 2M4KA 4AYSA 4M74A 1U5TB 2IA0A 2BY3A 2LREA 1YFHA 1FSEA 1HW2A 1L3LA 4XMWA 4A3FJ 3AG4H 1GXQA 1N77A 4L0YB
chains in the Genus database with same CATH topology
4XKBA 4XORA 3S8PA 4BGDA 4ZX5A 5KCMA 1BOBA 2JVGA 2V4JC 3K10A 3LFUA 2R7QA 4E7SA 5LD2C 4XO3A 1BR2A 1SAUA 3HXLA 4IQJA 3DPLC 1T1SA 2M4GA 2LY1A 4NQWB 1MW0A 4XNAA 4D1QA 4GAAA 2X6XA 1MW7A 2M7BA 1HS6A 2R59A 4OAYA 4XN5A 2CUJA 3CZ6A 3QYBA 2HPTA 2XF6A 1MVYA 4QPQA 3ZHXA 1QHHD 3NWTA 1D1CA 4E7JA 1MW3A 3ANNA 3VYUB 5HLTA 3DQVC 4U87A 3K70C 2DQMA 2R7VA 4PJJA 3CZKA 4XN4A 2R7UA 1MNDA 4QHPA 3CP8A 3LSKA 4CZCA 4P5OA 4Q4EA 3OYDA 1D0XA 4RMNA 2M7AA 4HPQA 3L2QA 4LITA 1TT0A 1GW6A 4AR9A 3OYLA 3IUOA 4J01A 2VJ4A 4XONA 2M3AA 1WJBA 4K5OA 1T95A 4BUPA 1X1CA 1W36C 3K4CA 3C2GA 2K5CA 3VDXA 3E1SA 3M1CA 1D0ZA 4R5TA 2X1EA 3R0IA 1X1BA 2HPOA 3OS2A 1N77A 3EUHC 2L2OA 2JCXA 3ZRGA 2Z16A 4XLCA 2XC7A 3FUHA 2KHMA 2IS4A 4F52A 3S93A 2L9NA 2HPIA 4J00A 2VJJA 3RSNA 4ZDLA 2LBFB 3OIPA 3EUKL 4II3A 4E7ZA 2FUG2 2ZXGA 4PJMA 3B7UX 4ARFA 5JO0A 4G6TB 3FUJA 2ZSIB 2E1MB 1G5AA 3VVMA 3DLAA 2VL8A 3MD2A 2IGKA 3U21A 2LC2A 4AR8A 4NUBA 2RQQA 3L2RA 3PSIA 2O5RA 4AYBA 3B7SA 3FH7A 3OYIA 2W00A 2XF7A 2VJ5A 3FHNA 3DTEA 3OY9A 5JHFA 4XKCA 2CV1A 1Y56A 5EV7A 4XN1A 3ANMA 4RVBA 2QKMB 4Y67A 3QYFA 4ZW5A 2UWMA 1R0LA 2MABA 4J3BA 3E0JB 2DXIA 2DOAA 3BG7A 1MMGA 5JMPA 4LIVA 4R79A 3OYJA 2Y0SA 1D1BA 3TBIA 2E60A 3RTRA 3FTUA 4FLOA 2KRCA 3DTKA 3BLYA 1YE9A 4CCOA 3FUKA 3FULA 2DJIA 1WJCA 5CKTA 4FLRA 1WJDA 4BQOA 4GAEA 4FLQA 4NNJA 3OYMA 2RJIA 3HKZA 3ZHZA 3FUNA 2LRDA 3PNTA 4B44A 1YX3A 2CUZA 4E4HA 2W7NA 4MS6A 4K5NA 4BEHB 4XN3A 4P1WA 2FFLA 2CFOA 3FTZA 3QOEA 2MD0A 3A06A 3FTYA 4DBQA 3OYCA 5HNHA 4N4NB 2HVQA 1JI8A 3AL0B 3MMYB 2E5ZA 3B3BA 2HPMA 3AU9A 3K4BA 3ONQA 1QU3A 2C82A 1N78A 3W2WA 1U0JA 3TMOA 4CCLA 3FTXA 3UEQA 3OL4A 5FRNA 3QJXA 2R7OA 5HVQC 3HPHA 4KP7A 4XN2A 3K4NA 3CZGA 1ZS2A 2JD2A 1MMDA 4HSRA 3JSZA 1OR7C 2HQAA 1X3ZA 5AENA 2VQCA 3RPUD 2WAEA 2L7KA 1SG7A 4XNBA 1MMAA 4D9JA 3MKWB 2V7FA 4ZW7A 4ZN6A 4Y4RA 1W36D 1NG6A 2C5ZA 4OOFA 3FTVA 4ZYAA 2OC6A 3FH5A 4XO4A 2LH9A 4MKTA 3DU5A 3N05A 3LSIA 1LVKA 4KT6A 3L2VA 4QUOA 5KHDA 4B3XA 2VKDA 1K6YA 4B47A 4CCNA 2VASA 2CV0A 2V26A 1X1DA 2PL5A 2XQ0A 3H9QA 2PJRB 3VYSB 3OYEA 4B43A 3HL2A 2R7SA 4CXFA 1ONOA 1R0KA 4F93B 5FWQA 2XF5A 1MNEA 4HNUA 4XN9A 4ZQGA 4RSYA 5CQGA 2WY7Q 3H9JA 3ZR8X 1RP3A 3QYEA 1VZ0A 3RC3A 3K4KA 2WAFA 3ANLA 1ONPA 3KEDA 3FTSA 3VVLA 1J09A 2LG4A 2CV2A 1SFKA 2JSPA 3OS1A 3H5AA 3A1YA 3BG6A 2LOOA 1WJ5A 4BJ5C 4HRIA 2E1MC 4PVBA 3A4CA 1H3LA 3H0DA 2CS3A 2A7OA 5JAZA 4PUSA 2X51A 3UR3C 2VXZA 3LMMA 4XLEA 4BKXA 2I8DA 3EBGA 3GBGA 1Q0HA 4AR1A 2W4SA 4N4OB 1KONA 1BR4A 2K3PA 2X6WA 4CCJA 2GOMA 2KPMA 4IZZA 1GLNA 3RASA 3AKZA 2QVWA 3RCOA 4IX7A 4BU2A 4XKWA 4XM3A 4BE0A 4RLQA 3FUEA 3Q44A 2L5QA 3CHQA 2JV7A 3DPUA 4H4KC 2ZFUA 3FUFA 4JNDA 4FASD 3LSMA 1Z3YA 1T0FC 4XMTA 3OS0A 2E5NA 2WZFA 2W82A 4YELA 1OR7A 3CHOA 3B2PA 1G8XA 4XR6A 2R7WA 4FETA 2F6CA 2WAQA 4Q4IA 4BL0B 1WJEA 3FU5A 2HZDA 3HOSA 4E7KA 4DGWB 4K5LA 4B48A 3M8JA 1X1AA 3A2KA 3W3CA 3B7RL 3HOTA 2VKHA 3T0YA 3IIEA 4Y6PA 3FH8A 3UNGC 2Y1GA 4ZDOA 4BQQA 1Z21A 2DCEA 3F9KA 1FMWA 3ZI0A 3BCAA 4L2LA 2A5WA 2XDVA 2PMZA 2K9LA 2X1DA 3V42A 1H19A 3TL4X 4BE2A 1R6RA 4XMYA 4BJ6C 2GOXB 4CSWA 1E0EA 4YRVA 2R7XA 1UAAA 4XLHA 5CPRB 4XMUA 1ERDA 4XMXA 2Z1DA 1OLTA 1EA3A 1UG0A 3MKYB 2XPYA 3FHEA 4ZQTA 3AL0C 3IAS2 2JD1A 3AU8A 3FU6A 2EGHA 1X3WA 5FRMA 4R5VA 4BXFA 2KRHA 1WFXA 1AA7A 1LFPA 2ZXIA 3CF2A 3OYHA 3C2HA 3HPGA 2WPGA 4PW4A 4E7LA 4XMVA 3NWSA 1FMVA 3U9WA 4DOZA 4XOTA 2VIXA 3L2UA 2B61A 1G59A 2CH0A 3DKYA 1ONNA 3B2XA 2OV7A 3CZLA 2XSJC 2VJ8A 2M0MA 3KYLA 3DPTA 2WA0A 2Y1DA 4ZC3A 4BDYA 4CH7A 4OAZA 2RNGA 3PL8A 5CQEA 3RQ4A 3FTWA 3K4JA 3OR1C 2Q1ZB 3FDYA 2JUGA 4R7LA 2AQEA 4LIUA 3WQSB 3FU3A 2ZXHA 3D5SC 4PFOA 1Q0LA 4XMZA 4ZW6A 4LUPA 2IGNA 2KDOA 4BACA 3AFHA 4NC7A 3PUBA 3DU6A 3VYTB 4F3QA 4E7HA 2PUSA 3JT1A 3K4LA 3B7TA 3EUAA 3PUUA 3QODA 2DT7B 1HA8A 3A14A 2L9SA 3DEEA 4QPEA 2K9MA 3J7AY 4CCKA 2HVRA 4XLAA 5KNLA 2WY8Q 2QJ1A 3CZEA 3ZHYA 4K5PA 1IRXA 1SC5A 4U7BA 3OYFA 4BEHA 4F91B 3I3LA 3PNVA 4OWRB 3W2AA 2O7GA 2Y1CA 2P0WA 4XN8A 3PNYA 2R70A 2F4IA 4II2A 2A6TA 1MW2A 2VPLA 1PJRA 4Y6RA 4ZQEA 2BW3A 4RCVA 4BS9A 4MLOA 2JVHA 2HDWA 4C9YA 4F92B 3H5NA 3S3OA 5DYFA 4XKVA 4JQFA 3OYBA 2ZSHB 2MAOA 3IAM2 2R7RA 3B37A 1T1RA 2BVMA 4PSXA 5JC1A 2XPZA 1QHGA 3I9V2 4PU2A 3CMMA 3OR2C 4FLSA 3IP4B 2Z2SB 3FBNB 2V1NA 1JGIA 2R7TA 4X2UA 4C30A 4QMEA 3OYNA 4IKFA 3B34A 4KJZA 2V9KA 4CCMA 2IGOA 4RM3A 3OYKA 3SZGA 1PYVA 2BOLA 4LG3A 1V5EA 2MFZA 3CHSA 5JMWA 1P9QC 3K4MA 2VQGA 4BE1A 4E7IA 4PJLA 3FBIB 4ZX4A 3AUAA 1S46A 3WQRA 1NG7A 4XLFA 4XN7A 1X19A 4PFPA 5JBIA 3ZCOA 2VB6A 1D1AA 2HU9A 2LY2A 2MC4A 4QPOA 5FROA 1D0YA 2KL4A 2VLAA 2CW8A 4XN0A 4YEJA 4XNFA 4ZJZA 3FKJA 2MAPA 2WZGA 3H35A 2X6YA 3KEYA 3BC8A 1SQMA 2V6EA 3D5RC 3D5LA 4OOEA 3H9GA 2R4GA 2DQ6A 1Z3XA 4E6KG 3SYTA 4K5MA 4KITB 3PFYA 2HVSA 2IS2A 4ZX3A 4JOMA 3VSLA 3VSKA 1MMNA 2RREA 4X0GA 4QIRA 2KQRA 3FU0A 4DPRA 2PGGA 4ZTJA 1DQUA 3H5RA 4ANJA 3DTIA 2IS1A 3VWBA 2VJIA 3FUDA 1N75A 1Q0QA 2R72A 2JCVA 1UELB 2LYCA 2PJRA 4NC8A 1DGWY 2DT6A 3Q43A 3CJQB 2VQHA 2LBFA 4AVZA 3DWLE 4R5XA 3WQQA 4ITVA 2F5VA 3ZGKA 2Y1FA 1ZELA 3LSGA 3K70D 4RLFA 3HG9A 4PK4A 2HNHA 3SEZA 4ZQHA 3EPZA 4EATA 4PSWA 1Y6IA 3OMYA 2AQFA 3ZXSA 3CHRA 1X4PA 1TZLA 4ZQFA 3OIQA 3HC7A 2Y1EA 4XNDA 5DULA 2IXSA 5HOOA 2KP6A 3OWTA 2NOJB 1V5GA 4C2TA 3CIAA 4F55A 4ZW3A 4HNTA 2JCYA 4XO5A 4GRIA 4BQNA 4A03A 1WJAA 2IGMA 2JA2A 3CP2A 3OOUA 3CHPA 3UERA 2CW7A 2Q2EB 4BDZA 1JG9A 3UCQA 1LKXA 4DBRA 4CUGA 2WB1A 4ZW8A 2KZVA 4XQFA 2CMPA 2WBMA 3S32A 3EBIA 1K5HA 3LSHA 2UV1A 2WADA 4XL9A 3FUIA 4Y33A 3L2WA 3S3MA 2X1CA 2X85A 3SEQA 4FCAA 4C2UA 2KLOA 3CJRB 2OUMA 5TGTA 3W2VA 4BJTA 3PSFA 1LDKB 3OYGA 1DP3A 1V5FA 4XOPA 4ZDPA 4AICA 1MW1A 3EBHA 4Y3OA 5JNLA 5LFAA 4HSTA 3HUGB 4ZX6A 3KX2A 3BCBA 4Y6SA 2ELJA 1Z7LA 3SDBA 1BR1A 4NQWA 3RC8A 1WJFA 1YX5A 4CA0A 2IS6A 4HEA2 2BVLA 4ZTFA 3CESA 3LL7A 3ZQQA 2W1OA 4DIQA 4IQ4A 3PJRA 5BPPA 2QKLB 1S9HA 2UUZA 4DJAA 1DGRM 5HNFA 3K6GA 3OL3A 2M4KA 4AYSA 3OYAA 3G2BA 2BW3B 2KMUA 2JD0A 3DKXA 4AU7A 2VQLA 1JVSA 3T8VA 2VXDA 2XAUA 4KISA 2LREA 2MYSA 3VYRB 4PJNA 4RM2A 3FUMA 3MKZA 4XMWA 2GTQA 1X4OA 3S3NA 4HG2A 5DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNH A;  5HNF A;  2VLA A;  5HLT A; 
#chains in the Genus database with same CATH topology
 1WI3 A;  4XKB A;  3R6S A;  3S8P A;  4BGD A;  4HF1 A;  2XAQ A;  1EV7 A;  4XO3 A;  3LFU A;  5H6R A;  2HZT A;  4GXO A;  2TDX A;  3PUF A;  4UB8 C;  1QA6 A;  1AOY A;  1GDT A;  1MW0 A;  2M45 A;  1BN5 A;  1QPM A;  2X6X A;  1QNT A;  1V3F A;  1QVU A;  2F5F A;  2CYY A;  1JKQ C;  1DP7 P;  1MVY A;  1C0W A;  3K1N A;  3DLL F;  3T5X A;  5FGM A;  3Q0U A;  1QO0 D;  5J4V A;  1IN5 A;  1BM9 A;  4EJW A;  2LDU A;  4XN4 A;  3ZN1 A;  3LSK A;  2DMU A;  2EFO A;  4W97 A;  3JRC A;  2J5O A;  1QZE A;  1D0X A;  4HLY A;  4RMN A;  2M7A A;  3FXR A;  3U9G A;  3RQI A;  2KIM A;  2GBY A;  2XB0 X;  2OCE A;  3JR9 A;  2RQP A;  4RB1 A;  4J01 A;  2VJ4 A;  2O8K A;  1L0O C;  5DD8 A;  4PJ0 C;  2FU4 A;  2DK5 A;  3COA C;  1W36 C;  5KAF C;  4WXH A;  2K5C A;  2BYV E;  1IUY A;  3IC7 A;  4R5T A;  2AO9 A;  1RKW A;  2HPO A;  3I4P A;  2HTJ A;  2K7L A;  2ESN A;  2XC7 A;  5JHU A;  5BS6 A;  2HPI A;  4ZDL A;  2LBF B;  1IXR C;  3OIP A;  3TP0 A;  5JO0 A;  1MBJ A;  2JSC A;  4YIF A;  5K7F A;  2V1X A;  1G5A A;  3VVM A;  3GFL A;  3MD2 A;  2IGK A;  1A04 A;  3GTJ J;  4AR8 A;  3JRG A;  3MN2 A;  1GHC A;  1IDZ A;  1Y0U A;  2VJ5 A;  4IL6 C;  3OY9 A;  3O2P E;  5JHF A;  1I6X A;  4XKC A;  2CV1 A;  1X3W B;  3ZMT A;  4XN1 A;  1B72 A;  3ANM A;  5EEH A;  1Q1V A;  4Y67 A;  1IN4 A;  1TTY A;  3QYF A;  2Q0O A;  1Z6T A;  2MAB A;  1LVA A;  3ABU A;  3E0J B;  1SD4 A;  4P55 A;  5EZG A;  1ZRC A;  2DFI A;  2N8G A;  1FBS A;  3FXK A;  5IPA A;  1EF4 A;  2Z33 A;  4FLO A;  2WB1 N;  3DCF A;  1TWH J;  1YE9 A;  1MBK A;  3F22 A;  3FUK A;  3FUL A;  3O3K A;  1WJC A;  2GZW A;  1WJD A;  3J7Z I;  1P4A A;  2EFN A;  3ZHZ A;  3N4M A;  2R0Q C;  3M1E A;  4B44 A;  2GWR A;  1S72 I;  3TGN A;  5C4J J;  4K5N A;  3S16 J;  4BEH B;  4G7O F;  4XN3 A;  4P1W A;  1XS9 A;  1VQ7 I;  2L7M P;  3L00 A;  2FFL A;  2CFO A;  3I59 B;  1JKR C;  4BBR J;  4BNC A;  4DBQ A;  5HDG A;  3OYC A;  3IHU A;  2QSH X;  2P6S A;  1FOW A;  3KE2 A;  3ONQ A;  2XAH A;  3FKI J;  1YW9 A;  2DT5 A;  1XCV A;  3OL4 A;  3TOA A;  4BYY A;  3CZG A;  2H1L A;  3O6B B;  2P5V A;  1OKR A;  4Y13 A;  2BXZ A;  2HQA A;  3S15 J;  4IHW A;  2VQC A;  2P7C B;  2WAE A;  2L4M A;  1MMA A;  4D9J A;  4ZYG A;  3MKW B;  4G7H F;  3CCS I;  4BY1 J;  2R5Z A;  3FF5 A;  4B09 A;  4ZYA A;  3FH5 A;  1BC7 C;  2KKO A;  3L2V A;  1R4N B;  2MD5 A;  2GA2 A;  5A2Q K;  5KHD A;  1B9M A;  2CV0 A;  2NS7 A;  4EM0 B;  1I27 A;  3VYS B;  1ONV A;  2GXA A;  1X58 A;  1YS7 A;  2RAE A;  4YFK F;  3HL2 A;  2R7S A;  2BHZ A;  1ONO A;  5FWQ A;  3ZQF A;  5ICE A;  4XN9 A;  4ZQG A;  5CQG A;  4BHB A;  2E1N A;  1JTX A;  5ILV A;  3H9J A;  2JJ7 A;  4RS8 A;  3NAR A;  3QYE A;  2HOS A;  3DFG A;  1K61 A;  5L3E A;  3I56 I;  3PO3 J;  2CSO A;  4G7Z F;  3OS1 A;  3DBH B;  5E1X A;  3CME I;  2LOO A;  3F8F A;  5GAE J;  1H3L A;  3E6M A;  2GIV A;  2ZJ2 A;  5IT3 A;  5HLG A;  1FT9 A;  3SQN A;  3F8C A;  2CS3 A;  3H0D A;  4O3M A;  1I39 A;  1S29 A;  5M3F J;  1ZAR A;  4O5V A;  4HZF A;  3LMM A;  4AR1 A;  3BG9 A;  3FXU A;  2L0K A;  2QYO A;  4CCJ A;  2GOM A;  2KPM A;  4IZZ A;  4L9J A;  1ETX A;  1CF7 A;  1GVJ A;  3VPR A;  3PIP F;  1XSX A;  2QUF A;  3QAH A;  1XPX A;  5LGU A;  4M72 A;  4XM3 A;  4ZZD A;  4BHC A;  1J75 A;  3QP6 A;  4IEJ A;  1LEB A;  4JND A;  2QCO A;  3LSM A;  4PCQ A;  5F04 A;  1Z3Y A;  2A3S A;  2HFH A;  2E5N A;  3SFI A;  3H36 A;  3J81 Z;  3CHO A;  4XR6 A;  2R7W A;  1K4S A;  2ZME A;  4FET A;  1VQL I;  2F6C A;  3CXB A;  3G1L A;  4BL0 B;  4E7K A;  2GIZ A;  1BI3 A;  1X1A A;  1N25 A;  3W3C A;  4D7N A;  4UUS A;  3B7R L;  1W0U A;  2VKH A;  5E3M A;  1KQ9 A;  2OZU A;  2XGX A;  3UNG C;  2Y1G A;  2DCE A;  1XTA A;  1W5C C;  2QF7 A;  1FYK A;  4AID A;  4L2L A;  5EG0 A;  1X1P A;  2L01 A;  2XDV A;  2K9L A;  3V42 A;  4M6X A;  1H19 A;  1R6R A;  2WV0 A;  4XMY A;  3IH2 A;  4BJ6 C;  3W6J B;  4I98 B;  1UAA A;  2BY1 A;  4EJU A;  1DDN A;  1ERD A;  4I01 A;  2RN7 A;  1FTT A;  3CLO A;  2CRG A;  3KIO A;  4L9V A;  1ZGJ A;  4RB2 C;  2XPY A;  2D2W A;  4CDG A;  1KYW A;  5EGO B;  5A2Q Z;  3AL0 C;  1F4K A;  2JD1 A;  2A6E F;  3AU8 A;  5DUI A;  2JA8 J;  2EGH A;  1IV8 A;  4V2F A;  1U5T C;  2FRH A;  3HOX J;  2KRH A;  1R1U A;  2R5Z B;  3QWL A;  1AA7 A;  2DFH A;  3QQA A;  4PW4 A;  3IH4 A;  1HXD A;  3QP5 A;  4DOZ A;  5F1J A;  4XOT A;  3DKY A;  3BR6 A;  1ONN A;  1XX5 A;  2VJ8 A;  1AKH B;  2QQ8 A;  3KYL A;  1XMA A;  3ELK A;  2CU7 A;  2Y1D A;  1T0F A;  2FXA A;  2E35 A;  2RNG A;  3CUO A;  3H1C A;  4OAZ A;  3ZMS A;  3JTG A;  1MD0 A;  3HTS B;  5K5R A;  4LIU A;  2EWN A;  3FU3 A;  2VE9 A;  4PFO A;  3GTP J;  2K9N A;  3P9K A;  1R58 A;  5M5Y J;  4LUP A;  1HDP A;  2IGN A;  3C7J A;  3AFH A;  1DU6 A;  2X4H A;  2WV1 A;  4BHP A;  3LAP A;  3EUA A;  3ABM H;  5IY5 H;  1HA8 A;  1BW6 A;  2EIL H;  2PFB A;  2Y2Z A;  1WZ2 A;  2QBY B;  5FKL A;  4ON0 A;  5J4Y A;  2QLZ A;  4FE4 A;  3J7A Y;  3HSR A;  4RBO A;  2LKX A;  3M7G A;  1KGS A;  4K5P A;  1IRX A;  3KP4 A;  2A05 A;  5HDK A;  4BY7 J;  3LSP A;  1SC5 A;  2XPW A;  1PUF B;  2FD5 A;  1MBG A;  2OAZ A;  1D5Y A;  1FSH A;  2Y1C A;  3W2A A;  1GVD A;  2P0W A;  4M6V A;  3HOW J;  3V7C A;  2ZO4 A;  3GZN B;  2F4I A;  1IC8 A;  5FKO A;  5IT9 Z;  4Y6R A;  2NVY J;  4BS9 A;  2ZBK A;  5F1R A;  2JVH A;  3DBR B;  1DUX C;  1BI1 A;  2BVM A;  3MQ0 A;  3FK7 A;  5JC1 A;  4LLG F;  3CC4 I;  2ADU A;  2Z2S B;  2V1N A;  2E36 A;  5DD4 A;  2R7T A;  2I5U A;  3RKW A;  4YIR X;  1HF0 A;  3OYN A;  4HF2 A;  5DTD A;  4OOI A;  4KJZ A;  3OYK A;  1PYV A;  2ECC A;  2CFX A;  3H3V K;  1F36 A;  2FX0 A;  4RAF A;  2K9S A;  2PMZ N;  2QSF X;  2CWE A;  1FYL A;  4ZX4 A;  3AUA A;  1S46 A;  3GFM A;  3WQR A;  4XN7 A;  1X19 A;  4PFP A;  4D5C A;  4EJV A;  5H2F C;  3J81 K;  2XHK A;  1Z6R A;  2DA3 A;  3A01 B;  2E2I J;  2JPC A;  4LLN A;  1WRJ A;  3RKQ A;  1OCC H;  3FKJ A;  1I6H J;  3CDH A;  1G3W A;  4N0B A;  3GTM J;  1SQM A;  3D5R C;  5H20 A;  3D5L A;  4OOE A;  1U9N A;  3H9G A;  1Z0X A;  2Z99 A;  2EV0 A;  4B3A A;  1T1S A;  5K5O A;  3CDL A;  4JOM A;  2DA1 A;  1MMN A;  4C2M J;  2RRE A;  4X0G A;  3KEO A;  2KQR A;  4QIR A;  4D7M A;  4M3G A;  3EYY A;  5M5X J;  4M3F A;  3WGH A;  3N97 A;  1DQU A;  1FNN A;  3ABK H;  2H1K A;  3P7N A;  2NOG A;  2LSO A;  1N75 A;  3ISP A;  3KP7 A;  3K7A J;  2MLK A;  1UEL B;  1TC3 C;  2PJR A;  4G94 A;  1QGP A;  5ED4 A;  2DT6 A;  2EZH A;  2MC3 A;  5J1U A;  3CJQ B;  3Q43 A;  1TQI A;  3DWL E;  3ZGK A;  1APL C;  3LSG A;  3SEZ A;  2HNH A;  4HQM A;  4EJO A;  4EAT A;  1Y6I A;  3LSR A;  3JRD A;  2VT3 A;  4I7H A;  3ZXS A;  3CHR A;  3HC7 A;  2JZY A;  1IUF A;  1POG A;  5HOO A;  4ENN A;  3OWT A;  1USS A;  2NOJ B;  1T38 A;  1ZK8 A;  3BZK A;  4HNT A;  1EH6 A;  2X0L A;  2JCY A;  1ZGW A;  4XO5 A;  1KYZ A;  1WJA A;  2EIN H;  3CP2 A;  3UER A;  1EKE A;  4LB6 B;  2ZC2 A;  2CW7 A;  2Q2E B;  2XAF A;  5D8L B;  4CUG A;  1VQ8 I;  1BJA A;  3GTG J;  2WB1 A;  4RAZ A;  1G3T A;  3WHB A;  3QOP A;  4A6E A;  4ZH4 F;  4EGY A;  4ZW8 A;  1K7A A;  2CMP A;  2Y9Y A;  5AIP A;  1FOX A;  3EBI A;  3WG9 A;  2HS5 A;  1LPQ A;  3L2W A;  2X1C A;  2X85 A;  3OOP A;  3SEQ A;  3GEZ A;  1U9O A;  1JKO C;  1BC8 C;  3LAJ A;  1U5T A;  2HYJ A;  4XOP A;  4ZDP A;  5FKM A;  5JNL A;  1E2X A;  5LFA A;  2ID6 A;  1UST A;  3RJP A;  2ELJ A;  4NQW A;  1BR1 A;  2LP0 A;  1X2N A;  3J7Y J;  1TQM A;  3MAJ A;  1R00 A;  3OIO A;  2CQK A;  2W1O A;  1JT6 A;  2OA4 A;  2ID3 A;  4IQ4 A;  4UV8 A;  3CCU I;  3PJR A;  2UUZ A;  4J19 A;  4DJA A;  5HNF A;  3K6G A;  3OL3 A;  5DM6 F;  3CUQ C;  4I6Z A;  2EV5 A;  3MCZ A;  5HS8 A;  3BT9 A;  2KMU A;  3L1P A;  2ZJQ F;  2M8G X;  2VQL A;  1UJ8 A;  2VXD A;  2XAU A;  2MYS A;  4RM2 A;  4NC6 A;  3RZO J;  1PUF A;  3KPH A;  1BIA A;  1X4O A;  3R0A A;  5DLL A;  2XUB A;  4A0Y A;  1OYW A;  4A2U A;  1TT5 B;  3LQR A;  1S5L C;  1BOB A;  2JVG A;  2V4J C;  3K10 A;  1TQP A;  2HQN A;  2VC1 A;  3ZMZ A;  5LD2 C;  5FLM J;  1BR2 A;  4P96 A;  3HJE A;  2F48 A;  2M4G A;  1YO5 C;  4NQW B;  5TRD A;  4XNA A;  4GAA A;  1FP1 D;  1MW7 A;  3C2B A;  3TQN A;  3QYB A;  3E5U A;  2XVC A;  2B9S A;  1V54 H;  1U2W A;  4NB5 A;  1ZAO A;  2LLK A;  2E19 A;  1R1T A;  1A36 A;  3NWT A;  2DOD A;  1OCZ H;  1D1C A;  1MW3 A;  3RI4 A;  3CUQ B;  3EUH A;  5HLT A;  5IOY A;  3CUQ A;  3J80 Z;  2IPQ X;  3F72 A;  1KZH A;  3CZK A;  1W7P D;  1MND A;  1ENH A;  1MH4 A;  1R7J A;  2XB5 A;  1H88 C;  2IA2 A;  2LF8 A;  4Q4E A;  1OPC A;  3H3U A;  3ESW B;  2PMH A;  3L2Q A;  4LIT A;  1TT0 A;  5GAH J;  3OYL A;  4A3K J;  4GO1 A;  3GYH X;  2HQR A;  1VFC A;  1X2M A;  1IAW A;  3FX3 A;  5L3F A;  5GPC A;  3C2G A;  3G6E I;  1FIA A;  3PQJ A;  2F5C A;  3GFJ A;  3W6V A;  3MVP A;  1TWF J;  3PM1 A;  4UXN A;  1X1B A;  3MFK A;  3G1M A;  3EUH C;  5C4X J;  4XLC A;  5F27 A;  4L9N A;  1TNT A;  2IS4 A;  2IP2 A;  1ZLJ A;  2L9N A;  1LB2 A;  2ESH A;  2VJJ A;  4MQV A;  5D6F A;  3HIF A;  9ANT A;  4CIC A;  4XSX F;  3F21 A;  2ZJR F;  4A5M A;  4LGW A;  5KAI C;  2VL8 A;  2M2E A;  3U21 A;  3WTZ A;  1AWC A;  1LQ1 A;  5FLV A;  2O5R A;  3OYI A;  2M34 A;  2V1D A;  3GWZ A;  3T1B A;  4GYI A;  1YG2 A;  1Y56 A;  2CUE A;  3BR5 A;  2LKP A;  4BXX J;  1FJL A;  1QVT A;  2J5P A;  4ZW5 A;  1FLI A;  4LMY A;  3RKY A;  1IV6 A;  2UWM A;  1R0L A;  4J3B A;  2L54 A;  2P6T A;  4XK4 A;  5JMP A;  1MMG A;  2XPV A;  3FM3 A;  4LJZ F;  4LIV A;  3ECH A;  3FMS A;  4V19 K;  3CMY A;  4HX7 A;  1U8B A;  2DMP A;  3TBI A;  3RTR A;  3LQQ A;  3HGY A;  3L7W A;  3FXQ A;  3BLY A;  4A3C J;  1ZG3 A;  4CCO A;  4FLR A;  3FZV A;  2H09 A;  3IWF A;  3GME A;  1EH7 A;  3GUD A;  3JAM K;  1Z91 A;  2JPB A;  4EGZ A;  1V4R A;  2LRD A;  1PDN C;  2RJI A;  1YRN A;  1G2H A;  1JGS A;  1D8K A;  3R61 A;  5D5X B;  2ETH A;  2LK2 A;  5HDN A;  1G3S A;  3RPQ A;  3FTZ A;  1EJ9 A;  2MD0 A;  3A06 A;  3M3Y J;  3FTY A;  3Q5F A;  3GVA A;  3JSO A;  2P4W A;  3E7L A;  1OMI A;  5JI6 A;  2DQL A;  5HNH A;  1P4X A;  5EEG A;  1ETQ A;  3HOZ J;  3BDD A;  3IWZ A;  1FZP B;  3CLQ A;  2HPM A;  3AL0 B;  3BR0 A;  1BI0 A;  2XSD C;  2WWY A;  2C82 A;  2O0Y A;  2KIU A;  4H0E A;  3TMO A;  1JUM A;  4CCL A;  1O4X A;  1N78 A;  2R7O A;  4XN2 A;  4KP7 A;  3K4N A;  5HOD A;  4IHV A;  3PO2 J;  4FCY A;  3H92 A;  2JD2 A;  1UHM A;  4HSR A;  3JSZ A;  1EH8 A;  1X3Z A;  4CYC B;  4UV9 A;  3QPH A;  4IHX A;  2EFW A;  2E34 A;  1SG7 A;  4XNB A;  1HW1 A;  1MIJ A;  3QPL A;  4ZN6 A;  1S6L A;  1G4D A;  3WG7 H;  4ENM A;  2C5Z A;  4OOF A;  3HSF A;  2VUM J;  3ZN0 A;  4XO4 A;  2LH9 A;  4HDU A;  4XID A;  3LSI A;  3BPX A;  3MZ8 A;  2VT2 A;  4KT6 A;  1NK3 P;  2FQ3 A;  2DLL A;  2O03 A;  4B3X A;  2NS0 A;  2VKD A;  4C3J J;  4CCN A;  3ABL H;  4PZJ A;  2PL5 A;  2C6Y A;  1XG1 A;  4DNC A;  1I50 J;  1J2X A;  5LGN A;  4F93 B;  5CVI A;  4B1R A;  1MNE A;  2D5V A;  1B4A A;  1KQ0 A;  4RSY A;  3ROU A;  1ONP A;  3KED A;  3VVL A;  5ERI A;  1HSJ A;  1LNW A;  1A5J A;  4KDP A;  3H5A A;  3BG6 A;  1WJ5 A;  4PVB A;  2E1M C;  4M6Y A;  2ZJP F;  4HLX A;  2GLO A;  2CQX A;  1R49 A;  3Q0V A;  1U3E M;  5M5W J;  5JAZ A;  2EFQ A;  3CTA A;  5DCF A;  3CO6 C;  5AON A;  3O8H A;  1JXS A;  4QWQ A;  2RVC A;  4BKX A;  4IHY A;  3HZJ A;  2VN2 A;  3GBG A;  5EG0 B;  3EBG A;  3JCU C;  2JQ7 A;  4N4O B;  2IT0 A;  3S1Q J;  4EJT A;  1KON A;  3CQZ J;  2X6W A;  1IW7 F;  1GLN A;  2FNA A;  3RAS A;  2E1C A;  5E8I A;  2VOP A;  2VKV A;  3CCL I;  1T56 A;  4M73 A;  2UXN A;  2L5Q A;  2YUS A;  1WHU A;  2ZME B;  3FUF A;  2LD5 A;  2DN0 A;  1T0F C;  4A0X A;  4XMT A;  2MG4 A;  1ACI A;  4BBS J;  1HW5 A;  2F5E A;  2CO5 A;  1BJZ A;  2QWW A;  4Q4I A;  4DGW B;  1YJN I;  4IOC F;  2XAJ A;  6PAX A;  1I1G A;  4R1H A;  3HOT A;  1TWA J;  3TW6 A;  2PN6 A;  2DBB A;  5J47 A;  4S05 A;  4Y6P A;  1H89 C;  2M5W A;  1UHS A;  3BTJ A;  4HF0 A;  4UUT A;  4WCG A;  4LD5 A;  1OCR H;  1Z21 A;  1FMW A;  1F1Z A;  3GCM A;  3BJO A;  2Z9O A;  3MEX A;  3GLX A;  4KT5 C;  3C18 A;  2X1D A;  4L5E A;  2MGQ A;  4M9Z A;  2XAG A;  4YG2 F;  4YRV A;  5IP7 J;  1MBE A;  2VPR A;  2ME6 A;  3L9F A;  1XN7 A;  1TP4 A;  2ICW G;  1W5T A;  2EFP A;  3ASN H;  1BL0 A;  1UG0 A;  3MKY B;  2Y69 H;  1ZR2 A;  3JAM Z;  3B02 A;  4ZQT A;  1LEA A;  3K2A A;  2EZI A;  2K40 A;  3IAS 2;  3FU6 A;  5FRM A;  2OD5 A;  1H9T A;  3F8M A;  4IVN A;  5CVU A;  2IW5 A;  4BAY A;  3CF2 A;  3GLL A;  2AS5 F;  1SMT A;  4YFX F;  3C2H A;  2WPG A;  1W5S A;  3FHZ A;  3U1D A;  1FMV A;  1PUE E;  3U9W A;  2V79 A;  2CW0 F;  2GXG A;  4Y17 A;  3L2U A;  3B2X A;  2OV7 A;  5JR3 A;  2MW8 A;  3RYP A;  4YFN F;  2MSY A;  1ON2 A;  1QPI A;  1JUP A;  2AXL A;  3WOD F;  4BDY A;  1MJA A;  3K0L A;  2G7U A;  3OR1 C;  2CUF A;  3ZMD A;  2JUG A;  4A3B J;  3TDU C;  2COM A;  2LTP A;  2ZXH A;  3D5S C;  4RA2 A;  4M9S A;  3K9T A;  4Q5S F;  2BE5 F;  4XMZ A;  1A6I A;  1VTN C;  2HEO A;  2VKE A;  1VQ6 I;  2FBH A;  3LOC A;  1CQT A;  1D5V A;  3DEU A;  2MA3 A;  2VC0 A;  1IDY A;  2OPT A;  4I2O A;  3PUB A;  3DU6 A;  3CCE I;  3VYT B;  4ESB A;  1P92 A;  4UUS B;  1R9T J;  3T8R A;  3JRA A;  1JT0 A;  2CGP A;  2PUS A;  3B7T A;  1ZG1 A;  1BIB A;  2DYS H;  1IZ1 A;  2HXI A;  4M9X A;  4KMU X;  1IN7 A;  3G3Z A;  5J3L A;  4X6A J;  3I0T A;  4CCK A;  3ABT A;  2HVR A;  1FIP A;  2E7W A;  3F23 A;  1W7P A;  3CZE A;  3FXO A;  1OQY A;  3HB9 A;  3ZHY A;  4MNU A;  3RKX A;  3U2R A;  2EH3 A;  3PNV A;  4KFC A;  2OCC H;  3PNY A;  4O6J A;  1TW2 A;  3S14 J;  2XRL A;  5DUK A;  1J59 A;  1DPR A;  2VPL A;  1IF1 A;  4RCV A;  4MLO A;  1ZLK A;  4C9Y A;  4F92 B;  5DYF A;  1R36 A;  1LJ9 A;  5GPA A;  3S3O A;  2JTV A;  4XKV A;  3BG3 A;  3CD6 I;  2R7R A;  1T1R A;  2XPZ A;  3I9V 2;  3IP4 B;  5CVR A;  1BA5 A;  3REO A;  4Q47 A;  3CC2 I;  5IOZ A;  2Q2E A;  1MMS A;  2DTZ A;  3J7A O;  2NAZ A;  5FD6 A;  4C30 A;  1UCR A;  4QME A;  4CCM A;  3T8T A;  4RM3 A;  3SZG A;  5JMW A;  1V5E A;  1B72 B;  1P9Q C;  2VQG A;  5EDN A;  5JLX A;  4PGH A;  5B1B H;  2A68 F;  2Y0M A;  4AVP A;  2EA2 A;  1FC3 A;  3CJN A;  2F4O B;  1RES A;  2VB6 A;  1D1A A;  2LY2 A;  4QPO A;  2KIF A;  5FRO A;  4QTR A;  3HW2 A;  4XN0 A;  4MTD A;  4GCV A;  2UXX A;  2WAQ N;  3H35 A;  2L02 A;  3BC8 A;  4OMZ A;  4JK1 X;  1AKH A;  1VQ4 I;  1I3A A;  2DQ6 A;  1Z3X A;  4E6K G;  4AD9 A;  3PFY A;  2HVS A;  2IS2 A;  3BR3 A;  5GTI C;  1WH5 A;  1IXC A;  5IP6 A;  4MO7 A;  2B0L A;  5CYV A;  1DPU A;  5DDG A;  2RV8 A;  4ANJ A;  3DTI A;  1IRZ A;  1BW5 A;  3HOU J;  4UUV A;  1Z7U A;  5B1A H;  2R72 A;  4HOB A;  3KEQ A;  1IJW C;  2JCV A;  2LYC A;  1SEU A;  4MIM A;  4AVZ A;  4R5X A;  3WQQ A;  1SVL A;  4ITV A;  2KFD A;  2LF7 A;  1VF9 A;  3E6C C;  2BBY A;  3J80 K;  4PK4 A;  5KK1 A;  3BR1 A;  2X6O A;  1S8N A;  3OMY A;  4D0P A;  1PVE A;  1TZL A;  4I0B A;  3TOB A;  2Y1E A;  4XND A;  3E3V A;  4ENK A;  5DUL A;  5EGO A;  3FIW A;  2V9V A;  4MGR A;  5KVR A;  1T8I A;  2YU9 J;  4CGZ A;  2O9L A;  5LLQ A;  4C2T A;  3I53 A;  4OU0 A;  2IGM A;  3OOU A;  4BDZ A;  2DDA A;  2DW4 A;  2W24 A;  2D1H A;  2Z3Y A;  2BY0 A;  4WK8 F;  5EEA A;  2WBM A;  4ASN A;  3V8K A;  4KN4 X;  2WAD A;  1E3H A;  4KIC A;  2WTE A;  3JRB A;  3K2Z A;  1G6N A;  4RGS A;  5DM7 F;  2R5Y B;  4FCA A;  3KFW X;  2W48 A;  2KLO A;  2NVQ J;  3CJR B;  4MFD A;  4BJT A;  1HKT A;  1LDK B;  2QQA A;  4G6Q A;  1DP3 A;  1V5F A;  4IRH A;  4I99 C;  3I64 A;  4UNO A;  3TO6 A;  4ZX6 A;  4HST A;  3HUG B;  3GF2 A;  2OQG A;  3BCB A;  3D1N I;  4Y6S A;  3SDB A;  1Z7L A;  3RC8 A;  3WTS C;  1WJF A;  3VB2 A;  3HEF A;  3GTL J;  4FIS A;  5B5E C;  2EB7 A;  2DK8 A;  3BQZ A;  4DIQ A;  3HTU A;  1FBU A;  3GXO A;  3S2W A;  5LEJ A;  3OYA A;  5F64 A;  2JD0 A;  1WCM J;  2H8R A;  3T8V A;  5FJ8 J;  3ZQL A;  4KIS A;  4L0Z B;  4A12 A;  3AG2 H;  3M8F A;  4FE7 A;  4HG2 A;  5IYB J;  4ENJ A;  2GA1 A;  2R5Y A;  3S2D J;  3FU0 A;  1RPW A;  4PDK A;  1Y39 A;  5IYC J;  3F3X A;  4CHU A;  4ZX5 A;  1XSV A;  4CO8 A;  2R7Q A;  4E7S A;  1P7J A;  1SAU A;  3HXL A;  1MKM A;  4IQJ A;  2HGC A;  5CVV A;  1Z1D A;  1XMX A;  2DA2 A;  1G3Y A;  2G9W A;  2LY1 A;  5K1Y A;  4D1Q A;  1REP C;  2H27 A;  3AAF A;  2M7B A;  2EIJ H;  2PX9 A;  4C3H J;  1RR8 C;  1HS6 A;  4XN5 A;  2OU2 A;  3CZ6 A;  5EZH A;  5GAD J;  1Y8R B;  1V55 H;  2XF6 A;  3I4M J;  2HPT A;  5BPI A;  1SD6 A;  1OFC X;  3DV8 A;  3WE3 A;  4Z2Y A;  4F7Z A;  4E7J A;  1FBQ A;  3CJT B;  3DQV C;  4EMS A;  4U87 A;  3K70 C;  2DQM A;  2R7V A;  5J8C A;  2EZL A;  2R7U A;  2VBZ A;  4FX4 A;  2M9H A;  4P5O A;  2PLY A;  1S7A A;  3OYD A;  4IJA A;  4P9U A;  2QZ8 A;  4A3G J;  2O6G E;  2ZME C;  4ETS A;  2BGC A;  3DEW A;  5EF6 A;  4OIO F;  4AR9 A;  2IBD A;  2LKS A;  3IUO A;  3B6A A;  5CLS A;  1IGN A;  1WJB A;  1XGO A;  2JUC A;  1T95 A;  3V7S A;  4BUP A;  2XIG A;  1F43 A;  3VDX A;  3E1S A;  2GXB A;  3M1C A;  3BP8 A;  2X1E A;  3R0I A;  1Y0N A;  2FNP A;  1YW7 A;  1ZQ3 P;  3OS2 A;  2L3D A;  2PI0 A;  2L2O A;  2CG4 A;  3ZRG A;  2Z16 A;  3FUH A;  1X3Z B;  2KHM A;  2A69 F;  2XGD A;  2FML A;  4S0H B;  2Y48 A;  4Q4Z F;  4Q48 A;  3EUK L;  4E7Z A;  4ARF A;  2FUG 2;  2Y30 A;  4G6T B;  2WC2 A;  2ZSI B;  2E1M B;  1ZRD A;  5TIS C;  3BRO A;  1FYM A;  3DLA A;  1B8I A;  3TDZ C;  3D0S A;  4NUB A;  3L2R A;  4HDV A;  3WTY C;  1E3O C;  2W00 A;  2XF7 A;  2ISZ A;  5EV7 A;  3HHH A;  2QKM B;  2TRT A;  1LFU P;  2HKX A;  4ESF A;  2HYG D;  1NHA A;  3DF8 A;  2V9P A;  2STW A;  1P6R A;  2DOA A;  2M30 A;  3GZ5 A;  1FPQ A;  3VFZ A;  2IAI A;  3BJA A;  4L5I A;  4R79 A;  3OYJ A;  4YII A;  2FF4 A;  5K7H A;  1ZRF A;  2E71 A;  2E60 A;  5E3L A;  2L9R A;  4AIH A;  3JRF A;  4IPA A;  2DJI A;  5CKT A;  2ECB A;  4Y7N J;  4GAE A;  4FLQ A;  3GZ6 A;  2DPU A;  3FK6 A;  2QQ9 A;  3CF5 F;  3FUN A;  1WVR A;  2FBI A;  2AHQ A;  3GO5 A;  1Y8Q B;  2FA5 A;  4E4H A;  2CUZ A;  4X1E A;  2W7N A;  4MS6 A;  4JX4 A;  1MGT A;  1T33 A;  3WU1 B;  3ULQ B;  5FKN A;  4FX0 A;  4NHJ A;  1O3Q A;  1U6G A;  5FFX A;  2E5Z A;  1ZGA A;  3AU9 A;  3B3B A;  1ETV A;  1QU3 A;  4BQA A;  3FTX A;  3W2W A;  4XRS G;  1F9N A;  2QA4 I;  2V1U A;  1ETK A;  1R1V A;  2VBX A;  3SZP A;  5HVQ C;  1BI2 A;  3I58 A;  3NRV A;  4LK0 F;  4FHT A;  4E70 A;  2A61 A;  4B8X A;  1SVM A;  1K78 A;  5AEN A;  2L9V A;  4M3E A;  1FOK A;  4EM2 A;  3RPU D;  1VQK I;  3CCM I;  2L7K A;  2BXY A;  4V2G A;  4N9I A;  2TCT A;  5E3N A;  2DMT A;  1W36 D;  4I76 A;  3RYR A;  4AIJ A;  5LRR A;  2OC6 A;  4L9T A;  4UY8 I;  1DU0 A;  5B66 C;  4LB5 A;  1LVK A;  3AG1 H;  4QUO A;  5GP9 A;  1K4T A;  4WWC A;  2CQ7 A;  4A3I J;  2VAS A;  2V26 A;  3HSE A;  2DI3 A;  3HRU A;  2XQ0 A;  2PJR B;  2DOE A;  3FWE A;  3P9I A;  1VQO I;  5FB2 A;  2K86 A;  1R0K A;  1VQN I;  2XF5 A;  1O3R A;  3KCC A;  4QIW N;  3M9A A;  2VON A;  1HCR A;  1STZ A;  1RKT A;  2WY7 Q;  4HW0 A;  3ZR8 X;  4KIG A;  1JHH A;  3RC3 A;  5LGT A;  2P8T A;  3K4K A;  5FO5 A;  3ANL A;  2LG4 A;  4WXD A;  2DFE A;  2L4A A;  2DPD A;  2CV2 A;  1SFK A;  2JSP A;  2OQR A;  1S7E A;  4BJ5 C;  4HRI A;  1A6Q A;  1YQA A;  5L3B A;  1RRJ A;  2DFF A;  2A7O A;  1U8R A;  2KIQ A;  3M8E A;  4AC0 A;  4CYD A;  3S1R J;  2STT A;  1UG2 A;  3UR3 C;  2VOD A;  4AIK A;  1VQM I;  1VQ5 I;  2PBI A;  1Q0H A;  3LFK A;  1KU9 A;  3S2H J;  2H6B A;  5BMZ A;  3HYI A;  4JYK A;  4KA4 A;  2QGU A;  3AKZ A;  2E2H J;  3V4G A;  3IH3 A;  2QVW A;  4IX7 A;  4BU2 A;  2MBF A;  2HR3 A;  4XKW A;  3BTC A;  2NS8 A;  3GW2 A;  1Q1H A;  5ICF A;  2QEN A;  3FUE A;  3Q44 A;  2JV7 A;  4H4K C;  2ZFU A;  4FAS D;  4XRS A;  3OS0 A;  2MH9 A;  1SFU A;  2WZF A;  2E7X A;  4I0A A;  3X2Q H;  2W82 A;  1A35 A;  1OR7 A;  3EQL F;  2K27 A;  3G1O A;  5DCM A;  2JA5 J;  3NQO A;  2WAQ A;  3FU5 A;  3A0B C;  1OCO H;  2HZD A;  3HOS A;  4K5L A;  3BPV A;  1FOY A;  1ZHF A;  4HA8 A;  5LHG A;  3Q0W A;  2P81 A;  1CF7 B;  2HDD A;  5F6F A;  5K5Q A;  2X9D A;  3PIO F;  1W0T A;  4BQQ A;  5DV5 A;  1O7F A;  2YR2 A;  1TWC J;  3BCA A;  3ZI0 A;  3ZOB A;  2A5W A;  3HBL A;  2PMZ A;  5DCM B;  3HOY J;  4MHG A;  3TL4 X;  3QPT A;  4BE2 A;  5FD5 A;  4Z6Y A;  1ZRE A;  1E0E A;  5LBQ A;  2R7X A;  1KA8 A;  4XLH A;  1IXS B;  5CPR B;  4XMU A;  1OIS A;  3TP3 A;  3JSP A;  4XMX A;  2Z1D A;  5FLX Z;  1OLT A;  2EA4 A;  2ELH A;  1RZ4 A;  1XMK A;  1NH3 A;  1YLF A;  1ZKG A;  3FIS A;  5AIQ A;  3F0C A;  3JRE A;  4RGR A;  1JJ8 C;  2FJ1 A;  1O7L A;  4R5V A;  4BXF A;  3MWM A;  1TBX A;  3I4N J;  1XC5 A;  1LFP A;  1W7P B;  3HGG A;  4U0Y A;  5M3M J;  3OYH A;  3HPG A;  2QQB A;  2DA4 A;  4XMV A;  3NWS A;  1XGN A;  3JTH A;  2B61 A;  2G7H A;  2P7V B;  1BBY A;  1T6S A;  2M0M A;  4QSH A;  3WE2 A;  5CJ9 A;  3L2C A;  1PP7 U;  1ETY A;  1H8A C;  3DPT A;  2ZXW H;  1WQ2 A;  3KP3 A;  4ZC3 A;  3IRQ A;  4DYQ A;  5DYM A;  1HLV A;  4NDL A;  3KP6 A;  5CQE A;  3FM5 A;  4JP0 A;  3LWF A;  1Y1W J;  3DBL B;  3FDY A;  1FP2 A;  2AQE A;  2DA6 A;  5E17 F;  1S7O A;  4IO9 F;  2HQ5 A;  2LR8 A;  1Q0L A;  1WSU A;  2XKP A;  2KDO A;  3B73 A;  1MBH A;  4G8X A;  4BAC A;  3I5U A;  1H0M A;  3EET A;  1X3U A;  4E7H A;  1B59 A;  1MJ9 A;  3K4L A;  5F0C A;  1ETW A;  1ZR4 A;  3PUU A;  4UB6 C;  1SFE A;  2OF7 A;  2YPR A;  2L9S A;  3DEE A;  3A14 A;  3C1D A;  4QPE A;  4RB0 A;  2XGE A;  2K9M A;  4RDU A;  3TW7 A;  5KNL A;  1FX7 A;  4P9F A;  1MSE C;  2R92 J;  3ZMU A;  3PQK A;  3OYF A;  4BEH A;  5JLW A;  3I3L A;  1LUJ B;  4ZYH A;  4HQE A;  1JE8 A;  2O7G A;  3CO7 C;  2R70 A;  3HRS A;  4II2 A;  1HKS A;  1YS6 A;  1MW2 A;  4K2E A;  5FLX K;  2CJJ A;  4W1U A;  2BW3 A;  3H5N A;  5EJC A;  2COB A;  3CDI A;  3IAM 2;  1J9I A;  3B37 A;  2M1B A;  5E79 C;  1QHG A;  3BZC A;  4PU2 A;  1I3Q J;  4M3D A;  4MFE A;  2O7O A;  1TLH B;  3FBN B;  1Z05 A;  1YIT I;  2VI6 A;  2F2E A;  2FSW A;  3GX4 X;  3FXL A;  2KJC A;  3B34 A;  3ZQC A;  2YS9 A;  3A02 A;  1YJW I;  5CVJ A;  2MFZ A;  1KU3 A;  2DJN A;  1ON1 A;  2VE8 A;  3K4M A;  1KU7 A;  4DW6 A;  2HOT A;  5JVT A;  3FBI B;  2DO7 A;  2O3F A;  5L3G A;  1MJB A;  1NG7 A;  3R60 A;  2D45 A;  1B8I B;  2V6C A;  2DDB A;  1J0R A;  2K02 A;  3VOD A;  3ZCO A;  2VLA A;  1D0Y A;  2CW8 A;  4YEJ A;  5TJJ A;  4U0W A;  4ZJZ A;  2K9Q A;  4ZYE A;  5ILU A;  1E17 A;  2MAP A;  3KLN A;  2L7Z A;  2X6Y A;  3FMQ A;  2V6E A;  4IF4 A;  5LRS A;  4A93 J;  4RAG A;  4UVA A;  3P5J A;  2K4J A;  4KIT B;  4K5M A;  1Z67 A;  4G6D A;  4ZX3 A;  2IRF G;  1AHD P;  3VSL A;  2LY9 A;  1SD7 A;  3VSK A;  2DA7 A;  1T2K A;  1LE8 B;  1JHF A;  1T39 A;  2B63 J;  4ZTJ A;  4HNV A;  1O3T A;  4LG0 B;  4IHS A;  2IS1 A;  2VJI A;  3Q9S A;  3FUD A;  3MZY A;  1KU2 A;  3F6O A;  2K85 A;  2CQN A;  1RUO A;  3LA7 A;  4TV7 A;  4NC8 A;  1DGW Y;  2RNJ A;  5L3C A;  1IRF A;  5D5U B;  2DA5 A;  2GQQ A;  2F5V A;  3DP7 A;  1MH3 A;  1SVO A;  1ZEL A;  4FT8 A;  4A0Z A;  4RLF A;  3EPZ A;  2ZXJ A;  2HDC A;  2AQF A;  4ZQF A;  1X4P A;  3OIQ A;  3E6D A;  2IXS A;  2JMW A;  5LEK A;  3S1M J;  1R5I D;  2EZK A;  4B4C A;  5HLH A;  4XRM A;  3CIA A;  2MLG A;  3EYI A;  3KYC B;  4A03 A;  3CHP A;  2JA2 A;  5ICC A;  3BR2 A;  4GFB A;  3VEP A;  3WGG A;  3UCQ A;  5C3E J;  4DBR A;  3K69 A;  3ZP5 A;  1GV2 A;  2EIK H;  2XPU A;  3A01 A;  3ZQ7 A;  1MDM A;  1R71 A;  1K5H A;  1T98 A;  2DQR A;  3NEU A;  4G9Y A;  3KZY A;  4QLC U;  3S3M A;  1R22 A;  5LHH A;  1UFM A;  5E3O A;  5DS9 A;  2OUM A;  3S1N J;  1WKM A;  2HOE A;  3PSF A;  3OYG A;  3E97 A;  2KDZ A;  4MEY F;  2W57 A;  3OV8 A;  3A03 A;  3EDP A;  3KX2 A;  2BV6 A;  3SJM A;  4EEF G;  1SAN A;  4RB3 C;  4CA0 A;  2Y75 A;  2IS6 A;  1NTC A;  4MTE A;  3CES A;  1MNM C;  5C44 J;  4KIB A;  2K4B A;  1W4M A;  5EYR A;  3F6V A;  5D4R A;  3R0J A;  3MZH A;  4HV5 A;  1XGS A;  2NRA C;  3I71 A;  4GDF A;  3G2B A;  2BW3 B;  3DKX A;  1T08 B;  4L5J A;  3SDG A;  4AU7 A;  1JVS A;  3ZPL A;  1I5Z A;  3VYR B;  3RPU A;  4PJN A;  3FUM A;  3MKZ A;  2GTQ A;  3S3N A;  4ZZL A;  1ZN2 A;  4XOR A;  2ACJ A;  3Q3S A;  2DOF A;  5KCM A;  2RGV A;  2G0E A;  3WGI A;  3HOV J;  4EVI A;  2BHY A;  3DPL C;  1QBJ A;  3PFI A;  2OJE D;  1E3P A;  2YX7 A;  2R59 A;  4OAY A;  2CUJ A;  4A3D J;  3F8N A;  5J1Y A;  1YTY A;  3LST A;  4QPQ A;  3WHC A;  1GXP A;  3ZHX A;  1ZH5 A;  3SXY A;  5ICG A;  1QHH D;  5HS9 A;  2EBI A;  2W84 A;  4LG0 A;  3ANN A;  3VYU B;  1SC7 A;  1HST A;  2GM4 A;  3P9C A;  2KIS A;  5HS7 A;  4PJJ A;  4QHP A;  3CP8 A;  3ZMV A;  3VOE A;  2A07 F;  4CZC A;  2ZNY A;  3V8J A;  1QZZ A;  1W1W E;  2BZT A;  4HPQ A;  1GW6 A;  5BOX A;  5FFZ A;  2FE3 A;  4XON A;  2M3A A;  4K5O A;  1TNS A;  1ODD A;  1WH7 A;  1X1C A;  3RIR A;  3SHF A;  1XGM A;  3K4C A;  1F5T A;  4A3L J;  3KYD B;  4G12 A;  1U78 A;  1D0Z A;  3HHG A;  1ZTR A;  2IA1 A;  2FMY A;  1RC9 A;  4CYC A;  5BQT A;  5HLI A;  2JCX A;  4F52 A;  2DTR A;  3S93 A;  4J00 A;  3RSN A;  2P5K A;  4II3 A;  2JRM A;  3GTK J;  2ZXG A;  3B7U X;  4PJM A;  4FTH A;  3FUJ A;  1WWX A;  2EQR A;  4KN7 X;  3WTW C;  3HKZ N;  1B9N A;  3CCY A;  4KUM A;  2LC2 A;  2RQQ A;  2K3F A;  3PSI A;  4AYB A;  1Y1V J;  3B7S A;  2KRF A;  4U7D A;  3FH7 A;  4XLN F;  3FHN A;  3KP2 A;  3DTE A;  5JFR A;  2NVT J;  1LE8 A;  3BY6 A;  3HUG A;  4RVB A;  3MKL A;  4A3M J;  1YRN B;  3FXM A;  3HDD A;  4IRI A;  1Z77 A;  2PG4 A;  3U1K A;  3JRI A;  1OCT C;  2DXI A;  2RKH A;  2NVU B;  1HC8 A;  3BG7 A;  4Y52 J;  1LDD A;  5F0H A;  1RIO H;  2Y0S A;  1LFB A;  1O57 A;  5F0F A;  4XLP F;  1D1B A;  3ASO H;  3FTU A;  2OTJ I;  1MDM B;  3WTX C;  3JW4 A;  2KRC A;  3DTK A;  4OIR F;  4R8H A;  5J40 A;  3S17 J;  1P2F A;  4HAM A;  4BQO A;  4NNJ A;  1QZY A;  3OYM A;  3HKZ A;  4RGX A;  3NAU A;  1YHQ I;  3PNT A;  5IT9 K;  2KZG A;  1YX3 A;  3LSJ A;  2IVM A;  1XB4 A;  3CCV I;  3QOE A;  5F08 A;  4IOA F;  2EV6 A;  1R23 A;  4N4N B;  2HVQ A;  1XDS A;  1JI8 A;  3MMY B;  3K4B A;  3WU0 A;  5J1R A;  1U0J A;  5LHI A;  3UEQ A;  5FRN A;  3I54 A;  3QJX A;  2JA6 J;  5E20 A;  3HPH A;  2XRO A;  3IKT A;  2X48 A;  5D6E A;  3Q9V A;  1ZS2 A;  1MMD A;  3ERE D;  1OR7 C;  1FEX A;  2JK3 A;  1JGG A;  3G4S I;  1GT0 C;  1IN8 A;  5E1Z B;  2W85 A;  4NBQ A;  1ZG5 A;  2V7F A;  4ZW7 A;  4Y4R A;  1NG6 A;  1UB9 A;  3FTV A;  4LOC A;  1D8J A;  3CMA I;  4MKT A;  2DAO A;  3DU5 A;  3N05 A;  4A5N A;  1IO2 A;  2OZ6 A;  1K6Y A;  1ETO A;  3K1P A;  4B47 A;  3JRH A;  1X1D A;  4HBL A;  3H9Q A;  3OYE A;  4A69 C;  4B43 A;  3I55 I;  4CXF A;  3SZT A;  3KLO A;  2LFB A;  5D5W B;  2HXO A;  4HNU A;  4IHT A;  2B7E A;  1NK2 P;  1FWZ A;  3CCJ I;  5D5V B;  1RP3 A;  1VZ0 A;  3CCR I;  4AM3 A;  3IRR A;  3V7R A;  4ESJ A;  4IRG A;  2WAF A;  1FY7 A;  1QQI A;  2H6C A;  2IEK A;  2NXN B;  2O61 A;  1YIO A;  1J09 A;  3FTS A;  2Y31 A;  2P5L C;  3A1Y A;  3HRT A;  3A4C A;  1JTY A;  2ZNZ A;  2NVX J;  4AYB N;  3BTI A;  2ISY A;  3ZQI A;  5GTH C;  4PUS A;  2KT0 A;  2PEX A;  2X51 A;  2NNN A;  3IL2 A;  2VXZ A;  1OJL A;  4XLE A;  3SFZ A;  1A31 A;  2I8D A;  1D3Y A;  3WU2 C;  2W4S A;  1K6O A;  1HKQ A;  1BR4 A;  2K3P A;  3A0H C;  2OTL I;  1WI9 A;  3RCO A;  4DYR A;  4BE0 A;  4RLQ A;  5BPP A;  4N9H A;  3CHQ A;  1HDD C;  3DPU A;  4U88 A;  4YEL A;  1HQC A;  3B2P A;  1G8X A;  2MH2 A;  3W6K B;  1WJE A;  2QSG X;  1R5H A;  2XAS A;  1YYV A;  4XSZ F;  4UVC A;  2HTS A;  1HOM A;  4B48 A;  2F5D A;  3M8J A;  4JX6 A;  3GTQ J;  3A2K A;  4HYE A;  4OIN F;  3GFI A;  4JX5 A;  1YW8 A;  3T0Y A;  3OSG A;  2R7F A;  2FEZ A;  1AU7 A;  3IIE A;  3FH8 A;  4GGG A;  4ZDO A;  2HYF A;  3F9K A;  4A3E J;  4L18 B;  3QPS A;  3IKV A;  4HX8 A;  3OSF A;  1MZB A;  2RC4 A;  3HRM A;  4OMY A;  1GUU A;  3QRF F;  1SFX A;  2Q8K A;  1TL8 A;  3GTO J;  1TW3 A;  2GOX B;  4CSW A;  1UHW A;  2BY2 A;  2JWT A;  1VND A;  4DZJ A;  2O8X A;  2QM3 A;  2YSR A;  3BWG A;  1XDU A;  5B3S H;  2I10 A;  1EA3 A;  4WX9 A;  2ME0 A;  3FHE A;  5ILS A;  2M0C A;  4A3J J;  3RZD J;  3G73 A;  2E1O A;  1P7I A;  1R5G A;  1X3W A;  4DZP A;  1WPK A;  1OCP A;  1J5Y A;  1K83 J;  2R93 J;  1WFX A;  3CCQ I;  3LA3 A;  1OYY A;  2ZXI A;  3KZI C;  4UVB A;  2LVS A;  1SAX A;  1VQ9 I;  3LA2 A;  4FQG A;  2E2J J;  4E7L A;  3ZQH A;  2R7D A;  3KZZ A;  2VIX A;  1SFO J;  2Y9Z A;  1TWG J;  2CH0 A;  2HOA A;  1G59 A;  2PJP A;  3CZL A;  2XSJ C;  2OBP A;  2W25 A;  3BJ6 A;  3BOQ A;  3IV5 A;  1R4M B;  2A6H F;  2WA0 A;  1ZYR F;  1YI2 I;  4CH7 A;  3FTW A;  3PL8 A;  3RQ4 A;  1KQ8 A;  2A5Y B;  3K4J A;  2Q1Z B;  4R7L A;  3L09 A;  4M71 A;  5JVG F;  3ECO A;  1ULY A;  3WQS B;  2NNY A;  3BTL A;  2F4M B;  4HX4 A;  1LDJ A;  1Z9C A;  4I09 A;  2EIM H;  4ZW6 A;  5E8G A;  2JRT A;  5BNG A;  4NC7 A;  2ELK A;  2NYX A;  1YIJ I;  1CGP A;  3DKW A;  1RI7 A;  2Z5U A;  2M87 A;  4EM1 A;  4WF2 A;  4F3Q A;  3LNQ A;  3JT1 A;  4KMF A;  4HV6 A;  2H94 A;  3QOD A;  5E1W A;  2DT7 B;  4KIF A;  3KP5 A;  4WXC A;  1IG7 A;  4I02 A;  4M3B A;  2GAU A;  1FTZ A;  2XRN A;  4EV0 A;  4XLA A;  2UZK A;  2QJ1 A;  2WY8 Q;  2VOO A;  5K7Z A;  5H6Q A;  1J7K A;  2PQ8 A;  4OIP F;  3K1M A;  2DMN A;  2ZKZ A;  5D4S A;  4U7B A;  4F91 B;  1K79 A;  4OWR B;  3FXJ A;  5BPD A;  4XN8 A;  3ZQG A;  2FOW A;  2A6T A;  1IN6 A;  1S3J A;  1I1S A;  1PJR A;  4ZQE A;  4RGU A;  2BEO A;  5IP9 J;  1SMY F;  4MQ9 F;  2LNB A;  3R4K A;  2HDW A;  5FKK A;  3H3Z A;  4JQF A;  3OYB A;  2ZSH B;  2MAO A;  3TKY A;  2JT1 A;  2ZFW A;  3ERM A;  2M8E A;  4PSX A;  1B1B A;  4KNY A;  5J8F A;  3CMM A;  3OR2 C;  4FLS A;  4LLL A;  1JGI A;  2JN6 A;  4X2U A;  4ZYD A;  4IKF A;  2VBW A;  2V9K A;  5J6X A;  2IGO A;  3E5Q A;  2BOL A;  4LG3 A;  4XBF A;  3CHS A;  4BE1 A;  3C3W A;  4E7I A;  3TO9 A;  4LFU A;  4PJL A;  2DYR H;  2QVO A;  5DEQ A;  4IXA A;  2R7Z J;  2H8W A;  4XLF A;  3BZ6 A;  4XRF A;  5JBI A;  3E6B A;  3CC7 I;  2HU9 A;  2HKO A;  2MC4 A;  2D1V A;  2KL4 A;  4KYW A;  4XNF A;  2JA7 J;  4EQQ A;  3WTU C;  1YOV B;  1RNL A;  1ORK A;  2WZG A;  2ZCW A;  3KEY A;  4AWX B;  3KET A;  2R4G A;  5D8K B;  3HM5 A;  3SYT A;  3V8L A;  1OYI A;  1O3S A;  1BOA A;  5L3D A;  4BXU A;  1RET A;  2CQQ A;  4DPR A;  2PGG A;  3H5R A;  1ITY A;  1JKP C;  4D5F A;  2XKO A;  1H9G A;  3QU3 A;  3VWB A;  2FBK A;  4S04 A;  4GYG A;  2QBY A;  1Q0Q A;  1RUN A;  4C3I J;  1M1E B;  3RDI A;  2XGC A;  2DMQ A;  2VQH A;  2EPF A;  2LBF A;  1JJ6 C;  2XV4 S;  2Y1F A;  4BH9 A;  4AUX A;  3H0G J;  1UMQ A;  3K70 D;  2DU9 A;  3HG9 A;  4ZQH A;  4JBA A;  3TED A;  4PSW A;  3FMR A;  1MBF A;  1B6A A;  3BG5 A;  3E5X A;  1PP8 F;  1K78 B;  3F8B A;  2QEX I;  4DQ2 A;  1VQP I;  1P4W A;  1WGX A;  1UZC A;  2KP6 A;  1V5G A;  3M07 A;  4F55 A;  4PGG A;  4LK1 F;  4ZW3 A;  4GRI A;  4BQN A;  2RDP A;  3TO7 A;  3WTT C;  3M4O J;  1JG9 A;  2FQ4 A;  3WTV C;  1LKX A;  2HI3 A;  1XCB A;  2EJR A;  4XIC A;  1VI0 A;  1XD7 A;  2KZV A;  4OIQ F;  2L7F P;  2LMD A;  4XQF A;  2YX4 A;  2FOK A;  2VBY A;  3S32 A;  3LSH A;  2UV1 A;  3AG3 H;  1RR7 A;  1SD5 A;  4UHT A;  4XL9 A;  4Y33 A;  1MSF C;  1HBX G;  1IRG A;  3FUI A;  5IYD J;  3DXJ F;  2R3S A;  3BQY A;  4CZZ A;  3G71 I;  3I59 A;  4C2U A;  2KJB A;  5TGT A;  3W2V A;  5GAG J;  2EK5 A;  4RAY A;  1XSD A;  2YU3 A;  4AIC A;  1MW1 A;  3EBH A;  4Y3O A;  1YJ9 I;  2AXT C;  3O8G A;  4Y15 A;  1YX5 A;  1GV5 A;  3QU6 A;  2ZB9 A;  4HEA 2;  2BVL A;  1QRY A;  3ML6 A;  4ZTF A;  3LL7 A;  2PMU A;  3ZQQ A;  2Y0S N;  2HWV A;  5E18 F;  1JUS A;  3UKG A;  4ABZ A;  2QKL B;  1S9H A;  3B6C A;  4U0V A;  4A6D A;  4DYC A;  4MEX F;  1DGR M;  2IJL A;  2M4K A;  4AYS A;  4M74 A;  1U5T B;  2IA0 A;  2BY3 A;  2LRE A;  1YFH A;  1FSE A;  1HW2 A;  1L3L A;  4XMW A;  4A3F J;  3AG4 H;  1GXQ A;  1N77 A;  4L0Y B; 
#chains in the Genus database with same CATH homology
 4XKB A;  4XOR A;  3S8P A;  4BGD A;  4ZX5 A;  5KCM A;  1BOB A;  2JVG A;  2V4J C;  3K10 A;  3LFU A;  2R7Q A;  4E7S A;  5LD2 C;  4XO3 A;  1BR2 A;  1SAU A;  3HXL A;  4IQJ A;  3DPL C;  1T1S A;  2M4G A;  2LY1 A;  4NQW B;  1MW0 A;  4XNA A;  4D1Q A;  4GAA A;  2X6X A;  1MW7 A;  2M7B A;  1HS6 A;  2R59 A;  4OAY A;  4XN5 A;  2CUJ A;  3CZ6 A;  3QYB A;  2HPT A;  2XF6 A;  1MVY A;  4QPQ A;  3ZHX A;  1QHH D;  3NWT A;  1D1C A;  4E7J A;  1MW3 A;  3ANN A;  3VYU B;  5HLT A;  3DQV C;  4U87 A;  3K70 C;  2DQM A;  2R7V A;  4PJJ A;  3CZK A;  4XN4 A;  2R7U A;  1MND A;  4QHP A;  3CP8 A;  3LSK A;  4CZC A;  4P5O A;  4Q4E A;  3OYD A;  1D0X A;  4RMN A;  2M7A A;  4HPQ A;  3L2Q A;  4LIT A;  1TT0 A;  1GW6 A;  4AR9 A;  3OYL A;  3IUO A;  4J01 A;  2VJ4 A;  4XON A;  2M3A A;  1WJB A;  4K5O A;  1T95 A;  4BUP A;  1X1C A;  1W36 C;  3K4C A;  3C2G A;  2K5C A;  3VDX A;  3E1S A;  3M1C A;  1D0Z A;  4R5T A;  2X1E A;  3R0I A;  1X1B A;  2HPO A;  3OS2 A;  1N77 A;  3EUH C;  2L2O A;  2JCX A;  3ZRG A;  2Z16 A;  4XLC A;  2XC7 A;  3FUH A;  2KHM A;  2IS4 A;  4F52 A;  3S93 A;  2L9N A;  2HPI A;  4J00 A;  2VJJ A;  3RSN A;  4ZDL A;  2LBF B;  3OIP A;  3EUK L;  4II3 A;  4E7Z A;  2FUG 2;  2ZXG A;  4PJM A;  3B7U X;  4ARF A;  5JO0 A;  4G6T B;  3FUJ A;  2ZSI B;  2E1M B;  1G5A A;  3VVM A;  3DLA A;  2VL8 A;  3MD2 A;  2IGK A;  3U21 A;  2LC2 A;  4AR8 A;  4NUB A;  2RQQ A;  3L2R A;  3PSI A;  2O5R A;  4AYB A;  3B7S A;  3FH7 A;  3OYI A;  2W00 A;  2XF7 A;  2VJ5 A;  3FHN A;  3DTE A;  3OY9 A;  5JHF A;  4XKC A;  2CV1 A;  1Y56 A;  5EV7 A;  4XN1 A;  3ANM A;  4RVB A;  2QKM B;  4Y67 A;  3QYF A;  4ZW5 A;  2UWM A;  1R0L A;  2MAB A;  4J3B A;  3E0J B;  2DXI A;  2DOA A;  3BG7 A;  1MMG A;  5JMP A;  4LIV A;  4R79 A;  3OYJ A;  2Y0S A;  1D1B A;  3TBI A;  2E60 A;  3RTR A;  3FTU A;  4FLO A;  2KRC A;  3DTK A;  3BLY A;  1YE9 A;  4CCO A;  3FUK A;  3FUL A;  2DJI A;  1WJC A;  5CKT A;  4FLR A;  1WJD A;  4BQO A;  4GAE A;  4FLQ A;  4NNJ A;  3OYM A;  2RJI A;  3HKZ A;  3ZHZ A;  3FUN A;  2LRD A;  3PNT A;  4B44 A;  1YX3 A;  2CUZ A;  4E4H A;  2W7N A;  4MS6 A;  4K5N A;  4BEH B;  4XN3 A;  4P1W A;  2FFL A;  2CFO A;  3FTZ A;  3QOE A;  2MD0 A;  3A06 A;  3FTY A;  4DBQ A;  3OYC A;  5HNH A;  4N4N B;  2HVQ A;  1JI8 A;  3AL0 B;  3MMY B;  2E5Z A;  3B3B A;  2HPM A;  3AU9 A;  3K4B A;  3ONQ A;  1QU3 A;  2C82 A;  1N78 A;  3W2W A;  1U0J A;  3TMO A;  4CCL A;  3FTX A;  3UEQ A;  3OL4 A;  5FRN A;  3QJX A;  2R7O A;  5HVQ C;  3HPH A;  4KP7 A;  4XN2 A;  3K4N A;  3CZG A;  1ZS2 A;  2JD2 A;  1MMD A;  4HSR A;  3JSZ A;  1OR7 C;  2HQA A;  1X3Z A;  5AEN A;  2VQC A;  3RPU D;  2WAE A;  2L7K A;  1SG7 A;  4XNB A;  1MMA A;  4D9J A;  3MKW B;  2V7F A;  4ZW7 A;  4ZN6 A;  4Y4R A;  1W36 D;  1NG6 A;  2C5Z A;  4OOF A;  3FTV A;  4ZYA A;  2OC6 A;  3FH5 A;  4XO4 A;  2LH9 A;  4MKT A;  3DU5 A;  3N05 A;  3LSI A;  1LVK A;  4KT6 A;  3L2V A;  4QUO A;  5KHD A;  4B3X A;  2VKD A;  1K6Y A;  4B47 A;  4CCN A;  2VAS A;  2CV0 A;  2V26 A;  1X1D A;  2PL5 A;  2XQ0 A;  3H9Q A;  2PJR B;  3VYS B;  3OYE A;  4B43 A;  3HL2 A;  2R7S A;  4CXF A;  1ONO A;  1R0K A;  4F93 B;  5FWQ A;  2XF5 A;  1MNE A;  4HNU A;  4XN9 A;  4ZQG A;  4RSY A;  5CQG A;  2WY7 Q;  3H9J A;  3ZR8 X;  1RP3 A;  3QYE A;  1VZ0 A;  3RC3 A;  3K4K A;  2WAF A;  3ANL A;  1ONP A;  3KED A;  3FTS A;  3VVL A;  1J09 A;  2LG4 A;  2CV2 A;  1SFK A;  2JSP A;  3OS1 A;  3H5A A;  3A1Y A;  3BG6 A;  2LOO A;  1WJ5 A;  4BJ5 C;  4HRI A;  2E1M C;  4PVB A;  3A4C A;  1H3L A;  3H0D A;  2CS3 A;  2A7O A;  5JAZ A;  4PUS A;  2X51 A;  3UR3 C;  2VXZ A;  3LMM A;  4XLE A;  4BKX A;  2I8D A;  3EBG A;  3GBG A;  1Q0H A;  4AR1 A;  2W4S A;  4N4O B;  1KON A;  1BR4 A;  2K3P A;  2X6W A;  4CCJ A;  2GOM A;  2KPM A;  4IZZ A;  1GLN A;  3RAS A;  3AKZ A;  2QVW A;  3RCO A;  4IX7 A;  4BU2 A;  4XKW A;  4XM3 A;  4BE0 A;  4RLQ A;  3FUE A;  3Q44 A;  2L5Q A;  3CHQ A;  2JV7 A;  3DPU A;  4H4K C;  2ZFU A;  3FUF A;  4JND A;  4FAS D;  3LSM A;  1Z3Y A;  1T0F C;  4XMT A;  3OS0 A;  2E5N A;  2WZF A;  2W82 A;  4YEL A;  1OR7 A;  3CHO A;  3B2P A;  1G8X A;  4XR6 A;  2R7W A;  4FET A;  2F6C A;  2WAQ A;  4Q4I A;  4BL0 B;  1WJE A;  3FU5 A;  2HZD A;  3HOS A;  4E7K A;  4DGW B;  4K5L A;  4B48 A;  3M8J A;  1X1A A;  3A2K A;  3W3C A;  3B7R L;  3HOT A;  2VKH A;  3T0Y A;  3IIE A;  4Y6P A;  3FH8 A;  3UNG C;  2Y1G A;  4ZDO A;  4BQQ A;  1Z21 A;  2DCE A;  3F9K A;  1FMW A;  3ZI0 A;  3BCA A;  4L2L A;  2A5W A;  2XDV A;  2PMZ A;  2K9L A;  2X1D A;  3V42 A;  1H19 A;  3TL4 X;  4BE2 A;  1R6R A;  4XMY A;  4BJ6 C;  2GOX B;  4CSW A;  1E0E A;  4YRV A;  2R7X A;  1UAA A;  4XLH A;  5CPR B;  4XMU A;  1ERD A;  4XMX A;  2Z1D A;  1OLT A;  1EA3 A;  1UG0 A;  3MKY B;  2XPY A;  3FHE A;  4ZQT A;  3AL0 C;  3IAS 2;  2JD1 A;  3AU8 A;  3FU6 A;  2EGH A;  1X3W A;  5FRM A;  4R5V A;  4BXF A;  2KRH A;  1WFX A;  1AA7 A;  1LFP A;  2ZXI A;  3CF2 A;  3OYH A;  3C2H A;  3HPG A;  2WPG A;  4PW4 A;  4E7L A;  4XMV A;  3NWS A;  1FMV A;  3U9W A;  4DOZ A;  4XOT A;  2VIX A;  3L2U A;  2B61 A;  1G59 A;  2CH0 A;  3DKY A;  1ONN A;  3B2X A;  2OV7 A;  3CZL A;  2XSJ C;  2VJ8 A;  2M0M A;  3KYL A;  3DPT A;  2WA0 A;  2Y1D A;  4ZC3 A;  4BDY A;  4CH7 A;  4OAZ A;  2RNG A;  3PL8 A;  5CQE A;  3RQ4 A;  3FTW A;  3K4J A;  3OR1 C;  2Q1Z B;  3FDY A;  2JUG A;  4R7L A;  2AQE A;  4LIU A;  3WQS B;  3FU3 A;  2ZXH A;  3D5S C;  4PFO A;  1Q0L A;  4XMZ A;  4ZW6 A;  4LUP A;  2IGN A;  2KDO A;  4BAC A;  3AFH A;  4NC7 A;  3PUB A;  3DU6 A;  3VYT B;  4F3Q A;  4E7H A;  2PUS A;  3JT1 A;  3K4L A;  3B7T A;  3EUA A;  3PUU A;  3QOD A;  2DT7 B;  1HA8 A;  3A14 A;  2L9S A;  3DEE A;  4QPE A;  2K9M A;  3J7A Y;  4CCK A;  2HVR A;  4XLA A;  5KNL A;  2WY8 Q;  2QJ1 A;  3CZE A;  3ZHY A;  4K5P A;  1IRX A;  1SC5 A;  4U7B A;  3OYF A;  4BEH A;  4F91 B;  3I3L A;  3PNV A;  4OWR B;  3W2A A;  2O7G A;  2Y1C A;  2P0W A;  4XN8 A;  3PNY A;  2R70 A;  2F4I A;  4II2 A;  2A6T A;  1MW2 A;  2VPL A;  1PJR A;  4Y6R A;  4ZQE A;  2BW3 A;  4RCV A;  4BS9 A;  4MLO A;  2JVH A;  2HDW A;  4C9Y A;  4F92 B;  3H5N A;  3S3O A;  5DYF A;  4XKV A;  4JQF A;  3OYB A;  2ZSH B;  2MAO A;  3IAM 2;  2R7R A;  3B37 A;  1T1R A;  2BVM A;  4PSX A;  5JC1 A;  2XPZ A;  1QHG A;  3I9V 2;  4PU2 A;  3CMM A;  3OR2 C;  4FLS A;  3IP4 B;  2Z2S B;  3FBN B;  2V1N A;  1JGI A;  2R7T A;  4X2U A;  4C30 A;  4QME A;  3OYN A;  4IKF A;  3B34 A;  4KJZ A;  2V9K A;  4CCM A;  2IGO A;  4RM3 A;  3OYK A;  3SZG A;  1PYV A;  2BOL A;  4LG3 A;  1V5E A;  2MFZ A;  3CHS A;  5JMW A;  1P9Q C;  3K4M A;  2VQG A;  4BE1 A;  4E7I A;  4PJL A;  3FBI B;  4ZX4 A;  3AUA A;  1S46 A;  3WQR A;  1NG7 A;  4XLF A;  4XN7 A;  1X19 A;  4PFP A;  5JBI A;  3ZCO A;  2VB6 A;  1D1A A;  2HU9 A;  2LY2 A;  2MC4 A;  4QPO A;  5FRO A;  1D0Y A;  2KL4 A;  2VLA A;  2CW8 A;  4XN0 A;  4YEJ A;  4XNF A;  4ZJZ A;  3FKJ A;  2MAP A;  2WZG A;  3H35 A;  2X6Y A;  3KEY A;  3BC8 A;  1SQM A;  2V6E A;  3D5R C;  3D5L A;  4OOE A;  3H9G A;  2R4G A;  2DQ6 A;  1Z3X A;  4E6K G;  3SYT A;  4K5M A;  4KIT B;  3PFY A;  2HVS A;  2IS2 A;  4ZX3 A;  4JOM A;  3VSL A;  3VSK A;  1MMN A;  2RRE A;  4X0G A;  4QIR A;  2KQR A;  3FU0 A;  4DPR A;  2PGG A;  4ZTJ A;  1DQU A;  3H5R A;  4ANJ A;  3DTI A;  2IS1 A;  3VWB A;  2VJI A;  3FUD A;  1N75 A;  1Q0Q A;  2R72 A;  2JCV A;  1UEL B;  2LYC A;  2PJR A;  4NC8 A;  1DGW Y;  2DT6 A;  3Q43 A;  3CJQ B;  2VQH A;  2LBF A;  4AVZ A;  3DWL E;  4R5X A;  3WQQ A;  4ITV A;  2F5V A;  3ZGK A;  2Y1F A;  1ZEL A;  3LSG A;  3K70 D;  4RLF A;  3HG9 A;  4PK4 A;  2HNH A;  3SEZ A;  4ZQH A;  3EPZ A;  4EAT A;  4PSW A;  1Y6I A;  3OMY A;  2AQF A;  3ZXS A;  3CHR A;  1X4P A;  1TZL A;  4ZQF A;  3OIQ A;  3HC7 A;  2Y1E A;  4XND A;  5DUL A;  2IXS A;  5HOO A;  2KP6 A;  3OWT A;  2NOJ B;  1V5G A;  4C2T A;  3CIA A;  4F55 A;  4ZW3 A;  4HNT A;  2JCY A;  4XO5 A;  4GRI A;  4BQN A;  4A03 A;  1WJA A;  2IGM A;  2JA2 A;  3CP2 A;  3OOU A;  3CHP A;  3UER A;  2CW7 A;  2Q2E B;  4BDZ A;  1JG9 A;  3UCQ A;  1LKX A;  4DBR A;  4CUG A;  2WB1 A;  4ZW8 A;  2KZV A;  4XQF A;  2CMP A;  2WBM A;  3S32 A;  3EBI A;  1K5H A;  3LSH A;  2UV1 A;  2WAD A;  4XL9 A;  3FUI A;  4Y33 A;  3L2W A;  3S3M A;  2X1C A;  2X85 A;  3SEQ A;  4FCA A;  4C2U A;  2KLO A;  3CJR B;  2OUM A;  5TGT A;  3W2V A;  4BJT A;  3PSF A;  1LDK B;  3OYG A;  1DP3 A;  1V5F A;  4XOP A;  4ZDP A;  4AIC A;  1MW1 A;  3EBH A;  4Y3O A;  5JNL A;  5LFA A;  4HST A;  3HUG B;  4ZX6 A;  3KX2 A;  3BCB A;  4Y6S A;  2ELJ A;  1Z7L A;  3SDB A;  1BR1 A;  4NQW A;  3RC8 A;  1WJF A;  1YX5 A;  4CA0 A;  2IS6 A;  4HEA 2;  2BVL A;  4ZTF A;  3CES A;  3LL7 A;  3ZQQ A;  2W1O A;  4DIQ A;  4IQ4 A;  3PJR A;  5BPP A;  2QKL B;  1S9H A;  2UUZ A;  4DJA A;  1DGR M;  5HNF A;  3K6G A;  3OL3 A;  2M4K A;  4AYS A;  3OYA A;  3G2B A;  2BW3 B;  2KMU A;  2JD0 A;  3DKX A;  4AU7 A;  2VQL A;  1JVS A;  3T8V A;  2VXD A;  2XAU A;  4KIS A;  2LRE A;  2MYS A;  3VYR B;  4PJN A;  4RM2 A;  3FUM A;  3MKZ A;  4XMW A;  2GTQ A;  1X4O A;  3S3N A;  4HG2 A;  5DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...