5HNFA

Crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease R.BpuJI
publication title Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 108
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hnfA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5hnfA02
5HNFA 5HLTA 5HNHA 2VLAA
chains in the Genus database with same CATH superfamily
1RETA 5ED4A 4PFOA 5A2QK 1JI8A 3HSEA 2JCXA 4IKFA 3ISPA 1BA5A 1V5EA 4ZX6A 1OCZH 2K40A 4HLYA 3CC2I 1T2KA 1WQ2A 3VOEA 4QLCU 2D45A 1VQ6I 3K70C 1VZ0A 1AA7A 4M3DA 4KUMA 4OU0A 4E6KG 2NVXJ 2JPBA 1GW6A 2L9SA 2DJIA 4IHXA 4UB8C 3PO2J 3BT9A 4MO7A 2JRTA 1XGNA 5B3SH 3FTZA 1WZ2A 1FSHA 1Y6IA 3COAC 1MZBA 2FMYA 3FXJA 3KEQA 1ZR4A 1DU0A 3KZYA 1IDYA 3FH5A 1ETQA 3LSPA 3P9CA 2LREA 2VASA 2JUCA 4XKVA 5F64A 2EZKA 2CO5A 1YW8A 4CO8A 1HA8A 4EM1A 4IX7A 4M72A 2BEOA 2NOJB 2MH9A 2HYGD 3MKYB 3CF5F 3HOYJ 4A2UA 2WZFA 3V7SA 3MKZA 1YO5C 4YIRX 1RC9A 2EIMH 1Q0HA 5FKMA 3TL4X 1MNDA 2FQ4A 4U88A 2EZIA 2LY2A 4R79A 2HVSA 2F2EA 2VI6A 4AVZA 5D8LB 1ZGAA 3UERA 4C2UA 1UELB 2Y69H 1VFCA 3H36A 3E6MA 4N9HA 3WTZA 2M5WA 4MKTA 2IW5A 3VVLA 4BXXJ 2VBXA 2DTZA 5BPIA 1S3JA 4LLNA 3I3LA 1X1AA 3W6KB 4FASD 2HTSA 4G7ZF 3ZQCA 2M8EA 1PYVA 3QAHA 4D5FA 2UZKA 2WB1A 2BBYA 5KCMA 1KONA 2JK3A 1RZ4A 1MBFA 4ZN6A 4G7HF 4HYEA 3CDIA 2ELHA 2JN6A 5JFRA 5C44J 1PP7U 1CGPA 5EG0A 2CGPA 5FKNA 4XO3A 5AIPA 3RC3A 3K70D 5EG0B 3FULA 2FEZA 5FWQA 2R7OA 3V7RA 2HKXA 2DT5A 2KISA 5HS7A 2GWRA 5HLIA 2MLKA 2PG4A 5J47A 1JJ6C 2JD2A 3S16J 3WQSB 1JHFA 4CICA 2HZTA 1P9QC 2FQ3A 4DZJA 5K5RA 4QIRA 3FXLA 2XHKA 2UV1A 1ORKA 1ZLKA 5GTHC 4XLPF 1P92A 3AKZA 5E18F 3OYHA 1N75A 4CCLA 3FKJA 3RYPA 3MVPA 3WGHA 2EINH 1ZREA 2IA0A 3CC7I 4CHUA 2FNPA 1DGRM 4XR6A 1B9NA 2EQRA 4KITB 2QKMB 2VJ4A 3K0LA 1OR7C 2FBIA 4A0XA 1R0KA 3RPUD 3ZMVA 1YLFA 3GF2A 3LSGA 2FE3A 3RKYA 3GFMA 3ZQHA 1ZG1A 3O8GA 3RC8A 1R22A 2ZFWA 3RIRA 3RTRA 3SZPA 5H2FC 4K5OA 2EV6A 1FYLA 2HOAA 2V7FA 4QHPA 2DN0A 5HS9A 2DBBA 2HR3A 2HWVA 3BTIA 2FA5A 1AKHA 1HKTA 1O3TA 3FTWA 1W5TA 1AKHB 3SDBA 1JHHA 2KMUA 2ICWG 3TP0A 1R23A 4NC6A 3BG5A 4UV8A 3DPLC 4E7ZA 3U1KA 4HX4A 5FD6A 4N9IA 5AONA 3JREA 2RJIA 1C0WA 3FTUA 1B72A 3JTGA 5HODA 2QENA 3FHZA 5KVRA 1B72B 2R7DA 2E35A 4OOFA 2A3SA 5HNHA 3H9QA 2XAJA 5K1YA 2DCEA 2Y30A 1J5YA 1R71A 5FKLA 2EGHA 3WTWC 1J09A 3MCZA 3JRDA 1UHWA 3QPHA 2XV4S 2WC2A 1ONNA 4XOPA 3HRUA 3HEFA 3V4GA 1QU3A 4D7NA 2QA4I 5C3EJ 5KHDA 3OYDA 2X1CA 3C2BA 4I02A 3ERMA 4ZDLA 2OZ6A 4P9UA 3W2WA 2ZJRF 1T56A 2MFZA 1P4WA 2R7XA 2ZXIA 3K10A 2HVRA 4I6ZA 5E20A 3OYNA 4C3HJ 1TQMA 1IN7A 2EV0A 2BW3A 2DLLA 4GGGA 1SFEA 4AVPA 5FLXZ 2QSHX 2BW3B 2WADA 1WVRA 3UCQA 3ZMDA 3UKGA 1IGNA 1IUFA 3FF5A 4IO9F 3C1DA 1MBJA 3PL8A 2A05A 2WWYA 1MH3A 2JUGA 3KZIC 3CCSI 1MW2A 4AD9A 1E0EA 1XCBA 2DQLA 2EZHA 2P6SA 2H6BA 2I8DA 3S8PA 2QJ1A 3DEUA 2C6YA 3B7SA 3OR2C 1ERDA 3A06A 3HTUA 4A3JJ 2MW8A 2CQNA 2LY1A 3U1DA 3G73A 3PNYA 1APLC 4IHVA 1IDZA 1TWFJ 2GA2A 4A5NA 4B3AA 2FOKA 2VT2A 1WKMA 4BNCA 5FLVA 2KZVA 4ZDPA 4ZW7A 2XAHA 3RZDJ 2Q8KA 2A61A 3R4KA 1B6AA 1JTXA 4Y3OA 4IOCF 1ZRCA 2VQHA 2EZLA 3GTLJ 2XPZA 3F21A 3ULQB 4DOZA 4I7HA 1MW1A 3E97A 1T38A 4HX8A 3U2RA 3FXOA 3DV8A 4XSZF 3L2UA 4Y67A 3P9KA 1HCRA 2VPRA 1IG7A 2Y31A 2OF7A 4IJAA 3HZJA 3I4PA 3FM5A 2WAEA 1GVDA 2M30A 3E1SA 2VJJA 4W97A 1R36A 1UB9A 2E1CA 2OTJI 1GV2A 2DODA 2KDZA 3L09A 5DEQA 3DBLB 3K4BA 3FMQA 1ON1A 2K9SA 2HNHA 3FU5A 2GTQA 3OL4A 4Z2YA 1JKOC 2DK5A 2ZMEA 2GQQA 1OKRA 4GO1A 5E79C 3I58A 2NS0A 3JRGA 1D8KA 4B43A 2ZMEB 2QVWA 1XGSA 4A3EJ 3BOQA 1QZYA 3JSPA 1K4TA 4RAFA 1MSFC 4DBQA 4J00A 1S7EA 1W0TA 2KIFA 1KU7A 2EIKH 2AXLA 4L5IA 3UEQA 3V7CA 3B7UX 1LB2A 1ZKGA 1X4OA 3HOZJ 3AU8A 2DA4A 2FBKA 4L9JA 2O7OA 2LTPA 2AS5F 4XSXF 2MC3A 1SD4A 1DPUA 2HKOA 4I76A 1MMNA 2F5EA 4OOIA 1AOYA 4DJAA 4P5OA 4S05A 2X51A 2K3FA 1XGOA 2CFOA 2CQXA 1Z9CA 2HPOA 3HC7A 5BOXA 5FLMJ 1I39A 2E34A 2ID6A 1Z91A 3F0CA 1BN5A 1HW1A 3MMYB 4MHGA 1KA8A 3C2HA 3CZGA 4XN9A 3VPRA 3UR3C 4CUGA 2Y1GA 2DOAA 3OY9A 5M3FJ 4ARFA 4EJVA 3OYMA 4II2A 1J59A 3KYLA 1VF9A 1IO2A 1FX7A 3LNQA 4NC8A 3WHCA 4KFCA 4LMYA 2GOXB 3J80K 4ETSA 4A6EA 1FC3A 1S5LC 4Y17A 4RA2A 5FJ8J 3B6CA 1SFUA 4L2LA 4Q47A 2M1BA 3VDXA 4FX0A 3ABKH 3QPLA 4JX5A 1WFXA 1SD5A 3ZQLA 3PIOF 3BJ6A 3S1NJ 2IRFG 2DOEA 1YX5A 4BHPA 2DYRH 2EILH 3MZHA 4BBSJ 3OIPA 5BPPA 3S32A 1TT0A 2DA1A 3DTEA 2JCYA 1R5HA 2TCTA 3MN2A 4UUTA 3RPUA 2XF5A 3BG9A 3CZLA 2HZDA 1LEAA 1P7IA 2WTEA 4A6DA 2FU4A 4XMUA 2YPRA 3HB9A 4A0ZA 5M5WJ 5GAHJ 3RQ4A 1P7JA 1U78A 1Z77A 3T5XA 1IAWA 1SMYF 2K7LA 3K9TA 5L3FA 4YRVA 1HBXG 1JKQC 2LVSA 2KJCA 3EPZA 5DTDA 4A3DJ 2Y75A 5AIQA 1NG6A 3BWGA 1RRJA 2LBFA 1UFMA 3VEPA 2HVQA 1LDJA 5CLSA 2JD0A 2LBFB 4JBAA 3VSKA 3KP5A 4CXFA 2XAQA 1UHSA 5BQTA 3CHSA 2PLYA 2JCVA 2BV6A 2L7KA 2WAQA 1BI3A 4RLFA 5CPRB 4D9JA 4A3CJ 1Z3XA 2LFBA 5CQGA 1YW9A 1XGMA 4BU2A 2NYXA 2QYOA 2VQGA 5JR3A 3OS0A 3AAFA 3AG1H 2KRFA 4MFEA 4XLFA 3WU1B 4YIFA 1F43A 4R5XA 2ZCWA 1IXSB 2QQ9A 5BS6A 4I0AA 4G9YA 2X85A 5DCFA 4XNBA 1KGSA 1S9HA 2R59A 3CUQC 3AL0C 4RAZA 4D5CA 5D5VB 1O4XA 4RM2A 4K2EA 1K6YA 2Z2SB 1BC7C 3ZHYA 2VKEA 2B63J 3CTAA 1F9NA 3DP7A 2W7NA 5KAFC 3VVMA 1XSXA 3PQJA 1BW5A 3L00A 2H1KA 1RKWA 1HDPA 4BS9A 3O2PE 2MD5A 4IPAA 2UUZA 4MLOA 3ELKA 4R7LA 4GYIA 4HQMA 3L2CA 3H92A 4FLRA 2VLAA 2QSFX 3TKYA 3A1YA 1OR7A 1QPMA 4XICA 2X6YA 3B37A 1SFOJ 3AG4H 2XAUA 3F8BA 5J1YA 5H20A 1MGTA 2DMNA 2W24A 2RN7A 1JTYA 4C30A 1PP8F 3L2QA 2JA5J 4A3IJ 3KEDA 1IN4A 1WRJA 2FD5A 2NOGA 1JUPA 1ZG5A 4U7BA 2Z33A 3VFZA 4BGDA 3G2BA 3H9GA 5DULA 2OA4A 3LWFA 2NXNB 2FXAA 4PGGA 4L9TA 2IS6A 5F1RA 2GIVA 4XLNF 3IH3A 5LFAA 4CDGA 4KYWA 2LD5A 3K4LA 1K79A 1K7AA 1CF7A 4D1QA 3FHNA 1Q0LA 1D1CA 4W1UA 1F4KA 4WWCA 4XKCA 1CF7B 3ABLH 5KAIC 4ZW6A 2GLOA 1Y0UA 5KK1A 2NNYA 2W48A 4PJJA 2CS3A 2ZSIB 3VODA 4U7DA 4BE0A 4ENJA 1O7LA 1Z67A 2IGNA 4BAYA 2MSYA 1MBKA 4A69C 3H9JA 5K5OA 3TOAA 3JR9A 1ETOA 3CDHA 3FDYA 1KQ8A 3C18A 3HUGB 1SVMA 3KE2A 2L02A 3LSMA 1GXQA 4NUBA 4QUOA 1X2MA 3L7WA 2F5DA 3LA2A 9ANTA 4Y13A 2VODA 1OPCA 1DU6A 2L9VA 2OCCH 3ONQA 3RYRA 4D0PA 2Y1CA 1IZ1A 4U0YA 4DQ2A 4U87A 5DV5A 3KEOA 4GAEA 2AQFA 1MJ9A 4ZYGA 2VBYA 5JVTA 3JRFA 5BPDA 2Y0SN 2VC0A 3CZEA 2Y2ZA 2HPTA 2V6CA 4EQQA 2FX0A 3H0DA 3BR1A 3IUOA 4KISA 1LVAA 3S15J 2KL4A 3V42A 1BI1A 2V79A 3QYBA 4A0YA 2MLGA 3CUOA 3KPHA 3LSKA 1I1GA 2E7WA 4KMUX 3FBNB 1WJFA 4PK4A 2Y9ZA 4XMZA 2Z1DA 3OYJA 3BPVA 4BQOA 2D1HA 3CHPA 3PNTA 4XLCA 4XNFA 1G2HA 1MH4A 4RAYA 2DMQA 3K1PA 3HIFA 3GO5A 3L2RA 2DDBA 3IAS2 2W57A 3GLLA 3HHGA 2MBFA 3OWTA 1XDUA 2Q2EA 2EB7A 1FZPB 1VTNC 2Q2EB 4HF0A 3HL2A 1SAXA 1OCCH 3X2QH 1OYYA 2DMPA 2MYSA 1A31A 2I10A 5IP7J 4ESFA 3OYIA 4CCNA 4WXCA 2KFDA 4IQJA 3QYFA 3F8NA 5FLXK 1U3EM 2RREA 3HSRA 2PX9A 3WHBA 2KRCA 3HRTA 1R4NB 4OINF 3CZKA 3FUNA 1ZTRA 4PSXA 1Z6TA 1T8IA 3TMOA 3MKLA 3ASOH 1FMVA 4G12A 4NQWA 3ZQ7A 4C2MJ 5IYBJ 3FBIB 3R0AA 2E7XA 3K2ZA 5E3OA 4UB6C 1VQLI 3I54A 4NQWB 2EK5A 4BXUA 2DT7B 1VI0A 3IAM2 1GT0C 1WI9A 5CJ9A 2B61A 1G4DA 5JC1A 3JW4A 2XGXA 5HNFA 1EV7A 1YG2A 4FE7A 4I09A 4BXFA 3CMAI 2PI0A 2I5UA 4DBRA 3NWSA 2CFXA 1AHDP 2CUFA 3HKZN 5D6FA 1IXRC 2ZNYA 3RZOJ 2LP0A 4M3GA 3T1BA 2WV0A 3I55I 2QQ8A 1NH3A 2VQCA 1WHUA 3MD2A 4PFPA 4M6YA 4I2OA 4O6JA 2DOFA 2F48A 1ZS2A 4E7KA 2V6EA 2YS9A 5DYMA 4I01A 1V5FA 2JD1A 2M9HA 4E7SA 1BW6A 3IWZA 4RDUA 1A6IA 1V54H 2MD0A 2YSRA 5C4JJ 5FROA 2CW8A 3PSIA 2JMWA 4YFKF 3BTCA 3H5NA 4HDUA 1A6QA 4XRFA 1Z05A 3ABTA 4EGZA 1T6SA 3B2PA 4GRIA 2HFHA 4Q4EA 2RNJA 1G5AA 2CUZA 1JUMA 3AU9A 4ZQFA 4XNDA 1FWZA 2O0YA 3RQIA 3CCQI 2LLKA 2EFQA 3ZQIA 4XN4A 1UZCA 2G9WA 2DA5A 5J8FA 4XO5A 2H94A 1ZN2A 4LIUA 5ILSA 1JXSA 2TRTA 1RR8C 2ZO4A 5L3GA 2B9SA 2CW7A 3EUHC 4A3BJ 4QSHA 1R49A 3NWTA 2FUG2 3GCMA 4ON0A 3TDUC 2OQGA 3KX2A 1X4PA 4BQNA 4CCMA 5JMPA 3GTGJ 4KDPA 3BG3A 3F6VA 3S2WA 4XRSG 3TO7A 2RDPA 5LHIA 1YIOA 3F8FA 2R7WA 4FHTA 2E2JJ 2F6CA 4XN8A 5J1RA 4IF4A 2ZXGA 2L4MA 2HDCA 3WGIA 2LOOA 2IP2A 3FK6A 3A0BC 1IN6A 4N0BA 3BQYA 5D8KB 3CCJI 1ZR2A 4LLGF 2YX4A 1WJDA 2EPFA 3ESWB 2WY7Q 3N05A 1HLVA 3WTXC 2A6TA 1T1SA 2K9LA 2MA3A 2HYJA 3BR0A 1OYWA 4HPQA 3TDZC 4ZW3A 3H35A 3S1MJ 2HGCA 1HW5A 2JRMA 2V1NA 2VKHA 2XSJC 3ANLA 3ZOBA 3PIPF 3S17J 3KEYA 2LKPA 5B1AH 3GFJA 1YI2I 3ZPLA 3HJEA 2DI3A 4OIOF 1K6OA 3A2KA 1VQPI 4AU7A 3J7AO 4A03A 1TTYA 2NS8A 2VONA 2M45A 4Y6RA 3OSFA 1V4RA 5DM6F 5KNLA 5CVIA 2BY1A 3ECOA 1TWCJ 2ZB9A 5EEHA 5FKOA 3ZXSA 2DXIA 3OYBA 2O61A 3M4OJ 2XROA 3QPSA 4XMTA 2Y0MA 3G71I 3CUQA 3E5QA 3OYKA 1IRGA 3HPGA 3CUQB 3PFYA 3AL0B 1VQ4I 2O6GE 1FBUA 1Z3YA 4KJZA 5AENA 4IOAF 1LUJB 3HPHA 3QYEA 3QRFF 1IRFA 2R7ZJ 4HQEA 1XSVA 4IRGA 2V26A 3K4KA 3BJAA 1WSUA 5E8GA 3R6SA 2JVHA 4GFBA 3FM3A 4CH7A 2KKOA 3GTOJ 3OR1C 3EBHA 3ZI0A 2OCEA 1F36A 5J40A 1TT5B 3T8TA 1JG9A 4DW6A 5L3EA 1K5HA 3FH7A 2K4JA 3DKWA 3SEZA 5EEAA 4R5TA 1EH8A 3DQVC 4A3KJ 1Z7LA 2OV7A 5LHHA 1RNLA 1E2XA 3FXKA 4PDKA 1W1WE 1B1BA 2CJJA 3HM5A 2E19A 1QPIA 3E6CC 1P4AA 4ITVA 5JI6A 2M4GA 3DTIA 2MGQA 4P9FA 3MZYA 4FE4A 4ZYEA 1N77A 4ZX4A 4E7LA 2GM4A 1S8NA 2QSGX 3N97A 2RV8A 3CMMA 5EZGA 1M1EB 2R72A 4BDZA 3FUHA 1IC8A 1J0RA 2O5RA 3IRRA 5F08A 1REPC 3ML6A 4FTHA 2PMZN 3DWLE 1X58A 1LFPA 4FETA 1JVSA 2CG4A 2CV1A 3PM1A 4RVBA 1B8IA 3TQNA 2JTVA 2UWMA 5F27A 2UXXA 4FT8A 4E7HA 3H1CA 3WQRA 1LNWA 3G1MA 1HS6A 1Y56A 1X3ZA 3Q0VA 3QOEA 1LPQA 1USSA 2R93J 1HF0A 5K7FA 2HXIA 3CCRI 1X3ZB 4F55A 4RCVA 1GV5A 5J8CA 1MKMA 3LSRA 5B66C 1MMDA 1Q1VA 1R1TA 1YW7A 3AFHA 1ZARA 3OOUA 1ODDA 4UUVA 4EM2A 3IIEA 3OIOA 2OJED 2P7CB 3LQQA 2MC4A 3E6DA 2WPGA 5F1JA 4X2UA 2XPVA 3NQOA 5HDKA 4AIDA 4IZZA 1BC8C 5F0FA 3I59A 4PZJA 4M6XA 3I59B 4PUSA 3WG7H 2R7QA 5M5XJ 4ESJA 4RGXA 1FYMA 2EV5A 1X3WA 2DFFA 2OBPA 3B02A 3W6JB 1MMSA 2DA2A 3W2VA 1HKQA 3LSJA 4II3A 3CJTB 1T95A 4XN0A 1XMKA 3IV5A 1OCPA 2IBDA 3S3NA 1LDKB 5JLXA 1S7OA 1H89C 1XN7A 3CLOA 2IGKA 1D1AA 4HA8A 2K86A 1J2XA 2KIMA 2E2IJ 1PUEE 3CC4I 2R5ZA 4IXAA 4ESBA 4F91B 1OJLA 1IXCA 1YHQI 1HQCA 2R5ZB 4AYBA 2C5ZA 2Q1ZB 4BQAA 4ZQEA 2E1MC 2CU7A 2OC6A 3CMYA 4C3JJ 1R1UA 2V1DA 3WTVC 3RASA 5LRSA 3BZKA 4RB3C 2P8TA 3JRAA 2V9KA 3ERED 1H0MA 1ETWA 3IKTA 2FJ1A 3TBIA 4B44A 3SYTA 1TNTA 4H4KC 2XPWA 3L9FA 4F3QA 3Q0WA 2R7FA 1ZAOA 4F93B 1TQPA 3FWEA 2L2OA 2MH2A 2Q0OA 4N4OB 2VE9A 2V9PA 3CJNA 3L2VA 1WI3A 5E3MA 2HQNA 5IOZA 2M34A 4HEA2 1S72I 2ZNZA 1KYZA 4OMZA 3HRSA 2JPCA 1QNTA 2LY9A 2ZXJA 2ECCA 2PMUA 3LAPA 5L3CA 3CF2A 5L3BA 2XUBA 4EV0A 4Y6PA 1Y0NA 4EEFG 3OSGA 1LQ1A 5B5EC 2KIQA 5IT9Z 2L7ZA 3RKQA 2JA7J 2XIGA 4XBFA 1YYVA 4DGWB 3E0JB 2M7AA 1SQMA 1X3UA 1VQ7I 3RPQA 3R0IA 1LVKA 2O8KA 4EMSA 1X1BA 3D0SA 2AXTC 4AM3A 3K4JA 2W84A 4P1WA 2F5CA 4U0WA 1ZYRF 4EATA 3OYLA 3HDDA 3HHHA 2P81A 1P2FA 4XMXA 4QWQA 3E3VA 4HNTA 4NC7A 2A5YB 1LE8A 1R0LA 1BI2A 2QM3A 5FD5A 1ETXA 3C7JA 3LSHA 1LE8B 3P9IA 4XONA 3CCEI 1B4AA 3FU6A 5DCMA 4IRIA 2DPUA 3FTSA 1W7PD 1I3AA 2ID3A 1U2WA 2D1VA 3GVAA 4L18B 2MAPA 1T0FC 2VJIA 3KP3A 3B2XA 1V5GA 4MQ9F 4LLLA 3FK7A 3FZVA 4XM3A 1YITI 3FTYA 5JAZA 1JUSA 2Z16A 2H1LA 2QWWA 3ZMSA 4MS6A 3K7AJ 3LQRA 3OOPA 3R0JA 3GUDA 3QQAA 3FXUA 4D7MA 1HC8A 4ZQGA 4RMNA 3QWLA 3HXLA 1H8AC 4JX6A 2LSOA 3K1MA 5E1WA 4ZTJA 4HV5A 3BZCA 3RCOA 2F4IA 2PFBA 3U9GA 4L0YB 2BGCA 4KIBA 4AR9A 4ZQHA 1X1DA 2HQ5A 3EUHA 4XK4A 2OU2A 5BMZA 2DW4A 1MW7A 1EA3A 2ZJQF 2PJPA 3OS1A 5K7ZA 1YJNI 3RSNA 4YEJA 4KT6A 2RC4A 3HOVJ 5IYCJ 3SHFA 4Z6YA 2IS2A 2KT0A 4DNCA 5D4SA 2Y9YA 2VBWA 2CWEA 3S1QJ 2DT6A 2P4WA 4XOTA 1ZH5A 3Q9VA 3IWFA 4LK1F 3ECHA 3CXBA 1YE9A 2BZTA 2K85A 2X1EA 3W3CA 1T33A 3OIQA 1DDNA 4FCAA 3T0YA 5TISC 2QBYA 3FTXA 1GXPA 3JSZA 2DFHA 1WJEA 1PVEA 3FUKA 3M8FA 5IT3A 3VSLA 1FTZA 4B09A 2W00A 3FH8A 2QUFA 3WG9A 3G4SI 3TEDA 2XAGA 4BL0B 1RP3A 4E7JA 2VXDA 1A04A 3JCUC 3QP5A 3OYAA 2Y1FA 1Z0XA 5DD8A 2G7UA 1CQTA 3S14J 1YFHA 4XMWA 2QZ8A 2A6HF 3B7TA 3J81Z 2WZGA 1SFXA 2DK8A 2IPQX 1R9TJ 3V8JA 2WB1N 4RBOA 2MABA 2X6OA 4DYRA 2GXGA 2ETHA 2L54A 1E3OC 3WTUC 3OMYA 4AC0A 2FF4A 1FOKA 1U0JA 5F0CA 4X0GA 4XIDA 1KU3A 2AQEA 2O03A 1TZLA 3TGNA 2M7BA 3HTSB 1BR4A 4MTDA 3HOWJ 1ONOA 2STTA 3B7RL 1ZRFA 2KP6A 1MJBA 2BY3A 2F4MB 3DFGA 2ZC2A 3KYCB 4FLOA 4HW0A 2E1OA 5FFXA 3IHUA 3GTJJ 3BCBA 4PJLA 1I3QJ 4EVIA 1UG2A 2O9LA 2L7FP 3JAMZ 4IHSA 3OYFA 1XX5A 4O5VA 1MVYA 2KRHA 4EJUA 3EQLF 4OIQF 3GTPJ 1D0ZA 4CCKA 1O3QA 1EJ9A 4R5VA 4LJZF 3CHOA 2R70A 4XKWA 5B1BH 4EJWA 5F6FA 5CKTA 3P7NA 4WX9A 1HDDC 2W1OA 1GHCA 4E7IA 2CV2A 1G6NA 4HNVA 2WBMA 1Y8RB 4AIJA 2VE8A 2X4HA 1WJCA 2XPYA 4XN1A 2R0QC 1RIOH 1Q1HA 2IXSA 1FMWA 5E1XA 3SEQA 4CZCA 2DQMA 1K78A 4CCJA 1X2NA 2STWA 4UXNA 4HSRA 3C3WA 5K5QA 1K78B 2X1DA 3OYGA 5GAGJ 1FTTA 3DBHB 2X9DA 3IH4A 2EA4A 3FIWA 4A12A 3LSIA 2GA1A 4FISA 1WCMJ 2FMLA 1RESA 5HLHA 3SFIA 3I9V2 2LMDA 1IV6A 1F5TA 2IS4A 4PJNA 2CUEA 1OMIA 4ABZA 3EBIA 2LG4A 2E1NA 2NAZA 3DBRB 4V2FA 2XB5A 4XRMA 2H09A 3BTLA 2JSPA 2IAIA 1FJLA 2D2WA 3P5JA 3C2GA 1MNEA 3CJQB 1YOVB 5DUIA 3L2WA 2VPLA 4ENMA 3A0HC 1BJAA 1QGPA 5EV7A 1W36C 1WH7A 4ANJA 5D4RA 3QP6A 4G6DA 4MEYF 1IUYA 5GTIC 2PUSA 4XORA 5J4VA 2FOWA 2OQRA 1MSEC 3I56I 1ZG3A 3M1EA 2M87A 4KN7X 5FGMA 5IP6A 4K5LA 4XN5A 2GZWA 2P5KA 4LG0A 1L3LA 1LJ9A 2VKDA 4WCGA 4RGRA 2OAZA 5EYRA 2ME6A 3ZMTA 4LG0B 1TWGJ 2ME0A 5E3LA 1T1RA 1U6GA 4LGWA 1MMGA 4L9NA 1RUOA 4G7OF 3NRVA 4RS8A 3SQNA 3EYIA 4I98B 2W4SA 1Y39A 1TWAJ 4BJ6C 1TW2A 3GZ5A 2YX7A 4HBLA 2M2EA 1ZHFA 3QODA 3S3OA 1W7PA 4Y15A 3GX4X 2M0MA 3F8CA 1K61A 1W7PB 5EJCA 2ESNA 1UMQA 5L3DA 5D5XB 5JBIA 5DDGA 2GXBA 3BR3A 2HOSA 4JOMA 3QU3A 2FBHA 5DS9A 2EA2A 3FU3A 5TRDA 4I99C 4X6AJ 4B48A 3GEZA 3LSTA 2E1MB 1S7AA 4BY1J 1FP1D 1SC5A 4CSWA 1XC5A 5HLGA 3TO6A 1X19A 4FLSA 2QGUA 4HF1A 1G3SA 2PGGA 4M3EA 1O57A 1ETKA 2NVYJ 3Q43A 1BOAA 2K5CA 2JVGA 1YS6A 1KU2A 1QZZA 3F3XA 3LA3A 4RGSA 1UAAA 3BR5A 4HAMA 1QHHD 2O3FA 4I0BA 2IJLA 1DUXC 3HBLA 2IS1A 3DLAA 4GAAA 4MFDA 3J7ZI 2VB6A 2FFLA 4LUPA 1HSJA 2HDDA 3H3VK 1MW0A 2MAOA 4BJTA 1SG7A 2QQAA 1GUUA 2XPUA 3EYYA 3A01A 1YIJI 1RR7A 1WH5A 4L9VA 4M9XA 3HRMA 1BI0A 2QVOA 5J4YA 4QTRA 1QHGA 2XVCA 3IKVA 3M1CA 4B3XA 3A01B 4XLHA 3HYIA 3BTJA 1I6XA 1G3WA 5TJJA 1W36D 4PJ0C 3WQQA 4UVCA 3E7LA 2RQPA 3B6AA 4DZPA 1K83J 4Q5SF 1AWCA 2XF7A 1LDDA 1KYWA 1G3TA 4XLEA 1MBHA 2ZXWH 1NTCA 2KIUA 4EJOA 1VQ9I 2L7MP 1LEBA 5LHGA 4UHTA 4M9ZA 4F7ZA 4FLQA 4BJ5C 3DEWA 3LFKA 1G59A 4A3LJ 2EIJH 2PEXA 4RB1A 4OOEA 1MDMA 4Y6SA 1FY7A 4P55A 4BYYA 1OCTC 3KLNA 2FSWA 2JA6J 1MDMB 2BOLA 4K5NA 2XDVA 2L9RA 4ZZDA 1T0FA 3DEEA 2BY0A 4RB0A 2FNAA 2KZGA 5H6QA 3BR2A 3GTMJ 2HEOA 5IT9K 2XC7A 2HQRA 5ICGA 3FUMA 3IRQA 2LDUA 2R3SA 3DF8A 1I1SA 1KU9A 3E5UA 4BUPA 2BHZA 5F0HA 3A4CA 5LEJA 1YRNA 3FISA 5ILVA 4HRIA 4Q4ZF 2VXZA 1H9GA 4B8XA 1O7FA 1YRNB 1HXDA 3M8EA 3ABUA 3BG7A 1QQIA 3OYEA 4C9YA 4IVNA 4G94A 4F52A 3E5XA 3FUJA 4LK0F 4RGUA 3BCAA 1UHMA 4BE2A 4CYDA 4LG3A 4ZYHA 4QPOA 4LIVA 4JX4A 2VT3A 4C3IJ 2XRNA 1U8RA 5JMWA 5J1UA 3IH2A 3I4MJ 3ZCOA 4Y4RA 2DQ6A 5E8IA 4WK8F 4ZYAA 1BIAA 2HXOA 1ONVA 2VKVA 1S46A 4AWXB 2A6EF 4Y7NJ 4KMFA 1G3YA 3CDLA 2RQQA 1LFUP 2A5WA 4QPQA 1FYKA 5K7HA 4XL9A 3DPTA 2VJ8A 2NS7A 1AU7A 1T39A 3HGYA 3QJXA 4LOCA 3BPXA 4LFUA 4WF2A 2O7GA 2P0WA 2D5VA 4JP0A 3WE3A 1JKRC 5GADJ 1FBSA 2IA2A 3F9KA 2XASA 4FQGA 2LC2A 2VJ5A 1Y1VJ 2VQLA 3I71A 4ZTFA 2LKSA 5C4XJ 2P6TA 3BP8A 2TDXA 2YU3A 3G1LA 1DPRA 1ONPA 2V4JC 4CZZA 2COMA 2WAFA 4S04A 1V55H 1USTA 2LF7A 1YJ9I 1IW7F 1SVOA 4HDVA 2C82A 5LLQA 3EBGA 1VQMI 1H88C 2IT0A 3B3BA 2WAQN 2CQKA 4OAYA 1N78A 4MNUA 4M3FA 5M5YJ 5D5UB 1A35A 3WU2C 3H3UA 5IP9J 4BACA 2L3DA 3WTSC 2QEXI 4K5MA 4TV7A 1XG1A 3IC7A 3CHRA 5IPAA 5EGOA 4UVAA 1TWHJ 3EUKL 1S6LA 5EGOB 4H0EA 4KNYA 2PL5A 3F72A 1TNSA 4ZC3A 3D5RC 3GWZA 2H8WA 1YS7A 2P5LC 4NDLA 2DA7A 3K6GA 2QKLB 4J19A 2IA1A 3KP6A 2NVTJ 3DPUA 4C2TA 3CO7C 2ZJPF 1FPQA 3SZGA 5LD2C 4G6QA 4M9SA 5LGTA 3ZMUA 2NRAC 3J81K 2CMPA 3GZNB 1TL8A 1ZQ3P 1XPXA 3WTYC 1BOBA 2VUMJ 2DDAA 3ZN1A 1Z6RA 4CYCA 1B9MA 1HSTA 4HX7A 2EFPA 3ANMA 3RDIA 3SXYA 4CYCB 2N8GA 4MIMA 2W25A 1Z1DA 2ZFUA 2ZJ2A 4IHWA 3GTKJ 1SD6A 3ZQQA 4PW4A 2M4KA 5LEKA 3LAJA 4A93J 3ZP5A 4OIPF 3OS2A 3PSFA 1VQ8I 4DPRA 1XD7A 2CRGA 3DKYA 1QZEA 2QQBA 2DA6A 1U8BA 5FFZA 1R58A 2A7OA 1TBXA 1RI7A 5F04A 1SVLA 2R7RA 2ACJA 2CH0A 5FRNA 4AR8A 4HNUA 1STZA 1SAUA 4AICA 4OWRB 1NG7A 4QIWN 3G6EI 5LGUA 5GPCA 1OISA 2OUMA 3JAMK 1HW2A 3VYRB 2UXNA 1U9OA 2LR8A 1D8JA 4CA0A 4UUSA 5TGTA 4ZQTA 4RLQA 4M3BA 3CCVI 4UUSB 1JGIA 3LOCA 4O3MA 2KJBA 1MNMC 2K9QA 2XF6A 3PQKA 1J9IA 1I6HJ 3LFUA 5JLWA 3CMEI 4EM0B 5ICEA 4ZDOA 1LKXA 1DGWY 4OIRF 3PO3J 3AUAA 5FO5A 4G6TB 3S2HJ 1VQ5I 5E3NA 1NK3P 5FRMA 4N4NB 1BJZA 3DTKA 1O3RA 1B8IB 1XTAA 3G1OA 3M7GA 4FCYA 2WV1A 2DAOA 4NNJA 1KQ9A 1BM9A 3MQ0A 1FP2A 2M3AA 2HU9A 1WWXA 2M0CA 3MEXA 5D6EA 1XMXA 1OFCX 1VQNI 2ESHA 4X1EA 1XSDA 2V1XA 1G8XA 1OQYA 1XB4A 3S3MA 3VYTB 3V8LA 3BQZA 3J7YJ 1D5YA 2EBIA 2K9MA 4E4HA 3HGGA 3CZ6A 3WGGA 3PUUA 1QRYA 3HOSA 3FX3A 5CVJA 4JQFA 3PNVA 4ZX3A 1ZGWA 4PGHA 1H19A 1X3WB 4RB2C 2ZKZA 5HVQC 1X1CA 1I50J 3UNGC 1E3HA 3VYSB 4GXOA 3H5RA 3HOUJ 2BXYA 2HTJA 2DMUA 2JA2A 1ETVA 2CUJA 4WXHA 2DYSH 4U0VA 1DP7P 4CCOA 4L0ZB 2H8RA 1K4SA 1A36A 1D0XA 5HOOA 2A68F 3KZZA 2Y0SA 3RKWA 4M73A 3BC8A 1R5ID 4IHYA 1VQKI 1ETYA 5D5WB 3DU5A 1R5GA 3O3KA 3OL3A 5H6RA 3FTVA 4ZJZA 4DYQA 2HOTA 3FUIA 4M71A 1R7JA 3K4NA 5JNLA 5IY5H 1MBGA 4YG2F 5JHFA 1TW3A 1MIJA 5HDGA 1XCVA 1Y8QB 3CCYA 3MAJA 4M74A 1SEUA 1WJBA 1ULYA 1MW3A 3KCCA 3KIOA 4HG2A 1BIBA 3CP2A 3H0GJ 2DFEA 3PUBA 1FIPA 4ZW8A 2F4OB 5EF6A 3GFLA 5HS8A 4MQVA 4R1HA 2E5ZA 4LD5A 3FUFA 2DU9A 3Q9SA 4XKBA 4BKXA 1U5TA 1TC3C 5ICFA 4ZX5A 2XKPA 1P4XA 2VL8A 1JT0A 4GDFA 1U5TB 4AIHA 2E36A 2L4AA 2A07F 3DXJF 1GLNA 2VOOA 2Z3YA 1N25A 2O8XA 2PQ8A 4AR1A 1X1PA 4F92B 1JT6A 2H6CA 3CP8A 4B47A 1OCOH 2R4GA 4BQQA 1D3YA 4ZYDA 1W4MA 3QU6A 4IL6C 1KZHA 3ZMZA 4AUXA 3HOXJ 2K27A 2RVCA 4Q48A 1NK2P 3PJRA 1UCRA 2J5PA 1I27A 3BY6A 1MJAA 3F6OA 1RKTA 5DCMB 2HYFA 3RKXA 5A2QZ 3GFIA 3I4NJ 4BDYA 5M3MJ 4A3MJ 3HKZA 2W85A 1OCRH 1P6RA 3R60A 1SC7A 1IV8A 3PFIA 1D5VA 3EDPA 3PUFA 3A02A 3I64A 4GCVA 2X48A 3SDGA 3CQZJ 5J6XA 4PU2A 3HSFA 4R8HA 5HDNA 3D5SC 3GXOA 3KETA 2PJRA 1RUNA 2YR2A 4YFXF 1QA6A 3JSOA 2PJRB 3REOA 3JRBA 2DFIA 5JVGF 1R6RA 1QO0D 3FHEA 4Q4IA 4A3GJ 2M8GX 1V3FA 1EH7A 3TO9A 3GLXA 4ZH4F 3VWBA 5LGNA 2RAEA 2LK2A 4UVBA 5HLTA 4KA4A 3Q5FA 3DLLF 5DD4A 1EH6A 3K2AA 4E70A 1FOWA 2XGCA 4EGYA 1R00A 1Z21A 2KLOA 4BBRJ 1FLIA 3RI4A 3G3ZA 3LA7A 2ELKA 2LH9A 2KPMA 4G8XA 4BEHA 1FSEA 2Y48A 2YUSA 1DQUA 1EKEA 3GW2A 4BEHB 5LBQA 3F8MA 5CQEA 3OV8A 2QBYB 3FKIJ 2X6WA 2BVLA 4MGRA 5EDNA 3JT1A 2Y1DA 5CYVA 5BNGA 4K5PA 3HOTA 1XMAA 1EF4A 2NNNA 4KT5C 3CCUI 1J75A 4XMVA 3FXQA 4CGZA 2E60A 3V8KA 3ZR8X 2WY8Q 1SMTA 1XS9A 1E3PA 1SFKA 3F22A 4NB5A 2X6XA 2KHMA 1ENHA 4JK1X 4OMYA 4BHCA 2X0LA 3IL2A 1JE8A 1ZGJA 1JKPC 4J01A 4KN4X 4XRSA 5ERIA 2L5QA 1GVJA 3I0TA 4IEJA 3JRCA 3MZ8A 4HZFA 4YELA 1PDNC 1JGSA 5CVVA 3JTHA 5ICCA 2NVQJ 2W82A 4UV9A 1D1BA 4LITA 1A5JA 3M3YJ 3H3ZA 1OYIA 3FUEA 3CJRB 1HKSA 2LKXA 3GBGA 3K69A 4B1RA 1TP4A 3GMEA 3QPTA 5DUKA 3MWMA 2ZSHB 3ABMH 3N4MA 3EUAA 3FXMA 3J7AY 1TQIA 2XGDA 5ILUA 3TW6A 5FKKA 2K4BA 2DO7A 1FNNA 1IRZA 3WTTC 1HOMA 3ZN0A 4AIKA 1YJWI 3BROA 2DA3A 3ZHZA 1PJRA 3SFZA 4QMEA 2JV7A 3DKXA 3BG6A 4KIGA 3ZQFA 2VIXA 3GYHX 3CD6I 3D5LA 4A5MA 4ZZLA 4S0HB 4PVBA 4L5JA 4XO4A 2ZBKA 3IP4B 2ISZA 2BXZA 1WGXA 4RSYA 2AO9A 2OZUA 1D0YA 2GOMA 2MG4A 3O6BB 2HPIA 3WODF 2LRDA 2OD5A 3FUDA 3MKWB 2DTRA 3S1RJ 2PBIA 4UY8I 2YU9J 1IJWC 1JGGA 3JRHA 3HG9A 1Y1WJ 2CW0F 4V2GA 1BR1A 3DU6A 4M6VA 2EJRA 3ASNH 4DIQA 2CQ7A 6PAXA 2XQ0A 1LFBA 3BLYA 4LB5A 2DJNA 1WPKA 2ELJA 2JT1A 1H9TA 2RGVA 5CVUA 2COBA 2L9NA 1I5ZA 1FBQA 4ASNA 3TP3A 1IN5A 1L0OC 2HOEA 1NHAA 1TLHB 3AG3H 4XLAA 5E17F 2F5VA 3H5AA 4A3FJ 1B59A 1ZELA 4BY7J 2VBZA 3MFKA 1E17A 2ISYA 2Z99A 3CIAA 4HLXA 2BYVE 2G0EA 4GYGA 3T8VA 2ZXHA 1BL0A 3LL7A 3ZGKA 2XB0X 3QOPA 2KDOA 2JSCA 4KP7A 2CV0A 3M8JA 4IHTA 4ZW5A 2Y1EA 1RPWA 2JWTA 5GPAA 3CHQA 3I5UA 2GXAA 2E5NA 2GIZA 1YTYA 2EWNA 2HPMA 4XN3A 3BZ6A 3JRIA 2J5OA 4B4CA 2OTLI 3WU0A 1U9NA 2Z9OA 4UNOA 1YQAA 4P96A 2P7VB 4YIIA 2R7UA 2RKHA 2PN6A 3FMSA 2H27A 2HDWA 5E1ZB 3CESA 4XMYA 2L01A 1H3LA 1POGA 1JJ8C 1BR2A 4J3BA 2QF7A 2EFNA 5DLLA 2E71A 2A69F 2PMZA 1WJ5A 3HW2A 2NVUB 3K4CA 3KP4A 2EFWA 1W0UA 1XDSA 5LRRA 3ANNA 5DYFA 1QBJA 3W2AA 3HUGA 4V19K 4WXDA 2XRLA 5GP9A 1W5SA 1ZRDA 3F23A 4NBQA 2IVMA 3TOBA 1KQ0A 2BHYA 3M9AA 3Q44A 1R4MB 1MD0A 4PSWA 1QVTA 2VOPA 5CVRA 4BH9A 4AYBN 2R5YA 4EJTA 2CQQA 3NAUA 1PUFA 2R92J 3ROUA 4YFNF 3M07A 2R5YB 3FU0A 3NARA 2B0LA 2LF8A 3SJMA 1YX3A 2DQRA 2V9VA 2WA0A 1PUFB 1GDTA 2JQ7A 2BE5F 2LNBA 4BE1A 2EFOA 2OPTA 2BY2A 2R7VA 4XNAA 3L1PA 1T08B 1ITYA 5J3LA 4IQ4A 1SANA 3FXRA 4OAZA 5IOYA 2R7TA 2HI3A 3DCFA 1SD7A 2KQRA 3W6VA 2ADUA 1OLTA 4XQFA 2IGOA 3ZRGA 3VB2A 1J7KA 4IRHA 3T8RA 4L5EA 3A14A 3R61A 1BBYA 3SZTA 4HF2A 3E6BA 3VYUB 4QPEA 3BJOA 3KLOA 1Q0QA 2E2HJ 1T98A 1Z7UA 5EZHA 1FEXA 2IGMA 5EEGA 1W5CC 3EETA 4BHBA 2GBYA 3K4MA 1VQOI 4MEXF 2XKOA 3O8HA 3S2DJ 3S93A 3NEUA 4AYSA 1FIAA 2VN2A 5GAEJ 2QLZA 4ENNA 4Y33A 4FX4A 1F1ZA 4NHJA 4XN2A 2K02A 1IN8A 3Q0UA 3TW7A 3I53A 3ZQGA 2V1UA 2JA8J 3K1NA 4DYCA 4MTEA 2VC1A 1ZK8A 3BDDA 4PCQA 3CCLI 2CYYA 2CSOA 4LB6B 2IEKA 2GAUA 2QCOA 4XN7A 4Y52J 1U5TC 4JYKA 3CO6C 3ZHXA 2G7HA 2R7SA 1ZLJA 1S29A 4PJMA 2DPDA 2L0KA 4JNDA 3Q3SA 1QVUA 4HSTA 1FOYA 5FB2A 3WE2A 2RNGA 1UG0A 1FOXA 3KYDB 4RAGA 1ON2A 1ACIA 1R1VA 2XAFA 3KFWX 4HOBA 2ECBA 5JO0A 2B7EA 2LYCA 3OYCA 3GTQJ 1IF1A 4KICA 3A03A 4RM3A 4ENKA 3B73A 3KP7A 2FRHA 2PMHA 2F5FA 1WJAA 3CCMI 2JZYA 2JJ7A 2ZMEC 4HV6A 2K9NA 2HS5A 1O3SA 1VNDA 5JHUA 2EH3A 3RJPA 5DM7F 3CLQA 1IRXA 3AG2H 2DMTA 3BR6A 2Z5UA 2BVMA 3FMRA 3LMMA 3U21A 2XGEA 3J80Z 5IYDJ 2K3PA 3U9WA 2XSDC 3B34A 3GZ6A 1MBEA 1DP3A 1FT9A 3D1NI 1UJ8A 2HQAA 4KIFA 2AHQA 1MMAA 3KP2A 2P5VA
chains in the Genus database with same CATH topology
4PFOA 3RCOA 2F4IA 4D1QA 3FHNA 1JI8A 1Q0LA 1D1CA 4NNJA 4XKCA 4AR9A 4ZQHA 1X1DA 2JCXA 4IKFA 4ZX6A 1V5EA 2M3AA 1MW7A 2HU9A 4ZW6A 1EA3A 3OS1A 3K70C 4PJJA 4BE0A 2CS3A 1VZ0A 1AA7A 2ZSIB 4KT6A 4YEJA 3RSNA 4E6KG 2IGNA 1GW6A 2L9SA 3H9JA 2IS2A 2DJIA 1G8XA 3FDYA 3S3MA 3VYTB 3HUGB 2DT6A 4XOTA 3FTZA 3LSMA 2K9MA 4NUBA 4E4HA 1YE9A 1Y6IA 2X1EA 3W3CA 4QUOA 3CZ6A 3PUUA 3OIQA 3HOSA 4FCAA 3T0YA 4JQFA 3FTXA 3PNVA 3ONQA 4ZX3A 2Y1CA 3JSZA 3FH5A 1H19A 1WJEA 4U87A 3FUKA 2LREA 4GAEA 2VASA 2AQFA 4XKVA 3VSLA 5HVQC 1X1CA 3UNGC 2W00A 3FH8A 3VYSB 3CZEA 3H5RA 2HPTA 3H0DA 3IUOA 4KISA 1HA8A 2JA2A 2KL4A 3V42A 4IX7A 2CUJA 3QYBA 1RP3A 4BL0B 4E7JA 4CCOA 3LSKA 2NOJB 1D0XA 2VXDA 3OYAA 5HOOA 2Y1FA 3FBNB 3MKYB 1WJFA 2WZFA 4PK4A 3MKZA 4XMZA 1Q0HA 2Z1DA 3OYJA 2Y0SA 4XMWA 3TL4X 4BQOA 1MNDA 3B7TA 2WZGA 3CHPA 2LY2A 4R79A 2HVSA 3PNTA 4XLCA 3BC8A 4XNFA 4AVZA 3UERA 2MABA 4C2UA 1UELB 3L2RA 3DU5A 3FTVA 3OL3A 3OMYA 3IAS2 4ZJZA 3FUIA 3OWTA 1U0JA 3K4NA 4X0GA 5JNLA 4MKTA 3VVLA 2AQEA 2Q2EB 5JHFA 1TZLA 2M7BA 3HL2A 1BR4A 3I3LA 1X1AA 4FASD 1ONOA 1WJBA 2MYSA 1MW3A 3B7RL 3OYIA 1PYVA 2WB1A 4CCNA 2KP6A 5KCMA 4HG2A 1KONA 4IQJA 3CP2A 3QYFA 4ZN6A 3PUBA 2RREA 4FLOA 4ZW8A 2KRCA 4XO3A 3BCBA 3CZKA 3RC3A 3K70D 4PSXA 4PJLA 3FUNA 3FULA 3TMOA 2E5ZA 1FMVA 3FUFA 4BKXA 4XKBA 2R7OA 4NQWA 5FWQA 4ZX5A 3FBIB 3OYFA 2VL8A 4NQWB 1MVYA 2DT7B 2KRHA 1GLNA 3IAM2 2B61A 2JD2A 1D0ZA 4CCKA 3WQSB 5HNFA 4R5VA 4AR1A 5JC1A 3CHOA 2R70A 4XKWA 4BXFA 1P9QC 4B47A 3CP8A 4F92B 4QIRA 2R4GA 4DBRA 3NWSA 2UV1A 5CKTA 4BQQA 2W1OA 4E7IA 2CV2A 2WBMA 3AKZA 3OYHA 3PJRA 1N75A 4CCLA 3FKJA 1WJCA 2XPYA 4XN1A 3K4LA 2VQCA 3MD2A 4PFPA 1DGRM 4XR6A 4KITB 2IXSA 2QKMB 1FMWA 2VJ4A 1OR7C 3SEQA 1ZS2A 4E7KA 4CZCA 2V6EA 2DQMA 4CCJA 1R0KA 4BDYA 1V5FA 3RPUD 2JD1A 3HKZA 4HSRA 3LSGA 2X1DA 4E7SA 3OYGA 2MD0A 3RC8A 4K5OA 3RTRA 5FROA 2CW8A 3PSIA 3H5NA 3LSIA 4PU2A 2V7FA 4QHPA 3D5SC 4GRIA 3B2PA 3I9V2 2PJRA 2IS4A 4Q4EA 4PJNA 3EBIA 1G5AA 2CUZA 2LG4A 3FTWA 2PJRB 3AU9A 4ZQFA 4XNDA 3SDBA 2JSPA 2KMUA 1R6RA 3FHEA 4Q4IA 4XN4A 3C2GA 3DPLC 4E7ZA 1MNEA 3CJQB 3L2WA 3VWBA 2VPLA 4XO5A 2RJIA 5HLTA 4LIUA 5EV7A 3FTUA 1W36C 2CW7A 3EUHC 4ANJA 1Z21A 2FUG2 2KLOA 3NWTA 2PUSA 4XORA 2LH9A 4OOFA 2KPMA 3KX2A 1X4PA 4BQNA 4BEHA 4CCMA 3H9QA 5HNHA 5JMPA 2DCEA 4K5LA 1DQUA 4XN5A 4BEHB 2EGHA 5CQEA 2VKDA 1J09A 2X6WA 2BVLA 2R7WA 1T1RA 3JT1A 2Y1DA 2F6CA 4K5PA 4XN8A 3HOTA 1ONNA 2ZXGA 4XOPA 1MMGA 2W4SA 1QU3A 4XMVA 2E60A 2LOOA 3ZR8X 4BJ6C 2WY8Q 5KHDA 3OYDA 2X1CA 1SFKA 3QODA 4ZDLA 2X6XA 2KHMA 3S3OA 3W2WA 2M0MA 2MFZA 4J01A 1WJDA 2R7XA 2WY7Q 2ZXIA 3N05A 3K10A 2L5QA 2HVRA 5JBIA 3OYNA 2A6TA 4YELA 2K9LA 1T1SA 2BW3A 4JOMA 4HPQA 4ZW3A 3H35A 3FU3A 2W82A 2BW3B 2WADA 1D1BA 4LITA 2V1NA 2VKHA 4B48A 2E1MB 3UCQA 1SC5A 2XSJC 4CSWA 3ANLA 3FUEA 3CJRB 3KEYA 1X19A 4FLSA 3PL8A 2PGGA 3GBGA 3Q43A 3A2KA 2JUGA 2JVGA 2K5CA 4AU7A 2ZSHB 1MW2A 3EUAA 3J7AY 4A03A 1UAAA 1E0EA 1QHHD 3S8PA 2I8DA 4Y6RA 2QJ1A 5KNLA 3B7SA 3OR2C 2IS1A 3DLAA 1ERDA 3A06A 4GAAA 2VB6A 2LY1A 2FFLA 3ZHZA 3PNYA 1PJRA 4LUPA 1MW0A 2MAOA 4BJTA 1SG7A 2JV7A 3DKXA 3ZXSA 3BG6A 3OYBA 2DXIA 4QMEA 4XMTA 2VIXA 2KZVA 4ZDPA 3D5LA 1QHGA 3M1CA 4ZW7A 4B3XA 4Y3OA 4XO4A 3OYKA 4XLHA 4PVBA 3HPGA 3IP4B 3PFYA 2VQHA 3AL0B 2XPZA 1W36D 4RSYA 3WQQA 1Z3YA 4KJZA 5AENA 1D0YA 2GOMA 4DOZA 3HPHA 2HPIA 3QYEA 1MW1A 2LRDA 3FUDA 3MKWB 2XF7A 2V26A 3K4KA 3HG9A 4XLEA 3L2UA 4Y67A 2JVHA 1BR1A 3DU6A 4CH7A 4DIQA 2WAEA 3OR1C 3EBHA 3ZI0A 2XQ0A 3BLYA 3E1SA 4FLQA 1K5HA 2VJJA 4BJ5C 1JG9A 3FH7A 1G59A 3SEZA 2ELJA 4R5TA 2L9NA 3DQVC 1Z7LA 2OV7A 4OOEA 4Y6SA 3K4BA 3FU5A 2HNHA 4XLAA 2GTQA 3OL4A 2BOLA 4K5NA 2F5VA 3H5AA 2XDVA 3DEEA 1ZELA 4B43A 2QVWA 4ITVA 2M4GA 2XC7A 3DTIA 4DBQA 3CIAA 4J00A 3FUMA 3UEQA 3T8VA 2ZXHA 3LL7A 4BUPA 3ZGKA 3B7UX 3A4CA 1N77A 4ZX4A 2KDOA 4E7LA 1X4OA 3AU8A 4HRIA 4KP7A 2CV0A 3M8JA 2VXZA 4ZW5A 2Y1EA 3CMMA 3CHQA 3BG7A 3OYEA 2R72A 4C9YA 2E5NA 1MMNA 4BDZA 3FUHA 4DJAA 4P5OA 4F52A 3FUJA 2HPMA 2X51A 2O5RA 4XN3A 3BCAA 3DWLE 4BE2A 2CFOA 1LFPA 4LG3A 3HC7A 4FETA 4LIVA 4QPOA 1JVSA 2HPOA 2CV1A 3CZGA 4RVBA 3MMYB 2UWMA 3C2HA 4XN9A 4E7HA 2R7UA 3UR3C 4CUGA 2Y1GA 3WQRA 2DOAA 2HDWA 3OY9A 5JMWA 3CESA 1X3ZA 1HS6A 1Y56A 4ARFA 3OYMA 3QOEA 4XMYA 4Y4RA 3ZCOA 4II2A 1H3LA 3KYLA 2DQ6A 4ZYAA 4J3BA 1BR2A 4F55A 4RCVA 1S46A 5DLLA 4NC8A 2PMZA 1WJ5A 1MMDA 2GOXB 3AFHA 3OOUA 3K4CA 2RQQA 2A5WA 3IIEA 3ANNA 4QPQA 5DYFA 3W2AA 4L2LA 4XL9A 2MC4A 3DPTA 3VDXA 2VJ8A 2WPGA 4X2UA 3QJXA 1WFXA 4IZZA 2O7GA 2P0WA 1YX5A 3Q44A 3F9KA 4PUSA 4PSWA 2R7QA 2LC2A 2VJ5A 5BPPA 3OIPA 3S32A 3DTEA 1TT0A 2VQLA 4ZTFA 1X3WA 2JCYA 3W2VA 4II3A 2XF5A 3CZLA 1T95A 2HZDA 3FU0A 4XN0A 1YX3A 2WA0A 2V4JC 1ONPA 2WAFA 3S3NA 1LDKB 4BE1A 2R7VA 4XMUA 4XNAA 3RQ4A 2C82A 2IGKA 1D1AA 4IQ4A 2R7TA 3EBGA 4OAZA 2KQRA 4YRVA 3B3BA 1OLTA 1N78A 4OAYA 4F91B 4XQFA 2IGOA 4AYBA 3EPZA 3ZRGA 2C5ZA 2Q1ZB 1NG6A 4BACA 4ZQEA 2E1MC 2LBFA 3A14A 4K5MA 2HVQA 2OC6A 2JD0A 3CHRA 3VYUB 4QPEA 2LBFB 3VSKA 1Q0QA 3EUKL 3RASA 4CXFA 2IGMA 3CHSA 2V9KA 3K4MA 2JCVA 2PL5A 4ZC3A 3D5RC 2L7KA 2WAQA 3TBIA 4B44A 3SYTA 4H4KC 4RLFA 3S93A 4F3QA 4AYSA 5CPRB 4D9JA 3K6GA 2QKLB 1Z3XA 4Y33A 4F93B 3DPUA 4XN2A 5CQGA 2L2OA 4BU2A 4N4OB 4C2TA 3OS0A 2VQGA 3L2VA 4XLFA 3SZGA 5LD2C 4R5XA 4HEA2 2CMPA 2X85A 1BOBA 4XN7A 4XNBA 2R59A 1S9HA 3AL0C 3CF2A 3ANMA 3ZHXA 4Y6PA 2R7SA 4RM2A 1K6YA 2Z2SB 4PJMA 3ZHYA 2ZFUA 4JNDA 2W7NA 3ZQQA 3VVMA 4HSTA 4PW4A 4DGWB 2M4KA 3E0JB 2M7AA 2RNGA 1SQMA 1UG0A 3OS2A 3PSFA 4DPRA 4BS9A 3R0IA 1LVKA 1X1BA 3K4JA 3DKYA 2UUZA 4MLOA 4R7LA 4P1WA 2A7OA 4FLRA 4EATA 3OYLA 2VLAA 4AR8A 4XMXA 2R7RA 5FRNA 2CH0A 5JO0A 2LYCA 3A1YA 4HNUA 1OR7A 2X6YA 3OYCA 3B37A 4HNTA 4NC7A 1SAUA 2XAUA 1R0LA 4OWRB 1NG7A 4AICA 2OUMA 4RM3A 3LSHA 4XONA 3VYRB 3FU6A 1WJAA 4C30A 3FTSA 4CA0A 3L2QA 2MAPA 5TGTA 4ZQTA 1T0FC 4RLQA 2VJIA 3KEDA 3B2XA 1V5GA 3FTYA 1JGIA 4XM3A 5JAZA 2Z16A 1IRXA 2XF6A 4U7BA 4MS6A 4BGDA 3G2BA 3H9GA 5DULA 2BVMA 3LFUA 3LMMA 3U21A 4ZDOA 1LKXA 1DGWY 3AUAA 4ZQGA 2K3PA 2IS6A 3U9WA 3B34A 4RMNA 3HXLA 1DP3A 4G6TB 2HQAA 5LFAA 5FRMA 1MMAA 4N4NB 4ZTJA 3DTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNF A;  5HLT A;  5HNH A;  2VLA A; 
#chains in the Genus database with same CATH topology
 1RET A;  5ED4 A;  4PFO A;  5A2Q K;  1JI8 A;  3HSE A;  2JCX A;  4IKF A;  3ISP A;  1BA5 A;  1V5E A;  4ZX6 A;  1OCZ H;  2K40 A;  4HLY A;  3CC2 I;  1T2K A;  1WQ2 A;  3VOE A;  4QLC U;  2D45 A;  1VQ6 I;  3K70 C;  1VZ0 A;  1AA7 A;  4M3D A;  4KUM A;  4OU0 A;  4E6K G;  2NVX J;  2JPB A;  1GW6 A;  2L9S A;  2DJI A;  4IHX A;  4UB8 C;  3PO2 J;  3BT9 A;  4MO7 A;  2JRT A;  1XGN A;  5B3S H;  3FTZ A;  1WZ2 A;  1FSH A;  1Y6I A;  3COA C;  1MZB A;  2FMY A;  3FXJ A;  3KEQ A;  1ZR4 A;  1DU0 A;  3KZY A;  1IDY A;  3FH5 A;  1ETQ A;  3LSP A;  3P9C A;  2LRE A;  2VAS A;  2JUC A;  4XKV A;  5F64 A;  2EZK A;  2CO5 A;  1YW8 A;  4CO8 A;  1HA8 A;  4EM1 A;  4IX7 A;  4M72 A;  2BEO A;  2NOJ B;  2MH9 A;  2HYG D;  3MKY B;  3CF5 F;  3HOY J;  4A2U A;  2WZF A;  3V7S A;  3MKZ A;  1YO5 C;  4YIR X;  1RC9 A;  2EIM H;  1Q0H A;  5FKM A;  3TL4 X;  1MND A;  2FQ4 A;  4U88 A;  2EZI A;  2LY2 A;  4R79 A;  2HVS A;  2F2E A;  2VI6 A;  4AVZ A;  5D8L B;  1ZGA A;  3UER A;  4C2U A;  1UEL B;  2Y69 H;  1VFC A;  3H36 A;  3E6M A;  4N9H A;  3WTZ A;  2M5W A;  4MKT A;  2IW5 A;  3VVL A;  4BXX J;  2VBX A;  2DTZ A;  5BPI A;  1S3J A;  4LLN A;  3I3L A;  1X1A A;  3W6K B;  4FAS D;  2HTS A;  4G7Z F;  3ZQC A;  2M8E A;  1PYV A;  3QAH A;  4D5F A;  2UZK A;  2WB1 A;  2BBY A;  5KCM A;  1KON A;  2JK3 A;  1RZ4 A;  1MBF A;  4ZN6 A;  4G7H F;  4HYE A;  3CDI A;  2ELH A;  2JN6 A;  5JFR A;  5C44 J;  1PP7 U;  1CGP A;  5EG0 A;  2CGP A;  5FKN A;  4XO3 A;  5AIP A;  3RC3 A;  3K70 D;  5EG0 B;  3FUL A;  2FEZ A;  5FWQ A;  2R7O A;  3V7R A;  2HKX A;  2DT5 A;  2KIS A;  5HS7 A;  2GWR A;  5HLI A;  2MLK A;  2PG4 A;  5J47 A;  1JJ6 C;  2JD2 A;  3S16 J;  3WQS B;  1JHF A;  4CIC A;  2HZT A;  1P9Q C;  2FQ3 A;  4DZJ A;  5K5R A;  4QIR A;  3FXL A;  2XHK A;  2UV1 A;  1ORK A;  1ZLK A;  5GTH C;  4XLP F;  1P92 A;  3AKZ A;  5E18 F;  3OYH A;  1N75 A;  4CCL A;  3FKJ A;  3RYP A;  3MVP A;  3WGH A;  2EIN H;  1ZRE A;  2IA0 A;  3CC7 I;  4CHU A;  2FNP A;  1DGR M;  4XR6 A;  1B9N A;  2EQR A;  4KIT B;  2QKM B;  2VJ4 A;  3K0L A;  1OR7 C;  2FBI A;  4A0X A;  1R0K A;  3RPU D;  3ZMV A;  1YLF A;  3GF2 A;  3LSG A;  2FE3 A;  3RKY A;  3GFM A;  3ZQH A;  1ZG1 A;  3O8G A;  3RC8 A;  1R22 A;  2ZFW A;  3RIR A;  3RTR A;  3SZP A;  5H2F C;  4K5O A;  2EV6 A;  1FYL A;  2HOA A;  2V7F A;  4QHP A;  2DN0 A;  5HS9 A;  2DBB A;  2HR3 A;  2HWV A;  3BTI A;  2FA5 A;  1AKH A;  1HKT A;  1O3T A;  3FTW A;  1W5T A;  1AKH B;  3SDB A;  1JHH A;  2KMU A;  2ICW G;  3TP0 A;  1R23 A;  4NC6 A;  3BG5 A;  4UV8 A;  3DPL C;  4E7Z A;  3U1K A;  4HX4 A;  5FD6 A;  4N9I A;  5AON A;  3JRE A;  2RJI A;  1C0W A;  3FTU A;  1B72 A;  3JTG A;  5HOD A;  2QEN A;  3FHZ A;  5KVR A;  1B72 B;  2R7D A;  2E35 A;  4OOF A;  2A3S A;  5HNH A;  3H9Q A;  2XAJ A;  5K1Y A;  2DCE A;  2Y30 A;  1J5Y A;  1R71 A;  5FKL A;  2EGH A;  3WTW C;  1J09 A;  3MCZ A;  3JRD A;  1UHW A;  3QPH A;  2XV4 S;  2WC2 A;  1ONN A;  4XOP A;  3HRU A;  3HEF A;  3V4G A;  1QU3 A;  4D7N A;  2QA4 I;  5C3E J;  5KHD A;  3OYD A;  2X1C A;  3C2B A;  4I02 A;  3ERM A;  4ZDL A;  2OZ6 A;  4P9U A;  3W2W A;  2ZJR F;  1T56 A;  2MFZ A;  1P4W A;  2R7X A;  2ZXI A;  3K10 A;  2HVR A;  4I6Z A;  5E20 A;  3OYN A;  4C3H J;  1TQM A;  1IN7 A;  2EV0 A;  2BW3 A;  2DLL A;  4GGG A;  1SFE A;  4AVP A;  5FLX Z;  2QSH X;  2BW3 B;  2WAD A;  1WVR A;  3UCQ A;  3ZMD A;  3UKG A;  1IGN A;  1IUF A;  3FF5 A;  4IO9 F;  3C1D A;  1MBJ A;  3PL8 A;  2A05 A;  2WWY A;  1MH3 A;  2JUG A;  3KZI C;  3CCS I;  1MW2 A;  4AD9 A;  1E0E A;  1XCB A;  2DQL A;  2EZH A;  2P6S A;  2H6B A;  2I8D A;  3S8P A;  2QJ1 A;  3DEU A;  2C6Y A;  3B7S A;  3OR2 C;  1ERD A;  3A06 A;  3HTU A;  4A3J J;  2MW8 A;  2CQN A;  2LY1 A;  3U1D A;  3G73 A;  3PNY A;  1APL C;  4IHV A;  1IDZ A;  1TWF J;  2GA2 A;  4A5N A;  4B3A A;  2FOK A;  2VT2 A;  1WKM A;  4BNC A;  5FLV A;  2KZV A;  4ZDP A;  4ZW7 A;  2XAH A;  3RZD J;  2Q8K A;  2A61 A;  3R4K A;  1B6A A;  1JTX A;  4Y3O A;  4IOC F;  1ZRC A;  2VQH A;  2EZL A;  3GTL J;  2XPZ A;  3F21 A;  3ULQ B;  4DOZ A;  4I7H A;  1MW1 A;  3E97 A;  1T38 A;  4HX8 A;  3U2R A;  3FXO A;  3DV8 A;  4XSZ F;  3L2U A;  4Y67 A;  3P9K A;  1HCR A;  2VPR A;  1IG7 A;  2Y31 A;  2OF7 A;  4IJA A;  3HZJ A;  3I4P A;  3FM5 A;  2WAE A;  1GVD A;  2M30 A;  3E1S A;  2VJJ A;  4W97 A;  1R36 A;  1UB9 A;  2E1C A;  2OTJ I;  1GV2 A;  2DOD A;  2KDZ A;  3L09 A;  5DEQ A;  3DBL B;  3K4B A;  3FMQ A;  1ON1 A;  2K9S A;  2HNH A;  3FU5 A;  2GTQ A;  3OL4 A;  4Z2Y A;  1JKO C;  2DK5 A;  2ZME A;  2GQQ A;  1OKR A;  4GO1 A;  5E79 C;  3I58 A;  2NS0 A;  3JRG A;  1D8K A;  4B43 A;  2ZME B;  2QVW A;  1XGS A;  4A3E J;  3BOQ A;  1QZY A;  3JSP A;  1K4T A;  4RAF A;  1MSF C;  4DBQ A;  4J00 A;  1S7E A;  1W0T A;  2KIF A;  1KU7 A;  2EIK H;  2AXL A;  4L5I A;  3UEQ A;  3V7C A;  3B7U X;  1LB2 A;  1ZKG A;  1X4O A;  3HOZ J;  3AU8 A;  2DA4 A;  2FBK A;  4L9J A;  2O7O A;  2LTP A;  2AS5 F;  4XSX F;  2MC3 A;  1SD4 A;  1DPU A;  2HKO A;  4I76 A;  1MMN A;  2F5E A;  4OOI A;  1AOY A;  4DJA A;  4P5O A;  4S05 A;  2X51 A;  2K3F A;  1XGO A;  2CFO A;  2CQX A;  1Z9C A;  2HPO A;  3HC7 A;  5BOX A;  5FLM J;  1I39 A;  2E34 A;  2ID6 A;  1Z91 A;  3F0C A;  1BN5 A;  1HW1 A;  3MMY B;  4MHG A;  1KA8 A;  3C2H A;  3CZG A;  4XN9 A;  3VPR A;  3UR3 C;  4CUG A;  2Y1G A;  2DOA A;  3OY9 A;  5M3F J;  4ARF A;  4EJV A;  3OYM A;  4II2 A;  1J59 A;  3KYL A;  1VF9 A;  1IO2 A;  1FX7 A;  3LNQ A;  4NC8 A;  3WHC A;  4KFC A;  4LMY A;  2GOX B;  3J80 K;  4ETS A;  4A6E A;  1FC3 A;  1S5L C;  4Y17 A;  4RA2 A;  5FJ8 J;  3B6C A;  1SFU A;  4L2L A;  4Q47 A;  2M1B A;  3VDX A;  4FX0 A;  3ABK H;  3QPL A;  4JX5 A;  1WFX A;  1SD5 A;  3ZQL A;  3PIO F;  3BJ6 A;  3S1N J;  2IRF G;  2DOE A;  1YX5 A;  4BHP A;  2DYR H;  2EIL H;  3MZH A;  4BBS J;  3OIP A;  5BPP A;  3S32 A;  1TT0 A;  2DA1 A;  3DTE A;  2JCY A;  1R5H A;  2TCT A;  3MN2 A;  4UUT A;  3RPU A;  2XF5 A;  3BG9 A;  3CZL A;  2HZD A;  1LEA A;  1P7I A;  2WTE A;  4A6D A;  2FU4 A;  4XMU A;  2YPR A;  3HB9 A;  4A0Z A;  5M5W J;  5GAH J;  3RQ4 A;  1P7J A;  1U78 A;  1Z77 A;  3T5X A;  1IAW A;  1SMY F;  2K7L A;  3K9T A;  5L3F A;  4YRV A;  1HBX G;  1JKQ C;  2LVS A;  2KJC A;  3EPZ A;  5DTD A;  4A3D J;  2Y75 A;  5AIQ A;  1NG6 A;  3BWG A;  1RRJ A;  2LBF A;  1UFM A;  3VEP A;  2HVQ A;  1LDJ A;  5CLS A;  2JD0 A;  2LBF B;  4JBA A;  3VSK A;  3KP5 A;  4CXF A;  2XAQ A;  1UHS A;  5BQT A;  3CHS A;  2PLY A;  2JCV A;  2BV6 A;  2L7K A;  2WAQ A;  1BI3 A;  4RLF A;  5CPR B;  4D9J A;  4A3C J;  1Z3X A;  2LFB A;  5CQG A;  1YW9 A;  1XGM A;  4BU2 A;  2NYX A;  2QYO A;  2VQG A;  5JR3 A;  3OS0 A;  3AAF A;  3AG1 H;  2KRF A;  4MFE A;  4XLF A;  3WU1 B;  4YIF A;  1F43 A;  4R5X A;  2ZCW A;  1IXS B;  2QQ9 A;  5BS6 A;  4I0A A;  4G9Y A;  2X85 A;  5DCF A;  4XNB A;  1KGS A;  1S9H A;  2R59 A;  3CUQ C;  3AL0 C;  4RAZ A;  4D5C A;  5D5V B;  1O4X A;  4RM2 A;  4K2E A;  1K6Y A;  2Z2S B;  1BC7 C;  3ZHY A;  2VKE A;  2B63 J;  3CTA A;  1F9N A;  3DP7 A;  2W7N A;  5KAF C;  3VVM A;  1XSX A;  3PQJ A;  1BW5 A;  3L00 A;  2H1K A;  1RKW A;  1HDP A;  4BS9 A;  3O2P E;  2MD5 A;  4IPA A;  2UUZ A;  4MLO A;  3ELK A;  4R7L A;  4GYI A;  4HQM A;  3L2C A;  3H92 A;  4FLR A;  2VLA A;  2QSF X;  3TKY A;  3A1Y A;  1OR7 A;  1QPM A;  4XIC A;  2X6Y A;  3B37 A;  1SFO J;  3AG4 H;  2XAU A;  3F8B A;  5J1Y A;  5H20 A;  1MGT A;  2DMN A;  2W24 A;  2RN7 A;  1JTY A;  4C30 A;  1PP8 F;  3L2Q A;  2JA5 J;  4A3I J;  3KED A;  1IN4 A;  1WRJ A;  2FD5 A;  2NOG A;  1JUP A;  1ZG5 A;  4U7B A;  2Z33 A;  3VFZ A;  4BGD A;  3G2B A;  3H9G A;  5DUL A;  2OA4 A;  3LWF A;  2NXN B;  2FXA A;  4PGG A;  4L9T A;  2IS6 A;  5F1R A;  2GIV A;  4XLN F;  3IH3 A;  5LFA A;  4CDG A;  4KYW A;  2LD5 A;  3K4L A;  1K79 A;  1K7A A;  1CF7 A;  4D1Q A;  3FHN A;  1Q0L A;  1D1C A;  4W1U A;  1F4K A;  4WWC A;  4XKC A;  1CF7 B;  3ABL H;  5KAI C;  4ZW6 A;  2GLO A;  1Y0U A;  5KK1 A;  2NNY A;  2W48 A;  4PJJ A;  2CS3 A;  2ZSI B;  3VOD A;  4U7D A;  4BE0 A;  4ENJ A;  1O7L A;  1Z67 A;  2IGN A;  4BAY A;  2MSY A;  1MBK A;  4A69 C;  3H9J A;  5K5O A;  3TOA A;  3JR9 A;  1ETO A;  3CDH A;  3FDY A;  1KQ8 A;  3C18 A;  3HUG B;  1SVM A;  3KE2 A;  2L02 A;  3LSM A;  1GXQ A;  4NUB A;  4QUO A;  1X2M A;  3L7W A;  2F5D A;  3LA2 A;  9ANT A;  4Y13 A;  2VOD A;  1OPC A;  1DU6 A;  2L9V A;  2OCC H;  3ONQ A;  3RYR A;  4D0P A;  2Y1C A;  1IZ1 A;  4U0Y A;  4DQ2 A;  4U87 A;  5DV5 A;  3KEO A;  4GAE A;  2AQF A;  1MJ9 A;  4ZYG A;  2VBY A;  5JVT A;  3JRF A;  5BPD A;  2Y0S N;  2VC0 A;  3CZE A;  2Y2Z A;  2HPT A;  2V6C A;  4EQQ A;  2FX0 A;  3H0D A;  3BR1 A;  3IUO A;  4KIS A;  1LVA A;  3S15 J;  2KL4 A;  3V42 A;  1BI1 A;  2V79 A;  3QYB A;  4A0Y A;  2MLG A;  3CUO A;  3KPH A;  3LSK A;  1I1G A;  2E7W A;  4KMU X;  3FBN B;  1WJF A;  4PK4 A;  2Y9Z A;  4XMZ A;  2Z1D A;  3OYJ A;  3BPV A;  4BQO A;  2D1H A;  3CHP A;  3PNT A;  4XLC A;  4XNF A;  1G2H A;  1MH4 A;  4RAY A;  2DMQ A;  3K1P A;  3HIF A;  3GO5 A;  3L2R A;  2DDB A;  3IAS 2;  2W57 A;  3GLL A;  3HHG A;  2MBF A;  3OWT A;  1XDU A;  2Q2E A;  2EB7 A;  1FZP B;  1VTN C;  2Q2E B;  4HF0 A;  3HL2 A;  1SAX A;  1OCC H;  3X2Q H;  1OYY A;  2DMP A;  2MYS A;  1A31 A;  2I10 A;  5IP7 J;  4ESF A;  3OYI A;  4CCN A;  4WXC A;  2KFD A;  4IQJ A;  3QYF A;  3F8N A;  5FLX K;  1U3E M;  2RRE A;  3HSR A;  2PX9 A;  3WHB A;  2KRC A;  3HRT A;  1R4N B;  4OIN F;  3CZK A;  3FUN A;  1ZTR A;  4PSX A;  1Z6T A;  1T8I A;  3TMO A;  3MKL A;  3ASO H;  1FMV A;  4G12 A;  4NQW A;  3ZQ7 A;  4C2M J;  5IYB J;  3FBI B;  3R0A A;  2E7X A;  3K2Z A;  5E3O A;  4UB6 C;  1VQL I;  3I54 A;  4NQW B;  2EK5 A;  4BXU A;  2DT7 B;  1VI0 A;  3IAM 2;  1GT0 C;  1WI9 A;  5CJ9 A;  2B61 A;  1G4D A;  5JC1 A;  3JW4 A;  2XGX A;  5HNF A;  1EV7 A;  1YG2 A;  4FE7 A;  4I09 A;  4BXF A;  3CMA I;  2PI0 A;  2I5U A;  4DBR A;  3NWS A;  2CFX A;  1AHD P;  2CUF A;  3HKZ N;  5D6F A;  1IXR C;  2ZNY A;  3RZO J;  2LP0 A;  4M3G A;  3T1B A;  2WV0 A;  3I55 I;  2QQ8 A;  1NH3 A;  2VQC A;  1WHU A;  3MD2 A;  4PFP A;  4M6Y A;  4I2O A;  4O6J A;  2DOF A;  2F48 A;  1ZS2 A;  4E7K A;  2V6E A;  2YS9 A;  5DYM A;  4I01 A;  1V5F A;  2JD1 A;  2M9H A;  4E7S A;  1BW6 A;  3IWZ A;  4RDU A;  1A6I A;  1V54 H;  2MD0 A;  2YSR A;  5C4J J;  5FRO A;  2CW8 A;  3PSI A;  2JMW A;  4YFK F;  3BTC A;  3H5N A;  4HDU A;  1A6Q A;  4XRF A;  1Z05 A;  3ABT A;  4EGZ A;  1T6S A;  3B2P A;  4GRI A;  2HFH A;  4Q4E A;  2RNJ A;  1G5A A;  2CUZ A;  1JUM A;  3AU9 A;  4ZQF A;  4XND A;  1FWZ A;  2O0Y A;  3RQI A;  3CCQ I;  2LLK A;  2EFQ A;  3ZQI A;  4XN4 A;  1UZC A;  2G9W A;  2DA5 A;  5J8F A;  4XO5 A;  2H94 A;  1ZN2 A;  4LIU A;  5ILS A;  1JXS A;  2TRT A;  1RR8 C;  2ZO4 A;  5L3G A;  2B9S A;  2CW7 A;  3EUH C;  4A3B J;  4QSH A;  1R49 A;  3NWT A;  2FUG 2;  3GCM A;  4ON0 A;  3TDU C;  2OQG A;  3KX2 A;  1X4P A;  4BQN A;  4CCM A;  5JMP A;  3GTG J;  4KDP A;  3BG3 A;  3F6V A;  3S2W A;  4XRS G;  3TO7 A;  2RDP A;  5LHI A;  1YIO A;  3F8F A;  2R7W A;  4FHT A;  2E2J J;  2F6C A;  4XN8 A;  5J1R A;  4IF4 A;  2ZXG A;  2L4M A;  2HDC A;  3WGI A;  2LOO A;  2IP2 A;  3FK6 A;  3A0B C;  1IN6 A;  4N0B A;  3BQY A;  5D8K B;  3CCJ I;  1ZR2 A;  4LLG F;  2YX4 A;  1WJD A;  2EPF A;  3ESW B;  2WY7 Q;  3N05 A;  1HLV A;  3WTX C;  2A6T A;  1T1S A;  2K9L A;  2MA3 A;  2HYJ A;  3BR0 A;  1OYW A;  4HPQ A;  3TDZ C;  4ZW3 A;  3H35 A;  3S1M J;  2HGC A;  1HW5 A;  2JRM A;  2V1N A;  2VKH A;  2XSJ C;  3ANL A;  3ZOB A;  3PIP F;  3S17 J;  3KEY A;  2LKP A;  5B1A H;  3GFJ A;  1YI2 I;  3ZPL A;  3HJE A;  2DI3 A;  4OIO F;  1K6O A;  3A2K A;  1VQP I;  4AU7 A;  3J7A O;  4A03 A;  1TTY A;  2NS8 A;  2VON A;  2M45 A;  4Y6R A;  3OSF A;  1V4R A;  5DM6 F;  5KNL A;  5CVI A;  2BY1 A;  3ECO A;  1TWC J;  2ZB9 A;  5EEH A;  5FKO A;  3ZXS A;  2DXI A;  3OYB A;  2O61 A;  3M4O J;  2XRO A;  3QPS A;  4XMT A;  2Y0M A;  3G71 I;  3CUQ A;  3E5Q A;  3OYK A;  1IRG A;  3HPG A;  3CUQ B;  3PFY A;  3AL0 B;  1VQ4 I;  2O6G E;  1FBU A;  1Z3Y A;  4KJZ A;  5AEN A;  4IOA F;  1LUJ B;  3HPH A;  3QYE A;  3QRF F;  1IRF A;  2R7Z J;  4HQE A;  1XSV A;  4IRG A;  2V26 A;  3K4K A;  3BJA A;  1WSU A;  5E8G A;  3R6S A;  2JVH A;  4GFB A;  3FM3 A;  4CH7 A;  2KKO A;  3GTO J;  3OR1 C;  3EBH A;  3ZI0 A;  2OCE A;  1F36 A;  5J40 A;  1TT5 B;  3T8T A;  1JG9 A;  4DW6 A;  5L3E A;  1K5H A;  3FH7 A;  2K4J A;  3DKW A;  3SEZ A;  5EEA A;  4R5T A;  1EH8 A;  3DQV C;  4A3K J;  1Z7L A;  2OV7 A;  5LHH A;  1RNL A;  1E2X A;  3FXK A;  4PDK A;  1W1W E;  1B1B A;  2CJJ A;  3HM5 A;  2E19 A;  1QPI A;  3E6C C;  1P4A A;  4ITV A;  5JI6 A;  2M4G A;  3DTI A;  2MGQ A;  4P9F A;  3MZY A;  4FE4 A;  4ZYE A;  1N77 A;  4ZX4 A;  4E7L A;  2GM4 A;  1S8N A;  2QSG X;  3N97 A;  2RV8 A;  3CMM A;  5EZG A;  1M1E B;  2R72 A;  4BDZ A;  3FUH A;  1IC8 A;  1J0R A;  2O5R A;  3IRR A;  5F08 A;  1REP C;  3ML6 A;  4FTH A;  2PMZ N;  3DWL E;  1X58 A;  1LFP A;  4FET A;  1JVS A;  2CG4 A;  2CV1 A;  3PM1 A;  4RVB A;  1B8I A;  3TQN A;  2JTV A;  2UWM A;  5F27 A;  2UXX A;  4FT8 A;  4E7H A;  3H1C A;  3WQR A;  1LNW A;  3G1M A;  1HS6 A;  1Y56 A;  1X3Z A;  3Q0V A;  3QOE A;  1LPQ A;  1USS A;  2R93 J;  1HF0 A;  5K7F A;  2HXI A;  3CCR I;  1X3Z B;  4F55 A;  4RCV A;  1GV5 A;  5J8C A;  1MKM A;  3LSR A;  5B66 C;  1MMD A;  1Q1V A;  1R1T A;  1YW7 A;  3AFH A;  1ZAR A;  3OOU A;  1ODD A;  4UUV A;  4EM2 A;  3IIE A;  3OIO A;  2OJE D;  2P7C B;  3LQQ A;  2MC4 A;  3E6D A;  2WPG A;  5F1J A;  4X2U A;  2XPV A;  3NQO A;  5HDK A;  4AID A;  4IZZ A;  1BC8 C;  5F0F A;  3I59 A;  4PZJ A;  4M6X A;  3I59 B;  4PUS A;  3WG7 H;  2R7Q A;  5M5X J;  4ESJ A;  4RGX A;  1FYM A;  2EV5 A;  1X3W A;  2DFF A;  2OBP A;  3B02 A;  3W6J B;  1MMS A;  2DA2 A;  3W2V A;  1HKQ A;  3LSJ A;  4II3 A;  3CJT B;  1T95 A;  4XN0 A;  1XMK A;  3IV5 A;  1OCP A;  2IBD A;  3S3N A;  1LDK B;  5JLX A;  1S7O A;  1H89 C;  1XN7 A;  3CLO A;  2IGK A;  1D1A A;  4HA8 A;  2K86 A;  1J2X A;  2KIM A;  2E2I J;  1PUE E;  3CC4 I;  2R5Z A;  4IXA A;  4ESB A;  4F91 B;  1OJL A;  1IXC A;  1YHQ I;  1HQC A;  2R5Z B;  4AYB A;  2C5Z A;  2Q1Z B;  4BQA A;  4ZQE A;  2E1M C;  2CU7 A;  2OC6 A;  3CMY A;  4C3J J;  1R1U A;  2V1D A;  3WTV C;  3RAS A;  5LRS A;  3BZK A;  4RB3 C;  2P8T A;  3JRA A;  2V9K A;  3ERE D;  1H0M A;  1ETW A;  3IKT A;  2FJ1 A;  3TBI A;  4B44 A;  3SYT A;  1TNT A;  4H4K C;  2XPW A;  3L9F A;  4F3Q A;  3Q0W A;  2R7F A;  1ZAO A;  4F93 B;  1TQP A;  3FWE A;  2L2O A;  2MH2 A;  2Q0O A;  4N4O B;  2VE9 A;  2V9P A;  3CJN A;  3L2V A;  1WI3 A;  5E3M A;  2HQN A;  5IOZ A;  2M34 A;  4HEA 2;  1S72 I;  2ZNZ A;  1KYZ A;  4OMZ A;  3HRS A;  2JPC A;  1QNT A;  2LY9 A;  2ZXJ A;  2ECC A;  2PMU A;  3LAP A;  5L3C A;  3CF2 A;  5L3B A;  2XUB A;  4EV0 A;  4Y6P A;  1Y0N A;  4EEF G;  3OSG A;  1LQ1 A;  5B5E C;  2KIQ A;  5IT9 Z;  2L7Z A;  3RKQ A;  2JA7 J;  2XIG A;  4XBF A;  1YYV A;  4DGW B;  3E0J B;  2M7A A;  1SQM A;  1X3U A;  1VQ7 I;  3RPQ A;  3R0I A;  1LVK A;  2O8K A;  4EMS A;  1X1B A;  3D0S A;  2AXT C;  4AM3 A;  3K4J A;  2W84 A;  4P1W A;  2F5C A;  4U0W A;  1ZYR F;  4EAT A;  3OYL A;  3HDD A;  3HHH A;  2P81 A;  1P2F A;  4XMX A;  4QWQ A;  3E3V A;  4HNT A;  4NC7 A;  2A5Y B;  1LE8 A;  1R0L A;  1BI2 A;  2QM3 A;  5FD5 A;  1ETX A;  3C7J A;  3LSH A;  1LE8 B;  3P9I A;  4XON A;  3CCE I;  1B4A A;  3FU6 A;  5DCM A;  4IRI A;  2DPU A;  3FTS A;  1W7P D;  1I3A A;  2ID3 A;  1U2W A;  2D1V A;  3GVA A;  4L18 B;  2MAP A;  1T0F C;  2VJI A;  3KP3 A;  3B2X A;  1V5G A;  4MQ9 F;  4LLL A;  3FK7 A;  3FZV A;  4XM3 A;  1YIT I;  3FTY A;  5JAZ A;  1JUS A;  2Z16 A;  2H1L A;  2QWW A;  3ZMS A;  4MS6 A;  3K7A J;  3LQR A;  3OOP A;  3R0J A;  3GUD A;  3QQA A;  3FXU A;  4D7M A;  1HC8 A;  4ZQG A;  4RMN A;  3QWL A;  3HXL A;  1H8A C;  4JX6 A;  2LSO A;  3K1M A;  5E1W A;  4ZTJ A;  4HV5 A;  3BZC A;  3RCO A;  2F4I A;  2PFB A;  3U9G A;  4L0Y B;  2BGC A;  4KIB A;  4AR9 A;  4ZQH A;  1X1D A;  2HQ5 A;  3EUH A;  4XK4 A;  2OU2 A;  5BMZ A;  2DW4 A;  1MW7 A;  1EA3 A;  2ZJQ F;  2PJP A;  3OS1 A;  5K7Z A;  1YJN I;  3RSN A;  4YEJ A;  4KT6 A;  2RC4 A;  3HOV J;  5IYC J;  3SHF A;  4Z6Y A;  2IS2 A;  2KT0 A;  4DNC A;  5D4S A;  2Y9Y A;  2VBW A;  2CWE A;  3S1Q J;  2DT6 A;  2P4W A;  4XOT A;  1ZH5 A;  3Q9V A;  3IWF A;  4LK1 F;  3ECH A;  3CXB A;  1YE9 A;  2BZT A;  2K85 A;  2X1E A;  3W3C A;  1T33 A;  3OIQ A;  1DDN A;  4FCA A;  3T0Y A;  5TIS C;  2QBY A;  3FTX A;  1GXP A;  3JSZ A;  2DFH A;  1WJE A;  1PVE A;  3FUK A;  3M8F A;  5IT3 A;  3VSL A;  1FTZ A;  4B09 A;  2W00 A;  3FH8 A;  2QUF A;  3WG9 A;  3G4S I;  3TED A;  2XAG A;  4BL0 B;  1RP3 A;  4E7J A;  2VXD A;  1A04 A;  3JCU C;  3QP5 A;  3OYA A;  2Y1F A;  1Z0X A;  5DD8 A;  2G7U A;  1CQT A;  3S14 J;  1YFH A;  4XMW A;  2QZ8 A;  2A6H F;  3B7T A;  3J81 Z;  2WZG A;  1SFX A;  2DK8 A;  2IPQ X;  1R9T J;  3V8J A;  2WB1 N;  4RBO A;  2MAB A;  2X6O A;  4DYR A;  2GXG A;  2ETH A;  2L54 A;  1E3O C;  3WTU C;  3OMY A;  4AC0 A;  2FF4 A;  1FOK A;  1U0J A;  5F0C A;  4X0G A;  4XID A;  1KU3 A;  2AQE A;  2O03 A;  1TZL A;  3TGN A;  2M7B A;  3HTS B;  1BR4 A;  4MTD A;  3HOW J;  1ONO A;  2STT A;  3B7R L;  1ZRF A;  2KP6 A;  1MJB A;  2BY3 A;  2F4M B;  3DFG A;  2ZC2 A;  3KYC B;  4FLO A;  4HW0 A;  2E1O A;  5FFX A;  3IHU A;  3GTJ J;  3BCB A;  4PJL A;  1I3Q J;  4EVI A;  1UG2 A;  2O9L A;  2L7F P;  3JAM Z;  4IHS A;  3OYF A;  1XX5 A;  4O5V A;  1MVY A;  2KRH A;  4EJU A;  3EQL F;  4OIQ F;  3GTP J;  1D0Z A;  4CCK A;  1O3Q A;  1EJ9 A;  4R5V A;  4LJZ F;  3CHO A;  2R70 A;  4XKW A;  5B1B H;  4EJW A;  5F6F A;  5CKT A;  3P7N A;  4WX9 A;  1HDD C;  2W1O A;  1GHC A;  4E7I A;  2CV2 A;  1G6N A;  4HNV A;  2WBM A;  1Y8R B;  4AIJ A;  2VE8 A;  2X4H A;  1WJC A;  2XPY A;  4XN1 A;  2R0Q C;  1RIO H;  1Q1H A;  2IXS A;  1FMW A;  5E1X A;  3SEQ A;  4CZC A;  2DQM A;  1K78 A;  4CCJ A;  1X2N A;  2STW A;  4UXN A;  4HSR A;  3C3W A;  5K5Q A;  1K78 B;  2X1D A;  3OYG A;  5GAG J;  1FTT A;  3DBH B;  2X9D A;  3IH4 A;  2EA4 A;  3FIW A;  4A12 A;  3LSI A;  2GA1 A;  4FIS A;  1WCM J;  2FML A;  1RES A;  5HLH A;  3SFI A;  3I9V 2;  2LMD A;  1IV6 A;  1F5T A;  2IS4 A;  4PJN A;  2CUE A;  1OMI A;  4ABZ A;  3EBI A;  2LG4 A;  2E1N A;  2NAZ A;  3DBR B;  4V2F A;  2XB5 A;  4XRM A;  2H09 A;  3BTL A;  2JSP A;  2IAI A;  1FJL A;  2D2W A;  3P5J A;  3C2G A;  1MNE A;  3CJQ B;  1YOV B;  5DUI A;  3L2W A;  2VPL A;  4ENM A;  3A0H C;  1BJA A;  1QGP A;  5EV7 A;  1W36 C;  1WH7 A;  4ANJ A;  5D4R A;  3QP6 A;  4G6D A;  4MEY F;  1IUY A;  5GTI C;  2PUS A;  4XOR A;  5J4V A;  2FOW A;  2OQR A;  1MSE C;  3I56 I;  1ZG3 A;  3M1E A;  2M87 A;  4KN7 X;  5FGM A;  5IP6 A;  4K5L A;  4XN5 A;  2GZW A;  2P5K A;  4LG0 A;  1L3L A;  1LJ9 A;  2VKD A;  4WCG A;  4RGR A;  2OAZ A;  5EYR A;  2ME6 A;  3ZMT A;  4LG0 B;  1TWG J;  2ME0 A;  5E3L A;  1T1R A;  1U6G A;  4LGW A;  1MMG A;  4L9N A;  1RUO A;  4G7O F;  3NRV A;  4RS8 A;  3SQN A;  3EYI A;  4I98 B;  2W4S A;  1Y39 A;  1TWA J;  4BJ6 C;  1TW2 A;  3GZ5 A;  2YX7 A;  4HBL A;  2M2E A;  1ZHF A;  3QOD A;  3S3O A;  1W7P A;  4Y15 A;  3GX4 X;  2M0M A;  3F8C A;  1K61 A;  1W7P B;  5EJC A;  2ESN A;  1UMQ A;  5L3D A;  5D5X B;  5JBI A;  5DDG A;  2GXB A;  3BR3 A;  2HOS A;  4JOM A;  3QU3 A;  2FBH A;  5DS9 A;  2EA2 A;  3FU3 A;  5TRD A;  4I99 C;  4X6A J;  4B48 A;  3GEZ A;  3LST A;  2E1M B;  1S7A A;  4BY1 J;  1FP1 D;  1SC5 A;  4CSW A;  1XC5 A;  5HLG A;  3TO6 A;  1X19 A;  4FLS A;  2QGU A;  4HF1 A;  1G3S A;  2PGG A;  4M3E A;  1O57 A;  1ETK A;  2NVY J;  3Q43 A;  1BOA A;  2K5C A;  2JVG A;  1YS6 A;  1KU2 A;  1QZZ A;  3F3X A;  3LA3 A;  4RGS A;  1UAA A;  3BR5 A;  4HAM A;  1QHH D;  2O3F A;  4I0B A;  2IJL A;  1DUX C;  3HBL A;  2IS1 A;  3DLA A;  4GAA A;  4MFD A;  3J7Z I;  2VB6 A;  2FFL A;  4LUP A;  1HSJ A;  2HDD A;  3H3V K;  1MW0 A;  2MAO A;  4BJT A;  1SG7 A;  2QQA A;  1GUU A;  2XPU A;  3EYY A;  3A01 A;  1YIJ I;  1RR7 A;  1WH5 A;  4L9V A;  4M9X A;  3HRM A;  1BI0 A;  2QVO A;  5J4Y A;  4QTR A;  1QHG A;  2XVC A;  3IKV A;  3M1C A;  4B3X A;  3A01 B;  4XLH A;  3HYI A;  3BTJ A;  1I6X A;  1G3W A;  5TJJ A;  1W36 D;  4PJ0 C;  3WQQ A;  4UVC A;  3E7L A;  2RQP A;  3B6A A;  4DZP A;  1K83 J;  4Q5S F;  1AWC A;  2XF7 A;  1LDD A;  1KYW A;  1G3T A;  4XLE A;  1MBH A;  2ZXW H;  1NTC A;  2KIU A;  4EJO A;  1VQ9 I;  2L7M P;  1LEB A;  5LHG A;  4UHT A;  4M9Z A;  4F7Z A;  4FLQ A;  4BJ5 C;  3DEW A;  3LFK A;  1G59 A;  4A3L J;  2EIJ H;  2PEX A;  4RB1 A;  4OOE A;  1MDM A;  4Y6S A;  1FY7 A;  4P55 A;  4BYY A;  1OCT C;  3KLN A;  2FSW A;  2JA6 J;  1MDM B;  2BOL A;  4K5N A;  2XDV A;  2L9R A;  4ZZD A;  1T0F A;  3DEE A;  2BY0 A;  4RB0 A;  2FNA A;  2KZG A;  5H6Q A;  3BR2 A;  3GTM J;  2HEO A;  5IT9 K;  2XC7 A;  2HQR A;  5ICG A;  3FUM A;  3IRQ A;  2LDU A;  2R3S A;  3DF8 A;  1I1S A;  1KU9 A;  3E5U A;  4BUP A;  2BHZ A;  5F0H A;  3A4C A;  5LEJ A;  1YRN A;  3FIS A;  5ILV A;  4HRI A;  4Q4Z F;  2VXZ A;  1H9G A;  4B8X A;  1O7F A;  1YRN B;  1HXD A;  3M8E A;  3ABU A;  3BG7 A;  1QQI A;  3OYE A;  4C9Y A;  4IVN A;  4G94 A;  4F52 A;  3E5X A;  3FUJ A;  4LK0 F;  4RGU A;  3BCA A;  1UHM A;  4BE2 A;  4CYD A;  4LG3 A;  4ZYH A;  4QPO A;  4LIV A;  4JX4 A;  2VT3 A;  4C3I J;  2XRN A;  1U8R A;  5JMW A;  5J1U A;  3IH2 A;  3I4M J;  3ZCO A;  4Y4R A;  2DQ6 A;  5E8I A;  4WK8 F;  4ZYA A;  1BIA A;  2HXO A;  1ONV A;  2VKV A;  1S46 A;  4AWX B;  2A6E F;  4Y7N J;  4KMF A;  1G3Y A;  3CDL A;  2RQQ A;  1LFU P;  2A5W A;  4QPQ A;  1FYK A;  5K7H A;  4XL9 A;  3DPT A;  2VJ8 A;  2NS7 A;  1AU7 A;  1T39 A;  3HGY A;  3QJX A;  4LOC A;  3BPX A;  4LFU A;  4WF2 A;  2O7G A;  2P0W A;  2D5V A;  4JP0 A;  3WE3 A;  1JKR C;  5GAD J;  1FBS A;  2IA2 A;  3F9K A;  2XAS A;  4FQG A;  2LC2 A;  2VJ5 A;  1Y1V J;  2VQL A;  3I71 A;  4ZTF A;  2LKS A;  5C4X J;  2P6T A;  3BP8 A;  2TDX A;  2YU3 A;  3G1L A;  1DPR A;  1ONP A;  2V4J C;  4CZZ A;  2COM A;  2WAF A;  4S04 A;  1V55 H;  1UST A;  2LF7 A;  1YJ9 I;  1IW7 F;  1SVO A;  4HDV A;  2C82 A;  5LLQ A;  3EBG A;  1VQM I;  1H88 C;  2IT0 A;  3B3B A;  2WAQ N;  2CQK A;  4OAY A;  1N78 A;  4MNU A;  4M3F A;  5M5Y J;  5D5U B;  1A35 A;  3WU2 C;  3H3U A;  5IP9 J;  4BAC A;  2L3D A;  3WTS C;  2QEX I;  4K5M A;  4TV7 A;  1XG1 A;  3IC7 A;  3CHR A;  5IPA A;  5EGO A;  4UVA A;  1TWH J;  3EUK L;  1S6L A;  5EGO B;  4H0E A;  4KNY A;  2PL5 A;  3F72 A;  1TNS A;  4ZC3 A;  3D5R C;  3GWZ A;  2H8W A;  1YS7 A;  2P5L C;  4NDL A;  2DA7 A;  3K6G A;  2QKL B;  4J19 A;  2IA1 A;  3KP6 A;  2NVT J;  3DPU A;  4C2T A;  3CO7 C;  2ZJP F;  1FPQ A;  3SZG A;  5LD2 C;  4G6Q A;  4M9S A;  5LGT A;  3ZMU A;  2NRA C;  3J81 K;  2CMP A;  3GZN B;  1TL8 A;  1ZQ3 P;  1XPX A;  3WTY C;  1BOB A;  2VUM J;  2DDA A;  3ZN1 A;  1Z6R A;  4CYC A;  1B9M A;  1HST A;  4HX7 A;  2EFP A;  3ANM A;  3RDI A;  3SXY A;  4CYC B;  2N8G A;  4MIM A;  2W25 A;  1Z1D A;  2ZFU A;  2ZJ2 A;  4IHW A;  3GTK J;  1SD6 A;  3ZQQ A;  4PW4 A;  2M4K A;  5LEK A;  3LAJ A;  4A93 J;  3ZP5 A;  4OIP F;  3OS2 A;  3PSF A;  1VQ8 I;  4DPR A;  1XD7 A;  2CRG A;  3DKY A;  1QZE A;  2QQB A;  2DA6 A;  1U8B A;  5FFZ A;  1R58 A;  2A7O A;  1TBX A;  1RI7 A;  5F04 A;  1SVL A;  2R7R A;  2ACJ A;  2CH0 A;  5FRN A;  4AR8 A;  4HNU A;  1STZ A;  1SAU A;  4AIC A;  4OWR B;  1NG7 A;  4QIW N;  3G6E I;  5LGU A;  5GPC A;  1OIS A;  2OUM A;  3JAM K;  1HW2 A;  3VYR B;  2UXN A;  1U9O A;  2LR8 A;  1D8J A;  4CA0 A;  4UUS A;  5TGT A;  4ZQT A;  4RLQ A;  4M3B A;  3CCV I;  4UUS B;  1JGI A;  3LOC A;  4O3M A;  2KJB A;  1MNM C;  2K9Q A;  2XF6 A;  3PQK A;  1J9I A;  1I6H J;  3LFU A;  5JLW A;  3CME I;  4EM0 B;  5ICE A;  4ZDO A;  1LKX A;  1DGW Y;  4OIR F;  3PO3 J;  3AUA A;  5FO5 A;  4G6T B;  3S2H J;  1VQ5 I;  5E3N A;  1NK3 P;  5FRM A;  4N4N B;  1BJZ A;  3DTK A;  1O3R A;  1B8I B;  1XTA A;  3G1O A;  3M7G A;  4FCY A;  2WV1 A;  2DAO A;  4NNJ A;  1KQ9 A;  1BM9 A;  3MQ0 A;  1FP2 A;  2M3A A;  2HU9 A;  1WWX A;  2M0C A;  3MEX A;  5D6E A;  1XMX A;  1OFC X;  1VQN I;  2ESH A;  4X1E A;  1XSD A;  2V1X A;  1G8X A;  1OQY A;  1XB4 A;  3S3M A;  3VYT B;  3V8L A;  3BQZ A;  3J7Y J;  1D5Y A;  2EBI A;  2K9M A;  4E4H A;  3HGG A;  3CZ6 A;  3WGG A;  3PUU A;  1QRY A;  3HOS A;  3FX3 A;  5CVJ A;  4JQF A;  3PNV A;  4ZX3 A;  1ZGW A;  4PGH A;  1H19 A;  1X3W B;  4RB2 C;  2ZKZ A;  5HVQ C;  1X1C A;  1I50 J;  3UNG C;  1E3H A;  3VYS B;  4GXO A;  3H5R A;  3HOU J;  2BXY A;  2HTJ A;  2DMU A;  2JA2 A;  1ETV A;  2CUJ A;  4WXH A;  2DYS H;  4U0V A;  1DP7 P;  4CCO A;  4L0Z B;  2H8R A;  1K4S A;  1A36 A;  1D0X A;  5HOO A;  2A68 F;  3KZZ A;  2Y0S A;  3RKW A;  4M73 A;  3BC8 A;  1R5I D;  4IHY A;  1VQK I;  1ETY A;  5D5W B;  3DU5 A;  1R5G A;  3O3K A;  3OL3 A;  5H6R A;  3FTV A;  4ZJZ A;  4DYQ A;  2HOT A;  3FUI A;  4M71 A;  1R7J A;  3K4N A;  5JNL A;  5IY5 H;  1MBG A;  4YG2 F;  5JHF A;  1TW3 A;  1MIJ A;  5HDG A;  1XCV A;  1Y8Q B;  3CCY A;  3MAJ A;  4M74 A;  1SEU A;  1WJB A;  1ULY A;  1MW3 A;  3KCC A;  3KIO A;  4HG2 A;  1BIB A;  3CP2 A;  3H0G J;  2DFE A;  3PUB A;  1FIP A;  4ZW8 A;  2F4O B;  5EF6 A;  3GFL A;  5HS8 A;  4MQV A;  4R1H A;  2E5Z A;  4LD5 A;  3FUF A;  2DU9 A;  3Q9S A;  4XKB A;  4BKX A;  1U5T A;  1TC3 C;  5ICF A;  4ZX5 A;  2XKP A;  1P4X A;  2VL8 A;  1JT0 A;  4GDF A;  1U5T B;  4AIH A;  2E36 A;  2L4A A;  2A07 F;  3DXJ F;  1GLN A;  2VOO A;  2Z3Y A;  1N25 A;  2O8X A;  2PQ8 A;  4AR1 A;  1X1P A;  4F92 B;  1JT6 A;  2H6C A;  3CP8 A;  4B47 A;  1OCO H;  2R4G A;  4BQQ A;  1D3Y A;  4ZYD A;  1W4M A;  3QU6 A;  4IL6 C;  1KZH A;  3ZMZ A;  4AUX A;  3HOX J;  2K27 A;  2RVC A;  4Q48 A;  1NK2 P;  3PJR A;  1UCR A;  2J5P A;  1I27 A;  3BY6 A;  1MJA A;  3F6O A;  1RKT A;  5DCM B;  2HYF A;  3RKX A;  5A2Q Z;  3GFI A;  3I4N J;  4BDY A;  5M3M J;  4A3M J;  3HKZ A;  2W85 A;  1OCR H;  1P6R A;  3R60 A;  1SC7 A;  1IV8 A;  3PFI A;  1D5V A;  3EDP A;  3PUF A;  3A02 A;  3I64 A;  4GCV A;  2X48 A;  3SDG A;  3CQZ J;  5J6X A;  4PU2 A;  3HSF A;  4R8H A;  5HDN A;  3D5S C;  3GXO A;  3KET A;  2PJR A;  1RUN A;  2YR2 A;  4YFX F;  1QA6 A;  3JSO A;  2PJR B;  3REO A;  3JRB A;  2DFI A;  5JVG F;  1R6R A;  1QO0 D;  3FHE A;  4Q4I A;  4A3G J;  2M8G X;  1V3F A;  1EH7 A;  3TO9 A;  3GLX A;  4ZH4 F;  3VWB A;  5LGN A;  2RAE A;  2LK2 A;  4UVB A;  5HLT A;  4KA4 A;  3Q5F A;  3DLL F;  5DD4 A;  1EH6 A;  3K2A A;  4E70 A;  1FOW A;  2XGC A;  4EGY A;  1R00 A;  1Z21 A;  2KLO A;  4BBR J;  1FLI A;  3RI4 A;  3G3Z A;  3LA7 A;  2ELK A;  2LH9 A;  2KPM A;  4G8X A;  4BEH A;  1FSE A;  2Y48 A;  2YUS A;  1DQU A;  1EKE A;  3GW2 A;  4BEH B;  5LBQ A;  3F8M A;  5CQE A;  3OV8 A;  2QBY B;  3FKI J;  2X6W A;  2BVL A;  4MGR A;  5EDN A;  3JT1 A;  2Y1D A;  5CYV A;  5BNG A;  4K5P A;  3HOT A;  1XMA A;  1EF4 A;  2NNN A;  4KT5 C;  3CCU I;  1J75 A;  4XMV A;  3FXQ A;  4CGZ A;  2E60 A;  3V8K A;  3ZR8 X;  2WY8 Q;  1SMT A;  1XS9 A;  1E3P A;  1SFK A;  3F22 A;  4NB5 A;  2X6X A;  2KHM A;  1ENH A;  4JK1 X;  4OMY A;  4BHC A;  2X0L A;  3IL2 A;  1JE8 A;  1ZGJ A;  1JKP C;  4J01 A;  4KN4 X;  4XRS A;  5ERI A;  2L5Q A;  1GVJ A;  3I0T A;  4IEJ A;  3JRC A;  3MZ8 A;  4HZF A;  4YEL A;  1PDN C;  1JGS A;  5CVV A;  3JTH A;  5ICC A;  2NVQ J;  2W82 A;  4UV9 A;  1D1B A;  4LIT A;  1A5J A;  3M3Y J;  3H3Z A;  1OYI A;  3FUE A;  3CJR B;  1HKS A;  2LKX A;  3GBG A;  3K69 A;  4B1R A;  1TP4 A;  3GME A;  3QPT A;  5DUK A;  3MWM A;  2ZSH B;  3ABM H;  3N4M A;  3EUA A;  3FXM A;  3J7A Y;  1TQI A;  2XGD A;  5ILU A;  3TW6 A;  5FKK A;  2K4B A;  2DO7 A;  1FNN A;  1IRZ A;  3WTT C;  1HOM A;  3ZN0 A;  4AIK A;  1YJW I;  3BRO A;  2DA3 A;  3ZHZ A;  1PJR A;  3SFZ A;  4QME A;  2JV7 A;  3DKX A;  3BG6 A;  4KIG A;  3ZQF A;  2VIX A;  3GYH X;  3CD6 I;  3D5L A;  4A5M A;  4ZZL A;  4S0H B;  4PVB A;  4L5J A;  4XO4 A;  2ZBK A;  3IP4 B;  2ISZ A;  2BXZ A;  1WGX A;  4RSY A;  2AO9 A;  2OZU A;  1D0Y A;  2GOM A;  2MG4 A;  3O6B B;  2HPI A;  3WOD F;  2LRD A;  2OD5 A;  3FUD A;  3MKW B;  2DTR A;  3S1R J;  2PBI A;  4UY8 I;  2YU9 J;  1IJW C;  1JGG A;  3JRH A;  3HG9 A;  1Y1W J;  2CW0 F;  4V2G A;  1BR1 A;  3DU6 A;  4M6V A;  2EJR A;  3ASN H;  4DIQ A;  2CQ7 A;  6PAX A;  2XQ0 A;  1LFB A;  3BLY A;  4LB5 A;  2DJN A;  1WPK A;  2ELJ A;  2JT1 A;  1H9T A;  2RGV A;  5CVU A;  2COB A;  2L9N A;  1I5Z A;  1FBQ A;  4ASN A;  3TP3 A;  1IN5 A;  1L0O C;  2HOE A;  1NHA A;  1TLH B;  3AG3 H;  4XLA A;  5E17 F;  2F5V A;  3H5A A;  4A3F J;  1B59 A;  1ZEL A;  4BY7 J;  2VBZ A;  3MFK A;  1E17 A;  2ISY A;  2Z99 A;  3CIA A;  4HLX A;  2BYV E;  2G0E A;  4GYG A;  3T8V A;  2ZXH A;  1BL0 A;  3LL7 A;  3ZGK A;  2XB0 X;  3QOP A;  2KDO A;  2JSC A;  4KP7 A;  2CV0 A;  3M8J A;  4IHT A;  4ZW5 A;  2Y1E A;  1RPW A;  2JWT A;  5GPA A;  3CHQ A;  3I5U A;  2GXA A;  2E5N A;  2GIZ A;  1YTY A;  2EWN A;  2HPM A;  4XN3 A;  3BZ6 A;  3JRI A;  2J5O A;  4B4C A;  2OTL I;  3WU0 A;  1U9N A;  2Z9O A;  4UNO A;  1YQA A;  4P96 A;  2P7V B;  4YII A;  2R7U A;  2RKH A;  2PN6 A;  3FMS A;  2H27 A;  2HDW A;  5E1Z B;  3CES A;  4XMY A;  2L01 A;  1H3L A;  1POG A;  1JJ8 C;  1BR2 A;  4J3B A;  2QF7 A;  2EFN A;  5DLL A;  2E71 A;  2A69 F;  2PMZ A;  1WJ5 A;  3HW2 A;  2NVU B;  3K4C A;  3KP4 A;  2EFW A;  1W0U A;  1XDS A;  5LRR A;  3ANN A;  5DYF A;  1QBJ A;  3W2A A;  3HUG A;  4V19 K;  4WXD A;  2XRL A;  5GP9 A;  1W5S A;  1ZRD A;  3F23 A;  4NBQ A;  2IVM A;  3TOB A;  1KQ0 A;  2BHY A;  3M9A A;  3Q44 A;  1R4M B;  1MD0 A;  4PSW A;  1QVT A;  2VOP A;  5CVR A;  4BH9 A;  4AYB N;  2R5Y A;  4EJT A;  2CQQ A;  3NAU A;  1PUF A;  2R92 J;  3ROU A;  4YFN F;  3M07 A;  2R5Y B;  3FU0 A;  3NAR A;  2B0L A;  2LF8 A;  3SJM A;  1YX3 A;  2DQR A;  2V9V A;  2WA0 A;  1PUF B;  1GDT A;  2JQ7 A;  2BE5 F;  2LNB A;  4BE1 A;  2EFO A;  2OPT A;  2BY2 A;  2R7V A;  4XNA A;  3L1P A;  1T08 B;  1ITY A;  5J3L A;  4IQ4 A;  1SAN A;  3FXR A;  4OAZ A;  5IOY A;  2R7T A;  2HI3 A;  3DCF A;  1SD7 A;  2KQR A;  3W6V A;  2ADU A;  1OLT A;  4XQF A;  2IGO A;  3ZRG A;  3VB2 A;  1J7K A;  4IRH A;  3T8R A;  4L5E A;  3A14 A;  3R61 A;  1BBY A;  3SZT A;  4HF2 A;  3E6B A;  3VYU B;  4QPE A;  3BJO A;  3KLO A;  1Q0Q A;  2E2H J;  1T98 A;  1Z7U A;  5EZH A;  1FEX A;  2IGM A;  5EEG A;  1W5C C;  3EET A;  4BHB A;  2GBY A;  3K4M A;  1VQO I;  4MEX F;  2XKO A;  3O8H A;  3S2D J;  3S93 A;  3NEU A;  4AYS A;  1FIA A;  2VN2 A;  5GAE J;  2QLZ A;  4ENN A;  4Y33 A;  4FX4 A;  1F1Z A;  4NHJ A;  4XN2 A;  2K02 A;  1IN8 A;  3Q0U A;  3TW7 A;  3I53 A;  3ZQG A;  2V1U A;  2JA8 J;  3K1N A;  4DYC A;  4MTE A;  2VC1 A;  1ZK8 A;  3BDD A;  4PCQ A;  3CCL I;  2CYY A;  2CSO A;  4LB6 B;  2IEK A;  2GAU A;  2QCO A;  4XN7 A;  4Y52 J;  1U5T C;  4JYK A;  3CO6 C;  3ZHX A;  2G7H A;  2R7S A;  1ZLJ A;  1S29 A;  4PJM A;  2DPD A;  2L0K A;  4JND A;  3Q3S A;  1QVU A;  4HST A;  1FOY A;  5FB2 A;  3WE2 A;  2RNG A;  1UG0 A;  1FOX A;  3KYD B;  4RAG A;  1ON2 A;  1ACI A;  1R1V A;  2XAF A;  3KFW X;  4HOB A;  2ECB A;  5JO0 A;  2B7E A;  2LYC A;  3OYC A;  3GTQ J;  1IF1 A;  4KIC A;  3A03 A;  4RM3 A;  4ENK A;  3B73 A;  3KP7 A;  2FRH A;  2PMH A;  2F5F A;  1WJA A;  3CCM I;  2JZY A;  2JJ7 A;  2ZME C;  4HV6 A;  2K9N A;  2HS5 A;  1O3S A;  1VND A;  5JHU A;  2EH3 A;  3RJP A;  5DM7 F;  3CLQ A;  1IRX A;  3AG2 H;  2DMT A;  3BR6 A;  2Z5U A;  2BVM A;  3FMR A;  3LMM A;  3U21 A;  2XGE A;  3J80 Z;  5IYD J;  2K3P A;  3U9W A;  2XSD C;  3B34 A;  3GZ6 A;  1MBE A;  1DP3 A;  1FT9 A;  3D1N I;  1UJ8 A;  2HQA A;  4KIF A;  2AHQ A;  1MMA A;  3KP2 A;  2P5V A; 
#chains in the Genus database with same CATH homology
 4PFO A;  3RCO A;  2F4I A;  4D1Q A;  3FHN A;  1JI8 A;  1Q0L A;  1D1C A;  4NNJ A;  4XKC A;  4AR9 A;  4ZQH A;  1X1D A;  2JCX A;  4IKF A;  4ZX6 A;  1V5E A;  2M3A A;  1MW7 A;  2HU9 A;  4ZW6 A;  1EA3 A;  3OS1 A;  3K70 C;  4PJJ A;  4BE0 A;  2CS3 A;  1VZ0 A;  1AA7 A;  2ZSI B;  4KT6 A;  4YEJ A;  3RSN A;  4E6K G;  2IGN A;  1GW6 A;  2L9S A;  3H9J A;  2IS2 A;  2DJI A;  1G8X A;  3FDY A;  3S3M A;  3VYT B;  3HUG B;  2DT6 A;  4XOT A;  3FTZ A;  3LSM A;  2K9M A;  4NUB A;  4E4H A;  1YE9 A;  1Y6I A;  2X1E A;  3W3C A;  4QUO A;  3CZ6 A;  3PUU A;  3OIQ A;  3HOS A;  4FCA A;  3T0Y A;  4JQF A;  3FTX A;  3PNV A;  3ONQ A;  4ZX3 A;  2Y1C A;  3JSZ A;  3FH5 A;  1H19 A;  1WJE A;  4U87 A;  3FUK A;  2LRE A;  4GAE A;  2VAS A;  2AQF A;  4XKV A;  3VSL A;  5HVQ C;  1X1C A;  3UNG C;  2W00 A;  3FH8 A;  3VYS B;  3CZE A;  3H5R A;  2HPT A;  3H0D A;  3IUO A;  4KIS A;  1HA8 A;  2JA2 A;  2KL4 A;  3V42 A;  4IX7 A;  2CUJ A;  3QYB A;  1RP3 A;  4BL0 B;  4E7J A;  4CCO A;  3LSK A;  2NOJ B;  1D0X A;  2VXD A;  3OYA A;  5HOO A;  2Y1F A;  3FBN B;  3MKY B;  1WJF A;  2WZF A;  4PK4 A;  3MKZ A;  4XMZ A;  1Q0H A;  2Z1D A;  3OYJ A;  2Y0S A;  4XMW A;  3TL4 X;  4BQO A;  1MND A;  3B7T A;  2WZG A;  3CHP A;  2LY2 A;  4R79 A;  2HVS A;  3PNT A;  4XLC A;  3BC8 A;  4XNF A;  4AVZ A;  3UER A;  2MAB A;  4C2U A;  1UEL B;  3L2R A;  3DU5 A;  3FTV A;  3OL3 A;  3OMY A;  3IAS 2;  4ZJZ A;  3FUI A;  3OWT A;  1U0J A;  3K4N A;  4X0G A;  5JNL A;  4MKT A;  3VVL A;  2AQE A;  2Q2E B;  5JHF A;  1TZL A;  2M7B A;  3HL2 A;  1BR4 A;  3I3L A;  1X1A A;  4FAS D;  1ONO A;  1WJB A;  2MYS A;  1MW3 A;  3B7R L;  3OYI A;  1PYV A;  2WB1 A;  4CCN A;  2KP6 A;  5KCM A;  4HG2 A;  1KON A;  4IQJ A;  3CP2 A;  3QYF A;  4ZN6 A;  3PUB A;  2RRE A;  4FLO A;  4ZW8 A;  2KRC A;  4XO3 A;  3BCB A;  3CZK A;  3RC3 A;  3K70 D;  4PSX A;  4PJL A;  3FUN A;  3FUL A;  3TMO A;  2E5Z A;  1FMV A;  3FUF A;  4BKX A;  4XKB A;  2R7O A;  4NQW A;  5FWQ A;  4ZX5 A;  3FBI B;  3OYF A;  2VL8 A;  4NQW B;  1MVY A;  2DT7 B;  2KRH A;  1GLN A;  3IAM 2;  2B61 A;  2JD2 A;  1D0Z A;  4CCK A;  3WQS B;  5HNF A;  4R5V A;  4AR1 A;  5JC1 A;  3CHO A;  2R70 A;  4XKW A;  4BXF A;  1P9Q C;  4B47 A;  3CP8 A;  4F92 B;  4QIR A;  2R4G A;  4DBR A;  3NWS A;  2UV1 A;  5CKT A;  4BQQ A;  2W1O A;  4E7I A;  2CV2 A;  2WBM A;  3AKZ A;  3OYH A;  3PJR A;  1N75 A;  4CCL A;  3FKJ A;  1WJC A;  2XPY A;  4XN1 A;  3K4L A;  2VQC A;  3MD2 A;  4PFP A;  1DGR M;  4XR6 A;  4KIT B;  2IXS A;  2QKM B;  1FMW A;  2VJ4 A;  1OR7 C;  3SEQ A;  1ZS2 A;  4E7K A;  4CZC A;  2V6E A;  2DQM A;  4CCJ A;  1R0K A;  4BDY A;  1V5F A;  3RPU D;  2JD1 A;  3HKZ A;  4HSR A;  3LSG A;  2X1D A;  4E7S A;  3OYG A;  2MD0 A;  3RC8 A;  4K5O A;  3RTR A;  5FRO A;  2CW8 A;  3PSI A;  3H5N A;  3LSI A;  4PU2 A;  2V7F A;  4QHP A;  3D5S C;  4GRI A;  3B2P A;  3I9V 2;  2PJR A;  2IS4 A;  4Q4E A;  4PJN A;  3EBI A;  1G5A A;  2CUZ A;  2LG4 A;  3FTW A;  2PJR B;  3AU9 A;  4ZQF A;  4XND A;  3SDB A;  2JSP A;  2KMU A;  1R6R A;  3FHE A;  4Q4I A;  4XN4 A;  3C2G A;  3DPL C;  4E7Z A;  1MNE A;  3CJQ B;  3L2W A;  3VWB A;  2VPL A;  4XO5 A;  2RJI A;  5HLT A;  4LIU A;  5EV7 A;  3FTU A;  1W36 C;  2CW7 A;  3EUH C;  4ANJ A;  1Z21 A;  2FUG 2;  2KLO A;  3NWT A;  2PUS A;  4XOR A;  2LH9 A;  4OOF A;  2KPM A;  3KX2 A;  1X4P A;  4BQN A;  4BEH A;  4CCM A;  3H9Q A;  5HNH A;  5JMP A;  2DCE A;  4K5L A;  1DQU A;  4XN5 A;  4BEH B;  2EGH A;  5CQE A;  2VKD A;  1J09 A;  2X6W A;  2BVL A;  2R7W A;  1T1R A;  3JT1 A;  2Y1D A;  2F6C A;  4K5P A;  4XN8 A;  3HOT A;  1ONN A;  2ZXG A;  4XOP A;  1MMG A;  2W4S A;  1QU3 A;  4XMV A;  2E60 A;  2LOO A;  3ZR8 X;  4BJ6 C;  2WY8 Q;  5KHD A;  3OYD A;  2X1C A;  1SFK A;  3QOD A;  4ZDL A;  2X6X A;  2KHM A;  3S3O A;  3W2W A;  2M0M A;  2MFZ A;  4J01 A;  1WJD A;  2R7X A;  2WY7 Q;  2ZXI A;  3N05 A;  3K10 A;  2L5Q A;  2HVR A;  5JBI A;  3OYN A;  2A6T A;  4YEL A;  2K9L A;  1T1S A;  2BW3 A;  4JOM A;  4HPQ A;  4ZW3 A;  3H35 A;  3FU3 A;  2W82 A;  2BW3 B;  2WAD A;  1D1B A;  4LIT A;  2V1N A;  2VKH A;  4B48 A;  2E1M B;  3UCQ A;  1SC5 A;  2XSJ C;  4CSW A;  3ANL A;  3FUE A;  3CJR B;  3KEY A;  1X19 A;  4FLS A;  3PL8 A;  2PGG A;  3GBG A;  3Q43 A;  3A2K A;  2JUG A;  2JVG A;  2K5C A;  4AU7 A;  2ZSH B;  1MW2 A;  3EUA A;  3J7A Y;  4A03 A;  1UAA A;  1E0E A;  1QHH D;  3S8P A;  2I8D A;  4Y6R A;  2QJ1 A;  5KNL A;  3B7S A;  3OR2 C;  2IS1 A;  3DLA A;  1ERD A;  3A06 A;  4GAA A;  2VB6 A;  2LY1 A;  2FFL A;  3ZHZ A;  3PNY A;  1PJR A;  4LUP A;  1MW0 A;  2MAO A;  4BJT A;  1SG7 A;  2JV7 A;  3DKX A;  3ZXS A;  3BG6 A;  3OYB A;  2DXI A;  4QME A;  4XMT A;  2VIX A;  2KZV A;  4ZDP A;  3D5L A;  1QHG A;  3M1C A;  4ZW7 A;  4B3X A;  4Y3O A;  4XO4 A;  3OYK A;  4XLH A;  4PVB A;  3HPG A;  3IP4 B;  3PFY A;  2VQH A;  3AL0 B;  2XPZ A;  1W36 D;  4RSY A;  3WQQ A;  1Z3Y A;  4KJZ A;  5AEN A;  1D0Y A;  2GOM A;  4DOZ A;  3HPH A;  2HPI A;  3QYE A;  1MW1 A;  2LRD A;  3FUD A;  3MKW B;  2XF7 A;  2V26 A;  3K4K A;  3HG9 A;  4XLE A;  3L2U A;  4Y67 A;  2JVH A;  1BR1 A;  3DU6 A;  4CH7 A;  4DIQ A;  2WAE A;  3OR1 C;  3EBH A;  3ZI0 A;  2XQ0 A;  3BLY A;  3E1S A;  4FLQ A;  1K5H A;  2VJJ A;  4BJ5 C;  1JG9 A;  3FH7 A;  1G59 A;  3SEZ A;  2ELJ A;  4R5T A;  2L9N A;  3DQV C;  1Z7L A;  2OV7 A;  4OOE A;  4Y6S A;  3K4B A;  3FU5 A;  2HNH A;  4XLA A;  2GTQ A;  3OL4 A;  2BOL A;  4K5N A;  2F5V A;  3H5A A;  2XDV A;  3DEE A;  1ZEL A;  4B43 A;  2QVW A;  4ITV A;  2M4G A;  2XC7 A;  3DTI A;  4DBQ A;  3CIA A;  4J00 A;  3FUM A;  3UEQ A;  3T8V A;  2ZXH A;  3LL7 A;  4BUP A;  3ZGK A;  3B7U X;  3A4C A;  1N77 A;  4ZX4 A;  2KDO A;  4E7L A;  1X4O A;  3AU8 A;  4HRI A;  4KP7 A;  2CV0 A;  3M8J A;  2VXZ A;  4ZW5 A;  2Y1E A;  3CMM A;  3CHQ A;  3BG7 A;  3OYE A;  2R72 A;  4C9Y A;  2E5N A;  1MMN A;  4BDZ A;  3FUH A;  4DJA A;  4P5O A;  4F52 A;  3FUJ A;  2HPM A;  2X51 A;  2O5R A;  4XN3 A;  3BCA A;  3DWL E;  4BE2 A;  2CFO A;  1LFP A;  4LG3 A;  3HC7 A;  4FET A;  4LIV A;  4QPO A;  1JVS A;  2HPO A;  2CV1 A;  3CZG A;  4RVB A;  3MMY B;  2UWM A;  3C2H A;  4XN9 A;  4E7H A;  2R7U A;  3UR3 C;  4CUG A;  2Y1G A;  3WQR A;  2DOA A;  2HDW A;  3OY9 A;  5JMW A;  3CES A;  1X3Z A;  1HS6 A;  1Y56 A;  4ARF A;  3OYM A;  3QOE A;  4XMY A;  4Y4R A;  3ZCO A;  4II2 A;  1H3L A;  3KYL A;  2DQ6 A;  4ZYA A;  4J3B A;  1BR2 A;  4F55 A;  4RCV A;  1S46 A;  5DLL A;  4NC8 A;  2PMZ A;  1WJ5 A;  1MMD A;  2GOX B;  3AFH A;  3OOU A;  3K4C A;  2RQQ A;  2A5W A;  3IIE A;  3ANN A;  4QPQ A;  5DYF A;  3W2A A;  4L2L A;  4XL9 A;  2MC4 A;  3DPT A;  3VDX A;  2VJ8 A;  2WPG A;  4X2U A;  3QJX A;  1WFX A;  4IZZ A;  2O7G A;  2P0W A;  1YX5 A;  3Q44 A;  3F9K A;  4PUS A;  4PSW A;  2R7Q A;  2LC2 A;  2VJ5 A;  5BPP A;  3OIP A;  3S32 A;  3DTE A;  1TT0 A;  2VQL A;  4ZTF A;  1X3W A;  2JCY A;  3W2V A;  4II3 A;  2XF5 A;  3CZL A;  1T95 A;  2HZD A;  3FU0 A;  4XN0 A;  1YX3 A;  2WA0 A;  2V4J C;  1ONP A;  2WAF A;  3S3N A;  1LDK B;  4BE1 A;  2R7V A;  4XMU A;  4XNA A;  3RQ4 A;  2C82 A;  2IGK A;  1D1A A;  4IQ4 A;  2R7T A;  3EBG A;  4OAZ A;  2KQR A;  4YRV A;  3B3B A;  1OLT A;  1N78 A;  4OAY A;  4F91 B;  4XQF A;  2IGO A;  4AYB A;  3EPZ A;  3ZRG A;  2C5Z A;  2Q1Z B;  1NG6 A;  4BAC A;  4ZQE A;  2E1M C;  2LBF A;  3A14 A;  4K5M A;  2HVQ A;  2OC6 A;  2JD0 A;  3CHR A;  3VYU B;  4QPE A;  2LBF B;  3VSK A;  1Q0Q A;  3EUK L;  3RAS A;  4CXF A;  2IGM A;  3CHS A;  2V9K A;  3K4M A;  2JCV A;  2PL5 A;  4ZC3 A;  3D5R C;  2L7K A;  2WAQ A;  3TBI A;  4B44 A;  3SYT A;  4H4K C;  4RLF A;  3S93 A;  4F3Q A;  4AYS A;  5CPR B;  4D9J A;  3K6G A;  2QKL B;  1Z3X A;  4Y33 A;  4F93 B;  3DPU A;  4XN2 A;  5CQG A;  2L2O A;  4BU2 A;  4N4O B;  4C2T A;  3OS0 A;  2VQG A;  3L2V A;  4XLF A;  3SZG A;  5LD2 C;  4R5X A;  4HEA 2;  2CMP A;  2X85 A;  1BOB A;  4XN7 A;  4XNB A;  2R59 A;  1S9H A;  3AL0 C;  3CF2 A;  3ANM A;  3ZHX A;  4Y6P A;  2R7S A;  4RM2 A;  1K6Y A;  2Z2S B;  4PJM A;  3ZHY A;  2ZFU A;  4JND A;  2W7N A;  3ZQQ A;  3VVM A;  4HST A;  4PW4 A;  4DGW B;  2M4K A;  3E0J B;  2M7A A;  2RNG A;  1SQM A;  1UG0 A;  3OS2 A;  3PSF A;  4DPR A;  4BS9 A;  3R0I A;  1LVK A;  1X1B A;  3K4J A;  3DKY A;  2UUZ A;  4MLO A;  4R7L A;  4P1W A;  2A7O A;  4FLR A;  4EAT A;  3OYL A;  2VLA A;  4AR8 A;  4XMX A;  2R7R A;  5FRN A;  2CH0 A;  5JO0 A;  2LYC A;  3A1Y A;  4HNU A;  1OR7 A;  2X6Y A;  3OYC A;  3B37 A;  4HNT A;  4NC7 A;  1SAU A;  2XAU A;  1R0L A;  4OWR B;  1NG7 A;  4AIC A;  2OUM A;  4RM3 A;  3LSH A;  4XON A;  3VYR B;  3FU6 A;  1WJA A;  4C30 A;  3FTS A;  4CA0 A;  3L2Q A;  2MAP A;  5TGT A;  4ZQT A;  1T0F C;  4RLQ A;  2VJI A;  3KED A;  3B2X A;  1V5G A;  3FTY A;  1JGI A;  4XM3 A;  5JAZ A;  2Z16 A;  1IRX A;  2XF6 A;  4U7B A;  4MS6 A;  4BGD A;  3G2B A;  3H9G A;  5DUL A;  2BVM A;  3LFU A;  3LMM A;  3U21 A;  4ZDO A;  1LKX A;  1DGW Y;  3AUA A;  4ZQG A;  2K3P A;  2IS6 A;  3U9W A;  3B34 A;  4RMN A;  3HXL A;  1DP3 A;  4G6T B;  2HQA A;  5LFA A;  5FRM A;  1MMA A;  4N4N B;  4ZTJ A;  3DTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...