2EHPA

Crystal structure of a putative protein (aq1627) from aquifex aeolicus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
AIFTHEGKVEGVPGNYPLTAENLFRIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFQPLSETDIKKLESILFGRAPIPKKTGEDIGSFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aq_1627 protein
publication title Crystal Structure of a Putative protein (AQ1627) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 2ehpA00
1JDYA 1KFQA 1C47A 1KFIA 2FKFA 3C04A 1TUOA 2H5AX 5F9CA 2Z0FA 5JN5A 3PMGA 2FUVA 5BMNA 1P5DX 4IL8A 5KL0A 3PDKA 3UW2A 3OLPA 2H4LX 3I3WA 3RSMA 5BMPA 2FKMX 1PCJX 5EPCA 1C4GA 1PCMX 3BKQX 5HSHA 1P5GX 2F7LA 1K35A 4MRQA 1WQAA 2EIUA 4QG5A 2EHPA 1LXTA 1K2YX 1VKLA 3NA5A 4HJHA
chains in the Genus database with same CATH superfamily
1JDYA 1KFQA 1C47A 1KFIA 2FKFA 3C04A 1TUOA 2H5AX 5F9CA 2Z0FA 5JN5A 3PMGA 2FUVA 5BMNA 1P5DX 4IL8A 5KL0A 3PDKA 3UW2A 3OLPA 2H4LX 3I3WA 3RSMA 5BMPA 2FKMX 1PCJX 5EPCA 1C4GA 1PCMX 3BKQX 5HSHA 1P5GX 2F7LA 1K35A 4MRQA 1WQAA 2EIUA 4QG5A 2EHPA 1LXTA 1K2YX 1VKLA 3NA5A 4HJHA
chains in the Genus database with same CATH topology
1JDYA 1KFQA 1C47A 1KFIA 2FKFA 3C04A 1TUOA 2H5AX 5F9CA 2Z0FA 5JN5A 3PMGA 2FUVA 5BMNA 1P5DX 4IL8A 5KL0A 3PDKA 3UW2A 3OLPA 2H4LX 3I3WA 3RSMA 5BMPA 2FKMX 1PCJX 5EPCA 1C4GA 1PCMX 3BKQX 5HSHA 1P5GX 2F7LA 1K35A 4MRQA 1WQAA 2EIUA 4QG5A 2EHPA 1LXTA 1K2YX 1VKLA 3NA5A 4HJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JDY A;  1KFQ A;  1C47 A;  1KFI A;  2FKF A;  3C04 A;  1TUO A;  2H5A X;  5F9C A;  2Z0F A;  5JN5 A;  3PMG A;  2FUV A;  5BMN A;  1P5D X;  4IL8 A;  5KL0 A;  3PDK A;  3UW2 A;  3OLP A;  2H4L X;  3I3W A;  3RSM A;  5BMP A;  2FKM X;  1PCJ X;  5EPC A;  1C4G A;  1PCM X;  3BKQ X;  5HSH A;  1P5G X;  2F7L A;  1K35 A;  4MRQ A;  1WQA A;  2EIU A;  4QG5 A;  2EHP A;  1LXT A;  1K2Y X;  1VKL A;  3NA5 A;  4HJH A; 
#chains in the Genus database with same CATH topology
 1JDY A;  1KFQ A;  1C47 A;  1KFI A;  2FKF A;  3C04 A;  1TUO A;  2H5A X;  5F9C A;  2Z0F A;  5JN5 A;  3PMG A;  2FUV A;  5BMN A;  1P5D X;  4IL8 A;  5KL0 A;  3PDK A;  3UW2 A;  3OLP A;  2H4L X;  3I3W A;  3RSM A;  5BMP A;  2FKM X;  1PCJ X;  5EPC A;  1C4G A;  1PCM X;  3BKQ X;  5HSH A;  1P5G X;  2F7L A;  1K35 A;  4MRQ A;  1WQA A;  2EIU A;  4QG5 A;  2EHP A;  1LXT A;  1K2Y X;  1VKL A;  3NA5 A;  4HJH A; 
#chains in the Genus database with same CATH homology
 1JDY A;  1KFQ A;  1C47 A;  1KFI A;  2FKF A;  3C04 A;  1TUO A;  2H5A X;  5F9C A;  2Z0F A;  5JN5 A;  3PMG A;  2FUV A;  5BMN A;  1P5D X;  4IL8 A;  5KL0 A;  3PDK A;  3UW2 A;  3OLP A;  2H4L X;  3I3W A;  3RSM A;  5BMP A;  2FKM X;  1PCJ X;  5EPC A;  1C4G A;  1PCM X;  3BKQ X;  5HSH A;  1P5G X;  2F7L A;  1K35 A;  4MRQ A;  1WQA A;  2EIU A;  4QG5 A;  2EHP A;  1LXT A;  1K2Y X;  1VKL A;  3NA5 A;  4HJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...