3UW2A

X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
464
structure length
458
Chain Sequence
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGSGSYEQYDVADQYVERIVGDIKLTRPLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKATDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLARWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARVADPSALLNGLPNAVSTPELQLNVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGLARSSNTTPVVVLRFEATSDAALARIQDDFRRALKAAKPGANLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoglucomutase/phosphomannomutase family protein
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
total genus 159
structure length 458
sequence length 464
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 3uw2A04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A01
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A02
5BMPA 5JN5A 2EIUA 2JPIA 1WJWA 2FKFA 2EHPA 3UW2A 1TUOA 4WX8A 1JDYA 4QG5A 1PCMX 2F7LA 1K2YX 2Z0FA 3OLPA 3PDKA 3PMGA 4HJHA 3RSMA 2FUVA 1WQAA 1K35A 3ENCA 2H5AX 5F9CA 1C4GA 3C04A 5JMVD 2DKCA 1P5GX 5BMNA 4MRQA 1LXTA 3NA5A 2H4LX 1C47A 1PCJX 5EPCA 1KFQA 2DKAA 2FKMX 3BKQX 4IL8A 4WXAA 1P5DX 4BJUA 1VKLA 5HSHA 3ENOC 3I3WA 2DKDA 5KL0A 1KFIA
chains in the Genus database with same CATH superfamily
3I0XA 2EIUA 1QN5A 3UW2A 2NOLA 2NOIA 1JDYA 2EHBD 1TGHA 2NWVA 3OH9A 3PDKA 3OLPA 2NVMA 2I5WA 1YQMA 2OOXA 1QNAA 4EAGA 3IH7A 1TBPA 3N89A 1J3MA 1NGMA 1P5GX 3TDHA 1LXTA 3KTUA 2QR1A 2H4LX 3NA5A 2HL8A 5IYDP 2JHJA 2DKAA 1QN6A 3OSMA 3OSTA 2MJ7A 3ULXA 4I8OA 1RM1A 1EUVA 2QLVA 4ROEB 1YQKA 1YQRA 1QTSA 2QRCA 3ENOC 2DKDA 3OSEA 5AN4A 1KYFA 1TBAB 1KFIA 3DPUA 4EJYA 2HKPA 5BMPA 1FN7A 2HZMA 3EIKA 1LWYA 2V8QA 2EHPA 3KRMA 1YTBA 1TUOA 1QN3A 1M5Q1 1UT7A 1CDWA 1N3AA 3RPJA 2JHNA 1B9KA 1M3HA 1VTLE 3PMGA 3RSMA 2IV8A 1C9BB 2HL9A 3OCIA 3ENCA 1YQLA 1Q9UA 1C4GA 1NVPA 3C04A 2D0BA 2DKCA 2XHIA 3CVSA 1M3QA 1YTFA 2NOBA 1PZDA 3HS9A 4C7PA 2G30A 2Y8QA 2O3OA 1MP9A 2FKMX 3BKQX 3OGDA 4TPSA 4WXAA 4EAIA 1QNCA 1NH2A 2YH5A 1QN4A 1VKLA 3F10A 3T4NA 2D0AA 1W80A 3VN5A 1DIZA 2R5XA 1E42A 2V9JA 5JN5A 1WJWA 3OH6A 2OOYA 2V92A 1KYDA 4EAKA 4QG5A 1QN8A 5IYCP 3CWUA 3SNSA 1KY7A 2F7LA 3OC3C 4HJHA 1HU0A 1AISA 2FUVA 1V5SA 1K35A 1XSZA 4D7QA 1QN7A 1LWWA 4B0AA 5F9CA 4CFFA 4D7RA 5BMNA 3I0WA 3CVTA 4MRQA 2Z8UA 5EPCA 1PCJX 3ASMA 1KFQA 2PWWA 3F0ZA 2YA3A 1QNBA 1JFIC 4IL8A 1P5DX 2NOFA 4BJUA 1PCZA 1R4XA 3TE5A 1QTPA 2D0CA 1KYUA 2LAEA 1T6AA 5HSHA 5IYBP 1KY6A 3DPTA 2FGTA 2VJ0A 2JPIA 2FKFA 1LWVA 3D4VA 4WX8A 3H1ZA 2Y8LA 3CWTA 1D3UA 2NOEA 1PCMX 2NLVA 2Z0FA 1K2YX 2QREA 3CWSA 1QNEA 1WQAA 4ROCB 1UL7A 1QN9A 2JOIA 4EALA 2H5AX 4PY5A 4RODB 1KO9A 3HS8A 1UT4A 5JMVD 3CWAA 2QRDA 1PVSA 1N39A 1EBMA 4EJZA 2NOZA 1C47A 2IV9A 4WZSD 4EAJA 1N3CA 3CW7A 4Q11A 4DULA 2NOHA 1MPGA 2ZFDB 3D7QA 3EAYA 1VTOA 3I3WA 2MZ8A 1VOLB 5KL0A 2HZSA 1VOKA
chains in the Genus database with same CATH topology
5BMPA 5JN5A 2EIUA 2JPIA 1WJWA 2FKFA 2EHPA 3UW2A 1TUOA 4WX8A 1JDYA 4QG5A 1PCMX 2F7LA 1K2YX 2Z0FA 3OLPA 3PDKA 3PMGA 4HJHA 3RSMA 2FUVA 1WQAA 1K35A 3ENCA 2H5AX 5F9CA 1C4GA 3C04A 5JMVD 2DKCA 1P5GX 5BMNA 4MRQA 1LXTA 3NA5A 2H4LX 1C47A 1PCJX 5EPCA 1KFQA 2DKAA 2FKMX 3BKQX 4IL8A 4WXAA 1P5DX 4BJUA 1VKLA 5HSHA 3ENOC 3I3WA 2DKDA 5KL0A 1KFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMP A;  5JN5 A;  2EIU A;  2JPI A;  1WJW A;  2FKF A;  2EHP A;  3UW2 A;  1TUO A;  4WX8 A;  1JDY A;  4QG5 A;  1PCM X;  2F7L A;  1K2Y X;  2Z0F A;  3OLP A;  3PDK A;  3PMG A;  4HJH A;  3RSM A;  2FUV A;  1WQA A;  1K35 A;  3ENC A;  2H5A X;  5F9C A;  1C4G A;  3C04 A;  5JMV D;  2DKC A;  1P5G X;  5BMN A;  4MRQ A;  1LXT A;  3NA5 A;  2H4L X;  1C47 A;  1PCJ X;  5EPC A;  1KFQ A;  2DKA A;  2FKM X;  3BKQ X;  4IL8 A;  4WXA A;  1P5D X;  4BJU A;  1VKL A;  5HSH A;  3ENO C;  3I3W A;  2DKD A;  5KL0 A;  1KFI A; 
#chains in the Genus database with same CATH topology
 3I0X A;  2EIU A;  1QN5 A;  3UW2 A;  2NOL A;  2NOI A;  1JDY A;  2EHB D;  1TGH A;  2NWV A;  3OH9 A;  3PDK A;  3OLP A;  2NVM A;  2I5W A;  1YQM A;  2OOX A;  1QNA A;  4EAG A;  3IH7 A;  1TBP A;  3N89 A;  1J3M A;  1NGM A;  1P5G X;  3TDH A;  1LXT A;  3KTU A;  2QR1 A;  2H4L X;  3NA5 A;  2HL8 A;  5IYD P;  2JHJ A;  2DKA A;  1QN6 A;  3OSM A;  3OST A;  2MJ7 A;  3ULX A;  4I8O A;  1RM1 A;  1EUV A;  2QLV A;  4ROE B;  1YQK A;  1YQR A;  1QTS A;  2QRC A;  3ENO C;  2DKD A;  3OSE A;  5AN4 A;  1KYF A;  1TBA B;  1KFI A;  3DPU A;  4EJY A;  2HKP A;  5BMP A;  1FN7 A;  2HZM A;  3EIK A;  1LWY A;  2V8Q A;  2EHP A;  3KRM A;  1YTB A;  1TUO A;  1QN3 A;  1M5Q 1;  1UT7 A;  1CDW A;  1N3A A;  3RPJ A;  2JHN A;  1B9K A;  1M3H A;  1VTL E;  3PMG A;  3RSM A;  2IV8 A;  1C9B B;  2HL9 A;  3OCI A;  3ENC A;  1YQL A;  1Q9U A;  1C4G A;  1NVP A;  3C04 A;  2D0B A;  2DKC A;  2XHI A;  3CVS A;  1M3Q A;  1YTF A;  2NOB A;  1PZD A;  3HS9 A;  4C7P A;  2G30 A;  2Y8Q A;  2O3O A;  1MP9 A;  2FKM X;  3BKQ X;  3OGD A;  4TPS A;  4WXA A;  4EAI A;  1QNC A;  1NH2 A;  2YH5 A;  1QN4 A;  1VKL A;  3F10 A;  3T4N A;  2D0A A;  1W80 A;  3VN5 A;  1DIZ A;  2R5X A;  1E42 A;  2V9J A;  5JN5 A;  1WJW A;  3OH6 A;  2OOY A;  2V92 A;  1KYD A;  4EAK A;  4QG5 A;  1QN8 A;  5IYC P;  3CWU A;  3SNS A;  1KY7 A;  2F7L A;  3OC3 C;  4HJH A;  1HU0 A;  1AIS A;  2FUV A;  1V5S A;  1K35 A;  1XSZ A;  4D7Q A;  1QN7 A;  1LWW A;  4B0A A;  5F9C A;  4CFF A;  4D7R A;  5BMN A;  3I0W A;  3CVT A;  4MRQ A;  2Z8U A;  5EPC A;  1PCJ X;  3ASM A;  1KFQ A;  2PWW A;  3F0Z A;  2YA3 A;  1QNB A;  1JFI C;  4IL8 A;  1P5D X;  2NOF A;  4BJU A;  1PCZ A;  1R4X A;  3TE5 A;  1QTP A;  2D0C A;  1KYU A;  2LAE A;  1T6A A;  5HSH A;  5IYB P;  1KY6 A;  3DPT A;  2FGT A;  2VJ0 A;  2JPI A;  2FKF A;  1LWV A;  3D4V A;  4WX8 A;  3H1Z A;  2Y8L A;  3CWT A;  1D3U A;  2NOE A;  1PCM X;  2NLV A;  2Z0F A;  1K2Y X;  2QRE A;  3CWS A;  1QNE A;  1WQA A;  4ROC B;  1UL7 A;  1QN9 A;  2JOI A;  4EAL A;  2H5A X;  4PY5 A;  4ROD B;  1KO9 A;  3HS8 A;  1UT4 A;  5JMV D;  3CWA A;  2QRD A;  1PVS A;  1N39 A;  1EBM A;  4EJZ A;  2NOZ A;  1C47 A;  2IV9 A;  4WZS D;  4EAJ A;  1N3C A;  3CW7 A;  4Q11 A;  4DUL A;  2NOH A;  1MPG A;  2ZFD B;  3D7Q A;  3EAY A;  1VTO A;  3I3W A;  2MZ8 A;  1VOL B;  5KL0 A;  2HZS A;  1VOK A; 
#chains in the Genus database with same CATH homology
 5BMP A;  5JN5 A;  2EIU A;  2JPI A;  1WJW A;  2FKF A;  2EHP A;  3UW2 A;  1TUO A;  4WX8 A;  1JDY A;  4QG5 A;  1PCM X;  2F7L A;  1K2Y X;  2Z0F A;  3OLP A;  3PDK A;  3PMG A;  4HJH A;  3RSM A;  2FUV A;  1WQA A;  1K35 A;  3ENC A;  2H5A X;  5F9C A;  1C4G A;  3C04 A;  5JMV D;  2DKC A;  1P5G X;  5BMN A;  4MRQ A;  1LXT A;  3NA5 A;  2H4L X;  1C47 A;  1PCJ X;  5EPC A;  1KFQ A;  2DKA A;  2FKM X;  3BKQ X;  4IL8 A;  4WXA A;  1P5D X;  4BJU A;  1VKL A;  5HSH A;  3ENO C;  3I3W A;  2DKD A;  5KL0 A;  1KFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...