3UW2A

X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
464
structure length
458
Chain Sequence
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGSGSYEQYDVADQYVERIVGDIKLTRPLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKATDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLARWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARVADPSALLNGLPNAVSTPELQLNVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGLARSSNTTPVVVLRFEATSDAALARIQDDFRRALKAAKPGANLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglucomutase/phosphomannomutase family protein
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Isomerase
total genus 159
structure length 458
sequence length 464
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 3uw2A04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A01
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 3uw2A02
4BJUA 2EIUA 5HSHA 4HJHA 2DKAA 5JN5A 3NA5A 1WQAA 1P5DX 3OLPA 2DKDA 2FKFA 3ENCA 4WXAA 5F9CA 1KFQA 1KFIA 5KL0A 2DKCA 5JMVD 2JPIA 3PDKA 3UW2A 3ENOC 3RSMA 2EHPA 2H4LX 5EPCA 3BKQX 1K2YX 4IL8A 2H5AX 1JDYA 1K35A 2Z0FA 1C4GA 1VKLA 1WJWA 2F7LA 4QG5A 4MRQA 2FKMX 1C47A 2FUVA 3I3WA 5BMNA 1PCJX 1TUOA 1LXTA 3C04A 3PMGA 5BMPA 1P5GX 1PCMX 4WX8A
chains in the Genus database with same CATH superfamily
2QRDA 2IV9A 4I8OA 1TGHA 1M3HA 4HJHA 1QNAA 1EBMA 1QN4A 3NA5A 1KYUA 1KY6A 1YQKA 5IYDP 1LWYA 3SNSA 2DKDA 3TDHA 4EAGA 3ENCA 1R4XA 1QNBA 1QNCA 1UT4A 3CWUA 4EJYA 4D7QA 4PY5A 1TBPA 3F10A 3CW7A 2JPIA 3D7QA 3PDKA 2HL8A 1PVSA 1K2YX 3I0XA 4IL8A 2H5AX 1MP9A 1FN7A 2NVMA 1UL7A 1VKLA 1WJWA 4B0AA 3CWAA 1N3CA 4MRQA 2FUVA 1VOLB 3OSEA 2MZ8A 2G30A 3I3WA 5BMNA 1LXTA 1QNEA 2D0AA 3KTUA 2QLVA 2I5WA 2EIUA 3H1ZA 5JN5A 2FGTA 2V9JA 1QN3A 1M5Q1 3N89A 2PWWA 2YA3A 1D3UA 4WXAA 1JFIC 5F9CA 1QN5A 1YTFA 1VOKA 1YQMA 2XHIA 3OGDA 2DKCA 1CDWA 2EHPA 5AN4A 3RSMA 2HKPA 4ROEB 1VTLE 3ASMA 2OOYA 2MJ7A 2Y8QA 4TPSA 1N39A 1K35A 1NVPA 1KO9A 1T6AA 2JHJA 4QG5A 2EHBD 2QRCA 3DPTA 1QTPA 1EUVA 2Y8LA 3EIKA 4DULA 1E42A 4RODB 4D7RA 5HSHA 4C7PA 4CFFA 2DKAA 2O3OA 2JOIA 4EAIA 3DPUA 2NOHA 2VJ0A 3CVSA 1W80A 2NOZA 3TE5A 1WQAA 3HS9A 3OSTA 2NWVA 4WZSD 2HZSA 2FKFA 4WX8A 1MPGA 2R5XA 1DIZA 3EAYA 1YQLA 1B9KA 3CWSA 3RPJA 3T4NA 3IH7A 2NOIA 3UW2A 1LWVA 1QN9A 2ZFDB 1V5SA 1N3AA 2NOEA 2JHNA 1JDYA 2Z0FA 1C4GA 1M3QA 2HZMA 1KYDA 2F7LA 1TBAB 1KY7A 1C47A 4ROCB 1AISA 3VN5A 1NGMA 2D0CA 2OOXA 3OSMA 1PCJX 5BMPA 3PMGA 1RM1A 1YQRA 1HU0A 1QN6A 4EJZA 1P5GX 1PCMX 3OC3C 2HL9A 5IYCP 3OH6A 2QR1A 4EAJA 4BJUA 1PCZA 3OH9A 3OCIA 1LWWA 1UT7A 3HS8A 3KRMA 2NLVA 1P5DX 2IV8A 3OLPA 3CVTA 5IYBP 1J3MA 3F0ZA 2D0BA 4EAKA 1YTBA 2Z8UA 1KFQA 1KFIA 3ULXA 5KL0A 5JMVD 3CWTA 2QREA 3ENOC 2H4LX 2V8QA 2YH5A 5EPCA 4EALA 3BKQX 3I0WA 2NOLA 2NOBA 2V92A 1Q9UA 1VTOA 1KYFA 1QTSA 1XSZA 2NOFA 2FKMX 1QN7A 4Q11A 3D4VA 1TUOA 3C04A 1C9BB 1PZDA 1NH2A 1QN8A 2LAEA
chains in the Genus database with same CATH topology
4BJUA 2EIUA 5HSHA 4HJHA 2DKAA 5JN5A 3NA5A 1WQAA 1P5DX 3OLPA 2DKDA 2FKFA 3ENCA 4WXAA 5F9CA 1KFQA 1KFIA 5KL0A 2DKCA 5JMVD 2JPIA 3PDKA 3UW2A 3ENOC 3RSMA 2EHPA 2H4LX 5EPCA 3BKQX 1K2YX 4IL8A 2H5AX 1JDYA 1K35A 2Z0FA 1C4GA 1VKLA 1WJWA 2F7LA 4QG5A 4MRQA 2FKMX 1C47A 2FUVA 3I3WA 5BMNA 1PCJX 1TUOA 1LXTA 3C04A 3PMGA 5BMPA 1P5GX 1PCMX 4WX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJU A;  2EIU A;  5HSH A;  4HJH A;  2DKA A;  5JN5 A;  3NA5 A;  1WQA A;  1P5D X;  3OLP A;  2DKD A;  2FKF A;  3ENC A;  4WXA A;  5F9C A;  1KFQ A;  1KFI A;  5KL0 A;  2DKC A;  5JMV D;  2JPI A;  3PDK A;  3UW2 A;  3ENO C;  3RSM A;  2EHP A;  2H4L X;  5EPC A;  3BKQ X;  1K2Y X;  4IL8 A;  2H5A X;  1JDY A;  1K35 A;  2Z0F A;  1C4G A;  1VKL A;  1WJW A;  2F7L A;  4QG5 A;  4MRQ A;  2FKM X;  1C47 A;  2FUV A;  3I3W A;  5BMN A;  1PCJ X;  1TUO A;  1LXT A;  3C04 A;  3PMG A;  5BMP A;  1P5G X;  1PCM X;  4WX8 A; 
#chains in the Genus database with same CATH topology
 2QRD A;  2IV9 A;  4I8O A;  1TGH A;  1M3H A;  4HJH A;  1QNA A;  1EBM A;  1QN4 A;  3NA5 A;  1KYU A;  1KY6 A;  1YQK A;  5IYD P;  1LWY A;  3SNS A;  2DKD A;  3TDH A;  4EAG A;  3ENC A;  1R4X A;  1QNB A;  1QNC A;  1UT4 A;  3CWU A;  4EJY A;  4D7Q A;  4PY5 A;  1TBP A;  3F10 A;  3CW7 A;  2JPI A;  3D7Q A;  3PDK A;  2HL8 A;  1PVS A;  1K2Y X;  3I0X A;  4IL8 A;  2H5A X;  1MP9 A;  1FN7 A;  2NVM A;  1UL7 A;  1VKL A;  1WJW A;  4B0A A;  3CWA A;  1N3C A;  4MRQ A;  2FUV A;  1VOL B;  3OSE A;  2MZ8 A;  2G30 A;  3I3W A;  5BMN A;  1LXT A;  1QNE A;  2D0A A;  3KTU A;  2QLV A;  2I5W A;  2EIU A;  3H1Z A;  5JN5 A;  2FGT A;  2V9J A;  1QN3 A;  1M5Q 1;  3N89 A;  2PWW A;  2YA3 A;  1D3U A;  4WXA A;  1JFI C;  5F9C A;  1QN5 A;  1YTF A;  1VOK A;  1YQM A;  2XHI A;  3OGD A;  2DKC A;  1CDW A;  2EHP A;  5AN4 A;  3RSM A;  2HKP A;  4ROE B;  1VTL E;  3ASM A;  2OOY A;  2MJ7 A;  2Y8Q A;  4TPS A;  1N39 A;  1K35 A;  1NVP A;  1KO9 A;  1T6A A;  2JHJ A;  4QG5 A;  2EHB D;  2QRC A;  3DPT A;  1QTP A;  1EUV A;  2Y8L A;  3EIK A;  4DUL A;  1E42 A;  4ROD B;  4D7R A;  5HSH A;  4C7P A;  4CFF A;  2DKA A;  2O3O A;  2JOI A;  4EAI A;  3DPU A;  2NOH A;  2VJ0 A;  3CVS A;  1W80 A;  2NOZ A;  3TE5 A;  1WQA A;  3HS9 A;  3OST A;  2NWV A;  4WZS D;  2HZS A;  2FKF A;  4WX8 A;  1MPG A;  2R5X A;  1DIZ A;  3EAY A;  1YQL A;  1B9K A;  3CWS A;  3RPJ A;  3T4N A;  3IH7 A;  2NOI A;  3UW2 A;  1LWV A;  1QN9 A;  2ZFD B;  1V5S A;  1N3A A;  2NOE A;  2JHN A;  1JDY A;  2Z0F A;  1C4G A;  1M3Q A;  2HZM A;  1KYD A;  2F7L A;  1TBA B;  1KY7 A;  1C47 A;  4ROC B;  1AIS A;  3VN5 A;  1NGM A;  2D0C A;  2OOX A;  3OSM A;  1PCJ X;  5BMP A;  3PMG A;  1RM1 A;  1YQR A;  1HU0 A;  1QN6 A;  4EJZ A;  1P5G X;  1PCM X;  3OC3 C;  2HL9 A;  5IYC P;  3OH6 A;  2QR1 A;  4EAJ A;  4BJU A;  1PCZ A;  3OH9 A;  3OCI A;  1LWW A;  1UT7 A;  3HS8 A;  3KRM A;  2NLV A;  1P5D X;  2IV8 A;  3OLP A;  3CVT A;  5IYB P;  1J3M A;  3F0Z A;  2D0B A;  4EAK A;  1YTB A;  2Z8U A;  1KFQ A;  1KFI A;  3ULX A;  5KL0 A;  5JMV D;  3CWT A;  2QRE A;  3ENO C;  2H4L X;  2V8Q A;  2YH5 A;  5EPC A;  4EAL A;  3BKQ X;  3I0W A;  2NOL A;  2NOB A;  2V92 A;  1Q9U A;  1VTO A;  1KYF A;  1QTS A;  1XSZ A;  2NOF A;  2FKM X;  1QN7 A;  4Q11 A;  3D4V A;  1TUO A;  3C04 A;  1C9B B;  1PZD A;  1NH2 A;  1QN8 A;  2LAE A; 
#chains in the Genus database with same CATH homology
 4BJU A;  2EIU A;  5HSH A;  4HJH A;  2DKA A;  5JN5 A;  3NA5 A;  1WQA A;  1P5D X;  3OLP A;  2DKD A;  2FKF A;  3ENC A;  4WXA A;  5F9C A;  1KFQ A;  1KFI A;  5KL0 A;  2DKC A;  5JMV D;  2JPI A;  3PDK A;  3UW2 A;  3ENO C;  3RSM A;  2EHP A;  2H4L X;  5EPC A;  3BKQ X;  1K2Y X;  4IL8 A;  2H5A X;  1JDY A;  1K35 A;  2Z0F A;  1C4G A;  1VKL A;  1WJW A;  2F7L A;  4QG5 A;  4MRQ A;  2FKM X;  1C47 A;  2FUV A;  3I3W A;  5BMN A;  1PCJ X;  1TUO A;  1LXT A;  3C04 A;  3PMG A;  5BMP A;  1P5G X;  1PCM X;  4WX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...