1KFIA

Crystal structure of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase) from paramecium
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
570
structure length
570
Chain Sequence
QVIPAPRVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGRYFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHNPGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKFEGTRLEKSHFEVKVVDTVQDYTQLMQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKHIFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIHKKKDVGTVPQFGAACDGDADRNMILGRQFFVTPSDSLAVIAANANLIFKNGLLGAARSMPTSGALDKVAAKNGIKLFETPTGWKFFGNLMDAGLINLCGEESFGTGSNHIREKDGIWAVLAWLTILAHKNKNTDHFVTVEEIVTQYWQQFGRNYYSRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIRIYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphoglucomutase 1
publication title Crystal structure analysis of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase), from Paramecium reveals significant conformational variability.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Isomerase
total genus 181
structure length 570
sequence length 570
chains with identical sequence B
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 1kfiA04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA02
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA01
2H5AX 2DKAA 3ENOC 4QG5A 1KFQA 2FUVA 2FKFA 2H4LX 3UW2A 4MRQA 5BMNA 1PCMX 3OLPA 1JDYA 1C4GA 1LXTA 1KFIA 4IL8A 4WXAA 5KL0A 5HSHA 2EIUA 4HJHA 4WX8A 2DKDA 1VKLA 2DKCA 3PDKA 1WJWA 1P5DX 4BJUA 2F7LA 3BKQX 1K35A 3I3WA 3C04A 1PCJX 1C47A 3PMGA 3NA5A 3RSMA 1K2YX 5JMVD 5BMPA 5JN5A 2Z0FA 5EPCA 5F9CA 3ENCA 1TUOA 1WQAA 2EHPA 2JPIA 1P5GX 2FKMX
chains in the Genus database with same CATH superfamily
2H5AX 3ENOC 4QG5A 1KFQA 1KYUA 2FUVA 2JHJA 2Z8UA 1NVPA 1UT7A 3DPTA 4MRQA 1MPGA 1PCMX 1M3HA 1JDYA 1HU0A 1KFIA 1QN4A 1VTLE 1PCZA 1TBPA 2D0BA 4HJHA 2DKDA 1VKLA 2DKCA 4WX8A 4WZSD 3I0WA 2EHBD 2NOEA 3HS8A 1EBMA 1Q9UA 2F7LA 1K35A 3HS9A 3C04A 1PCJX 2YA3A 3I3WA 3OH6A 3OH9A 2NLVA 1N39A 3OSTA 2NOIA 1PVSA 2QLVA 4EAGA 3RSMA 2I5WA 1NGMA 3RPJA 4D7RA 1QN6A 2NOHA 2NOLA 3D4VA 1QTSA 1YQRA 2EHPA 4DULA 2HZMA 1KY7A 2FKMX 2HZSA 2DKAA 1QNEA 1RM1A 3CVTA 2FKFA 2H4LX 2V92A 4Q11A 4D7QA 2NWVA 5BMNA 5JN5A 1VOKA 1C4GA 1QN7A 2V8QA 2R5XA 2MJ7A 3TE5A 2EIUA 4TPSA 1D3UA 2NOFA 1R4XA 3EIKA 1WJWA 1KY6A 3OGDA 1EUVA 2HKPA 2OOYA 2PWWA 2ZFDB 3BKQX 3OSMA 4EAJA 3OSEA 4C7PA 1K2YX 5JMVD 1MP9A 2OOXA 5BMPA 3VN5A 1QN9A 4I8OA 4EALA 4ROEB 2JHNA 1TUOA 3T4NA 2JPIA 5AN4A 3N89A 1N3CA 1LWVA 1N3AA 5IYBP 1CDWA 5IYDP 1TBAB 4ROCB 2YH5A 1VTOA 3DPUA 3CWAA 3OCIA 3UW2A 5HSHA 2NVMA 1LXTA 3OLPA 5KL0A 4WXAA 2QRDA 2V9JA 2Y8LA 1AISA 1QNCA 1UL7A 3H1ZA 3PDKA 1E42A 3CW7A 3TDHA 2QR1A 1P5DX 1YTBA 2HL8A 4BJUA 1B9KA 4EJZA 1KYFA 4EJYA 1C47A 2VJ0A 3CWTA 3EAYA 3KTUA 3I0XA 2G30A 1DIZA 3IH7A 3CWUA 2O3OA 2JOIA 2D0AA 2XHIA 2FGTA 1LWYA 1QN5A 2Z0FA 3ULXA 3ENCA 1QTPA 1XSZA 1WQAA 1TGHA 2QRCA 2LAEA 1KYDA 2D0CA 2QREA 1QN8A 3OC3C 3KRMA 1M5Q1 3F10A 5IYCP 2Y8QA 4B0AA 1J3MA 2MZ8A 4CFFA 1C9BB 4IL8A 2IV8A 2IV9A 4RODB 1LWWA 4EAKA 3F0ZA 1QNAA 3ASMA 1FN7A 4EAIA 2NOBA 3PMGA 2NOZA 3D7QA 1YQLA 3CVSA 1NH2A 3NA5A 2HL9A 1YQMA 1QN3A 4PY5A 1V5SA 1JFIC 1T6AA 1UT4A 1YTFA 5EPCA 1QNBA 5F9CA 1VOLB 1W80A 3SNSA 1YQKA 1M3QA 1PZDA 3CWSA 1P5GX 1KO9A
chains in the Genus database with same CATH topology
2H5AX 2DKAA 3ENOC 4QG5A 1KFQA 2FUVA 2FKFA 2H4LX 3UW2A 4MRQA 5BMNA 1PCMX 3OLPA 1JDYA 1C4GA 1LXTA 1KFIA 4IL8A 4WXAA 5KL0A 5HSHA 2EIUA 4HJHA 4WX8A 2DKDA 1VKLA 2DKCA 3PDKA 1WJWA 1P5DX 4BJUA 2F7LA 3BKQX 1K35A 3I3WA 3C04A 1PCJX 1C47A 3PMGA 3NA5A 3RSMA 1K2YX 5JMVD 5BMPA 5JN5A 2Z0FA 5EPCA 5F9CA 3ENCA 1TUOA 1WQAA 2EHPA 2JPIA 1P5GX 2FKMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5A X;  2DKA A;  3ENO C;  4QG5 A;  1KFQ A;  2FUV A;  2FKF A;  2H4L X;  3UW2 A;  4MRQ A;  5BMN A;  1PCM X;  3OLP A;  1JDY A;  1C4G A;  1LXT A;  1KFI A;  4IL8 A;  4WXA A;  5KL0 A;  5HSH A;  2EIU A;  4HJH A;  4WX8 A;  2DKD A;  1VKL A;  2DKC A;  3PDK A;  1WJW A;  1P5D X;  4BJU A;  2F7L A;  3BKQ X;  1K35 A;  3I3W A;  3C04 A;  1PCJ X;  1C47 A;  3PMG A;  3NA5 A;  3RSM A;  1K2Y X;  5JMV D;  5BMP A;  5JN5 A;  2Z0F A;  5EPC A;  5F9C A;  3ENC A;  1TUO A;  1WQA A;  2EHP A;  2JPI A;  1P5G X;  2FKM X; 
#chains in the Genus database with same CATH topology
 2H5A X;  3ENO C;  4QG5 A;  1KFQ A;  1KYU A;  2FUV A;  2JHJ A;  2Z8U A;  1NVP A;  1UT7 A;  3DPT A;  4MRQ A;  1MPG A;  1PCM X;  1M3H A;  1JDY A;  1HU0 A;  1KFI A;  1QN4 A;  1VTL E;  1PCZ A;  1TBP A;  2D0B A;  4HJH A;  2DKD A;  1VKL A;  2DKC A;  4WX8 A;  4WZS D;  3I0W A;  2EHB D;  2NOE A;  3HS8 A;  1EBM A;  1Q9U A;  2F7L A;  1K35 A;  3HS9 A;  3C04 A;  1PCJ X;  2YA3 A;  3I3W A;  3OH6 A;  3OH9 A;  2NLV A;  1N39 A;  3OST A;  2NOI A;  1PVS A;  2QLV A;  4EAG A;  3RSM A;  2I5W A;  1NGM A;  3RPJ A;  4D7R A;  1QN6 A;  2NOH A;  2NOL A;  3D4V A;  1QTS A;  1YQR A;  2EHP A;  4DUL A;  2HZM A;  1KY7 A;  2FKM X;  2HZS A;  2DKA A;  1QNE A;  1RM1 A;  3CVT A;  2FKF A;  2H4L X;  2V92 A;  4Q11 A;  4D7Q A;  2NWV A;  5BMN A;  5JN5 A;  1VOK A;  1C4G A;  1QN7 A;  2V8Q A;  2R5X A;  2MJ7 A;  3TE5 A;  2EIU A;  4TPS A;  1D3U A;  2NOF A;  1R4X A;  3EIK A;  1WJW A;  1KY6 A;  3OGD A;  1EUV A;  2HKP A;  2OOY A;  2PWW A;  2ZFD B;  3BKQ X;  3OSM A;  4EAJ A;  3OSE A;  4C7P A;  1K2Y X;  5JMV D;  1MP9 A;  2OOX A;  5BMP A;  3VN5 A;  1QN9 A;  4I8O A;  4EAL A;  4ROE B;  2JHN A;  1TUO A;  3T4N A;  2JPI A;  5AN4 A;  3N89 A;  1N3C A;  1LWV A;  1N3A A;  5IYB P;  1CDW A;  5IYD P;  1TBA B;  4ROC B;  2YH5 A;  1VTO A;  3DPU A;  3CWA A;  3OCI A;  3UW2 A;  5HSH A;  2NVM A;  1LXT A;  3OLP A;  5KL0 A;  4WXA A;  2QRD A;  2V9J A;  2Y8L A;  1AIS A;  1QNC A;  1UL7 A;  3H1Z A;  3PDK A;  1E42 A;  3CW7 A;  3TDH A;  2QR1 A;  1P5D X;  1YTB A;  2HL8 A;  4BJU A;  1B9K A;  4EJZ A;  1KYF A;  4EJY A;  1C47 A;  2VJ0 A;  3CWT A;  3EAY A;  3KTU A;  3I0X A;  2G30 A;  1DIZ A;  3IH7 A;  3CWU A;  2O3O A;  2JOI A;  2D0A A;  2XHI A;  2FGT A;  1LWY A;  1QN5 A;  2Z0F A;  3ULX A;  3ENC A;  1QTP A;  1XSZ A;  1WQA A;  1TGH A;  2QRC A;  2LAE A;  1KYD A;  2D0C A;  2QRE A;  1QN8 A;  3OC3 C;  3KRM A;  1M5Q 1;  3F10 A;  5IYC P;  2Y8Q A;  4B0A A;  1J3M A;  2MZ8 A;  4CFF A;  1C9B B;  4IL8 A;  2IV8 A;  2IV9 A;  4ROD B;  1LWW A;  4EAK A;  3F0Z A;  1QNA A;  3ASM A;  1FN7 A;  4EAI A;  2NOB A;  3PMG A;  2NOZ A;  3D7Q A;  1YQL A;  3CVS A;  1NH2 A;  3NA5 A;  2HL9 A;  1YQM A;  1QN3 A;  4PY5 A;  1V5S A;  1JFI C;  1T6A A;  1UT4 A;  1YTF A;  5EPC A;  1QNB A;  5F9C A;  1VOL B;  1W80 A;  3SNS A;  1YQK A;  1M3Q A;  1PZD A;  3CWS A;  1P5G X;  1KO9 A; 
#chains in the Genus database with same CATH homology
 2H5A X;  2DKA A;  3ENO C;  4QG5 A;  1KFQ A;  2FUV A;  2FKF A;  2H4L X;  3UW2 A;  4MRQ A;  5BMN A;  1PCM X;  3OLP A;  1JDY A;  1C4G A;  1LXT A;  1KFI A;  4IL8 A;  4WXA A;  5KL0 A;  5HSH A;  2EIU A;  4HJH A;  4WX8 A;  2DKD A;  1VKL A;  2DKC A;  3PDK A;  1WJW A;  1P5D X;  4BJU A;  2F7L A;  3BKQ X;  1K35 A;  3I3W A;  3C04 A;  1PCJ X;  1C47 A;  3PMG A;  3NA5 A;  3RSM A;  1K2Y X;  5JMV D;  5BMP A;  5JN5 A;  2Z0F A;  5EPC A;  5F9C A;  3ENC A;  1TUO A;  1WQA A;  2EHP A;  2JPI A;  1P5G X;  2FKM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...