1KFIA

Crystal structure of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase) from paramecium
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
570
structure length
570
Chain Sequence
QVIPAPRVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGRYFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHNPGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKFEGTRLEKSHFEVKVVDTVQDYTQLMQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKHIFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIHKKKDVGTVPQFGAACDGDADRNMILGRQFFVTPSDSLAVIAANANLIFKNGLLGAARSMPTSGALDKVAAKNGIKLFETPTGWKFFGNLMDAGLINLCGEESFGTGSNHIREKDGIWAVLAWLTILAHKNKNTDHFVTVEEIVTQYWQQFGRNYYSRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIRIYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords phosphoglucomutase 1
publication title Crystal structure analysis of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase), from Paramecium reveals significant conformational variability.
pubmed doi rcsb
source organism Paramecium tetraurelia
total genus 181
structure length 570
sequence length 570
chains with identical sequence B
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 1kfiA04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA02
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfiA01
3BKQX 4HJHA 2DKCA 5JN5A 1JDYA 3I3WA 4MRQA 2DKAA 2H4LX 3OLPA 4WX8A 5BMPA 5KL0A 5F9CA 4WXAA 1KFIA 1K35A 2F7LA 3PMGA 1P5GX 2EHPA 4QG5A 2H5AX 2Z0FA 1K2YX 2JPIA 3ENOC 1LXTA 3C04A 4IL8A 1WQAA 5HSHA 1WJWA 2FKMX 5EPCA 3PDKA 3RSMA 1VKLA 4BJUA 3ENCA 2EIUA 5JMVD 2DKDA 3UW2A 1P5DX 2FKFA 1TUOA 3NA5A 1PCJX 1PCMX 1C4GA 1KFQA 1C47A 5BMNA 2FUVA
chains in the Genus database with same CATH superfamily
2JHNA 3OGDA 2HZSA 2IV8A 3CWUA 1QN8A 3BKQX 3KTUA 1VOLB 2NOBA 2G30A 4MRQA 2DKAA 2H4LX 3OLPA 2JHJA 5BMPA 3I0XA 1XSZA 1EBMA 1W80A 2VJ0A 2HL9A 2OOXA 2QLVA 1EUVA 3PMGA 1QN9A 4Q11A 2OOYA 4EAGA 1J3MA 1K2YX 2JPIA 1KYFA 2ZFDB 3EAYA 3OSEA 3I0WA 3C04A 5IYBP 3IH7A 5HSHA 2QR1A 1UT7A 1WJWA 2NWVA 1VTLE 2NOLA 4EAIA 1VKLA 4BJUA 3HS9A 5JMVD 2DKDA 3OSMA 2FKFA 1NVPA 4RODB 2I5WA 3NA5A 1PCJX 2NOFA 2NOIA 1N3CA 1PCMX 3N89A 1TGHA 5BMNA 3OH9A 4EJZA 2EIUA 1N3AA 2HZMA 4EJYA 1V5SA 2V8QA 1JDYA 1KO9A 2NOZA 1KYUA 3KRMA 1QTPA 1AISA 1M5Q1 2QREA 2QRCA 1P5GX 1YQMA 1PVSA 2EHPA 3T4NA 2Y8QA 4EAKA 2Z0FA 1VTOA 4CFFA 4IL8A 1WQAA 4EALA 1Q9UA 4ROCB 1QNEA 5IYCP 1M3QA 1KYDA 4WZSD 1VOKA 3PDKA 2O3OA 2PWWA 1RM1A 3EIKA 1CDWA 1MPGA 1QN7A 4TPSA 2HKPA 1QN3A 2NVMA 1B9KA 1KFQA 3CVSA 2D0AA 2NOEA 4I8OA 2XHIA 1YQRA 2NOHA 1T6AA 2V9JA 1QNBA 5JN5A 3I3WA 4WX8A 5F9CA 4WXAA 1LWYA 1K35A 3D7QA 1QNAA 1HU0A 3F10A 2F7LA 1UT4A 3H1ZA 4D7RA 3HS8A 2V92A 3ENOC 1DIZA 3CWSA 1LXTA 2MZ8A 2YH5A 1YTBA 1QNCA 3TDHA 3DPTA 1M3HA 2FKMX 1PZDA 3ULXA 1MP9A 3VN5A 3OH6A 1NH2A 1FN7A 1D3UA 1QTSA 3ENCA 1YTFA 4DULA 3CWTA 2LAEA 3UW2A 3CW7A 1P5DX 4C7PA 1TUOA 1QN6A 2QRDA 1LWVA 4EAJA 1C47A 1TBPA 2FUVA 1UL7A 2Y8LA 5AN4A 1LWWA 2IV9A 4HJHA 2DKCA 3TE5A 4D7QA 3CVTA 2NLVA 3F0ZA 5KL0A 1PCZA 1N39A 1KFIA 4B0AA 1JFIC 3RPJA 2Z8UA 1E42A 1C9BB 2MJ7A 4QG5A 2R5XA 4ROEB 2H5AX 3D4VA 1YQLA 3OCIA 1TBAB 1KY6A 5IYDP 4PY5A 2JOIA 3OSTA 5EPCA 1QN5A 2HL8A 2D0BA 3ASMA 3DPUA 3RSMA 1YQKA 3SNSA 1R4XA 3OC3C 1KY7A 3CWAA 2FGTA 1QN4A 2YA3A 1C4GA 1NGMA 2D0CA 2EHBD
chains in the Genus database with same CATH topology
3BKQX 4HJHA 2DKCA 5JN5A 1JDYA 3I3WA 4MRQA 2DKAA 2H4LX 3OLPA 4WX8A 5BMPA 5KL0A 5F9CA 4WXAA 1KFIA 1K35A 2F7LA 3PMGA 1P5GX 2EHPA 4QG5A 2H5AX 2Z0FA 1K2YX 2JPIA 3ENOC 1LXTA 3C04A 4IL8A 1WQAA 5HSHA 1WJWA 2FKMX 5EPCA 3PDKA 3RSMA 1VKLA 4BJUA 3ENCA 2EIUA 5JMVD 2DKDA 3UW2A 1P5DX 2FKFA 1TUOA 3NA5A 1PCJX 1PCMX 1C4GA 1KFQA 1C47A 5BMNA 2FUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BKQ X;  4HJH A;  2DKC A;  5JN5 A;  1JDY A;  3I3W A;  4MRQ A;  2DKA A;  2H4L X;  3OLP A;  4WX8 A;  5BMP A;  5KL0 A;  5F9C A;  4WXA A;  1KFI A;  1K35 A;  2F7L A;  3PMG A;  1P5G X;  2EHP A;  4QG5 A;  2H5A X;  2Z0F A;  1K2Y X;  2JPI A;  3ENO C;  1LXT A;  3C04 A;  4IL8 A;  1WQA A;  5HSH A;  1WJW A;  2FKM X;  5EPC A;  3PDK A;  3RSM A;  1VKL A;  4BJU A;  3ENC A;  2EIU A;  5JMV D;  2DKD A;  3UW2 A;  1P5D X;  2FKF A;  1TUO A;  3NA5 A;  1PCJ X;  1PCM X;  1C4G A;  1KFQ A;  1C47 A;  5BMN A;  2FUV A; 
#chains in the Genus database with same CATH topology
 2JHN A;  3OGD A;  2HZS A;  2IV8 A;  3CWU A;  1QN8 A;  3BKQ X;  3KTU A;  1VOL B;  2NOB A;  2G30 A;  4MRQ A;  2DKA A;  2H4L X;  3OLP A;  2JHJ A;  5BMP A;  3I0X A;  1XSZ A;  1EBM A;  1W80 A;  2VJ0 A;  2HL9 A;  2OOX A;  2QLV A;  1EUV A;  3PMG A;  1QN9 A;  4Q11 A;  2OOY A;  4EAG A;  1J3M A;  1K2Y X;  2JPI A;  1KYF A;  2ZFD B;  3EAY A;  3OSE A;  3I0W A;  3C04 A;  5IYB P;  3IH7 A;  5HSH A;  2QR1 A;  1UT7 A;  1WJW A;  2NWV A;  1VTL E;  2NOL A;  4EAI A;  1VKL A;  4BJU A;  3HS9 A;  5JMV D;  2DKD A;  3OSM A;  2FKF A;  1NVP A;  4ROD B;  2I5W A;  3NA5 A;  1PCJ X;  2NOF A;  2NOI A;  1N3C A;  1PCM X;  3N89 A;  1TGH A;  5BMN A;  3OH9 A;  4EJZ A;  2EIU A;  1N3A A;  2HZM A;  4EJY A;  1V5S A;  2V8Q A;  1JDY A;  1KO9 A;  2NOZ A;  1KYU A;  3KRM A;  1QTP A;  1AIS A;  1M5Q 1;  2QRE A;  2QRC A;  1P5G X;  1YQM A;  1PVS A;  2EHP A;  3T4N A;  2Y8Q A;  4EAK A;  2Z0F A;  1VTO A;  4CFF A;  4IL8 A;  1WQA A;  4EAL A;  1Q9U A;  4ROC B;  1QNE A;  5IYC P;  1M3Q A;  1KYD A;  4WZS D;  1VOK A;  3PDK A;  2O3O A;  2PWW A;  1RM1 A;  3EIK A;  1CDW A;  1MPG A;  1QN7 A;  4TPS A;  2HKP A;  1QN3 A;  2NVM A;  1B9K A;  1KFQ A;  3CVS A;  2D0A A;  2NOE A;  4I8O A;  2XHI A;  1YQR A;  2NOH A;  1T6A A;  2V9J A;  1QNB A;  5JN5 A;  3I3W A;  4WX8 A;  5F9C A;  4WXA A;  1LWY A;  1K35 A;  3D7Q A;  1QNA A;  1HU0 A;  3F10 A;  2F7L A;  1UT4 A;  3H1Z A;  4D7R A;  3HS8 A;  2V92 A;  3ENO C;  1DIZ A;  3CWS A;  1LXT A;  2MZ8 A;  2YH5 A;  1YTB A;  1QNC A;  3TDH A;  3DPT A;  1M3H A;  2FKM X;  1PZD A;  3ULX A;  1MP9 A;  3VN5 A;  3OH6 A;  1NH2 A;  1FN7 A;  1D3U A;  1QTS A;  3ENC A;  1YTF A;  4DUL A;  3CWT A;  2LAE A;  3UW2 A;  3CW7 A;  1P5D X;  4C7P A;  1TUO A;  1QN6 A;  2QRD A;  1LWV A;  4EAJ A;  1C47 A;  1TBP A;  2FUV A;  1UL7 A;  2Y8L A;  5AN4 A;  1LWW A;  2IV9 A;  4HJH A;  2DKC A;  3TE5 A;  4D7Q A;  3CVT A;  2NLV A;  3F0Z A;  5KL0 A;  1PCZ A;  1N39 A;  1KFI A;  4B0A A;  1JFI C;  3RPJ A;  2Z8U A;  1E42 A;  1C9B B;  2MJ7 A;  4QG5 A;  2R5X A;  4ROE B;  2H5A X;  3D4V A;  1YQL A;  3OCI A;  1TBA B;  1KY6 A;  5IYD P;  4PY5 A;  2JOI A;  3OST A;  5EPC A;  1QN5 A;  2HL8 A;  2D0B A;  3ASM A;  3DPU A;  3RSM A;  1YQK A;  3SNS A;  1R4X A;  3OC3 C;  1KY7 A;  3CWA A;  2FGT A;  1QN4 A;  2YA3 A;  1C4G A;  1NGM A;  2D0C A;  2EHB D; 
#chains in the Genus database with same CATH homology
 3BKQ X;  4HJH A;  2DKC A;  5JN5 A;  1JDY A;  3I3W A;  4MRQ A;  2DKA A;  2H4L X;  3OLP A;  4WX8 A;  5BMP A;  5KL0 A;  5F9C A;  4WXA A;  1KFI A;  1K35 A;  2F7L A;  3PMG A;  1P5G X;  2EHP A;  4QG5 A;  2H5A X;  2Z0F A;  1K2Y X;  2JPI A;  3ENO C;  1LXT A;  3C04 A;  4IL8 A;  1WQA A;  5HSH A;  1WJW A;  2FKM X;  5EPC A;  3PDK A;  3RSM A;  1VKL A;  4BJU A;  3ENC A;  2EIU A;  5JMV D;  2DKD A;  3UW2 A;  1P5D X;  2FKF A;  1TUO A;  3NA5 A;  1PCJ X;  1PCM X;  1C4G A;  1KFQ A;  1C47 A;  5BMN A;  2FUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...