1KFQA

Crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
571
structure length
571
Chain Sequence
QQVIPAPRVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGRYFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHNPGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKFEGTRLEKSHFEVKVVDTVQDYTQLMQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKHIFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIHKKKDVGTVPQFGAACDGDADRNMILGRQFFVTPSDSLAVIAANANLIFKNGLLGAARSMPTSGALDKVAAKNGIKLFETPTGWKFFGNLMDAGLINLCGEESFGTGSNHIREKDGIWAVLAWLTILAHKNKNTDHFVTVEEIVTQYWQQFGRNYYSRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIRIYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords phosphoglucomutase 1
publication title Crystal structure analysis of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase), from Paramecium reveals significant conformational variability.
pubmed doi rcsb
source organism Paramecium tetraurelia
total genus 174
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2001-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 1kfqA04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA02
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA01
4MRQA 3ENCA 1P5DX 4HJHA 2DKAA 4WXAA 3NA5A 5BMPA 5F9CA 5HSHA 1C4GA 2H5AX 5JMVD 1PCMX 3ENOC 2FKFA 2F7LA 1WJWA 5KL0A 3RSMA 2EHPA 2FKMX 2Z0FA 3UW2A 4IL8A 2DKDA 1K2YX 3PMGA 1WQAA 3OLPA 5BMNA 1P5GX 4WX8A 5EPCA 1VKLA 1KFIA 1JDYA 1KFQA 3BKQX 4BJUA 3C04A 1C47A 2DKCA 1K35A 4QG5A 1PCJX 2H4LX 3I3WA 1LXTA 2JPIA 2FUVA 3PDKA 5JN5A 2EIUA 1TUOA
chains in the Genus database with same CATH superfamily
4MRQA 2FGTA 2MJ7A 2NVMA 3DPUA 1XSZA 2OOXA 4HJHA 3NA5A 1N3AA 1PVSA 1PCZA 3ENOC 3T4NA 3OC3C 1QN5A 2D0BA 1VOKA 2EHPA 2Z0FA 2HL8A 4ROEB 2EHBD 1WQAA 1R4XA 4WX8A 1YTBA 5EPCA 4Q11A 3HS9A 1NH2A 1RM1A 2NOHA 1QN3A 2NOIA 4I8OA 3ULXA 1YQRA 4EJYA 3SNSA 4C7PA 1QN9A 3CW7A 1V5SA 2OOYA 3TE5A 3I0WA 4PY5A 4ROCB 2FUVA 3KTUA 3OCIA 3CWSA 1B9KA 4D7RA 3OH6A 1YTFA 4EAJA 1NVPA 1N3CA 1UL7A 3OSEA 1W80A 4WXAA 5BMPA 3CWUA 1LWYA 4D7QA 2PWWA 1CDWA 3RSMA 3CWAA 1AISA 2G30A 3HS8A 2NOFA 3DPTA 4B0AA 1K2YX 3D7QA 2V8QA 2O3OA 3OLPA 3OSMA 1VTLE 4WZSD 1QNAA 3CVTA 1VKLA 1KFIA 3H1ZA 1JDYA 4BJUA 1PZDA 2D0CA 1K35A 1JFIC 2QR1A 1YQKA 1QN8A 3EAYA 4EAIA 2NOLA 1PCJX 3OH9A 3I0XA 3VN5A 5IYCP 2HKPA 2R5XA 2Y8QA 2IV9A 4EALA 5F9CA 3KRMA 1LXTA 1KYUA 1QNEA 3D4VA 1M3HA 1UT4A 1P5DX 2DKAA 1UT7A 5IYBP 5HSHA 1TBPA 2H5AX 2MZ8A 1NGMA 2F7LA 3N89A 1J3MA 1WJWA 2JHNA 5KL0A 2FKMX 1M3QA 1D3UA 1KO9A 3F0ZA 1EBMA 2DKDA 3PMGA 1P5GX 1FN7A 1KYFA 1YQLA 2LAEA 1KFQA 3OGDA 4EAKA 2ZFDB 2NOBA 1Q9UA 1KY6A 3C04A 3EIKA 1C47A 2YA3A 3TDHA 2VJ0A 1TBAB 1N39A 2H4LX 1MPGA 4DULA 2NWVA 3IH7A 2JPIA 4TPSA 1QN7A 1MP9A 2YH5A 3PDKA 1QNBA 1VOLB 2NOEA 1TUOA 2IV8A 2QRCA 2XHIA 3ENCA 2QRDA 2Y8LA 3OSTA 5AN4A 2QLVA 1QTSA 1QN4A 2Z8UA 1C4GA 1HU0A 5JMVD 1EUVA 1PCMX 2FKFA 2QREA 1YQMA 1QNCA 4RODB 1VTOA 3ASMA 2JOIA 1M5Q1 3UW2A 4IL8A 2HL9A 3F10A 2I5WA 5BMNA 2V92A 3RPJA 1KYDA 5IYDP 1QN6A 3BKQX 1DIZA 2V9JA 4EJZA 2HZSA 4EAGA 1T6AA 2DKCA 1KY7A 2NLVA 4QG5A 1TGHA 1E42A 4CFFA 3I3WA 1QTPA 2JHJA 1LWWA 2D0AA 2NOZA 3CVSA 2HZMA 3CWTA 1LWVA 5JN5A 2EIUA 1C9BB
chains in the Genus database with same CATH topology
4MRQA 3ENCA 1P5DX 4HJHA 2DKAA 4WXAA 3NA5A 5BMPA 5F9CA 5HSHA 1C4GA 2H5AX 5JMVD 1PCMX 3ENOC 2FKFA 2F7LA 1WJWA 5KL0A 3RSMA 2EHPA 2FKMX 2Z0FA 3UW2A 4IL8A 2DKDA 1K2YX 3PMGA 1WQAA 3OLPA 5BMNA 1P5GX 4WX8A 5EPCA 1VKLA 1KFIA 1JDYA 1KFQA 3BKQX 4BJUA 3C04A 1C47A 2DKCA 1K35A 4QG5A 1PCJX 2H4LX 3I3WA 1LXTA 2JPIA 2FUVA 3PDKA 5JN5A 2EIUA 1TUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRQ A;  3ENC A;  1P5D X;  4HJH A;  2DKA A;  4WXA A;  3NA5 A;  5BMP A;  5F9C A;  5HSH A;  1C4G A;  2H5A X;  5JMV D;  1PCM X;  3ENO C;  2FKF A;  2F7L A;  1WJW A;  5KL0 A;  3RSM A;  2EHP A;  2FKM X;  2Z0F A;  3UW2 A;  4IL8 A;  2DKD A;  1K2Y X;  3PMG A;  1WQA A;  3OLP A;  5BMN A;  1P5G X;  4WX8 A;  5EPC A;  1VKL A;  1KFI A;  1JDY A;  1KFQ A;  3BKQ X;  4BJU A;  3C04 A;  1C47 A;  2DKC A;  1K35 A;  4QG5 A;  1PCJ X;  2H4L X;  3I3W A;  1LXT A;  2JPI A;  2FUV A;  3PDK A;  5JN5 A;  2EIU A;  1TUO A; 
#chains in the Genus database with same CATH topology
 4MRQ A;  2FGT A;  2MJ7 A;  2NVM A;  3DPU A;  1XSZ A;  2OOX A;  4HJH A;  3NA5 A;  1N3A A;  1PVS A;  1PCZ A;  3ENO C;  3T4N A;  3OC3 C;  1QN5 A;  2D0B A;  1VOK A;  2EHP A;  2Z0F A;  2HL8 A;  4ROE B;  2EHB D;  1WQA A;  1R4X A;  4WX8 A;  1YTB A;  5EPC A;  4Q11 A;  3HS9 A;  1NH2 A;  1RM1 A;  2NOH A;  1QN3 A;  2NOI A;  4I8O A;  3ULX A;  1YQR A;  4EJY A;  3SNS A;  4C7P A;  1QN9 A;  3CW7 A;  1V5S A;  2OOY A;  3TE5 A;  3I0W A;  4PY5 A;  4ROC B;  2FUV A;  3KTU A;  3OCI A;  3CWS A;  1B9K A;  4D7R A;  3OH6 A;  1YTF A;  4EAJ A;  1NVP A;  1N3C A;  1UL7 A;  3OSE A;  1W80 A;  4WXA A;  5BMP A;  3CWU A;  1LWY A;  4D7Q A;  2PWW A;  1CDW A;  3RSM A;  3CWA A;  1AIS A;  2G30 A;  3HS8 A;  2NOF A;  3DPT A;  4B0A A;  1K2Y X;  3D7Q A;  2V8Q A;  2O3O A;  3OLP A;  3OSM A;  1VTL E;  4WZS D;  1QNA A;  3CVT A;  1VKL A;  1KFI A;  3H1Z A;  1JDY A;  4BJU A;  1PZD A;  2D0C A;  1K35 A;  1JFI C;  2QR1 A;  1YQK A;  1QN8 A;  3EAY A;  4EAI A;  2NOL A;  1PCJ X;  3OH9 A;  3I0X A;  3VN5 A;  5IYC P;  2HKP A;  2R5X A;  2Y8Q A;  2IV9 A;  4EAL A;  5F9C A;  3KRM A;  1LXT A;  1KYU A;  1QNE A;  3D4V A;  1M3H A;  1UT4 A;  1P5D X;  2DKA A;  1UT7 A;  5IYB P;  5HSH A;  1TBP A;  2H5A X;  2MZ8 A;  1NGM A;  2F7L A;  3N89 A;  1J3M A;  1WJW A;  2JHN A;  5KL0 A;  2FKM X;  1M3Q A;  1D3U A;  1KO9 A;  3F0Z A;  1EBM A;  2DKD A;  3PMG A;  1P5G X;  1FN7 A;  1KYF A;  1YQL A;  2LAE A;  1KFQ A;  3OGD A;  4EAK A;  2ZFD B;  2NOB A;  1Q9U A;  1KY6 A;  3C04 A;  3EIK A;  1C47 A;  2YA3 A;  3TDH A;  2VJ0 A;  1TBA B;  1N39 A;  2H4L X;  1MPG A;  4DUL A;  2NWV A;  3IH7 A;  2JPI A;  4TPS A;  1QN7 A;  1MP9 A;  2YH5 A;  3PDK A;  1QNB A;  1VOL B;  2NOE A;  1TUO A;  2IV8 A;  2QRC A;  2XHI A;  3ENC A;  2QRD A;  2Y8L A;  3OST A;  5AN4 A;  2QLV A;  1QTS A;  1QN4 A;  2Z8U A;  1C4G A;  1HU0 A;  5JMV D;  1EUV A;  1PCM X;  2FKF A;  2QRE A;  1YQM A;  1QNC A;  4ROD B;  1VTO A;  3ASM A;  2JOI A;  1M5Q 1;  3UW2 A;  4IL8 A;  2HL9 A;  3F10 A;  2I5W A;  5BMN A;  2V92 A;  3RPJ A;  1KYD A;  5IYD P;  1QN6 A;  3BKQ X;  1DIZ A;  2V9J A;  4EJZ A;  2HZS A;  4EAG A;  1T6A A;  2DKC A;  1KY7 A;  2NLV A;  4QG5 A;  1TGH A;  1E42 A;  4CFF A;  3I3W A;  1QTP A;  2JHJ A;  1LWW A;  2D0A A;  2NOZ A;  3CVS A;  2HZM A;  3CWT A;  1LWV A;  5JN5 A;  2EIU A;  1C9B B; 
#chains in the Genus database with same CATH homology
 4MRQ A;  3ENC A;  1P5D X;  4HJH A;  2DKA A;  4WXA A;  3NA5 A;  5BMP A;  5F9C A;  5HSH A;  1C4G A;  2H5A X;  5JMV D;  1PCM X;  3ENO C;  2FKF A;  2F7L A;  1WJW A;  5KL0 A;  3RSM A;  2EHP A;  2FKM X;  2Z0F A;  3UW2 A;  4IL8 A;  2DKD A;  1K2Y X;  3PMG A;  1WQA A;  3OLP A;  5BMN A;  1P5G X;  4WX8 A;  5EPC A;  1VKL A;  1KFI A;  1JDY A;  1KFQ A;  3BKQ X;  4BJU A;  3C04 A;  1C47 A;  2DKC A;  1K35 A;  4QG5 A;  1PCJ X;  2H4L X;  3I3W A;  1LXT A;  2JPI A;  2FUV A;  3PDK A;  5JN5 A;  2EIU A;  1TUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...