1KFQA

Crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
571
structure length
571
Chain Sequence
QQVIPAPRVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGRYFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHNPGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKFEGTRLEKSHFEVKVVDTVQDYTQLMQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKHIFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIHKKKDVGTVPQFGAACDGDADRNMILGRQFFVTPSDSLAVIAANANLIFKNGLLGAARSMPTSGALDKVAAKNGIKLFETPTGWKFFGNLMDAGLINLCGEESFGTGSNHIREKDGIWAVLAWLTILAHKNKNTDHFVTVEEIVTQYWQQFGRNYYSRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIRIYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphoglucomutase 1
publication title Crystal structure analysis of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase), from Paramecium reveals significant conformational variability.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Isomerase
total genus 174
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2001-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain
A PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
A PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
A PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 1kfqA04
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA02
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA03
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 1kfqA01
3PDKA 2JPIA 1KFIA 4HJHA 5EPCA 1WQAA 1P5DX 5BMPA 5JMVD 5JN5A 1PCMX 2H5AX 4WXAA 1TUOA 2FKFA 3PMGA 1K35A 4MRQA 1KFQA 5KL0A 1C47A 1VKLA 4QG5A 1K2YX 4BJUA 5HSHA 2Z0FA 3BKQX 3C04A 4IL8A 5F9CA 3OLPA 1LXTA 3ENOC 2EIUA 2H4LX 3I3WA 3ENCA 1PCJX 2DKCA 5BMNA 2FUVA 2DKDA 1WJWA 3NA5A 3UW2A 1P5GX 2FKMX 3RSMA 2EHPA 2F7LA 4WX8A 1JDYA 2DKAA 1C4GA
chains in the Genus database with same CATH superfamily
1KFIA 2PWWA 2OOYA 1QTPA 1P5DX 3DPUA 1KY7A 1VOLB 3PMGA 1FN7A 2NOFA 1KFQA 1PZDA 3D4VA 1M5Q1 1HU0A 1K2YX 1Q9UA 5IYBP 1QNEA 2R5XA 3BKQX 5IYDP 4IL8A 3ASMA 1QTSA 2JHJA 3OSTA 1QN3A 1CDWA 1YTBA 1R4XA 1LWYA 2NVMA 1UT4A 1PCJX 3DPTA 2FUVA 2NWVA 1M3QA 2Y8QA 3RSMA 3OH6A 3TDHA 1N3AA 2QRDA 2QLVA 3CVTA 1YQMA 3KRMA 3OSEA 2JPIA 2HZMA 3PDKA 2O3OA 1WQAA 2NLVA 5EPCA 5BMPA 3TE5A 4C7PA 3CVSA 2NOEA 1PCMX 2H5AX 1N39A 4EJZA 2FKFA 3I0WA 1PCZA 4WZSD 3OCIA 3OH9A 1VTOA 2FGTA 4CFFA 4QG5A 3CWAA 1KYUA 3OGDA 1KYDA 3D7QA 3CWSA 2LAEA 3OLPA 1NH2A 1TBAB 2G30A 3ENOC 4B0AA 1AISA 1QN7A 3N89A 4ROEB 1MPGA 4EALA 1NVPA 2DKCA 1KY6A 5AN4A 1LWWA 2DKDA 4ROCB 4PY5A 3NA5A 2D0BA 4DULA 2NOZA 2FKMX 1YTFA 1E42A 4WX8A 1LWVA 2DKAA 1D3UA 1C4GA 2I5WA 1VTLE 1QN4A 3HS8A 5JN5A 4HJHA 2Y8LA 1B9KA 4EAIA 5JMVD 1QNCA 1M3HA 2NOBA 1DIZA 2EHBD 3SNSA 4MRQA 3EAYA 1JFIC 3RPJA 3T4NA 3F0ZA 5KL0A 1XSZA 3IH7A 1VKLA 3ULXA 2VJ0A 1QN5A 5HSHA 2JOIA 2V8QA 2Z0FA 3C04A 1QNAA 2OOXA 2QREA 4Q11A 1PVSA 2QR1A 3I3WA 1QNBA 2MZ8A 5BMNA 4EAJA 1WJWA 3CW7A 3I0XA 1QN8A 2YH5A 1P5GX 3H1ZA 1YQKA 3VN5A 4D7QA 2EHPA 2HKPA 2V92A 3CWUA 1JDYA 4TPSA 2ZFDB 1YQLA 1TGHA 2NOIA 1J3MA 3F10A 1UL7A 2JHNA 1EBMA 4WXAA 1RM1A 2IV8A 1TUOA 4EJYA 1K35A 4I8OA 2D0AA 2IV9A 2XHIA 1UT7A 2YA3A 2D0CA 1C47A 2HL9A 1TBPA 1NGMA 1C9BB 4BJUA 3KTUA 3EIKA 1VOKA 4RODB 3CWTA 1EUVA 5F9CA 3OSMA 1LXTA 1QN6A 3OC3C 1W80A 2H4LX 2QRCA 1YQRA 1QN9A 4EAGA 2NOHA 3ENCA 2EIUA 2HL8A 1KO9A 1T6AA 3HS9A 4D7RA 2Z8UA 1N3CA 1KYFA 5IYCP 1V5SA 1MP9A 3UW2A 4EAKA 2HZSA 2F7LA 2V9JA 2MJ7A 2NOLA
chains in the Genus database with same CATH topology
3PDKA 2JPIA 1KFIA 4HJHA 5EPCA 1WQAA 1P5DX 5BMPA 5JMVD 5JN5A 1PCMX 2H5AX 4WXAA 1TUOA 2FKFA 3PMGA 1K35A 4MRQA 1KFQA 5KL0A 1C47A 1VKLA 4QG5A 1K2YX 4BJUA 5HSHA 2Z0FA 3BKQX 3C04A 4IL8A 5F9CA 3OLPA 1LXTA 3ENOC 2EIUA 2H4LX 3I3WA 3ENCA 1PCJX 2DKCA 5BMNA 2FUVA 2DKDA 1WJWA 3NA5A 3UW2A 1P5GX 2FKMX 3RSMA 2EHPA 2F7LA 4WX8A 1JDYA 2DKAA 1C4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDK A;  2JPI A;  1KFI A;  4HJH A;  5EPC A;  1WQA A;  1P5D X;  5BMP A;  5JMV D;  5JN5 A;  1PCM X;  2H5A X;  4WXA A;  1TUO A;  2FKF A;  3PMG A;  1K35 A;  4MRQ A;  1KFQ A;  5KL0 A;  1C47 A;  1VKL A;  4QG5 A;  1K2Y X;  4BJU A;  5HSH A;  2Z0F A;  3BKQ X;  3C04 A;  4IL8 A;  5F9C A;  3OLP A;  1LXT A;  3ENO C;  2EIU A;  2H4L X;  3I3W A;  3ENC A;  1PCJ X;  2DKC A;  5BMN A;  2FUV A;  2DKD A;  1WJW A;  3NA5 A;  3UW2 A;  1P5G X;  2FKM X;  3RSM A;  2EHP A;  2F7L A;  4WX8 A;  1JDY A;  2DKA A;  1C4G A; 
#chains in the Genus database with same CATH topology
 1KFI A;  2PWW A;  2OOY A;  1QTP A;  1P5D X;  3DPU A;  1KY7 A;  1VOL B;  3PMG A;  1FN7 A;  2NOF A;  1KFQ A;  1PZD A;  3D4V A;  1M5Q 1;  1HU0 A;  1K2Y X;  1Q9U A;  5IYB P;  1QNE A;  2R5X A;  3BKQ X;  5IYD P;  4IL8 A;  3ASM A;  1QTS A;  2JHJ A;  3OST A;  1QN3 A;  1CDW A;  1YTB A;  1R4X A;  1LWY A;  2NVM A;  1UT4 A;  1PCJ X;  3DPT A;  2FUV A;  2NWV A;  1M3Q A;  2Y8Q A;  3RSM A;  3OH6 A;  3TDH A;  1N3A A;  2QRD A;  2QLV A;  3CVT A;  1YQM A;  3KRM A;  3OSE A;  2JPI A;  2HZM A;  3PDK A;  2O3O A;  1WQA A;  2NLV A;  5EPC A;  5BMP A;  3TE5 A;  4C7P A;  3CVS A;  2NOE A;  1PCM X;  2H5A X;  1N39 A;  4EJZ A;  2FKF A;  3I0W A;  1PCZ A;  4WZS D;  3OCI A;  3OH9 A;  1VTO A;  2FGT A;  4CFF A;  4QG5 A;  3CWA A;  1KYU A;  3OGD A;  1KYD A;  3D7Q A;  3CWS A;  2LAE A;  3OLP A;  1NH2 A;  1TBA B;  2G30 A;  3ENO C;  4B0A A;  1AIS A;  1QN7 A;  3N89 A;  4ROE B;  1MPG A;  4EAL A;  1NVP A;  2DKC A;  1KY6 A;  5AN4 A;  1LWW A;  2DKD A;  4ROC B;  4PY5 A;  3NA5 A;  2D0B A;  4DUL A;  2NOZ A;  2FKM X;  1YTF A;  1E42 A;  4WX8 A;  1LWV A;  2DKA A;  1D3U A;  1C4G A;  2I5W A;  1VTL E;  1QN4 A;  3HS8 A;  5JN5 A;  4HJH A;  2Y8L A;  1B9K A;  4EAI A;  5JMV D;  1QNC A;  1M3H A;  2NOB A;  1DIZ A;  2EHB D;  3SNS A;  4MRQ A;  3EAY A;  1JFI C;  3RPJ A;  3T4N A;  3F0Z A;  5KL0 A;  1XSZ A;  3IH7 A;  1VKL A;  3ULX A;  2VJ0 A;  1QN5 A;  5HSH A;  2JOI A;  2V8Q A;  2Z0F A;  3C04 A;  1QNA A;  2OOX A;  2QRE A;  4Q11 A;  1PVS A;  2QR1 A;  3I3W A;  1QNB A;  2MZ8 A;  5BMN A;  4EAJ A;  1WJW A;  3CW7 A;  3I0X A;  1QN8 A;  2YH5 A;  1P5G X;  3H1Z A;  1YQK A;  3VN5 A;  4D7Q A;  2EHP A;  2HKP A;  2V92 A;  3CWU A;  1JDY A;  4TPS A;  2ZFD B;  1YQL A;  1TGH A;  2NOI A;  1J3M A;  3F10 A;  1UL7 A;  2JHN A;  1EBM A;  4WXA A;  1RM1 A;  2IV8 A;  1TUO A;  4EJY A;  1K35 A;  4I8O A;  2D0A A;  2IV9 A;  2XHI A;  1UT7 A;  2YA3 A;  2D0C A;  1C47 A;  2HL9 A;  1TBP A;  1NGM A;  1C9B B;  4BJU A;  3KTU A;  3EIK A;  1VOK A;  4ROD B;  3CWT A;  1EUV A;  5F9C A;  3OSM A;  1LXT A;  1QN6 A;  3OC3 C;  1W80 A;  2H4L X;  2QRC A;  1YQR A;  1QN9 A;  4EAG A;  2NOH A;  3ENC A;  2EIU A;  2HL8 A;  1KO9 A;  1T6A A;  3HS9 A;  4D7R A;  2Z8U A;  1N3C A;  1KYF A;  5IYC P;  1V5S A;  1MP9 A;  3UW2 A;  4EAK A;  2HZS A;  2F7L A;  2V9J A;  2MJ7 A;  2NOL A; 
#chains in the Genus database with same CATH homology
 3PDK A;  2JPI A;  1KFI A;  4HJH A;  5EPC A;  1WQA A;  1P5D X;  5BMP A;  5JMV D;  5JN5 A;  1PCM X;  2H5A X;  4WXA A;  1TUO A;  2FKF A;  3PMG A;  1K35 A;  4MRQ A;  1KFQ A;  5KL0 A;  1C47 A;  1VKL A;  4QG5 A;  1K2Y X;  4BJU A;  5HSH A;  2Z0F A;  3BKQ X;  3C04 A;  4IL8 A;  5F9C A;  3OLP A;  1LXT A;  3ENO C;  2EIU A;  2H4L X;  3I3W A;  3ENC A;  1PCJ X;  2DKC A;  5BMN A;  2FUV A;  2DKD A;  1WJW A;  3NA5 A;  3UW2 A;  1P5G X;  2FKM X;  3RSM A;  2EHP A;  2F7L A;  4WX8 A;  1JDY A;  2DKA A;  1C4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...