2MAPA

Solution structure of the complex formed by the region 2 of e. coli sigmae and its cognate -10 promoter element non template strand tgtcaaa.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2mapA00
3IIEA 4CXFA 2JCVA 1MW0A 1JGIA 2EGHA 1MVYA 3AUAA 4AICA 5JC1A 5JO0A 5JMWA 1JG9A 1RP3A 4ZQHA 3UEQA 2Y1GA 1SC5A 4OOFA 3ANLA 4RCVA 2MAPA 4Y6SA 4ZN6A 4OOEA 2JD1A 3T0YA 3CZEA 2Y1CA 4FLRA 4Y6PA 2JCXA 1OR7A 2Y1EA 5DULA 4KP7A 1R0LA 1Q0HA 4AYSA 1MW3A 1ZS2A 3CZKA 3CZGA 3WQSB 1T1SA 3R0IA 4A03A 1H3LA 2C82A 4ZQEA 2Y1DA 2JD0A 4ZQFA 2JD2A 1MW2A 4GAEA 3ZHXA 1G5AA 3AU9A 5JNLA 4FLOA 4FLSA 4LUPA 1ONPA 3ZHZA 3AU8A 3ANMA 1ONOA 4Y67A 1R0KA 1T1RA 3CZLA 3A14A 3WQRA 3RASA 4ZQGA 2Y1FA 3UERA 5JMPA 1MW1A 2O7GA 1JVSA 4NQWA 5JAZA 3A06A 3ANNA 3ZHYA 3WQQA 3UCQA 2JCYA 5JBIA 2WPGA 4FLQA 2MAOA 1K5HA 1Q0LA 3ZI0A 1ONNA 4Y6RA 1Q0QA 1S46A
chains in the Genus database with same CATH superfamily
3IIEA 3B2PA 3B3BA 3B2XA 4AR8A 4CXFA 4XN7A 2JCVA 4ZX6A 1MW0A 1JGIA 2EGHA 4PW4A 1MVYA 3Q43A 1SQMA 4XMUA 3AUAA 3FTVA 3FUKA 4ZW8A 4AICA 4QIRA 3FHEA 4XO4A 5JC1A 1JG9A 5JO0A 1RP3A 4RVBA 4XO5A 1HS6A 2QVWA 3B34A 3EBHA 4ZQHA 3UEQA 3FULA 4RSYA 2Y1GA 3VVLA 4K5LA 2HPTA 1SC5A 4OOFA 4QUOA 1GW6A 3ANLA 3T8VA 3QJXA 4XMWA 2DQMA 4XN9A 4RCVA 3Q44A 4AR9A 5JMWA 4Y6SA 2MAPA 2WZGA 4ZW6A 4OOEA 4ZN6A 2JD1A 4ZW7A 4XN2A 5HLTA 5HNFA 3PUUA 4XO3A 3T0YA 3CZEA 2Y1CA 3FU6A 3FUFA 2HPOA 3B7UX 3FTWA 4FLRA 3FH7A 4ZQTA 5HNHA 4Y6PA 2JCXA 1OR7A 2R59A 4XMTA 2Y1EA 3KEDA 5DULA 4KP7A 3FUIA 1R0LA 1Q0HA 2RJIA 4AYSA 1MW3A 1ZS2A 4XN5A 3RC8A 4GAAA 3JT1A 2XQ0A 4R5XA 5EV7A 4X2UA 4J3BA 4Q4IA 3CZKA 4JNDA 3CZGA 3CHRA 3WQSB 1T1SA 3R0IA 3VVMA 4A03A 1H3LA 5BPPA 2C82A 2A7OA 4ZQEA 3CIAA 2DQ6A 1H19A 3RC3A 4ARFA 2VLAA 5DYFA 3JSZA 3U9WA 4XN8A 2Y1DA 4XN4A 2JD0A 4ZQFA 4MKTA 2JD2A 1MW2A 2FFLA 4BKXA 3CHOA 3HW2A 4ZW5A 1SG7A 4GAEA 5AENA 3ZHXA 1G5AA 2GTQA 3AU9A 1X3ZA 1X3WA 4XMXA 4ZX4A 5JNLA 3CHPA 3FTUA 2VJ8A 3CHSA 3FUDA 4FLOA 4K5NA 4DPRA 3FU0A 4FLSA 4LUPA 3FTZA 3WQRA 4PVBA 4ZX3A 1ONPA 3ZHZA 2B61A 2PUSA 1ONOA 3ANMA 3AU8A 4Y67A 1R0KA 3CHQA 4XNDA 4ZW3A 4XMZA 1T1RA 2QJ1A 3CZLA 3A14A 3FTYA 2XPZA 2PL5A 3FH5A 3FU5A 3FUMA 4Q4EA 4XMVA 3FU3A 4XNAA 4QHPA 2ZXGA 4QMEA 3RASA 4FCAA 3FH8A 4ZQGA 2PGGA 4QPEA 2Y1FA 3FTSA 3UERA 3EBIA 4MS6A 4R5TA 5FWQA 3B7RL 4K5PA 5JMPA 4XNBA 1MW1A 3FUHA 3FTXA 2O7GA 4K5OA 4AR1A 1JVSA 4NQWA 4PU2A 5JAZA 2WZFA 3EBGA 3A06A 3ANNA 3ZHYA 3WQQA 3UCQA 2JV7A 2XPYA 3B7SA 3CXBA 2C5ZA 2JCYA 2WPGA 4FLQA 4L2LA 4K5MA 3B7TA 5JBIA 3FUNA 2MAOA 4ZX5A 1K5HA 4R5VA 1Q0LA 3ZI0A 2R72A 1ONNA 3FUEA 4Y6RA 3B37A 2R70A 4R7LA 1Q0QA 1S46A 3FUJA 5DLLA 4XN1A
chains in the Genus database with same CATH topology
3IIEA 3B2PA 3B3BA 3B2XA 4AR8A 4CXFA 4XN7A 2JCVA 4ZX6A 1MW0A 1JGIA 2EGHA 4PW4A 1MVYA 3Q43A 1SQMA 4XMUA 3AUAA 3FTVA 3FUKA 4ZW8A 4AICA 4QIRA 3FHEA 4XO4A 5JC1A 1JG9A 5JO0A 1RP3A 4RVBA 4XO5A 1HS6A 2QVWA 3B34A 3EBHA 4ZQHA 3UEQA 3FULA 4RSYA 2Y1GA 3VVLA 4K5LA 2HPTA 1SC5A 4OOFA 4QUOA 1GW6A 3ANLA 3T8VA 3QJXA 4XMWA 2DQMA 4XN9A 4RCVA 3Q44A 4AR9A 5JMWA 4Y6SA 2MAPA 2WZGA 4ZW6A 4OOEA 4ZN6A 2JD1A 4ZW7A 4XN2A 5HLTA 5HNFA 3PUUA 4XO3A 3T0YA 3CZEA 2Y1CA 3FU6A 3FUFA 2HPOA 3B7UX 3FTWA 4FLRA 3FH7A 4ZQTA 5HNHA 4Y6PA 2JCXA 1OR7A 2R59A 4XMTA 2Y1EA 3KEDA 5DULA 4KP7A 3FUIA 1R0LA 1Q0HA 2RJIA 4AYSA 1MW3A 1ZS2A 4XN5A 3RC8A 4GAAA 3JT1A 2XQ0A 4R5XA 5EV7A 4X2UA 4J3BA 4Q4IA 3CZKA 4JNDA 3CZGA 3CHRA 3WQSB 1T1SA 3R0IA 3VVMA 4A03A 1H3LA 5BPPA 2C82A 2A7OA 4ZQEA 3CIAA 2DQ6A 1H19A 3RC3A 4ARFA 2VLAA 5DYFA 3JSZA 3U9WA 4XN8A 2Y1DA 4XN4A 2JD0A 4ZQFA 4MKTA 2JD2A 1MW2A 2FFLA 4BKXA 3CHOA 4ZW5A 1SG7A 4GAEA 5AENA 3ZHXA 1G5AA 2GTQA 3AU9A 1X3ZA 1X3WA 4XMXA 4ZX4A 5JNLA 3CHPA 3FTUA 2VJ8A 3CHSA 3FUDA 4FLOA 4K5NA 4DPRA 3FU0A 4FLSA 4LUPA 3FTZA 3WQRA 4PVBA 4ZX3A 1ONPA 3ZHZA 2B61A 2PUSA 1ONOA 3ANMA 3AU8A 4Y67A 1R0KA 3CHQA 4XNDA 4ZW3A 4XMZA 1T1RA 2QJ1A 3CZLA 3A14A 3FTYA 2XPZA 2PL5A 3FH5A 3FU5A 3FUMA 4Q4EA 4XMVA 3FU3A 4XNAA 4QHPA 2ZXGA 4QMEA 3RASA 4FCAA 3FH8A 4ZQGA 2PGGA 4QPEA 2Y1FA 3FTSA 3UERA 3EBIA 4MS6A 4R5TA 5FWQA 3B7RL 4K5PA 5JMPA 4XNBA 1MW1A 3FUHA 3FTXA 2O7GA 4K5OA 4AR1A 1JVSA 4NQWA 4PU2A 5JAZA 2WZFA 3EBGA 3A06A 3ANNA 3ZHYA 3WQQA 3UCQA 2JV7A 2XPYA 3B7SA 2C5ZA 2JCYA 2WPGA 4FLQA 4L2LA 4K5MA 3B7TA 5JBIA 3FUNA 2MAOA 4ZX5A 1K5HA 4R5VA 1Q0LA 3ZI0A 2R72A 1ONNA 3FUEA 4Y6RA 3B37A 2R70A 4R7LA 1Q0QA 1S46A 3FUJA 5DLLA 4XN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIE A;  4CXF A;  2JCV A;  1MW0 A;  1JGI A;  2EGH A;  1MVY A;  3AUA A;  4AIC A;  5JC1 A;  5JO0 A;  5JMW A;  1JG9 A;  1RP3 A;  4ZQH A;  3UEQ A;  2Y1G A;  1SC5 A;  4OOF A;  3ANL A;  4RCV A;  2MAP A;  4Y6S A;  4ZN6 A;  4OOE A;  2JD1 A;  3T0Y A;  3CZE A;  2Y1C A;  4FLR A;  4Y6P A;  2JCX A;  1OR7 A;  2Y1E A;  5DUL A;  4KP7 A;  1R0L A;  1Q0H A;  4AYS A;  1MW3 A;  1ZS2 A;  3CZK A;  3CZG A;  3WQS B;  1T1S A;  3R0I A;  4A03 A;  1H3L A;  2C82 A;  4ZQE A;  2Y1D A;  2JD0 A;  4ZQF A;  2JD2 A;  1MW2 A;  4GAE A;  3ZHX A;  1G5A A;  3AU9 A;  5JNL A;  4FLO A;  4FLS A;  4LUP A;  1ONP A;  3ZHZ A;  3AU8 A;  3ANM A;  1ONO A;  4Y67 A;  1R0K A;  1T1R A;  3CZL A;  3A14 A;  3WQR A;  3RAS A;  4ZQG A;  2Y1F A;  3UER A;  5JMP A;  1MW1 A;  2O7G A;  1JVS A;  4NQW A;  5JAZ A;  3A06 A;  3ANN A;  3ZHY A;  3WQQ A;  3UCQ A;  2JCY A;  5JBI A;  2WPG A;  4FLQ A;  2MAO A;  1K5H A;  1Q0L A;  3ZI0 A;  1ONN A;  4Y6R A;  1Q0Q A;  1S46 A; 
#chains in the Genus database with same CATH topology
 3IIE A;  3B2P A;  3B3B A;  3B2X A;  4AR8 A;  4CXF A;  4XN7 A;  2JCV A;  4ZX6 A;  1MW0 A;  1JGI A;  2EGH A;  4PW4 A;  1MVY A;  3Q43 A;  1SQM A;  4XMU A;  3AUA A;  3FTV A;  3FUK A;  4ZW8 A;  4AIC A;  4QIR A;  3FHE A;  4XO4 A;  5JC1 A;  1JG9 A;  5JO0 A;  1RP3 A;  4RVB A;  4XO5 A;  1HS6 A;  2QVW A;  3B34 A;  3EBH A;  4ZQH A;  3UEQ A;  3FUL A;  4RSY A;  2Y1G A;  3VVL A;  4K5L A;  2HPT A;  1SC5 A;  4OOF A;  4QUO A;  1GW6 A;  3ANL A;  3T8V A;  3QJX A;  4XMW A;  2DQM A;  4XN9 A;  4RCV A;  3Q44 A;  4AR9 A;  5JMW A;  4Y6S A;  2MAP A;  2WZG A;  4ZW6 A;  4OOE A;  4ZN6 A;  2JD1 A;  4ZW7 A;  4XN2 A;  5HLT A;  5HNF A;  3PUU A;  4XO3 A;  3T0Y A;  3CZE A;  2Y1C A;  3FU6 A;  3FUF A;  2HPO A;  3B7U X;  3FTW A;  4FLR A;  3FH7 A;  4ZQT A;  5HNH A;  4Y6P A;  2JCX A;  1OR7 A;  2R59 A;  4XMT A;  2Y1E A;  3KED A;  5DUL A;  4KP7 A;  3FUI A;  1R0L A;  1Q0H A;  2RJI A;  4AYS A;  1MW3 A;  1ZS2 A;  4XN5 A;  3RC8 A;  4GAA A;  3JT1 A;  2XQ0 A;  4R5X A;  5EV7 A;  4X2U A;  4J3B A;  4Q4I A;  3CZK A;  4JND A;  3CZG A;  3CHR A;  3WQS B;  1T1S A;  3R0I A;  3VVM A;  4A03 A;  1H3L A;  5BPP A;  2C82 A;  2A7O A;  4ZQE A;  3CIA A;  2DQ6 A;  1H19 A;  3RC3 A;  4ARF A;  2VLA A;  5DYF A;  3JSZ A;  3U9W A;  4XN8 A;  2Y1D A;  4XN4 A;  2JD0 A;  4ZQF A;  4MKT A;  2JD2 A;  1MW2 A;  2FFL A;  4BKX A;  3CHO A;  3HW2 A;  4ZW5 A;  1SG7 A;  4GAE A;  5AEN A;  3ZHX A;  1G5A A;  2GTQ A;  3AU9 A;  1X3Z A;  1X3W A;  4XMX A;  4ZX4 A;  5JNL A;  3CHP A;  3FTU A;  2VJ8 A;  3CHS A;  3FUD A;  4FLO A;  4K5N A;  4DPR A;  3FU0 A;  4FLS A;  4LUP A;  3FTZ A;  3WQR A;  4PVB A;  4ZX3 A;  1ONP A;  3ZHZ A;  2B61 A;  2PUS A;  1ONO A;  3ANM A;  3AU8 A;  4Y67 A;  1R0K A;  3CHQ A;  4XND A;  4ZW3 A;  4XMZ A;  1T1R A;  2QJ1 A;  3CZL A;  3A14 A;  3FTY A;  2XPZ A;  2PL5 A;  3FH5 A;  3FU5 A;  3FUM A;  4Q4E A;  4XMV A;  3FU3 A;  4XNA A;  4QHP A;  2ZXG A;  4QME A;  3RAS A;  4FCA A;  3FH8 A;  4ZQG A;  2PGG A;  4QPE A;  2Y1F A;  3FTS A;  3UER A;  3EBI A;  4MS6 A;  4R5T A;  5FWQ A;  3B7R L;  4K5P A;  5JMP A;  4XNB A;  1MW1 A;  3FUH A;  3FTX A;  2O7G A;  4K5O A;  4AR1 A;  1JVS A;  4NQW A;  4PU2 A;  5JAZ A;  2WZF A;  3EBG A;  3A06 A;  3ANN A;  3ZHY A;  3WQQ A;  3UCQ A;  2JV7 A;  2XPY A;  3B7S A;  3CXB A;  2C5Z A;  2JCY A;  2WPG A;  4FLQ A;  4L2L A;  4K5M A;  3B7T A;  5JBI A;  3FUN A;  2MAO A;  4ZX5 A;  1K5H A;  4R5V A;  1Q0L A;  3ZI0 A;  2R72 A;  1ONN A;  3FUE A;  4Y6R A;  3B37 A;  2R70 A;  4R7L A;  1Q0Q A;  1S46 A;  3FUJ A;  5DLL A;  4XN1 A; 
#chains in the Genus database with same CATH homology
 3IIE A;  3B2P A;  3B3B A;  3B2X A;  4AR8 A;  4CXF A;  4XN7 A;  2JCV A;  4ZX6 A;  1MW0 A;  1JGI A;  2EGH A;  4PW4 A;  1MVY A;  3Q43 A;  1SQM A;  4XMU A;  3AUA A;  3FTV A;  3FUK A;  4ZW8 A;  4AIC A;  4QIR A;  3FHE A;  4XO4 A;  5JC1 A;  1JG9 A;  5JO0 A;  1RP3 A;  4RVB A;  4XO5 A;  1HS6 A;  2QVW A;  3B34 A;  3EBH A;  4ZQH A;  3UEQ A;  3FUL A;  4RSY A;  2Y1G A;  3VVL A;  4K5L A;  2HPT A;  1SC5 A;  4OOF A;  4QUO A;  1GW6 A;  3ANL A;  3T8V A;  3QJX A;  4XMW A;  2DQM A;  4XN9 A;  4RCV A;  3Q44 A;  4AR9 A;  5JMW A;  4Y6S A;  2MAP A;  2WZG A;  4ZW6 A;  4OOE A;  4ZN6 A;  2JD1 A;  4ZW7 A;  4XN2 A;  5HLT A;  5HNF A;  3PUU A;  4XO3 A;  3T0Y A;  3CZE A;  2Y1C A;  3FU6 A;  3FUF A;  2HPO A;  3B7U X;  3FTW A;  4FLR A;  3FH7 A;  4ZQT A;  5HNH A;  4Y6P A;  2JCX A;  1OR7 A;  2R59 A;  4XMT A;  2Y1E A;  3KED A;  5DUL A;  4KP7 A;  3FUI A;  1R0L A;  1Q0H A;  2RJI A;  4AYS A;  1MW3 A;  1ZS2 A;  4XN5 A;  3RC8 A;  4GAA A;  3JT1 A;  2XQ0 A;  4R5X A;  5EV7 A;  4X2U A;  4J3B A;  4Q4I A;  3CZK A;  4JND A;  3CZG A;  3CHR A;  3WQS B;  1T1S A;  3R0I A;  3VVM A;  4A03 A;  1H3L A;  5BPP A;  2C82 A;  2A7O A;  4ZQE A;  3CIA A;  2DQ6 A;  1H19 A;  3RC3 A;  4ARF A;  2VLA A;  5DYF A;  3JSZ A;  3U9W A;  4XN8 A;  2Y1D A;  4XN4 A;  2JD0 A;  4ZQF A;  4MKT A;  2JD2 A;  1MW2 A;  2FFL A;  4BKX A;  3CHO A;  4ZW5 A;  1SG7 A;  4GAE A;  5AEN A;  3ZHX A;  1G5A A;  2GTQ A;  3AU9 A;  1X3Z A;  1X3W A;  4XMX A;  4ZX4 A;  5JNL A;  3CHP A;  3FTU A;  2VJ8 A;  3CHS A;  3FUD A;  4FLO A;  4K5N A;  4DPR A;  3FU0 A;  4FLS A;  4LUP A;  3FTZ A;  3WQR A;  4PVB A;  4ZX3 A;  1ONP A;  3ZHZ A;  2B61 A;  2PUS A;  1ONO A;  3ANM A;  3AU8 A;  4Y67 A;  1R0K A;  3CHQ A;  4XND A;  4ZW3 A;  4XMZ A;  1T1R A;  2QJ1 A;  3CZL A;  3A14 A;  3FTY A;  2XPZ A;  2PL5 A;  3FH5 A;  3FU5 A;  3FUM A;  4Q4E A;  4XMV A;  3FU3 A;  4XNA A;  4QHP A;  2ZXG A;  4QME A;  3RAS A;  4FCA A;  3FH8 A;  4ZQG A;  2PGG A;  4QPE A;  2Y1F A;  3FTS A;  3UER A;  3EBI A;  4MS6 A;  4R5T A;  5FWQ A;  3B7R L;  4K5P A;  5JMP A;  4XNB A;  1MW1 A;  3FUH A;  3FTX A;  2O7G A;  4K5O A;  4AR1 A;  1JVS A;  4NQW A;  4PU2 A;  5JAZ A;  2WZF A;  3EBG A;  3A06 A;  3ANN A;  3ZHY A;  3WQQ A;  3UCQ A;  2JV7 A;  2XPY A;  3B7S A;  2C5Z A;  2JCY A;  2WPG A;  4FLQ A;  4L2L A;  4K5M A;  3B7T A;  5JBI A;  3FUN A;  2MAO A;  4ZX5 A;  1K5H A;  4R5V A;  1Q0L A;  3ZI0 A;  2R72 A;  1ONN A;  3FUE A;  4Y6R A;  3B37 A;  2R70 A;  4R7L A;  1Q0Q A;  1S46 A;  3FUJ A;  5DLL A;  4XN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...