4TR6A

Crystal structure of dna polymerase sliding clamp from bacillus subtilis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
380
structure length
380
Chain Sequence
SHMKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA polymerase III subunit beta
publication title Differential Modes of Peptide Binding onto Replicative Sliding Clamps from Various Bacterial Origins.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 91
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain
A PF02767 DNA_pol3_beta_2 DNA polymerase III beta subunit, central domain
A PF02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.150.10 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III, subunit A, domain 2 4tr6A01
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4tr6A02
5AH4A 3U5ZF 2IO4A 3LX2A 3GGRB 3GPNA 4PNWA 3PGEB 4K3OA 1GE8A 2IX2C 4K3PA 1W60A 5JNED 1DMLA 5FVEA 2HIIB 1SXJF 2OD8A 3L0XA 3AIXB 4N94A 4TR6A 2POLA 1B8HA 3G65B 3GGRC 4K3MA 3P16A 3L10A 1RXZA 3QSBA 4PNUA 2ZVLA 3P83A 1OK7A 2HIIC 3LX1A 4ZTDA 2IO4B 3G65C 4RJFA 5IWDA 4K3SA 5AH2A 1IZ5A 1VPKA 1VYJA 4N9AA 3TBLA 4PNVA 2IZOB 3A1JB 3A1JA 3D1FA 4OVGA 2IJXA 4K74A 2XURA 3U60F 4N96A 4OVFA 3D1GA 3QSBB 3HI8A 4YHRA 4N95A 3A1JC 2IZOC 2HIKA 4K3LA 1CZDA 4D2GA 4OVHA 5FRQA 1T6LA 3BEPA 3AIZA 5CFKA 1MMIA 4N98A 1UL1A 1UD9A 4MJPA 5E0VA 5H0TA 4S3IA 4K3QA 1JQLA 4HK1A 5HACA 3P91A 3V60B 3RB9A 1RWZA 3WGWA 3I2MX 2AWAA 2ZVWA 5AGUA 1JQJA 1ISQA 2ZVMA 4TR7A 5IY4A 4K3RA 4TRTA 5A6DA 5E0UA 4L6PA 3FDSC 3A2FB 1UNNA 5B7OA 4K3KA 3V62B 4TSZA 4N97A 3T0PA 2HIKB 3D1EA 2ZVVA 3IFVA 5DAIA 2NTIB 5DA7A 5E0TA 2IX2A 4CS5A 2NTIA 4MJRA 4N99A 3VKXA 1VYMA 5AUJA 3GPMA 3HSLX 1IZ4A 3Q4LA 2HIKC 3GGRA 2AVTA 1PLQA 2ZVKA 2NTIC 3AIZC 5IXAA 4MJQA 3Q4KA 1B77A 3FDSD 1PLRA 4TR8A 2HIIA 1U7BA 3F1VA 5AGVA 3AIXA 3PWEA 3L0WA 1U76A 3G65A 2Z0LA 4L60A 1YYPA 3K4XA 4RKIA 1RXMA 3F1WA 1AXCA 3U61F 2IX2B 3Q4JA 3V61B 3P87A
chains in the Genus database with same CATH superfamily
5AH4A 3U5ZF 2IO4A 3LX2A 3GGRB 3GPNA 4PNWA 3PGEB 4K3OA 1GE8A 2IX2C 4K3PA 1W60A 5JNED 1DMLA 5FVEA 2HIIB 1SXJF 2OD8A 3L0XA 3AIXB 4N94A 4TR6A 2POLA 1B8HA 3G65B 3GGRC 4K3MA 3P16A 3L10A 1RXZA 3QSBA 4PNUA 2ZVLA 3P83A 1OK7A 2HIIC 3LX1A 4ZTDA 2IO4B 3G65C 4RJFA 5IWDA 4K3SA 5AH2A 1IZ5A 1VPKA 1VYJA 4N9AA 3TBLA 4PNVA 2IZOB 3A1JB 3A1JA 3D1FA 4OVGA 2IJXA 3L0XB 4K74A 2XURA 3U60F 4N96A 4OVFA 3D1GA 3L10B 3QSBB 3HI8A 4YHRA 4N95A 3A1JC 2IZOC 2HIKA 4K3LA 1CZDA 4D2GA 4OVHA 5FRQA 1T6LA 3BEPA 3AIZA 5CFKA 1MMIA 4N98A 1UL1A 1UD9A 4MJPA 5E0VA 5H0TA 4S3IA 4K3QA 1JQLA 4HK1A 5HACA 3P91A 3V60B 3RB9A 1RWZA 3WGWA 3I2MX 2AWAA 2ZVWA 5AGUA 1JQJA 1ISQA 2ZVMA 4TR7A 5IY4A 4K3RA 4TRTA 5A6DA 5E0UA 4L6PA 3FDSC 3A2FB 1UNNA 5B7OA 4K3KA 3V62B 4TSZA 4N97A 3T0PA 2HIKB 3D1EA 2ZVVA 3IFVA 5DAIA 2NTIB 5DA7A 5E0TA 2IX2A 4CS5A 2NTIA 4MJRA 4N99A 3VKXA 1VYMA 5AUJA 3GPMA 3HSLX 1IZ4A 3Q4LA 2HIKC 3GGRA 2AVTA 1PLQA 2ZVKA 2NTIC 3PGEA 3AIZC 5IXAA 4MJQA 3Q4KA 1B77A 3FDSD 1PLRA 4TR8A 2HIIA 3L0WB 1U7BA 3F1VA 5AGVA 3AIXA 3PWEA 3L0WA 1U76A 3G65A 2Z0LA 4L60A 1YYPA 3K4XA 4RKIA 1RXMA 3F1WA 1AXCA 3U61F 2IX2B 3Q4JA 3V61B 3P87A
chains in the Genus database with same CATH topology
5AH4A 3U5ZF 2IO4A 3LX2A 3GGRB 3GPNA 4PNWA 3PGEB 4K3OA 1GE8A 2IX2C 4K3PA 1W60A 5JNED 1DMLA 5FVEA 2HIIB 1SXJF 2OD8A 3L0XA 3AIXB 4N94A 4TR6A 2POLA 1B8HA 3G65B 3GGRC 4K3MA 3P16A 3L10A 1RXZA 3QSBA 4PNUA 2ZVLA 3P83A 1OK7A 2HIIC 3LX1A 4ZTDA 2IO4B 3G65C 4RJFA 5IWDA 4K3SA 5AH2A 1IZ5A 1VPKA 1VYJA 4N9AA 3TBLA 4PNVA 2IZOB 3A1JB 3A1JA 3D1FA 4OVGA 2IJXA 4K74A 2XURA 3U60F 4N96A 4OVFA 3D1GA 3QSBB 3HI8A 4YHRA 4N95A 3A1JC 2IZOC 2HIKA 4K3LA 1CZDA 4D2GA 4OVHA 5FRQA 1T6LA 3BEPA 3AIZA 5CFKA 1MMIA 4N98A 1UL1A 1UD9A 4MJPA 5E0VA 5H0TA 4S3IA 4K3QA 1JQLA 4HK1A 5HACA 3P91A 3V60B 3RB9A 1RWZA 3WGWA 3I2MX 2AWAA 2ZVWA 5AGUA 1JQJA 1ISQA 2ZVMA 4TR7A 5IY4A 4K3RA 4TRTA 5A6DA 5E0UA 4L6PA 3FDSC 3A2FB 1UNNA 5B7OA 4K3KA 3V62B 4TSZA 4N97A 3T0PA 2HIKB 3D1EA 2ZVVA 3IFVA 5DAIA 2NTIB 5DA7A 5E0TA 2IX2A 4CS5A 2NTIA 4MJRA 4N99A 3VKXA 1VYMA 5AUJA 3GPMA 3HSLX 1IZ4A 3Q4LA 2HIKC 3GGRA 2AVTA 1PLQA 2ZVKA 2NTIC 3AIZC 5IXAA 4MJQA 3Q4KA 1B77A 3FDSD 1PLRA 4TR8A 2HIIA 1U7BA 3F1VA 5AGVA 3AIXA 3PWEA 3L0WA 1U76A 3G65A 2Z0LA 4L60A 1YYPA 3K4XA 4RKIA 1RXMA 3F1WA 1AXCA 3U61F 2IX2B 3Q4JA 3V61B 3P87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AH4 A;  3U5Z F;  2IO4 A;  3LX2 A;  3GGR B;  3GPN A;  4PNW A;  3PGE B;  4K3O A;  1GE8 A;  2IX2 C;  4K3P A;  1W60 A;  5JNE D;  1DML A;  5FVE A;  2HII B;  1SXJ F;  2OD8 A;  3L0X A;  3AIX B;  4N94 A;  4TR6 A;  2POL A;  1B8H A;  3G65 B;  3GGR C;  4K3M A;  3P16 A;  3L10 A;  1RXZ A;  3QSB A;  4PNU A;  2ZVL A;  3P83 A;  1OK7 A;  2HII C;  3LX1 A;  4ZTD A;  2IO4 B;  3G65 C;  4RJF A;  5IWD A;  4K3S A;  5AH2 A;  1IZ5 A;  1VPK A;  1VYJ A;  4N9A A;  3TBL A;  4PNV A;  2IZO B;  3A1J B;  3A1J A;  3D1F A;  4OVG A;  2IJX A;  4K74 A;  2XUR A;  3U60 F;  4N96 A;  4OVF A;  3D1G A;  3QSB B;  3HI8 A;  4YHR A;  4N95 A;  3A1J C;  2IZO C;  2HIK A;  4K3L A;  1CZD A;  4D2G A;  4OVH A;  5FRQ A;  1T6L A;  3BEP A;  3AIZ A;  5CFK A;  1MMI A;  4N98 A;  1UL1 A;  1UD9 A;  4MJP A;  5E0V A;  5H0T A;  4S3I A;  4K3Q A;  1JQL A;  4HK1 A;  5HAC A;  3P91 A;  3V60 B;  3RB9 A;  1RWZ A;  3WGW A;  3I2M X;  2AWA A;  2ZVW A;  5AGU A;  1JQJ A;  1ISQ A;  2ZVM A;  4TR7 A;  5IY4 A;  4K3R A;  4TRT A;  5A6D A;  5E0U A;  4L6P A;  3FDS C;  3A2F B;  1UNN A;  5B7O A;  4K3K A;  3V62 B;  4TSZ A;  4N97 A;  3T0P A;  2HIK B;  3D1E A;  2ZVV A;  3IFV A;  5DAI A;  2NTI B;  5DA7 A;  5E0T A;  2IX2 A;  4CS5 A;  2NTI A;  4MJR A;  4N99 A;  3VKX A;  1VYM A;  5AUJ A;  3GPM A;  3HSL X;  1IZ4 A;  3Q4L A;  2HIK C;  3GGR A;  2AVT A;  1PLQ A;  2ZVK A;  2NTI C;  3AIZ C;  5IXA A;  4MJQ A;  3Q4K A;  1B77 A;  3FDS D;  1PLR A;  4TR8 A;  2HII A;  1U7B A;  3F1V A;  5AGV A;  3AIX A;  3PWE A;  3L0W A;  1U76 A;  3G65 A;  2Z0L A;  4L60 A;  1YYP A;  3K4X A;  4RKI A;  1RXM A;  3F1W A;  1AXC A;  3U61 F;  2IX2 B;  3Q4J A;  3V61 B;  3P87 A; 
#chains in the Genus database with same CATH topology
 5AH4 A;  3U5Z F;  2IO4 A;  3LX2 A;  3GGR B;  3GPN A;  4PNW A;  3PGE B;  4K3O A;  1GE8 A;  2IX2 C;  4K3P A;  1W60 A;  5JNE D;  1DML A;  5FVE A;  2HII B;  1SXJ F;  2OD8 A;  3L0X A;  3AIX B;  4N94 A;  4TR6 A;  2POL A;  1B8H A;  3G65 B;  3GGR C;  4K3M A;  3P16 A;  3L10 A;  1RXZ A;  3QSB A;  4PNU A;  2ZVL A;  3P83 A;  1OK7 A;  2HII C;  3LX1 A;  4ZTD A;  2IO4 B;  3G65 C;  4RJF A;  5IWD A;  4K3S A;  5AH2 A;  1IZ5 A;  1VPK A;  1VYJ A;  4N9A A;  3TBL A;  4PNV A;  2IZO B;  3A1J B;  3A1J A;  3D1F A;  4OVG A;  2IJX A;  3L0X B;  4K74 A;  2XUR A;  3U60 F;  4N96 A;  4OVF A;  3D1G A;  3L10 B;  3QSB B;  3HI8 A;  4YHR A;  4N95 A;  3A1J C;  2IZO C;  2HIK A;  4K3L A;  1CZD A;  4D2G A;  4OVH A;  5FRQ A;  1T6L A;  3BEP A;  3AIZ A;  5CFK A;  1MMI A;  4N98 A;  1UL1 A;  1UD9 A;  4MJP A;  5E0V A;  5H0T A;  4S3I A;  4K3Q A;  1JQL A;  4HK1 A;  5HAC A;  3P91 A;  3V60 B;  3RB9 A;  1RWZ A;  3WGW A;  3I2M X;  2AWA A;  2ZVW A;  5AGU A;  1JQJ A;  1ISQ A;  2ZVM A;  4TR7 A;  5IY4 A;  4K3R A;  4TRT A;  5A6D A;  5E0U A;  4L6P A;  3FDS C;  3A2F B;  1UNN A;  5B7O A;  4K3K A;  3V62 B;  4TSZ A;  4N97 A;  3T0P A;  2HIK B;  3D1E A;  2ZVV A;  3IFV A;  5DAI A;  2NTI B;  5DA7 A;  5E0T A;  2IX2 A;  4CS5 A;  2NTI A;  4MJR A;  4N99 A;  3VKX A;  1VYM A;  5AUJ A;  3GPM A;  3HSL X;  1IZ4 A;  3Q4L A;  2HIK C;  3GGR A;  2AVT A;  1PLQ A;  2ZVK A;  2NTI C;  3PGE A;  3AIZ C;  5IXA A;  4MJQ A;  3Q4K A;  1B77 A;  3FDS D;  1PLR A;  4TR8 A;  2HII A;  3L0W B;  1U7B A;  3F1V A;  5AGV A;  3AIX A;  3PWE A;  3L0W A;  1U76 A;  3G65 A;  2Z0L A;  4L60 A;  1YYP A;  3K4X A;  4RKI A;  1RXM A;  3F1W A;  1AXC A;  3U61 F;  2IX2 B;  3Q4J A;  3V61 B;  3P87 A; 
#chains in the Genus database with same CATH homology
 5AH4 A;  3U5Z F;  2IO4 A;  3LX2 A;  3GGR B;  3GPN A;  4PNW A;  3PGE B;  4K3O A;  1GE8 A;  2IX2 C;  4K3P A;  1W60 A;  5JNE D;  1DML A;  5FVE A;  2HII B;  1SXJ F;  2OD8 A;  3L0X A;  3AIX B;  4N94 A;  4TR6 A;  2POL A;  1B8H A;  3G65 B;  3GGR C;  4K3M A;  3P16 A;  3L10 A;  1RXZ A;  3QSB A;  4PNU A;  2ZVL A;  3P83 A;  1OK7 A;  2HII C;  3LX1 A;  4ZTD A;  2IO4 B;  3G65 C;  4RJF A;  5IWD A;  4K3S A;  5AH2 A;  1IZ5 A;  1VPK A;  1VYJ A;  4N9A A;  3TBL A;  4PNV A;  2IZO B;  3A1J B;  3A1J A;  3D1F A;  4OVG A;  2IJX A;  4K74 A;  2XUR A;  3U60 F;  4N96 A;  4OVF A;  3D1G A;  3QSB B;  3HI8 A;  4YHR A;  4N95 A;  3A1J C;  2IZO C;  2HIK A;  4K3L A;  1CZD A;  4D2G A;  4OVH A;  5FRQ A;  1T6L A;  3BEP A;  3AIZ A;  5CFK A;  1MMI A;  4N98 A;  1UL1 A;  1UD9 A;  4MJP A;  5E0V A;  5H0T A;  4S3I A;  4K3Q A;  1JQL A;  4HK1 A;  5HAC A;  3P91 A;  3V60 B;  3RB9 A;  1RWZ A;  3WGW A;  3I2M X;  2AWA A;  2ZVW A;  5AGU A;  1JQJ A;  1ISQ A;  2ZVM A;  4TR7 A;  5IY4 A;  4K3R A;  4TRT A;  5A6D A;  5E0U A;  4L6P A;  3FDS C;  3A2F B;  1UNN A;  5B7O A;  4K3K A;  3V62 B;  4TSZ A;  4N97 A;  3T0P A;  2HIK B;  3D1E A;  2ZVV A;  3IFV A;  5DAI A;  2NTI B;  5DA7 A;  5E0T A;  2IX2 A;  4CS5 A;  2NTI A;  4MJR A;  4N99 A;  3VKX A;  1VYM A;  5AUJ A;  3GPM A;  3HSL X;  1IZ4 A;  3Q4L A;  2HIK C;  3GGR A;  2AVT A;  1PLQ A;  2ZVK A;  2NTI C;  3AIZ C;  5IXA A;  4MJQ A;  3Q4K A;  1B77 A;  3FDS D;  1PLR A;  4TR8 A;  2HII A;  1U7B A;  3F1V A;  5AGV A;  3AIX A;  3PWE A;  3L0W A;  1U76 A;  3G65 A;  2Z0L A;  4L60 A;  1YYP A;  3K4X A;  4RKI A;  1RXM A;  3F1W A;  1AXC A;  3U61 F;  2IX2 B;  3Q4J A;  3V61 B;  3P87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...