The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
177
|
structure length |
161
|
Chain Sequence |
SIDEQSLHNARRLFESGDIDRIEVGTTAGLQQIHRYLFGGLYDFAGQIRLKEALVKIEQMPERTFEEIIAKYVRMNIAHPFLEGNGRSTRIWLDLVLKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYYYEGYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Intrinsic regulation of FIC-domain AMP-transferases by oligomerization and automodification.
pubmed doi rcsb |
| molecule keywords |
Adenosine monophosphate-protein transferase NmFic
|
| molecule tags |
Transferase
|
| source organism |
Neisseria meningitidis
|
| total genus |
61
|
| structure length |
161
|
| sequence length |
177
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.7.n1: Protein adenylyltransferase. |
| pdb deposition date | 2015-07-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02661 | Fic | Fic/DOC family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Fic-like fold | Fido-like domain |
#chains in the Genus database with same CATH superfamily 2VY3 A; 3SE5 A; 4NPS A; 4X2D A; 2JK8 A; 4LU4 A; 3ZC7 A; 3ZLM A; 4U0S A; 5JJ6 A; 4U04 A; 4X2E A; 5CGL A; 4N67 A; 3S6A A; 3LET A; 5JFZ A; 5EU0 A; 5CMT A; 4PY3 A; 4U0Z A; 2F6S A; 5CKL A; 4XI8 A; 4ITR A; 2G03 A; 4X2C A; 4U07 A; 3SHG A; 3N3U A; 2VZA A; 3CUC A; 4WGJ A; 3SN9 A; 5JJ7 A; 5JFF A; 3ZCB A; 4M16 A; 4U0U A; #chains in the Genus database with same CATH topology 2VY3 A; 2NUD A; 3SE5 A; 4NPS A; 4X2D A; 2JK8 A; 4LU4 A; 3ZC7 A; 3ZLM A; 4U0S A; 5JJ6 A; 4U04 A; 4X2E A; 2NUN A; 5CGL A; 4N67 A; 3S6A A; 3LET A; 5JFZ A; 5EU0 A; 5CMT A; 4PY3 A; 1NH1 A; 4U0Z A; 2F6S A; 5CKL A; 4XI8 A; 4ITR A; 2G03 A; 4X2C A; 4U07 A; 3SHG A; 3N3U A; 2VZA A; 3CUC A; 4WGJ A; 3SN9 A; 5JJ7 A; 5JFF A; 3ZCB A; 4M16 A; 4U0U A; #chains in the Genus database with same CATH homology 2VY3 A; 3SE5 A; 4NPS A; 4X2D A; 2JK8 A; 4LU4 A; 3ZC7 A; 3ZLM A; 4U0S A; 5JJ6 A; 4U04 A; 4X2E A; 5CGL A; 4N67 A; 3S6A A; 3LET A; 5JFZ A; 5EU0 A; 5CMT A; 4PY3 A; 4U0Z A; 2F6S A; 5CKL A; 4XI8 A; 4ITR A; 2G03 A; 4X2C A; 4U07 A; 3SHG A; 3N3U A; 2VZA A; 3CUC A; 4WGJ A; 3SN9 A; 5JJ7 A; 5JFF A; 3ZCB A; 4M16 A; 4U0U A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...