4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
2JJQA 4JI6L 2UXCL 2NZOA 1PV4A 4DV4L 1PH8A 1V1QA 3OTOL 4X64Q 3A5ZB 1VQKA 5BR8L 4JV5L 4LF9Q 1Q81C 3AQQA 4LUOA 4BBSH 3S15H 2BH2A 4P73A 4YY3Q 5AJ3L 4B3TQ 1X56A 2EQSA 3K8AA 4LF4Q 3I7FA 2VW9A 1FJGL 4B3SQ 3HFZB 3JAMi 1HR0L 4O0AA 4OONA 4PZ6A 1L0WA 3ZLMA 1CSPA 4GKJL 3KFUA 3HOYG 5FJ8G 2NVQH 4UP8A 3MXNB 2B63G 4IFDG 4K0KQ 1A63A 1QUQB 3PUXA 3TS0A 4A3LH 2F6SA 2VUMH 4DR5Q 3PO3G 4LF7L 1FL0A 3SGIA 1MIUA 4QGUA 4YWLA 1PH6A 4JBJA 3HKSA 1BVSA 2HHHQ 2E5LL 4BBRG 1Q82C 3J81c 3G4SA 1I50H 1KRSA 4H02A 4JI4Q 3ZJYC 2BA1A 5LMNL 4LF6L 4JCVE 2ZJRA 1BBWA 1YJNA 1K8GA 1WCMH 1PH2A 1XMQQ 3U4ZA 2BH8A 2I5LX 2R7FA 4JI8Q 4DR2Q 4C3IH 1N34Q 2UXBQ 2JA8H 4POFA 2ZTCA 1L1OA 2KENA 1UE5A 5E7NA 3RLOA 3HOZG 1EQQA 3I2ZA 2G03A 3CF5A 3K7UC 5IYCG 4BXXH 2VY3A 4LUVA 3OW2A 2BA0A 4DR4L 3JAMc 3M85A 2ZM6L 2E2JH 4DR1Q 5C4XH 4LNQA 2HT1A 4A3BH 4GNXA 1IBMQ 1SLJA 5GAGC 1IBKQ 1FVIA 2AWNA 4A3JG 1RIPA 4LU4A 2R92G 4X65Q 1VQGA 4YHHQ 3PUVA 4O2DA 1OXXK 5M3FG 4DUYL 3S1RH 1WFQA 3U4VA 2E2HH 3TRZA 2NVYH 2ATWA 3NELA 1CKMA 3W1BA 2IHEA 1J6QA 4B3RQ 4MNOA 2JEBI 1Z47A 1E7ZA 4LFBQ 1VQFA 4DV1Q 4A3FH 1HZBA 4GN3B 2C35B 2WFWA 1VQ6A 2IY5B 2MFIA 5JFZA 2A19A 4YCUA 2CKZB 3CPWA 4HJ5A 4A3DG 3PGZA 4IFDI 3L7ZC 5FLMG 4R4CA 4UP9A 4JI3Q 4DUZQ 2UU9L 1HZCA 2Z6KA 1UWVA 1CKOA 3GTGH 1VQDA 3RZDH 1NY4A 3M7NA 3S1QH 1EQRA 2CFMA 4NXML 2PQAB 5JEAG 4U0SA 4GN4B 1PH1A 1I94Q 3RLNA 1J5EL 4LFAQ 1VQOA 4X66L 1CKNB 4A3CG 4GLVB 1CSQA 4LUZA 3HKZG 4JC0A 2VL6A 1KRTA 1L2FA 2F3IA 1KHIA 4C3JH 5JJIA 2ES2A 2H5XA 3HOYH 3CUCA 3UDIA 5H1SE 1JJ2A 1YHQA 4A3EG 2VQFQ 1K73C 3E9HA 1Q12A 2K4KA 2RCNA 2YTYA 3G48A 2R93G 2UXDQ 2UUAQ 3H0GG 4A75A 1EIYB 3CC7A 4JI7Q 3S1MH 3PO3H 3M4QA 5IWAQ 1VQHA 2I5MX 2XGTA 3CCVA 1KD1C 1K83H 2Q2TA 3J7ZC 4BBRH 2Z0SA 1E1OA 3UE1A 3BZKA 1N33Q 4QL5A 2HIXA 3PV0A 4ME3A 5C4JH 1G6PA 4ALPA 5C3EH 4JI5Q 1VQEA 3KDFA 2E8GA 1N36L 1TWHH 3S24A 2N78A 1IBLQ 3J7A5 5CMTA 3STBC 5C44G 4OX9Q 3CCLA 4C2MH 1HNXQ 3J80i 3KJOA 2F52A 1C7YA 3HOZH 1VQ4A 4GOPA 1HZAA 2UXCQ 1X65A 3SE5A 3GDEA 3TREA 3BZCA 1U5KA 5M3MG 4DV4Q 4JI6Q 1FGUA 2MQHA 3OTOQ 3CCUA 2Q2UA 4L5QA 5BR8Q 4JV5Q 1SROA 5C0XI 4OO1I 4IOAA 4KI0A 4JBKA 4ITRA 4A3JH 1VQ7A 1LM0A 2R92H 2JEAI 2ALYB 4X62L 5AJ3Q 5M3FH 1AH9A 3LETA 4KLKA 1M1KC 1V9PA 1FJGQ 1O7IA 1HNWL 4PZ8A 1GO3E 2Y0SG 4A3IH 1HR0Q 3K0XA 4NB3A 4DV7L 4DR3L 4GKJQ 3CPFA 3T1HL 2Y0SE 5HY6A 3ULPA 4KHPL 2A1AA 2IX1A 3ICEA 4A3KG 3B6YA 4LF7Q 2N8NA 4A3DH 1W2BA 4R4IA 1CUKA 1YVCA 1Q1BA 3KYHC 1L1OB 4LF8L 5FLMH 3M4PA 1S72A 4DV6L 3H3VI 4JI0L 2E5LQ 3J80c 3PIOA 3GO5A 5LMNQ 2OTJA 1K8AC 1TXYA 4GN5A 1VQ5A 4YWMA 4A76A 2JA5G 4HIOA 1A8VA 5EU0A 1OXTA 1LTLA 1UE1A 4GNXB 4A3CH 1TWFH 1VQCA 1VQAA 1YHBA 3KF6A 3CCRA 2R7ZG 3M4OH 2RF4A 4U0UA 4IJLA 2WP8J 4A3EH 3S2HH 3H3VH 4GS3A 4Y7NH 4DR4Q 2ZM6Q 3GTMH 3H0GH 4JOIC 2JA7G 1D7QA 3GTOH 1ASZA 1A62A 1SMXA 4QIWE 2LSSA 2KHJA 4MZ9A 1YITA 1GVPA 4OWXB 1YHAA 4BY1G 2OQKA 2IX0A 5IY0A 1SE8A 4DUYQ 3I4MG 4X6AH 1KAWA 4J15A 1EIFA 4IFDJ 1SR3A 2VNUD 4N67A 3F1ZA 2IHFA 5IYDG 2PNHA 4AQYL 2I5HA 1VQNA 1DGSA 2JQOA 4JI1L 4HJ7A 5IP7G 1S3OA 1U0LA 3T1YL 4LF5Q 4A93G 1I5FA 1N32L 1W3SA 4YWKA 4LFCL 3ZCBA 2D62A 1Y14B 1BKBA 5M3MH 1AE2A 1QVFA 4BA1I 1WI5A 2HHHL 3W5OA 2UU9Q 3ULJA 5JJLA 3BU2A 2CWAA 4U07A 4TVAB 2GN5A 1PYBA 2KHIA 4QJFA 3WWVA 2UUBL 3CW2C 5GROA 2FXQA 3ER0A 1M90C 4NXMQ 5K36G 1VQJA 4JI2L 4A3MG 4X2DA 5JFFA 1J5EQ 3K81C 4X66Q 1GM5A 2PI2E 3FHWA 1ASYA 3A0JA 1WYDA 4DV5Q 3RN5A 1PYSB 3KF8B 1VQLA 4NXNL 5DLQE 1VQPA 1E22A 3EN2A 1XJVA 2JK8A 4POGA 2VQEL 1IZ6A 3CCSA 3HOWG 1B8AA 1UE7A 1X6OA 4R4OA 3GTLH 3KDFB 1SRUA 5IE8A 3AEVA 3PUZA 4A3KH 1XNQL 3UDXA 3I4OA 4DV0L 2NVXH 3PCOB 1PHJA 2CCZA 4DR6L 1UEBA 1XPOA 5CGLA 5M5YH 4LWCA 2HIVA 3CMAA 1EFWA 5FJ8H 3UDGA 5ELNA 4GOPB 2B63H 3CAMA 3RZOH 4IOCA 4IPHA 4C3HH 3JC66 1JMCA 2F4VL 2R7DA 4RG1A 4WGJA 1N9WA 3GTQH 1WJJA 1N36Q 4JYAL 2JA5H 1A0IA 3J81j 3CCQA 4GKKL 1HH2P 3A5UA 3FKIG 5C0XJ 2D0OA 4R1JA 1YJ9A 5LMNW 3MEFA 2R7ZH 2R6GA 2CQOA 4LFBL 3CCJA 2KCMA 3S17H 3K7AH 3S2DH 3ZC7A 4DAYB 4OWWB 1B7YB 4B3ML 3HOUG 4WJ3M 3NENA 2JA7H 1MKHA 1XNRL 1E1TA 2K5HA 1Q1EA 1KIXA 1KQSA 2QA4A 4YCWA 3IRBA 2NN6G 2UUCL 4X62Q 1G291 2DGYA 2N3SA 2RHQB 1YZ6A 3I4MH 2NVTH 2GVAA 2MO1A 3CP0A 4GLAC 5IYCH 4XIGS 3DM3A 4DV2L 4HIKA 5GAHC 5IYDH 4DV7Q 4DR3Q 2I0QA 3GD7A 1Y1WG 3T1HQ 4JBMA 4KHPQ 4HIMA 1R9TH 5IP9G 1JE5A 2JA6G 4BXXG 4A93H 3EBEA 4IPDA 3RLFA 1NJIC 3PO2G 4BY7H 1YJWA 5C4XG 2PQAA 4XTCS 4JBWA 4A3BG 4QQBX 3LGJA 4BY7G 3KF6B 4PY3A 1BBUA 1C0AA 2K50A 2LXJA 1Y1VG 2B3GA 4DV6Q 4LW1A 4JI0Q 1MJCA 3ERSX 3RR5A 4DR7L 4L5TA 5IYBG 1KXLA 4OWTB 4GLXA 1X3FA 4UY8C 1XPUA 3PUWA 2V1CC 1NMFA 1UE6A 3CCMA 3UDFA 3CQZH 2JE6I 1Q46A 4JG2A 1Q86C 2NZHA 3M9BA 1XMOL 3W1GA 4A3MH 5IT9c 1PH4A 4U04A 1X55A 3CCEA 1Q7YC 2ID0A 4BA2I 1B70B 1NTGA 1LYLA 4P74A 5GAEC 1T9HA 3D31A 4AH6A 3KLWA 1YNXA 4LF6Q 3HOWH 1KC8C 2WAQE 1HJPA 2VZAA 3FP9A 2GVBA 3F8TA 5M5WH 4DV3L 1K9MC 4UP7A 2N49A 3KOJA 1HNZL 1SN8A 1XPRA 5J3BA 2ZTEA 4PG3A 4A3GG 1PH5A 1VQBA 5LMUL 2A8VA 3HOVG 2PMZE 1OXVA 2D0PA 2AWOA 4DUZL 4XI8A 3F2BA 3S1NH 4QY7A 1JJCB 1OTCA 2NN6I 4R4TA 2R93H 3A74A 3F2CA 1PVOA 4X64L 2EXDA 4AQYQ 5JJ6A 1NMGA 1OXUA 2ZJQA 4LF9L 4IPCA 1LUZA 3FKIH 1N8RC 1IYJB 2PI2A 4JOIA 4JI1Q 1TWAH 2VS1A 4P75A 1VQ9A 3STBD 3T1YQ 3D0FA 2OTLA 4YY3L 4U0ZA 3AYHB 4B3TL 4LFCQ 1N32Q 2YTXA 2OCEA 4DNIA 3TS2A 4LF4L 3HOXG 5GQOA 3EIVA 3HOUH 2MO0A 4B3SL 5JJ7A 4DR6Q 5C44H 4K0KL 3OYYA 1EUJA 2EIFA 3G71A 3TQYA 1VQMA 1G51A 2UUBQ 5C3EG 4L5SA 2UXBL 4DR5L 3PF5A 3CC2A 3K80C 2YYZA 4JI2Q 4DK3C 4NPSA 1L1OC 4Y52H 1PA6A 3CC4A 4DAMA 4NXNQ 5FLXc 4M16A 1IL2A 1Y1WH 4JI4L 2VQEQ 1QVCA 4MTNA 5IP9H 1QUQA 1X9NA 2OWOA 2JA6H 3GTPH 3AFQA 1I6HH 4AIMA 3SN9A 4GNXC 3RN2A 3VDYA 3PO2H 1XNQQ 5CKLA 2JA9A 1K0RA 1C9OA 2K52A 1X3EA 2DUDA 4PZ7A 4UPAA 4DV0Q 4DR2L 4JI8L 3KJPA 2ZJPA 1XMQL 1N34L 1VCIA 3CD6A 4HJAA 3NBHB 2KBNA 1Y1VH 3TEHB 3L2PA 3GTKH 3I4NG 2YU9H 3G6EA 4L5RC 5IYBH 4TQUS 3N3UA 2Q2IA 1E24A 2F4VQ 1HR0W 1H95A 4A3IG 4JYAQ 4DR1L 4GKKQ 1TWGH 1IBML 3UE0A 1Q8KA 1IBKL 1JB7A 4APVA 1EYGA 3L0OA 3Q8DA 3DLLA 3F2DA 4BBSG 2AKWB 2ZTDA 4X65L 4LF5L 2QGQA 4YHHL 5C0XG 4OO1G 1OXSC 1GD7A 3I55A 4B3MQ 1X3GA 1GKHA 2AHOB 1P8LA 4B3RL 3E0EA 2Z6KC 3E9IA 2L15A 1PH3A 1X54A 1XNRQ 3SHGA 4FDBA 2RHSB 4PMWA 1HZ9A 4A3GH 2WB1G 1KL9A 4DV1L 4A3LG 3H15A 2UUCQ 3M3YH 3HOVH 1VQIA 1XTDA 1D8LA 3PUYA 2VUMG 4DK6C 2XTIA 5M5XH 2ASBA 1I3QH 1JJGA 2WB1E 1JT8A 2CWPA 3S14H 2K14A 4A4IA 3PSIA 4IJHA 4DV2Q 4KHZA 4IPGA 4DV5L 2OQ0A 1YIJA 1YEZA 4OXPA 4JI3L 4X2EA 3CMEA 4X2CA 5JEAJ 3HKZE 1NBWA 1SFOH 2B29A 4BY1H 1QZGA 1V43A 3S16H 1K3RA 4HJ8A 4HIDA 1QZHA 1IXRA 2IT1A 1WCMG 1I94L 3HOXH 4LFAL 1HNWQ 4AYBG 3PIPA 2JA8G 3I56A 1QVGA 3U58A 2HQLA 2Q2HA 1PH7A 4AYBE 1PFSA 2AMCB 2K5VA 4DR7Q 2MNAA 3BJUA 1VS0A 3U50C 1EWIA 1EOVA 4EQ5A 5IP7H 2VQFL 3NEMA 5ELOA 4WJ4A 1TWCH 4RMFA 1E3PA 2UXDL 2UUAL 4EX5A 3CXCA 4JI7L 1XMOQ 5IWAL 2YV5A 1CKNA 4LF8Q 1WOCA 1P16A 4GOPC 2E2IH 1VQ8A 4DKAC 4YCVA 4R4QA 1N33L 4DPGA 1RL2A 1AE3A 2K75A 1NE3A 5HGQA 3S6AA 4JI5L 4P72A 2K5NA 3GTJH 4IO9A 1PH9A 3RNUA 3AFPA 3ULLA 4DV3Q 1IBLL 3PF4A 1HNZQ 4OX9L 2LXKA 4HJ9A 4A3FG 1YI2A 3I4NH 1HNXL 5LMUQ 3J81i 1YBYA 5JJKA 2WAQG 1S40A 4P71A 5GADC 1MJEA 2QEXA 2YTVA 5EAYA 2KCTA 1Z9FA
chains in the Genus database with same CATH superfamily
2D2CC 2JJQA 2NZOA 1GHJA 4DV4L 4HSPA 4G7ZC 2M9VA 3VYSA 3OTOL 2F0PA 4LUOA 5M5WB 4P73A 1KNAA 2HDMA 4NDXA 4LF4Q 3I7FA 2VW9A 3HFZB 4L63B 4PZ6A 3Q0AA 1LABA 3KFUA 2B63G 4C3HG 3CRKC 1RF2D 4J8QA 2G9HD 4DR5Q 1K3BC 1MIUA 4QGUA 2HQEA 1EY7A 4RHSA 1PH6A 4IUTA 3HOUB 1IKLA 1O7ZA 1I50H 2BA1A 2ZJRA 1BBWA 5C44B 1QE6A 1DXMA 5F2DA 1PRTF 1FNUA 1PH2A 3C3LA 3A54A 5CGKA 2R7FA 4JI8Q 1M4VA 4C3IH 4MIUA 4POFA 2JA8H 1WTQA 2KENA 2G03A 1CI3M 3VR6A 2VY3A 3DEOA 2BA0A 1IBMQ 1SLJA 4ZKBB 1IBKQ 2AWNA 4ABNA 3S1RH 3TRZA 2YU9B 3NELA 1CKMA 1Q90A 5C5MA 1E7ZA 4DV1Q 1LTAD 3ND9A 1TWGB 4A3FH 2WFWA 2IY5B 2A19A 1V8QA 2CKZB 4HJ5A 4A3DG 3BDCA 4IFDI 3AB9A 3D4DA 4UP9A 5JPMC 4JI3Q 4IUQA 2P5ZX 1CKOA 1G8ZD 1VQDA 3RZDH 3M7NA 2PQAB 1PH1A 3RLNA 3S17B 4LFAQ 1VQOA 4HEDA 1CTMA 4FF3A 2VL6A 2F3IA 4C3JH 5JVH3 2A69C 2ES2A 3HOYH 3UDIA 1EY9A 2YTYA 1DM0B 2PW5A 4RGMA 2RCFA 3H0GG 4A75A 1EIYB 2OXPA 3M4QA 2CHBD 3J7ZC 4BBRH 1PZKD 2HIXA 2B2YA 4ME3A 1EOTA 4ALPA 5C3EH 3J7YW 4JI5Q 1VQEA 2K01A 1PTOD 3E3XA 1N36L 3S24A 2NUCA 2PO4A 1ILPA 4K5VA 1TVXA 2IW3A 2PCFB 3O13A 2F0IA 1VMPA 5CBEE 4R9WA 2CVRA 5BR8Q 1IW7D 1SROA 1D2BA 4JBKA 5J39A 3JAME 2OEOA 1A3VA 2ALYB 5M3FH 3A55A 1KAAA 2F3VA 1V9PA 1DYQA 1II3A 2KUMA 1GO3E 5C6AA 3D8GA 1SYCA 2M00A 2Y0SE 4KHPL 3ICEA 2L5TA 2BE5D 1LTSD 1NAPA 5A2QE 4LF7Q 1L1OB 2L4NA 3M4PA 5CV4A 2E5LQ 2XSCA 4ZK9B 3GO5A 5NUCA 5LMNQ 1WTWA 1TXYA 2NVQB 4YWMA 4A76A 4HIOA 4DXGA 3QB3A 1NNXA 1EZ6A 1TWFH 3L9AX 5J22A 1PRTB 1VQAA 2ZXRA 3CCRA 2R7ZG 1F9QA 3E0JA 1JORA 4DAPA 1L0XB 4UDUC 5CV6A 2F0FA 5A35A 5JJZA 3TP5A 2ZM6Q 1U9RA 1ASZA 2LSSA 4MZ9A 1SYFA 1YHAA 2WIIB 3MZ5A 1KAWA 1EIFA 1SR3A 1TY2A 2BOSA 3F1ZA 2WACA 2PNHA 4F7XA 1VQNA 2E74C 1JB3A 2G9DA 1N32L 1SYDA 4LFCL 2B39A 1Y14B 2NVYB 5DM73 2GN5A 4XT1B 2FXQA 4NXMQ 4Q0FA 5JFFA 4X3KA 3VYRA 1ASYA 4ZRZA 1WYDA 3KF8B 1TS3A 1VQPA 3KLSA 2JK8A 1VDZA 2VQEL 1UE7A 1EEID 1SRUA 4F87A 1HQMC 3AEVA 3RD4A 3HOVB 4DR6L 4CHTB 1UEBA 5M5YH 4LWCA 2HIVA 5LHY1 5ELNA 3CAMA 4IPHA 3JC66 5DEHA 4WGJA 1N9WA 3GTQH 1UEAB 2EJFC 4JW0A 1WTHA 4GKKL 3A5UA 5C0XJ 2D0OA 3MEFA 1XX8A 3CCJA 2KCMA 3ZC7A 1EFID 2F0GA 4B3ML 3SK8A 5CV9A 2JA7H 1RKNA 1E1TA 1KIXA 5FK9C 5BN5A 2Z4IA 3MFYA 2RHQB 4PV1C 3I4MH 3CP0A 4GLAC 3FPPA 5ELFA 4XIGS 3T4AC 3HOZB 4DV2L 1DONA 5IYDH 3GD7A 3X3NA 1PMRA 1GJXA 1AW7A 1JE5A 4QMGA 1TIID 5IP9G 4EQNA 1A3TA 5CV5A 4OHJA 4A3JB 4HAEA 1G2TA 4BY7G 1JWMD 3KF6B 1BBUA 2A6EC 2K50A 1SNOA 5IYBG 4A3IB 4OWTB 1X3FA 2V1CC 2ZXPA 2JE6I 2NZHA 5IT9c 1X55A 3CCEA 3OIPA 2ID0A 4ZAIA 2F4IA 2O5JC 5I6WA 2Z8LA 3QJYA 2WAQE 1F2YA 4QCLA 2WB1B 5M5WH 4UP7A 2N49A 3KOJA 5AFWA 2ZTEA 4PG3A 1OXVA 1I4RA 2D0PA 1OTCA 1I50B 1FNVA 2NN6I 1NH1A 2FHTA 4A3EB 1NMGA 2ZJQA 4Y7NB 1IYJB 1KLGD 3GTMB 3FVQA 3T1YQ 3D0FA 3SK5A 4B3TL 1QNKA 3TS2A 1SNPA 3HOUH 3EIVA 2A73B 2L1BA 3ONAB 1STYA 4N9PA 5C44H 3T53B 1PTOF 4ILWA 3TQYA 1VQMA 2K7VA 5C3EG 2CW0D 3PF5A 4XQJA 4JI2Q 4DN4M 1LTID 1LT3D 4DAMA 4IUNA 5FLXc 4NXNQ 1T5XD 3FDTA 1E0BA 1QVCA 1PTOC 1NR2A 2J7ZA 4AIMA 1LACA 1AP0A 4S3SA 2K52A 1XMQL 4P2CB 4N9TA 4DR2L 2EY1A 3I4NG 4HJAA 1Y1VH 4HTHA 2YU9H 4DAVA 5EJWA 4QUCA 3ERQA 1IW7C 4JYAQ 3K5OA 2RKSA 1TWGH 1FGBD 1JB7A 1TU2B 4C56C 1LT5D 3NP8A 3D6WA 5C0XG 2G5DA 4K6LA 2NTTA 2QDLA 3I55A 2NUNA 4CDCC 1RHPA 2E75C 2EYJA 3C1EA 4B3RL 3RZOB 2L15A 1PH3A 4OL7A 4FDBA 5EGTA 5HGTA 5L37A 2BE5C 2B8GA 3QR8A 1PZJD 3PUYA 2VUMG 4DK6C 5I2YA 3K7AB 2K14A 3S2DB 4FVMA 2OQ0A 4X2EA 3Q24A 3CMEA 4IQZA 1LTRD 1QZGA 1QZHA 5JPNC 3PIPA 3I56A 3U58A 2Q2HA 1B2TA 1H9SA 2K5VA 5FOBB 1HA6A 5IP7H 3T51B 2MP1A 4RMFA 3K5MA 2UUAL 4EX5A 4A93B 1ENFA 2YV5A 1CKNA 1TS4A 3I91A 4GOPC 3GP7A 4R4QA 1AE3A 5TSSA 3T56B 3SVMA 1NE3A 2I07B 4HR7B 4DV3Q 1IBLL 4ZUJA 5I9PA 3I72A 1HNZQ 3PF4A 2LXKA 1I4PA 4DNRB 3JAML 4HJ9A 1PLFA 4A3MB 5LMUQ 2WAQG 3D6CA 1S5CD 1S40A 1MJEA 2A69D 2KCNA 2UXCL 3TP7A 1PV4A 1X3PA 2K03A 2EYFA 4J1MA 4X64Q 3A5ZB 1VQKA 3HOWB 4LF9Q 2EYHA 2F0WA 1CZWA 4RCOA 3PIO3 1IKMA 2RVLA 2FINB 4NW2A 1Z7TA 1CQFA 1X56A 2EQSA 5A2QL 5FO8B 1SEBD 3D3RA 2Z1CA 4CKCA 1J9OA 1LTBD 5IGFA 2NVQH 1A63A 4K0KQ 2HUGA 3H09A 3PUXA 3TS0A 3PO3G 3SGIA 4U68A 2O5IC 1DD2A 4YWLA 1BVSA 1Q82C 3J81c 3N6RA 1PDQA 1JICA 3DMUA 1F9RA 1EEFD 1K28A 1WCMH 3U4ZA 1N34Q 2UXBQ 1BUVT 1UE5A 3CF5A 4BXXH 3MTSA 4LUVA 3M85A 4DR1Q 1JOQA 2PZWA 5E4WC 3OOCA 3SDZA 2JA6B 1CA6A 1FVIA 1RIPA 3UI2A 2R92G 1RJTA 3VA5A 4X65Q 1VQGA 3FRPB 5LL6S 3T16A 3PUVA 4YHHQ 1OXXK 4DUYL 5EBDA 2NVYH 2F0UA 2Z9HA 2KJXA 3BS1A 3AMUA 3H3VC 5I4DA 1BCPB 2DJGC 3K6OA 3NHHA 4GN3B 1I6VC 4YCUA 3A7AB 3P20A 3PGZA 4RA8A 3C2PA 3GV3A 1UWVA 4KK7A 3TSSA 3H94A 2CFMA 2NYZD 5C4HA 4GLVB 4JC0A 1HTLD 1I3QB 1B44D 1L2FA 1KRTA 5IGBA 1AEXA 1KHIA 2VB2X 3CUCA 4IFDH 4KKTA 1YHQA 4JPBW 2VQFQ 1Q12A 2K4KA 3J80L 1PFNA 2SDFA 1SFOB 5IWAQ 1VQHA 2DY8A 2KECA 2XGTA 1GOZA 3I4MB 3S16B 3HOXB 1LTGD 2F0KA 3BZKA 2EY6A 4UAIA 4CDEC 3LWEA 4RKLA 3HGBA 1ZKOA 2N78A 3U9SA 2AUKA 5C44G 1ZYRC 3CCLA 1HNXQ 2VB3X 3HOZH 2OF1A 1VQ4A 4GOPA 1HZAA 2E2IB 1X65A 3SE5A 5M3MG 4JI6Q 1CT1D 2LKVA 4OEMB 2NWGA 2Q2UA 2B2UC 4JV5Q 4DA2A 4IOAA 4ITRA 4A3JH 1U4RA 5AJ3Q 1AH9A 3LETA 2HCIA 3MWYW 5DAUA 5ELCA 1FJGQ 4PZ8A 5KGUA 4A3IH 1HR0Q 3K0XA 4NB3A 4DV7L 4DR3L 2PYKA 2QDBA 4GKJQ 5ELDA 3CPFA 3T1HL 2F3WA 5HY6A 4KHVA 2K5QA 3Q23A 4BBSB 4EGVA 2NB0A 3NE5B 5LL6X 4TRDA 1RCVD 2F0HA 5FLMH 1S4ZA 2EOTA 1VQ5A 2JA5G 5JEAH 1LTLA 4A3CH 1VQCA 4KV6A 3H6MA 5JAVA 2WP8J 2E2DC 1H9KA 1TKWB 4A3EH 4LAAA 4KN7C 4Y7NH 4DR4Q 3GTMH 4FF2A 1KDBA 4JOIC 4XT3B 3FEWX 4QIWE 2KHJA 1GVPA 1KLUD 2IX0A 2A6ED 3BDLA 1QNUA 4X6AH 4J15A 4IFDJ 4N67A 1SJHD 1U4MA 2IHFA 4R8NA 4PNYA 2F0JA 1EY4A 2JQOA 3E6ZX 4JI1L 5IP7G 3KLSX 4A3BB 1U0LA 4K14A 1I5FA 4C1NI 4PMBA 1Y1VB 2RDFA 1ZEQX 1SYBA 4DK1A 4LJZC 1V1PA 4BA1I 3W5OA 1AN8A 3OIQA 2UU9Q 4WRDA 2CWAA 3BYTB 4TVAB 3WWVA 2K5DA 5GROA 2E76C 3ER0A 4KD3A 1QB5D 1J5EQ 1GM5A 4X66Q 3RN5A 3VYUA 2FMMA 1E22A 2KQ3A 2F0SA 1IZ6A 1B8AA 1X6OA 3Q6SA 5IE8A 5JOBA 2DY7A 4A3KH 1XNQL 3I4OA 1SNCA 4DV0L 2NVXH 1G2SA 5CORA 1STBA 3CMAA 1K0SA 1EFWA 1B4OA 5IT9E 3BYYB 5D3IB 3RZOH 4IOCA 2R7DA 2H1EA 1I4HA 3J81j 3CCQA 1HH2P 2RA4A 3FKIG 5LMNW 2R6GA 2CQOA 3IFTA 3K7AH 2MGSA 3S2DH 1TQOA 4DAYB 1STAA 4WJ3M 1RDPD 2B2VC 4ODGA 5EBCA 1A15A 2WINB 1MKHA 1ESRA 2B8FA 2K5HA 1XNRL 1IYVA 1ET9A 2QA4A 4YCWA 1TWHB 1SYEA 4MHEA 1BNZA 4X62Q 5IYCH 1SNMA 2BCOA 4ULLA 2MJ8A 4WORA 1Y1WG 2B2UA 2N88A 3RMHA 1JC7A 4HIMA 4BXXG 4A93H 1LV9A 4H0LC 4IURA 2PQAA 4JBWA 1HPCA 4QQBX 4KJNA 2MHVA 2B3GA 1U4LA 4DV6Q 4JI0Q 2XVSA 1MJCA 3C1FA 3ERSX 4DR7L 4L5TA 1XPUA 4V190 5EPKA 1UE6A 5FLXE 5K36H 1STHA 3DEPA 3UDFA 1Q86C 1LO5D 5DM63 1F2ZA 3M9BA 1XMOL 4A3MH 4ZCKA 1NUCA 4A3DB 4X3SA 3L3OC 5GAEC 5G3LD 1T9HA 3KLWA 1F2MA 4LF6Q 3HOWH 3FP9A 3IL8A 3I90A 5J3BA 4A3GG 3LWUA 3HOVG 2PMZE 3NK9A 1Q3LA 2R3ZA 1CHQD 3R2IA 4V0BA 2RBMA 4R4TA 2EJMA 4G57A 3EA6A 3F2CA 1PVOA 4AQYQ 4IPCA 4JOIA 2HD3A 2AQ3B 3H0GB 1WCMB 5C5LA 4P75A 1VQ9A 3STBD 3GTOB 4AYBB 3DWPA 2OCEA 4DNIA 4LF4L 5JJ7A 1QWYA 1S5DD 4CJ1B 4KY7A 4CJ2C 3SEBA 1BF4A 2Q8IB 2NN6H 1EUJA 2EIFA 1QCBD 1CHPD 2UUBQ 1A3UA 5K5PA 1KDCA 3OMCA 4DR5L 2YYZA 3NPPA 3K5NA 4PQXA 1PA6A 1S5ED 2K05A 2C9OA 4K5XA 5D3DA 1C48A 3OWEB 1B50A 1D1IA 4MTNA 1QUQA 3V96A 2JA6H 3AFQA 4GNXC 3RN2A 2ZXOA 3PO2H 1ICFB 2DUDA 1K8MA 4JI8L 2ZJPA 2NBFA 1SSOA 3G6EA 5EKIA 4ZKCB 4TQUS 3N3UA 1CA5A 2F4VQ 2JYOA 2XWJB 1H95A 4A3IG 4IUUA 1IBML 3KBXA 1Q8KA 1IBKL 4APVA 3L0OA 3F2DA 2L9HA 1G6ZA 3CKIB 1RTNA 1GUGA 1OXSC 1YNND 5CYUA 2AHOB 1P8LA 2SOBA 5CMDA 3SHGA 2WB1G 1KL9A 4DV1L 2UUCQ 1XYIA 1VQIA 2BDNA 4DXFA 1A6XA 2B2WC 1I3QH 1JT8A 2CWPA 2ENBA 4IPGA 3TZUA 2B2VA 2EJGC 4JI3L 3HKZE 3EJIA 1SFOH 2B29A 1VMCA 4XXEA 2LY7A 3S16H 1HRJA 2IT1A 3HOXH 4LFAL 3R3OA 4K2LA 4C3IG 2JA8G 2NVTB 3D4WA 2AMCB 3LX0A 3BZDB 1DJRD 3BJUA 1IYUA 1VS0A 1EOVA 4L8JA 1E3PA 3SXHA 1BO0A 1XXGA 1EU3A 4LF8Q 1WOCA 2E2IH 2HCCA 3P1HA 1HCZA 4DPGA 2K75A 2K04A 2F1MA 4JI5L 3W2DA 5ELBA 3C46A 5I9OA 1MSHA 3CQZB 1LT4D 4A3FG 1YI2A 3I4LA 3J81i 5JJKA 5EAYA 2KCTA 1Z9FA 1TR5A 4DUZQ 2K5WA 1PH8A 1X3QA 1V1QA 5BR8L 4NP5A 3K59A 2X6LA 4BBSH 1JE4A 2H4OA 4YY3Q 4B3SQ 1JWUD 2GA4B 3A8JE 3NTIA 1NR4A 3EROA 4C3JG 2EYOA 1CSPA 4B08A 3HOYG 3IFDA 3MXNB 2R93B 1MGSA 4A3LH 1ZYRD 1EY0A 2K32A 1TWAB 4LF7L 2RQXA 1KNEA 5KNBA 1OO9B 4JBJA 2HHHQ 1PFMA 2E5LL 1KDAA 4BBRG 3E5SA 1KRSA 4H02A 4JI4Q 1E2WA 2PW7A 5LMNL 4LF6L 1H9JA 1JOOA 4I65A 1CQVA 2TSSA 1JR0D 3FMCA 2BH8A 2I5LX 4CDFC 3TP8A 2DNEA 1VF5C 5E7NA 1EQQA 3K7UC 4YIJA 5IYCG 3RUZA 4WJWA 4DU9A 3JAMc 4KKSA 2ZM6L 3GTPB 4TSSA 4A3BH 2OT2A 3NBIA 4GNXA 4LU4A 1C8CA 3DWQA 4BY7B 2EXZA 5M3FG 2E2HH 1WFQA 2Y0SB 3U4VA 3GTKB 2ATWA 3G7LA 1F2LA 1J6QA 3VYTA 4BS9A 2JEBI 5CV8A 4A3KB 3I3CA 2NVXB 1VQ6A 3K58A 3GV6A 3NXWA 5G3LF 2O2LD 1HZCA 5DNFA 3GTGH 1PFBA 4H7BA 1NY4A 3VR4A 4NXML 1V1OA 1I94Q 1CKNB 2B2WA 5M5XB 3HKZG 2IX3A 4XQNA 3S14B 3BDOA 3NTKA 1I4GA 5H1SE 1JJ2A 4E6IA 1K73C 3E9HA 2Z6BA 3HP3A 1RODA 1TT2A 3V2TA 2UXDQ 2RSNA 2LS01 4JI7Q 4BY1B 2I5MX 1UAPA 3CCVA 3H91A 5CBAE 1EY5A 2Z0SA 2KCCA 1N33Q 1G6PA 3WOFA 4FP5D 1HHVA 3J7AF 3KDFA 2E8GA 2N55A 1BCPC 1TWHH 1D6EC 3J7A5 5CMTA 2CQAA 3STBC 1TWCB 4OX9Q 2EVBA 5JVG3 2VXWA 1ESFA 1EU4A 2BDOA 5ELEA 3CRLC 3TREA 4DV4Q 1U5KA 1SE4A 1FGUA 2PPBC 3OTOQ 1RD9D 4NKLA 2CH4A 4OO1I 1VQ7A 1LM0A 4L6TB 5IGDA 5ISRA 2JEAI 1HTPA 2QKIC 5C3WA 2MUYA 4KLKA 4DNTB 1H9MA 5KRUA 3I4NB 1FR3A 1O7IA 4RGOS 3NQTA 2X69A 3TMEA 1STEA 2IX1A 1WTXA 3S15B 3SHLA 4XYOA 2N8NA 4A3DH 1BOSA 1W2BA 4R4IA 1YVCA 1Q1BA 3ND8A 4QF4A 4LF8L 2L12A 2AQ1B 3H3VI 4N8X1 5KYIA 1M8AA 2A74C 3J80c 3NWTA 1K8AC 4M1UB 1PTOB 5IIFA 1A8VA 1UE1A 3MAQA 2ICEC 2VUMB 3Q22A 3M4OH 1YHBA 1D5MC 3MFGA 2RF4A 1YNNC 4U0UA 1Q8IA 4IJLA 2I46A 3WOEA 2QEJC 3KBGA 1CFMA 3H0GH 4LMQD 2JA7G 3GTOH 2LFNA 3PQIA 2WKDA 3I4MG 4IZ8A 2EYLA 4TKOB 2VNUD 4IUVA 5IYDG 4K5WA 2L0CA 3PO2B 2E2JB 1JCKB 4HJ7A 4PMCA 5C4XB 3QWNA 3NWSA 1S3OA 3T1YL 1W3SA 4YWKA 2D62A 1BKBA 3S2HB 1AE2A 2HHHL 1SAPA 3K0YA 3AU7A 1PYBA 2KHIA 4QJFA 3CW2C 3TBIB 5KYLA 1M90C 1YNJD 4RGTA 4BWGB 1VQJA 1SMYC 1UUPA 2J0TD 4JI2L 4X2DA 3K81C 2WAQB 1PYSB 4NXNL 2M2LA 4HCSA 1XJVA 4G4KA 3BG3A 2B2TC 2QCPX 4G7HC 4F8MA 4LK1C 3PCOB 1PHJA 2CCZA 3S1QB 1ZXTA 5FJ8H 3UDGA 4GOPB 2K6AA 4RG1A 1AZPA 1WJJA 1N36Q 4JYAL 1A0IA 2IJ0A 2WV6D 4HSVA 1ML0D 3PO3B 2R7ZH 3S1MB 1BBXC 3NBHA 4CGYB 4QUFA 3QOLA 3S9WA 1K83B 4H44C 3HOUG 1B7YB 1MD2D 1SNDA 3WDNA 3PIP3 5C4JB 3NENA 1S5BD 4HN7A 4ZLTF 3IRBA 2DGYA 1YZ6A 2NVTH 4C2MB 3BVGA 3DM3A 4HIKA 1NSNS 1O80A 3TP6A 3SK6A 4KHPQ 1B53A 2NUDA 3EBEA 1TY0A 1NJIC 1JWSD 3R2TA 2R92B 1YJWA 4A3BG 3LGJA 2A6HD 1Y1VG 4XDXA 5EKKA 2A68C 4K8IA 3RR5A 4OELB 3QO2A 2KEDA 1NMFA 3CCMA 1HFNA 3CQZH 1Q46A 1A2UA 1PZID 2K1BA 4DK0A 4U04A 4FF4A 1Q7YC 4BA2I 1B70B 1A2TA 4WFN3 3MC0B 4AH6A 1YNXA 4FO2A 1KC8C 1D1KA 3V05A 1HJPA 1EY8A 3F8TA 1D5ZC 4KMUC 5KEEA 4DV3L 3U9OA 1HNZL 1Y69U 1PH5A 1VQBA 5LMUL 2A8VA 2FJ2A 2AWOA 3R8BA 3F2BA 1V1PB 2R93H 3A74A 4X64L 4K2KA 4LF9L 1LUZA 1T5EA 1N8RC 2PI2A 4RH6A 1MSGA 1TWAH 4HMIA 3M7GA 4U0ZA 3AYHB 1N32Q 4LFCQ 2YTXA 2EZVA 5GQOA 4K0KL 3OYYA 5CR3A 3DHQA 3G71A 4DGZA 1G51A 2SNMA 4L5SA 4CJ0B 4RHRA 1I4XA 2RSOA 3K80C 3SE0A 4NPSA 1L1OC 2E2HB 3CC4A 1J8IA 1R4PB 2KOLA 4B9XA 1GUNA 3TZDA 5M3MB 2VQEQ 2OWOA 5IP9H 1X9NA 3GTPH 5E4XA 3SN9A 3VDYA 4KTAA 3MVVA 5CKLA 3IAYA 2JA9A 4PZ7A 4EQOA 1PRTC 4BY7H 4DR6Q 1N34L 3CD6A 2UXBL 1VCIA 1QG7A 4ZUIA 3GTKH 3L2PA 5IYBH 3D4RA 1S5FD 2F0EA 2Q2IA 3DXJC 3OPOA 2B2TA 3GTGB 4N8FA 4DR1L 3VR3A 4GKKQ 3GTLB 1CZGA 3Q8DA 2AKWB 4X65L 4U673 4YHHL 1GD7A 4B3MQ 1X3GA 1PXUA 2B63B 4Q5VA 4F88A 3E0EA 5FKAC 2Z6KC 3E9IA 4C3HB 1X54A 1HZ9A 2JA5B 3H15A 1XTDA 1D8LA 5M5XH 2XTIA 2ASBA 1JJGA 2WB1E 2EE1A 3S14H 1BR9A 2FFKB 3PSIA 4IJHA 4DV2Q 1YIJA 1YEZA 1EIHA 2K33A 4FNFA 4X2CA 5JEAJ 1NBWA 3FPUB 4BY1H 1V43A 4HIDA 1WCMG 5EPJA 1HNWQ 4AYBG 5IGEA 1WTRA 1QVGA 3X3MA 1PH7A 3DUZA 3BVZA 1JOKA 1PFSA 2MNAA 1E2ZA 3R93A 3KUPA 1EWIA 3MXUA 2VQFL 1AZQA 5ELOA 1W6JA 1TWCH 3CXCA 1R9TB 1I4QA 5IWAL 4OIKA 2XN9C 3NUCA 2EDGA 1VQ8A 3SK4A 1FD7D 4YCVA 4DKAC 1RL2A 3HS0C 3ITPA 4CBVA 5HGQA 3S6AA 4P72A 3GTJH 3AFPA 3ULLA 1LT6D 2JXMB 4RAUC 3I4NH 1HNXL 3HEJA 1YBYA 1H9RA 2QEXA 4QY7A 3CU7A 4JI6L 5E3FA 2A5HA 4DAYA 1EL0A 5BN4A 1DOMA 2F0TA 4JV5L 1G91A 1Q81C 3AQQA 3S15H 1YNJC 2BH2A 5AJ3L 4B3TQ 5C0XH 1B9MA 2PNRC 3M4OB 1GHKA 3K8AA 1BDOA 1FJGL 4R8IA 4RWSC 3JAMi 1HR0L 4O0AA 4OONA 1L0WA 3ZLMA 2RDHA 3S1NB 4GKJL 1ET6A 5FJ8G 4UP8A 1BCPD 1PTOH 4IFDG 4Z9CB 1QUQB 2K28A 2EYPA 3FKIB 2F6SA 2VUMH 1FL0A 1C4QA 3IKJA 3HKSA 1IHZA 5E1FA 3BVMA 3G4SA 4G7OC 3ZJYC 1ONLA 5D14A 4JCVE 1W6KA 1KABA 1YJNA 2KHSA 2SEBD 1K8GA 1AFPA 1SE3A 1XMQQ 4DR2Q 1MHWC 2DNCA 1WTPA 1CM9A 2ZTCA 1L1OA 3RLOA 3OW7A 3HOZG 3CHBD 3I2ZA 1TS5A 3DWAA 3OW2A 1Y1WB 4DR4L 2E2JH 1LLRD 1KTKA 5C4XH 4LNQA 4I7AA 2HT1A 1I6HB 1SBBB 5GAGC 4A3JG 3TDQA 3EQLC 5CC4A 4O2DA 3S2HH 4ZYSA 2PQEA 4B9WA 2QW7A 1X32A 3W1BA 2IHEA 4B3RQ 4KKUA 4MNOA 1Z47A 4HCEA 2XRSD 4LFBQ 1VQFA 1HZBA 1GUOA 2C35B 3HG9A 2MFIA 2AUJD 3NSWA 5JFZA 1Z6HA 2A6HC 1BQQT 3CPWA 3L7ZC 5FLMG 4R4CA 3G6JB 2UU9L 2ZT9C 1O7LA 2Z6KA 3TN2A 1SNQA 2QILA 3S1QH 1EQRA 1QVFA 2R7ZB 5JEAG 4U0SA 4GN4B 4A3GB 1BXTA 1J5EL 3M3YB 4X66L 2F0NA 1QJOA 3I70A 1CSQA 4LUZA 4A3CG 3M4YA 2CH4W 5JJIA 3QIAA 2H5XA 1TS2A 4QIWB 4FF1A 3MA2B 4A3EG 5IOCA 2RCNA 3G48A 2R93G 3J80E 2UUAQ 3PO3H 3CC7A 3S1MH 1ICWA 1KD1C 1K83H 3F2UA 2Q2TA 3KF8A 1E1OA 3UE1A 4QL5A 5C4JH 3PV0A 3J81E 1QOHA 1IBLQ 1WD1A 1SMYD 2XRQD 4C2MH 3OMGA 4RGNA 4ID6A 3J80i 3KJOA 2F52A 1C7YA 2XIWA 2UXCQ 3GDEA 1GUWA 3BZCA 4DF7A 2MQHA 4FXKC 3CCUA 4L5QA 5C0XI 4KI0A 1NCVA 4CKBA 2R92H 4X62L 4EQPA 4DFAA 3OHXC 1F9PA 1M1KC 1HNWL 2Y0SG 4M8AA 3N52A 3NTHA 3ULPA 4KY6A 2A1AA 1DZ1A 2DN8A 4OO1H 1EIGA 3MHBA 4A3KG 3B6YA 4RFBA 1SYGA 4J6HA 1CUKA 3KYHC 1JQYD 1S72A 3W3AA 3ZYYX 4DV6L 4JI0L 3PIOA 2OTJA 4GN5A 1GUSA 1XWEA 1OXTA 5EU0A 3QOJA 4GNXB 2JSOA 3VR5A 3KF6A 1FNWA 4O1NA 2MPMA 4KY5A 1E2VA 4JVZA 1EQTA 1RTOA 3J7AV 4RCNA 4IUPA 3H3VH 3KLRA 4GS3A 1K8OA 1D7QA 1VF7A 3OWFA 1A62A 1SMXA 1YITA 5IY0A 3PMFA 4OWXB 4BY1G 2OQKA 5C4ZA 1SE8A 4C3IB 4DUYQ 3EVQA 1Y8NB 2JA8B 1HUMA 4ME5A 2A68D 2XNAC 1QILA 2R61A 4AQYL 2I5HA 1DGSA 2F0VA 2D5DA 4LF5Q 1SXTA 4A93G 2IL8A 4RKBA 3DM1A 3ZCBA 1R4QB 5M3MH 3S1RB 2TMPA 1WI5A 5JJLA 1SJED 3ULJA 3BU2A 4U07A 3MXNA 2UUBL 5K36G 4I7ZC 4A3FB 2J4XA 4A3MG 1B9NA 2PI2E 3FHWA 3A0JA 4DV5Q 2QF7A 1VQLA 4OIJA 5DLQE 1H9SB 1STNA 3EN2A 3SR1A 4POGA 3CCSA 3HOWG 4R4OA 3GTLH 2PMZB 3KDFB 1F9SA 1GXDC 3PUZA 3VR2A 1WTVA 5IODA 4H13C 3UDXA 3RZDB 1B1ZA 1DOKA 1ENCA 1ENAA 2F03A 5BN3A 1XPOA 5CGLA 3VA7A 1Y8OB 5IT9L 2B63H 5KIXA 4C3JB 4C3HH 1JMCA 5FO7B 2F4VL 1EY6A 2JP1A 3HOYB 3OSOA 5I6YA 1FYCA 1BCPF 2JA5H 2AQ2B 2D9UA 4IALA 4R1JA 5FO9B 1YJ9A 2JN4A 4ZQ3A 4LFBL 1DOLA 3S17H 4KN4C 2ICIA 4UHVA 4OWWB 1UNSA 4BBRB 1SE2A 2KVMA 3GQBA 1KQSA 1Q1EA 3A7LA 4K6DA 4MTKA 4X3UA 5C3EB 3URYA 2NN6G 2EY5A 1PRTD 3K57A 2UUCL 1G291 2N3SA 2GVAA 2MO1A 3I73A 5EKLA 5GAHC 4DV7Q 4DR3Q 2I0QA 4GZYC 3T1HQ 3GTJB 3P75A 4JBMA 2L55A 1R9TH 2JA6G 5D65A 4NMZA 4KD4A 4IPDA 3RLFA 3PO2G 5T1GA 5C4XG 4XTCS 5M3FB 4PY3A 1C0AA 2F0OA 2LXJA 4LW1A 1DCZA 2PZUA 2EY2A 4K8JA 4GLXA 4UY8C 1PYWD 1KXLA 3PUWA 1D5XC 5FLXL 1EYCA 2DJFC 5IGCA 3EFXD 4JG2A 5HURA 1PH4A 3W1GA 1CK1A 1EQVA 1F77A 2NZ1D 1NTGA 1LYLA 3A8KE 4P74A 5KNDA 3D31A 1SDFA 5COYA 1MI2A 2VZAA 2GVBA 2LMCB 1K9MC 4KJOA 1SN8A 1XPRA 3A8IE 5CV7A 2L11A 3A56A 4OGQC 1TWFB 3HKZB 1HXYD 4DUZL 4XI8A 3S1NH 1EYDA 1JJCB 1EWCA 1Y8PB 1IL8A 2EXDA 3MXGA 5JJ6A 1OXUA 1EYAA 3QG1A 3FKIH 4JI1Q 4CDDC 2VS1A 2OTLA 3P7JA 4YY3L 1B3QA 2FMCA 2F0LA 3HOXG 2MO0A 2C5CA 4B3SL 5C3XA 4FYDA 2RDGA 4EVOA 3K5LA 3KK7A 1ILQA 1EZ8A 1L0YB 4CKEA 3LNNA 3CC2A 4DK3C 4Y52H 1O78A 3MXPA 2Q8RE 4M16A 1IL2A 1Y1WH 4JI4L 2EPBA 1I6HH 5IGGA 2PZTA 2X6GA 5M9OA 1XNQQ 1K0RA 1C9OA 4UPAA 1X3EA 2KA7A 4DV0Q 3KJPA 2Z4HA 2XWBB 2KBNA 3NBHB 3TEHB 3T13A 2HDLA 4L5RC 4FXDA 1E24A 1HR0W 1WTOA 3UE0A 4BBSG 1EYGA 3DLLA 2ZTDA 4LF5L 2QGQA 4OO1G 5M5YB 1MBYA 4HMJA 1GKHA 4XQQA 1XNRQ 5I2XA 3GTQB 2RHSB 5EPLA 4PMWA 3HRZC 4A3GH 4A3LG 3M3YH 3MEHA 1U4PA 3HOVH 1GUTA 3NQIA 4A4IA 1EWHA 4KHZA 4DV5L 2IWHA 4OXPA 2JA7B 2KEEA 1O7YA 4JK1C 1WVLA 3HZXA 1K3RA 4HJ8A 2F0DA 1IXRA 1HA5A 1LTTD 1I94L 2EYMA 2HQLA 2B2YC 2F0MA 4AYBE 4DR7Q 3I8ZA 4QB4A 3U50C 4EQ5A 2O4XA 1HUNA 3NEMA 3J81L 2IPKD 2UXDL 4WJ4A 4JI7L 1XMOQ 1WD0A 4X3TA 4IN3A 1P16A 2NTSA 4FXGC 1N33L 5KNCA 2V4DA 2SNSA 2K5NA 4IO9A 1PH9A 3RNUA 4O42A 1B3AA 4OX9L 1HFGA 4C1NK 5T1IA 2CW0C 2Q8TA 1XTCD 2WKCA 1HQRD 4MN3A 4XYQA 1STGA 4P71A 5EQ0A 2YTVA 2F0QA 5GADC 5J1ZA
chains in the Genus database with same CATH topology
2JJQA 4JI6L 2UXCL 2NZOA 1PV4A 4DV4L 1PH8A 1V1QA 3OTOL 4X64Q 3A5ZB 1VQKA 5BR8L 4JV5L 4LF9Q 1Q81C 3AQQA 4LUOA 4BBSH 3S15H 2BH2A 4P73A 4YY3Q 5AJ3L 4B3TQ 1X56A 2EQSA 3K8AA 4LF4Q 3I7FA 2VW9A 1FJGL 4B3SQ 3HFZB 3JAMi 1HR0L 4O0AA 4OONA 4PZ6A 1L0WA 3ZLMA 1CSPA 4GKJL 3KFUA 3HOYG 5FJ8G 2NVQH 4UP8A 3MXNB 2B63G 4IFDG 4K0KQ 1A63A 1QUQB 3PUXA 3TS0A 4A3LH 2F6SA 2VUMH 4DR5Q 3PO3G 4LF7L 1FL0A 3SGIA 1MIUA 4QGUA 4YWLA 1PH6A 4JBJA 3HKSA 1BVSA 2HHHQ 2E5LL 4BBRG 1Q82C 3J81c 3G4SA 1I50H 1KRSA 4H02A 4JI4Q 3ZJYC 2BA1A 5LMNL 4LF6L 4JCVE 2ZJRA 1BBWA 1YJNA 1K8GA 1WCMH 1PH2A 1XMQQ 3U4ZA 2BH8A 2I5LX 2R7FA 4JI8Q 4DR2Q 4C3IH 1N34Q 2UXBQ 2JA8H 4POFA 2ZTCA 1L1OA 2KENA 1UE5A 5E7NA 3RLOA 3HOZG 1EQQA 3I2ZA 2G03A 3CF5A 3K7UC 5IYCG 4BXXH 2VY3A 4LUVA 3OW2A 2BA0A 4DR4L 3JAMc 3M85A 2ZM6L 2E2JH 4DR1Q 5C4XH 4LNQA 2HT1A 4A3BH 4GNXA 1IBMQ 1SLJA 5GAGC 1IBKQ 1FVIA 2AWNA 4A3JG 1RIPA 4LU4A 2R92G 4X65Q 1VQGA 4YHHQ 3PUVA 4O2DA 1OXXK 5M3FG 4DUYL 3S1RH 1WFQA 3U4VA 2E2HH 3TRZA 2NVYH 2ATWA 3NELA 1CKMA 3W1BA 2IHEA 1J6QA 4B3RQ 4MNOA 2JEBI 1Z47A 1E7ZA 4LFBQ 1VQFA 4DV1Q 4A3FH 1HZBA 4GN3B 2C35B 2WFWA 1VQ6A 2IY5B 2MFIA 5JFZA 2A19A 4YCUA 2CKZB 3CPWA 4HJ5A 4A3DG 3PGZA 4IFDI 3L7ZC 5FLMG 4R4CA 4UP9A 4JI3Q 4DUZQ 2UU9L 1HZCA 2Z6KA 1UWVA 1CKOA 3GTGH 1VQDA 3RZDH 1NY4A 3M7NA 3S1QH 1EQRA 2CFMA 4NXML 2PQAB 5JEAG 4U0SA 4GN4B 1PH1A 1I94Q 3RLNA 1J5EL 4LFAQ 1VQOA 4X66L 1CKNB 4A3CG 4GLVB 1CSQA 4LUZA 3HKZG 4JC0A 2VL6A 1KRTA 1L2FA 2F3IA 1KHIA 4C3JH 5JJIA 2ES2A 2H5XA 3HOYH 3CUCA 3UDIA 5H1SE 1JJ2A 1YHQA 4A3EG 2VQFQ 1K73C 3E9HA 1Q12A 2K4KA 2RCNA 2YTYA 3G48A 2R93G 2UXDQ 2UUAQ 3H0GG 4A75A 1EIYB 3CC7A 4JI7Q 3S1MH 3PO3H 3M4QA 5IWAQ 1VQHA 2I5MX 2XGTA 3CCVA 1KD1C 1K83H 2Q2TA 3J7ZC 4BBRH 2Z0SA 1E1OA 3UE1A 3BZKA 1N33Q 4QL5A 2HIXA 3PV0A 4ME3A 5C4JH 1G6PA 4ALPA 5C3EH 4JI5Q 1VQEA 3KDFA 2E8GA 1N36L 1TWHH 3S24A 2N78A 1IBLQ 3J7A5 5CMTA 3STBC 5C44G 4OX9Q 3CCLA 4C2MH 1HNXQ 3J80i 3KJOA 2F52A 1C7YA 3HOZH 1VQ4A 4GOPA 1HZAA 2UXCQ 1X65A 3SE5A 3GDEA 3TREA 3BZCA 1U5KA 5M3MG 4DV4Q 4JI6Q 1FGUA 2MQHA 3OTOQ 3CCUA 2Q2UA 4L5QA 5BR8Q 4JV5Q 1SROA 5C0XI 4OO1I 4IOAA 4KI0A 4JBKA 4ITRA 4A3JH 1VQ7A 1LM0A 2R92H 2JEAI 2ALYB 4X62L 5AJ3Q 5M3FH 1AH9A 3LETA 4KLKA 1M1KC 1V9PA 1FJGQ 1O7IA 1HNWL 4PZ8A 1GO3E 2Y0SG 4A3IH 1HR0Q 3K0XA 4NB3A 4DV7L 4DR3L 4GKJQ 3CPFA 3T1HL 2Y0SE 5HY6A 3ULPA 4KHPL 2A1AA 2IX1A 3ICEA 4A3KG 3B6YA 4LF7Q 2N8NA 4A3DH 1W2BA 4R4IA 1CUKA 1YVCA 1Q1BA 3KYHC 1L1OB 4LF8L 5FLMH 3M4PA 1S72A 4DV6L 3H3VI 4JI0L 2E5LQ 3J80c 3PIOA 3GO5A 5LMNQ 2OTJA 1K8AC 1TXYA 4GN5A 1VQ5A 4YWMA 4A76A 2JA5G 4HIOA 1A8VA 5EU0A 1OXTA 1LTLA 1UE1A 4GNXB 4A3CH 1TWFH 1VQCA 1VQAA 1YHBA 3KF6A 3CCRA 2R7ZG 3M4OH 2RF4A 4U0UA 4IJLA 2WP8J 4A3EH 3S2HH 3H3VH 4GS3A 4Y7NH 4DR4Q 2ZM6Q 3GTMH 3H0GH 4JOIC 2JA7G 1D7QA 3GTOH 1ASZA 1A62A 1SMXA 4QIWE 2LSSA 2KHJA 4MZ9A 1YITA 1GVPA 4OWXB 1YHAA 4BY1G 2OQKA 2IX0A 5IY0A 1SE8A 4DUYQ 3I4MG 4X6AH 1KAWA 4J15A 1EIFA 4IFDJ 1SR3A 2VNUD 4N67A 3F1ZA 2IHFA 5IYDG 2PNHA 4AQYL 2I5HA 1VQNA 1DGSA 2JQOA 4JI1L 4HJ7A 5IP7G 1S3OA 1U0LA 3T1YL 4LF5Q 4A93G 1I5FA 1N32L 1W3SA 4YWKA 4LFCL 3ZCBA 2D62A 1Y14B 1BKBA 5M3MH 1AE2A 1QVFA 4BA1I 1WI5A 2HHHL 3W5OA 2UU9Q 3ULJA 5JJLA 3BU2A 2CWAA 4U07A 4TVAB 2GN5A 1PYBA 2KHIA 4QJFA 3WWVA 2UUBL 3CW2C 5GROA 2FXQA 3ER0A 1M90C 4NXMQ 5K36G 1VQJA 4JI2L 4A3MG 4X2DA 5JFFA 1J5EQ 3K81C 4X66Q 1GM5A 2PI2E 3FHWA 1ASYA 3A0JA 1WYDA 4DV5Q 3RN5A 1PYSB 3KF8B 1VQLA 4NXNL 5DLQE 1VQPA 1E22A 3EN2A 1XJVA 2JK8A 4POGA 2VQEL 1IZ6A 3CCSA 3HOWG 1B8AA 1UE7A 1X6OA 4R4OA 3GTLH 3KDFB 1SRUA 5IE8A 3AEVA 3PUZA 4A3KH 1XNQL 3UDXA 3I4OA 4DV0L 2NVXH 3PCOB 1PHJA 2CCZA 4DR6L 1UEBA 1XPOA 5CGLA 5M5YH 4LWCA 2HIVA 3CMAA 1EFWA 5FJ8H 3UDGA 5ELNA 4GOPB 2B63H 3CAMA 3RZOH 4IOCA 4IPHA 4C3HH 3JC66 1JMCA 2F4VL 2R7DA 4RG1A 4WGJA 1N9WA 3GTQH 1WJJA 1N36Q 4JYAL 2JA5H 1A0IA 3J81j 3CCQA 4GKKL 1HH2P 3A5UA 3FKIG 5C0XJ 2D0OA 4R1JA 1YJ9A 5LMNW 3MEFA 2R7ZH 2R6GA 2CQOA 4LFBL 3CCJA 2KCMA 3S17H 3K7AH 3S2DH 3ZC7A 4DAYB 4OWWB 1B7YB 4B3ML 3HOUG 4WJ3M 3NENA 2JA7H 1MKHA 1XNRL 1E1TA 2K5HA 1Q1EA 1KIXA 1KQSA 2QA4A 4YCWA 3IRBA 2NN6G 2UUCL 4X62Q 1G291 2DGYA 2N3SA 2RHQB 1YZ6A 3I4MH 2NVTH 2GVAA 2MO1A 3CP0A 4GLAC 5IYCH 4XIGS 3DM3A 4DV2L 4HIKA 5GAHC 5IYDH 4DV7Q 4DR3Q 2I0QA 3GD7A 1Y1WG 3T1HQ 4JBMA 4KHPQ 4HIMA 1R9TH 5IP9G 1JE5A 2JA6G 4BXXG 4A93H 3EBEA 4IPDA 3RLFA 1NJIC 3PO2G 4BY7H 1YJWA 5C4XG 2PQAA 4XTCS 4JBWA 4A3BG 4QQBX 3LGJA 4BY7G 3KF6B 4PY3A 1BBUA 1C0AA 2K50A 2LXJA 1Y1VG 2B3GA 4DV6Q 4LW1A 4JI0Q 1MJCA 3ERSX 3RR5A 4DR7L 4L5TA 5IYBG 1KXLA 4OWTB 4GLXA 1X3FA 4UY8C 1XPUA 3PUWA 2V1CC 1NMFA 1UE6A 3CCMA 3UDFA 3CQZH 2JE6I 1Q46A 4JG2A 1Q86C 2NZHA 3M9BA 1XMOL 3W1GA 4A3MH 5IT9c 1PH4A 4U04A 1X55A 3CCEA 1Q7YC 2ID0A 4BA2I 1B70B 1NTGA 1LYLA 4P74A 5GAEC 1T9HA 3D31A 4AH6A 3KLWA 1YNXA 4LF6Q 3HOWH 1KC8C 2WAQE 1HJPA 2VZAA 3FP9A 2GVBA 3F8TA 5M5WH 4DV3L 1K9MC 4UP7A 2N49A 3KOJA 1HNZL 1SN8A 1XPRA 5J3BA 2ZTEA 4PG3A 4A3GG 1PH5A 1VQBA 5LMUL 2A8VA 3HOVG 2PMZE 1OXVA 2D0PA 2AWOA 4DUZL 4XI8A 3F2BA 3S1NH 4QY7A 1JJCB 1OTCA 2NN6I 4R4TA 2R93H 3A74A 3F2CA 1PVOA 4X64L 2EXDA 4AQYQ 5JJ6A 1NMGA 1OXUA 2ZJQA 4LF9L 4IPCA 1LUZA 3FKIH 1N8RC 1IYJB 2PI2A 4JOIA 4JI1Q 1TWAH 2VS1A 4P75A 1VQ9A 3STBD 3T1YQ 3D0FA 2OTLA 4YY3L 4U0ZA 3AYHB 4B3TL 4LFCQ 1N32Q 2YTXA 2OCEA 4DNIA 3TS2A 4LF4L 3HOXG 5GQOA 3EIVA 3HOUH 2MO0A 4B3SL 5JJ7A 4DR6Q 5C44H 4K0KL 3OYYA 1EUJA 2EIFA 3G71A 3TQYA 1VQMA 1G51A 2UUBQ 5C3EG 4L5SA 2UXBL 4DR5L 3PF5A 3CC2A 3K80C 2YYZA 4JI2Q 4DK3C 4NPSA 1L1OC 4Y52H 1PA6A 3CC4A 4DAMA 4NXNQ 5FLXc 4M16A 1IL2A 1Y1WH 4JI4L 2VQEQ 1QVCA 4MTNA 5IP9H 1QUQA 1X9NA 2OWOA 2JA6H 3GTPH 3AFQA 1I6HH 4AIMA 3SN9A 4GNXC 3RN2A 3VDYA 3PO2H 1XNQQ 5CKLA 2JA9A 1K0RA 1C9OA 2K52A 1X3EA 2DUDA 4PZ7A 4UPAA 4DV0Q 4DR2L 4JI8L 3KJPA 2ZJPA 1XMQL 1N34L 1VCIA 3CD6A 4HJAA 3NBHB 2KBNA 1Y1VH 3TEHB 3L2PA 3GTKH 3I4NG 2YU9H 3G6EA 4L5RC 5IYBH 4TQUS 3N3UA 2Q2IA 1E24A 2F4VQ 1HR0W 1H95A 4A3IG 4JYAQ 4DR1L 4GKKQ 1TWGH 1IBML 3UE0A 1Q8KA 1IBKL 1JB7A 4APVA 1EYGA 3L0OA 3Q8DA 3DLLA 3F2DA 4BBSG 2AKWB 2ZTDA 4X65L 4LF5L 2QGQA 4YHHL 5C0XG 4OO1G 1OXSC 1GD7A 3I55A 4B3MQ 1X3GA 1GKHA 2AHOB 1P8LA 4B3RL 3E0EA 2Z6KC 3E9IA 2L15A 1PH3A 1X54A 1XNRQ 3SHGA 4FDBA 2RHSB 4PMWA 1HZ9A 4A3GH 2WB1G 1KL9A 4DV1L 4A3LG 3H15A 2UUCQ 3M3YH 3HOVH 1VQIA 1XTDA 1D8LA 3PUYA 2VUMG 4DK6C 2XTIA 5M5XH 2ASBA 1I3QH 1JJGA 2WB1E 1JT8A 2CWPA 3S14H 2K14A 4A4IA 3PSIA 4IJHA 4DV2Q 4KHZA 4IPGA 4DV5L 2OQ0A 1YIJA 1YEZA 4OXPA 4JI3L 4X2EA 3CMEA 4X2CA 5JEAJ 3HKZE 1NBWA 1SFOH 2B29A 4BY1H 1QZGA 1V43A 3S16H 1K3RA 4HJ8A 4HIDA 1QZHA 1IXRA 2IT1A 1WCMG 1I94L 3HOXH 4LFAL 1HNWQ 4AYBG 3PIPA 2JA8G 3I56A 1QVGA 3U58A 2HQLA 2Q2HA 1PH7A 4AYBE 1PFSA 2AMCB 2K5VA 4DR7Q 2MNAA 3BJUA 1VS0A 3U50C 1EWIA 1EOVA 4EQ5A 5IP7H 2VQFL 3NEMA 5ELOA 4WJ4A 1TWCH 4RMFA 1E3PA 2UXDL 2UUAL 4EX5A 3CXCA 4JI7L 1XMOQ 5IWAL 2YV5A 1CKNA 4LF8Q 1WOCA 1P16A 4GOPC 2E2IH 1VQ8A 4DKAC 4YCVA 4R4QA 1N33L 4DPGA 1RL2A 1AE3A 2K75A 1NE3A 5HGQA 3S6AA 4JI5L 4P72A 2K5NA 3GTJH 4IO9A 1PH9A 3RNUA 3AFPA 3ULLA 4DV3Q 1IBLL 3PF4A 1HNZQ 4OX9L 2LXKA 4HJ9A 4A3FG 1YI2A 3I4NH 1HNXL 5LMUQ 3J81i 1YBYA 5JJKA 2WAQG 1S40A 4P71A 5GADC 1MJEA 2QEXA 2YTVA 5EAYA 2KCTA 1Z9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJQ A;  4JI6 L;  2UXC L;  2NZO A;  1PV4 A;  4DV4 L;  1PH8 A;  1V1Q A;  3OTO L;  4X64 Q;  3A5Z B;  1VQK A;  5BR8 L;  4JV5 L;  4LF9 Q;  1Q81 C;  3AQQ A;  4LUO A;  4BBS H;  3S15 H;  2BH2 A;  4P73 A;  4YY3 Q;  5AJ3 L;  4B3T Q;  1X56 A;  2EQS A;  3K8A A;  4LF4 Q;  3I7F A;  2VW9 A;  1FJG L;  4B3S Q;  3HFZ B;  3JAM i;  1HR0 L;  4O0A A;  4OON A;  4PZ6 A;  1L0W A;  3ZLM A;  1CSP A;  4GKJ L;  3KFU A;  3HOY G;  5FJ8 G;  2NVQ H;  4UP8 A;  3MXN B;  2B63 G;  4IFD G;  4K0K Q;  1A63 A;  1QUQ B;  3PUX A;  3TS0 A;  4A3L H;  2F6S A;  2VUM H;  4DR5 Q;  3PO3 G;  4LF7 L;  1FL0 A;  3SGI A;  1MIU A;  4QGU A;  4YWL A;  1PH6 A;  4JBJ A;  3HKS A;  1BVS A;  2HHH Q;  2E5L L;  4BBR G;  1Q82 C;  3J81 c;  3G4S A;  1I50 H;  1KRS A;  4H02 A;  4JI4 Q;  3ZJY C;  2BA1 A;  5LMN L;  4LF6 L;  4JCV E;  2ZJR A;  1BBW A;  1YJN A;  1K8G A;  1WCM H;  1PH2 A;  1XMQ Q;  3U4Z A;  2BH8 A;  2I5L X;  2R7F A;  4JI8 Q;  4DR2 Q;  4C3I H;  1N34 Q;  2UXB Q;  2JA8 H;  4POF A;  2ZTC A;  1L1O A;  2KEN A;  1UE5 A;  5E7N A;  3RLO A;  3HOZ G;  1EQQ A;  3I2Z A;  2G03 A;  3CF5 A;  3K7U C;  5IYC G;  4BXX H;  2VY3 A;  4LUV A;  3OW2 A;  2BA0 A;  4DR4 L;  3JAM c;  3M85 A;  2ZM6 L;  2E2J H;  4DR1 Q;  5C4X H;  4LNQ A;  2HT1 A;  4A3B H;  4GNX A;  1IBM Q;  1SLJ A;  5GAG C;  1IBK Q;  1FVI A;  2AWN A;  4A3J G;  1RIP A;  4LU4 A;  2R92 G;  4X65 Q;  1VQG A;  4YHH Q;  3PUV A;  4O2D A;  1OXX K;  5M3F G;  4DUY L;  3S1R H;  1WFQ A;  3U4V A;  2E2H H;  3TRZ A;  2NVY H;  2ATW A;  3NEL A;  1CKM A;  3W1B A;  2IHE A;  1J6Q A;  4B3R Q;  4MNO A;  2JEB I;  1Z47 A;  1E7Z A;  4LFB Q;  1VQF A;  4DV1 Q;  4A3F H;  1HZB A;  4GN3 B;  2C35 B;  2WFW A;  1VQ6 A;  2IY5 B;  2MFI A;  5JFZ A;  2A19 A;  4YCU A;  2CKZ B;  3CPW A;  4HJ5 A;  4A3D G;  3PGZ A;  4IFD I;  3L7Z C;  5FLM G;  4R4C A;  4UP9 A;  4JI3 Q;  4DUZ Q;  2UU9 L;  1HZC A;  2Z6K A;  1UWV A;  1CKO A;  3GTG H;  1VQD A;  3RZD H;  1NY4 A;  3M7N A;  3S1Q H;  1EQR A;  2CFM A;  4NXM L;  2PQA B;  5JEA G;  4U0S A;  4GN4 B;  1PH1 A;  1I94 Q;  3RLN A;  1J5E L;  4LFA Q;  1VQO A;  4X66 L;  1CKN B;  4A3C G;  4GLV B;  1CSQ A;  4LUZ A;  3HKZ G;  4JC0 A;  2VL6 A;  1KRT A;  1L2F A;  2F3I A;  1KHI A;  4C3J H;  5JJI A;  2ES2 A;  2H5X A;  3HOY H;  3CUC A;  3UDI A;  5H1S E;  1JJ2 A;  1YHQ A;  4A3E G;  2VQF Q;  1K73 C;  3E9H A;  1Q12 A;  2K4K A;  2RCN A;  2YTY A;  3G48 A;  2R93 G;  2UXD Q;  2UUA Q;  3H0G G;  4A75 A;  1EIY B;  3CC7 A;  4JI7 Q;  3S1M H;  3PO3 H;  3M4Q A;  5IWA Q;  1VQH A;  2I5M X;  2XGT A;  3CCV A;  1KD1 C;  1K83 H;  2Q2T A;  3J7Z C;  4BBR H;  2Z0S A;  1E1O A;  3UE1 A;  3BZK A;  1N33 Q;  4QL5 A;  2HIX A;  3PV0 A;  4ME3 A;  5C4J H;  1G6P A;  4ALP A;  5C3E H;  4JI5 Q;  1VQE A;  3KDF A;  2E8G A;  1N36 L;  1TWH H;  3S24 A;  2N78 A;  1IBL Q;  3J7A 5;  5CMT A;  3STB C;  5C44 G;  4OX9 Q;  3CCL A;  4C2M H;  1HNX Q;  3J80 i;  3KJO A;  2F52 A;  1C7Y A;  3HOZ H;  1VQ4 A;  4GOP A;  1HZA A;  2UXC Q;  1X65 A;  3SE5 A;  3GDE A;  3TRE A;  3BZC A;  1U5K A;  5M3M G;  4DV4 Q;  4JI6 Q;  1FGU A;  2MQH A;  3OTO Q;  3CCU A;  2Q2U A;  4L5Q A;  5BR8 Q;  4JV5 Q;  1SRO A;  5C0X I;  4OO1 I;  4IOA A;  4KI0 A;  4JBK A;  4ITR A;  4A3J H;  1VQ7 A;  1LM0 A;  2R92 H;  2JEA I;  2ALY B;  4X62 L;  5AJ3 Q;  5M3F H;  1AH9 A;  3LET A;  4KLK A;  1M1K C;  1V9P A;  1FJG Q;  1O7I A;  1HNW L;  4PZ8 A;  1GO3 E;  2Y0S G;  4A3I H;  1HR0 Q;  3K0X A;  4NB3 A;  4DV7 L;  4DR3 L;  4GKJ Q;  3CPF A;  3T1H L;  2Y0S E;  5HY6 A;  3ULP A;  4KHP L;  2A1A A;  2IX1 A;  3ICE A;  4A3K G;  3B6Y A;  4LF7 Q;  2N8N A;  4A3D H;  1W2B A;  4R4I A;  1CUK A;  1YVC A;  1Q1B A;  3KYH C;  1L1O B;  4LF8 L;  5FLM H;  3M4P A;  1S72 A;  4DV6 L;  3H3V I;  4JI0 L;  2E5L Q;  3J80 c;  3PIO A;  3GO5 A;  5LMN Q;  2OTJ A;  1K8A C;  1TXY A;  4GN5 A;  1VQ5 A;  4YWM A;  4A76 A;  2JA5 G;  4HIO A;  1A8V A;  5EU0 A;  1OXT A;  1LTL A;  1UE1 A;  4GNX B;  4A3C H;  1TWF H;  1VQC A;  1VQA A;  1YHB A;  3KF6 A;  3CCR A;  2R7Z G;  3M4O H;  2RF4 A;  4U0U A;  4IJL A;  2WP8 J;  4A3E H;  3S2H H;  3H3V H;  4GS3 A;  4Y7N H;  4DR4 Q;  2ZM6 Q;  3GTM H;  3H0G H;  4JOI C;  2JA7 G;  1D7Q A;  3GTO H;  1ASZ A;  1A62 A;  1SMX A;  4QIW E;  2LSS A;  2KHJ A;  4MZ9 A;  1YIT A;  1GVP A;  4OWX B;  1YHA A;  4BY1 G;  2OQK A;  2IX0 A;  5IY0 A;  1SE8 A;  4DUY Q;  3I4M G;  4X6A H;  1KAW A;  4J15 A;  1EIF A;  4IFD J;  1SR3 A;  2VNU D;  4N67 A;  3F1Z A;  2IHF A;  5IYD G;  2PNH A;  4AQY L;  2I5H A;  1VQN A;  1DGS A;  2JQO A;  4JI1 L;  4HJ7 A;  5IP7 G;  1S3O A;  1U0L A;  3T1Y L;  4LF5 Q;  4A93 G;  1I5F A;  1N32 L;  1W3S A;  4YWK A;  4LFC L;  3ZCB A;  2D62 A;  1Y14 B;  1BKB A;  5M3M H;  1AE2 A;  1QVF A;  4BA1 I;  1WI5 A;  2HHH L;  3W5O A;  2UU9 Q;  3ULJ A;  5JJL A;  3BU2 A;  2CWA A;  4U07 A;  4TVA B;  2GN5 A;  1PYB A;  2KHI A;  4QJF A;  3WWV A;  2UUB L;  3CW2 C;  5GRO A;  2FXQ A;  3ER0 A;  1M90 C;  4NXM Q;  5K36 G;  1VQJ A;  4JI2 L;  4A3M G;  4X2D A;  5JFF A;  1J5E Q;  3K81 C;  4X66 Q;  1GM5 A;  2PI2 E;  3FHW A;  1ASY A;  3A0J A;  1WYD A;  4DV5 Q;  3RN5 A;  1PYS B;  3KF8 B;  1VQL A;  4NXN L;  5DLQ E;  1VQP A;  1E22 A;  3EN2 A;  1XJV A;  2JK8 A;  4POG A;  2VQE L;  1IZ6 A;  3CCS A;  3HOW G;  1B8A A;  1UE7 A;  1X6O A;  4R4O A;  3GTL H;  3KDF B;  1SRU A;  5IE8 A;  3AEV A;  3PUZ A;  4A3K H;  1XNQ L;  3UDX A;  3I4O A;  4DV0 L;  2NVX H;  3PCO B;  1PHJ A;  2CCZ A;  4DR6 L;  1UEB A;  1XPO A;  5CGL A;  5M5Y H;  4LWC A;  2HIV A;  3CMA A;  1EFW A;  5FJ8 H;  3UDG A;  5ELN A;  4GOP B;  2B63 H;  3CAM A;  3RZO H;  4IOC A;  4IPH A;  4C3H H;  3JC6 6;  1JMC A;  2F4V L;  2R7D A;  4RG1 A;  4WGJ A;  1N9W A;  3GTQ H;  1WJJ A;  1N36 Q;  4JYA L;  2JA5 H;  1A0I A;  3J81 j;  3CCQ A;  4GKK L;  1HH2 P;  3A5U A;  3FKI G;  5C0X J;  2D0O A;  4R1J A;  1YJ9 A;  5LMN W;  3MEF A;  2R7Z H;  2R6G A;  2CQO A;  4LFB L;  3CCJ A;  2KCM A;  3S17 H;  3K7A H;  3S2D H;  3ZC7 A;  4DAY B;  4OWW B;  1B7Y B;  4B3M L;  3HOU G;  4WJ3 M;  3NEN A;  2JA7 H;  1MKH A;  1XNR L;  1E1T A;  2K5H A;  1Q1E A;  1KIX A;  1KQS A;  2QA4 A;  4YCW A;  3IRB A;  2NN6 G;  2UUC L;  4X62 Q;  1G29 1;  2DGY A;  2N3S A;  2RHQ B;  1YZ6 A;  3I4M H;  2NVT H;  2GVA A;  2MO1 A;  3CP0 A;  4GLA C;  5IYC H;  4XIG S;  3DM3 A;  4DV2 L;  4HIK A;  5GAH C;  5IYD H;  4DV7 Q;  4DR3 Q;  2I0Q A;  3GD7 A;  1Y1W G;  3T1H Q;  4JBM A;  4KHP Q;  4HIM A;  1R9T H;  5IP9 G;  1JE5 A;  2JA6 G;  4BXX G;  4A93 H;  3EBE A;  4IPD A;  3RLF A;  1NJI C;  3PO2 G;  4BY7 H;  1YJW A;  5C4X G;  2PQA A;  4XTC S;  4JBW A;  4A3B G;  4QQB X;  3LGJ A;  4BY7 G;  3KF6 B;  4PY3 A;  1BBU A;  1C0A A;  2K50 A;  2LXJ A;  1Y1V G;  2B3G A;  4DV6 Q;  4LW1 A;  4JI0 Q;  1MJC A;  3ERS X;  3RR5 A;  4DR7 L;  4L5T A;  5IYB G;  1KXL A;  4OWT B;  4GLX A;  1X3F A;  4UY8 C;  1XPU A;  3PUW A;  2V1C C;  1NMF A;  1UE6 A;  3CCM A;  3UDF A;  3CQZ H;  2JE6 I;  1Q46 A;  4JG2 A;  1Q86 C;  2NZH A;  3M9B A;  1XMO L;  3W1G A;  4A3M H;  5IT9 c;  1PH4 A;  4U04 A;  1X55 A;  3CCE A;  1Q7Y C;  2ID0 A;  4BA2 I;  1B70 B;  1NTG A;  1LYL A;  4P74 A;  5GAE C;  1T9H A;  3D31 A;  4AH6 A;  3KLW A;  1YNX A;  4LF6 Q;  3HOW H;  1KC8 C;  2WAQ E;  1HJP A;  2VZA A;  3FP9 A;  2GVB A;  3F8T A;  5M5W H;  4DV3 L;  1K9M C;  4UP7 A;  2N49 A;  3KOJ A;  1HNZ L;  1SN8 A;  1XPR A;  5J3B A;  2ZTE A;  4PG3 A;  4A3G G;  1PH5 A;  1VQB A;  5LMU L;  2A8V A;  3HOV G;  2PMZ E;  1OXV A;  2D0P A;  2AWO A;  4DUZ L;  4XI8 A;  3F2B A;  3S1N H;  4QY7 A;  1JJC B;  1OTC A;  2NN6 I;  4R4T A;  2R93 H;  3A74 A;  3F2C A;  1PVO A;  4X64 L;  2EXD A;  4AQY Q;  5JJ6 A;  1NMG A;  1OXU A;  2ZJQ A;  4LF9 L;  4IPC A;  1LUZ A;  3FKI H;  1N8R C;  1IYJ B;  2PI2 A;  4JOI A;  4JI1 Q;  1TWA H;  2VS1 A;  4P75 A;  1VQ9 A;  3STB D;  3T1Y Q;  3D0F A;  2OTL A;  4YY3 L;  4U0Z A;  3AYH B;  4B3T L;  4LFC Q;  1N32 Q;  2YTX A;  2OCE A;  4DNI A;  3TS2 A;  4LF4 L;  3HOX G;  5GQO A;  3EIV A;  3HOU H;  2MO0 A;  4B3S L;  5JJ7 A;  4DR6 Q;  5C44 H;  4K0K L;  3OYY A;  1EUJ A;  2EIF A;  3G71 A;  3TQY A;  1VQM A;  1G51 A;  2UUB Q;  5C3E G;  4L5S A;  2UXB L;  4DR5 L;  3PF5 A;  3CC2 A;  3K80 C;  2YYZ A;  4JI2 Q;  4DK3 C;  4NPS A;  1L1O C;  4Y52 H;  1PA6 A;  3CC4 A;  4DAM A;  4NXN Q;  5FLX c;  4M16 A;  1IL2 A;  1Y1W H;  4JI4 L;  2VQE Q;  1QVC A;  4MTN A;  5IP9 H;  1QUQ A;  1X9N A;  2OWO A;  2JA6 H;  3GTP H;  3AFQ A;  1I6H H;  4AIM A;  3SN9 A;  4GNX C;  3RN2 A;  3VDY A;  3PO2 H;  1XNQ Q;  5CKL A;  2JA9 A;  1K0R A;  1C9O A;  2K52 A;  1X3E A;  2DUD A;  4PZ7 A;  4UPA A;  4DV0 Q;  4DR2 L;  4JI8 L;  3KJP A;  2ZJP A;  1XMQ L;  1N34 L;  1VCI A;  3CD6 A;  4HJA A;  3NBH B;  2KBN A;  1Y1V H;  3TEH B;  3L2P A;  3GTK H;  3I4N G;  2YU9 H;  3G6E A;  4L5R C;  5IYB H;  4TQU S;  3N3U A;  2Q2I A;  1E24 A;  2F4V Q;  1HR0 W;  1H95 A;  4A3I G;  4JYA Q;  4DR1 L;  4GKK Q;  1TWG H;  1IBM L;  3UE0 A;  1Q8K A;  1IBK L;  1JB7 A;  4APV A;  1EYG A;  3L0O A;  3Q8D A;  3DLL A;  3F2D A;  4BBS G;  2AKW B;  2ZTD A;  4X65 L;  4LF5 L;  2QGQ A;  4YHH L;  5C0X G;  4OO1 G;  1OXS C;  1GD7 A;  3I55 A;  4B3M Q;  1X3G A;  1GKH A;  2AHO B;  1P8L A;  4B3R L;  3E0E A;  2Z6K C;  3E9I A;  2L15 A;  1PH3 A;  1X54 A;  1XNR Q;  3SHG A;  4FDB A;  2RHS B;  4PMW A;  1HZ9 A;  4A3G H;  2WB1 G;  1KL9 A;  4DV1 L;  4A3L G;  3H15 A;  2UUC Q;  3M3Y H;  3HOV H;  1VQI A;  1XTD A;  1D8L A;  3PUY A;  2VUM G;  4DK6 C;  2XTI A;  5M5X H;  2ASB A;  1I3Q H;  1JJG A;  2WB1 E;  1JT8 A;  2CWP A;  3S14 H;  2K14 A;  4A4I A;  3PSI A;  4IJH A;  4DV2 Q;  4KHZ A;  4IPG A;  4DV5 L;  2OQ0 A;  1YIJ A;  1YEZ A;  4OXP A;  4JI3 L;  4X2E A;  3CME A;  4X2C A;  5JEA J;  3HKZ E;  1NBW A;  1SFO H;  2B29 A;  4BY1 H;  1QZG A;  1V43 A;  3S16 H;  1K3R A;  4HJ8 A;  4HID A;  1QZH A;  1IXR A;  2IT1 A;  1WCM G;  1I94 L;  3HOX H;  4LFA L;  1HNW Q;  4AYB G;  3PIP A;  2JA8 G;  3I56 A;  1QVG A;  3U58 A;  2HQL A;  2Q2H A;  1PH7 A;  4AYB E;  1PFS A;  2AMC B;  2K5V A;  4DR7 Q;  2MNA A;  3BJU A;  1VS0 A;  3U50 C;  1EWI A;  1EOV A;  4EQ5 A;  5IP7 H;  2VQF L;  3NEM A;  5ELO A;  4WJ4 A;  1TWC H;  4RMF A;  1E3P A;  2UXD L;  2UUA L;  4EX5 A;  3CXC A;  4JI7 L;  1XMO Q;  5IWA L;  2YV5 A;  1CKN A;  4LF8 Q;  1WOC A;  1P16 A;  4GOP C;  2E2I H;  1VQ8 A;  4DKA C;  4YCV A;  4R4Q A;  1N33 L;  4DPG A;  1RL2 A;  1AE3 A;  2K75 A;  1NE3 A;  5HGQ A;  3S6A A;  4JI5 L;  4P72 A;  2K5N A;  3GTJ H;  4IO9 A;  1PH9 A;  3RNU A;  3AFP A;  3ULL A;  4DV3 Q;  1IBL L;  3PF4 A;  1HNZ Q;  4OX9 L;  2LXK A;  4HJ9 A;  4A3F G;  1YI2 A;  3I4N H;  1HNX L;  5LMU Q;  3J81 i;  1YBY A;  5JJK A;  2WAQ G;  1S40 A;  4P71 A;  5GAD C;  1MJE A;  2QEX A;  2YTV A;  5EAY A;  2KCT A;  1Z9F A; 
#chains in the Genus database with same CATH topology
 2D2C C;  2JJQ A;  2NZO A;  1GHJ A;  4DV4 L;  4HSP A;  4G7Z C;  2M9V A;  3VYS A;  3OTO L;  2F0P A;  4LUO A;  5M5W B;  4P73 A;  1KNA A;  2HDM A;  4NDX A;  4LF4 Q;  3I7F A;  2VW9 A;  3HFZ B;  4L63 B;  4PZ6 A;  3Q0A A;  1LAB A;  3KFU A;  2B63 G;  4C3H G;  3CRK C;  1RF2 D;  4J8Q A;  2G9H D;  4DR5 Q;  1K3B C;  1MIU A;  4QGU A;  2HQE A;  1EY7 A;  4RHS A;  1PH6 A;  4IUT A;  3HOU B;  1IKL A;  1O7Z A;  1I50 H;  2BA1 A;  2ZJR A;  1BBW A;  5C44 B;  1QE6 A;  1DXM A;  5F2D A;  1PRT F;  1FNU A;  1PH2 A;  3C3L A;  3A54 A;  5CGK A;  2R7F A;  4JI8 Q;  1M4V A;  4C3I H;  4MIU A;  4POF A;  2JA8 H;  1WTQ A;  2KEN A;  2G03 A;  1CI3 M;  3VR6 A;  2VY3 A;  3DEO A;  2BA0 A;  1IBM Q;  1SLJ A;  4ZKB B;  1IBK Q;  2AWN A;  4ABN A;  3S1R H;  3TRZ A;  2YU9 B;  3NEL A;  1CKM A;  1Q90 A;  5C5M A;  1E7Z A;  4DV1 Q;  1LTA D;  3ND9 A;  1TWG B;  4A3F H;  2WFW A;  2IY5 B;  2A19 A;  1V8Q A;  2CKZ B;  4HJ5 A;  4A3D G;  3BDC A;  4IFD I;  3AB9 A;  3D4D A;  4UP9 A;  5JPM C;  4JI3 Q;  4IUQ A;  2P5Z X;  1CKO A;  1G8Z D;  1VQD A;  3RZD H;  3M7N A;  2PQA B;  1PH1 A;  3RLN A;  3S17 B;  4LFA Q;  1VQO A;  4HED A;  1CTM A;  4FF3 A;  2VL6 A;  2F3I A;  4C3J H;  5JVH 3;  2A69 C;  2ES2 A;  3HOY H;  3UDI A;  1EY9 A;  2YTY A;  1DM0 B;  2PW5 A;  4RGM A;  2RCF A;  3H0G G;  4A75 A;  1EIY B;  2OXP A;  3M4Q A;  2CHB D;  3J7Z C;  4BBR H;  1PZK D;  2HIX A;  2B2Y A;  4ME3 A;  1EOT A;  4ALP A;  5C3E H;  3J7Y W;  4JI5 Q;  1VQE A;  2K01 A;  1PTO D;  3E3X A;  1N36 L;  3S24 A;  2NUC A;  2PO4 A;  1ILP A;  4K5V A;  1TVX A;  2IW3 A;  2PCF B;  3O13 A;  2F0I A;  1VMP A;  5CBE E;  4R9W A;  2CVR A;  5BR8 Q;  1IW7 D;  1SRO A;  1D2B A;  4JBK A;  5J39 A;  3JAM E;  2OEO A;  1A3V A;  2ALY B;  5M3F H;  3A55 A;  1KAA A;  2F3V A;  1V9P A;  1DYQ A;  1II3 A;  2KUM A;  1GO3 E;  5C6A A;  3D8G A;  1SYC A;  2M00 A;  2Y0S E;  4KHP L;  3ICE A;  2L5T A;  2BE5 D;  1LTS D;  1NAP A;  5A2Q E;  4LF7 Q;  1L1O B;  2L4N A;  3M4P A;  5CV4 A;  2E5L Q;  2XSC A;  4ZK9 B;  3GO5 A;  5NUC A;  5LMN Q;  1WTW A;  1TXY A;  2NVQ B;  4YWM A;  4A76 A;  4HIO A;  4DXG A;  3QB3 A;  1NNX A;  1EZ6 A;  1TWF H;  3L9A X;  5J22 A;  1PRT B;  1VQA A;  2ZXR A;  3CCR A;  2R7Z G;  1F9Q A;  3E0J A;  1JOR A;  4DAP A;  1L0X B;  4UDU C;  5CV6 A;  2F0F A;  5A35 A;  5JJZ A;  3TP5 A;  2ZM6 Q;  1U9R A;  1ASZ A;  2LSS A;  4MZ9 A;  1SYF A;  1YHA A;  2WII B;  3MZ5 A;  1KAW A;  1EIF A;  1SR3 A;  1TY2 A;  2BOS A;  3F1Z A;  2WAC A;  2PNH A;  4F7X A;  1VQN A;  2E74 C;  1JB3 A;  2G9D A;  1N32 L;  1SYD A;  4LFC L;  2B39 A;  1Y14 B;  2NVY B;  5DM7 3;  2GN5 A;  4XT1 B;  2FXQ A;  4NXM Q;  4Q0F A;  5JFF A;  4X3K A;  3VYR A;  1ASY A;  4ZRZ A;  1WYD A;  3KF8 B;  1TS3 A;  1VQP A;  3KLS A;  2JK8 A;  1VDZ A;  2VQE L;  1UE7 A;  1EEI D;  1SRU A;  4F87 A;  1HQM C;  3AEV A;  3RD4 A;  3HOV B;  4DR6 L;  4CHT B;  1UEB A;  5M5Y H;  4LWC A;  2HIV A;  5LHY 1;  5ELN A;  3CAM A;  4IPH A;  3JC6 6;  5DEH A;  4WGJ A;  1N9W A;  3GTQ H;  1UEA B;  2EJF C;  4JW0 A;  1WTH A;  4GKK L;  3A5U A;  5C0X J;  2D0O A;  3MEF A;  1XX8 A;  3CCJ A;  2KCM A;  3ZC7 A;  1EFI D;  2F0G A;  4B3M L;  3SK8 A;  5CV9 A;  2JA7 H;  1RKN A;  1E1T A;  1KIX A;  5FK9 C;  5BN5 A;  2Z4I A;  3MFY A;  2RHQ B;  4PV1 C;  3I4M H;  3CP0 A;  4GLA C;  3FPP A;  5ELF A;  4XIG S;  3T4A C;  3HOZ B;  4DV2 L;  1DON A;  5IYD H;  3GD7 A;  3X3N A;  1PMR A;  1GJX A;  1AW7 A;  1JE5 A;  4QMG A;  1TII D;  5IP9 G;  4EQN A;  1A3T A;  5CV5 A;  4OHJ A;  4A3J B;  4HAE A;  1G2T A;  4BY7 G;  1JWM D;  3KF6 B;  1BBU A;  2A6E C;  2K50 A;  1SNO A;  5IYB G;  4A3I B;  4OWT B;  1X3F A;  2V1C C;  2ZXP A;  2JE6 I;  2NZH A;  5IT9 c;  1X55 A;  3CCE A;  3OIP A;  2ID0 A;  4ZAI A;  2F4I A;  2O5J C;  5I6W A;  2Z8L A;  3QJY A;  2WAQ E;  1F2Y A;  4QCL A;  2WB1 B;  5M5W H;  4UP7 A;  2N49 A;  3KOJ A;  5AFW A;  2ZTE A;  4PG3 A;  1OXV A;  1I4R A;  2D0P A;  1OTC A;  1I50 B;  1FNV A;  2NN6 I;  1NH1 A;  2FHT A;  4A3E B;  1NMG A;  2ZJQ A;  4Y7N B;  1IYJ B;  1KLG D;  3GTM B;  3FVQ A;  3T1Y Q;  3D0F A;  3SK5 A;  4B3T L;  1QNK A;  3TS2 A;  1SNP A;  3HOU H;  3EIV A;  2A73 B;  2L1B A;  3ONA B;  1STY A;  4N9P A;  5C44 H;  3T53 B;  1PTO F;  4ILW A;  3TQY A;  1VQM A;  2K7V A;  5C3E G;  2CW0 D;  3PF5 A;  4XQJ A;  4JI2 Q;  4DN4 M;  1LTI D;  1LT3 D;  4DAM A;  4IUN A;  5FLX c;  4NXN Q;  1T5X D;  3FDT A;  1E0B A;  1QVC A;  1PTO C;  1NR2 A;  2J7Z A;  4AIM A;  1LAC A;  1AP0 A;  4S3S A;  2K52 A;  1XMQ L;  4P2C B;  4N9T A;  4DR2 L;  2EY1 A;  3I4N G;  4HJA A;  1Y1V H;  4HTH A;  2YU9 H;  4DAV A;  5EJW A;  4QUC A;  3ERQ A;  1IW7 C;  4JYA Q;  3K5O A;  2RKS A;  1TWG H;  1FGB D;  1JB7 A;  1TU2 B;  4C56 C;  1LT5 D;  3NP8 A;  3D6W A;  5C0X G;  2G5D A;  4K6L A;  2NTT A;  2QDL A;  3I55 A;  2NUN A;  4CDC C;  1RHP A;  2E75 C;  2EYJ A;  3C1E A;  4B3R L;  3RZO B;  2L15 A;  1PH3 A;  4OL7 A;  4FDB A;  5EGT A;  5HGT A;  5L37 A;  2BE5 C;  2B8G A;  3QR8 A;  1PZJ D;  3PUY A;  2VUM G;  4DK6 C;  5I2Y A;  3K7A B;  2K14 A;  3S2D B;  4FVM A;  2OQ0 A;  4X2E A;  3Q24 A;  3CME A;  4IQZ A;  1LTR D;  1QZG A;  1QZH A;  5JPN C;  3PIP A;  3I56 A;  3U58 A;  2Q2H A;  1B2T A;  1H9S A;  2K5V A;  5FOB B;  1HA6 A;  5IP7 H;  3T51 B;  2MP1 A;  4RMF A;  3K5M A;  2UUA L;  4EX5 A;  4A93 B;  1ENF A;  2YV5 A;  1CKN A;  1TS4 A;  3I91 A;  4GOP C;  3GP7 A;  4R4Q A;  1AE3 A;  5TSS A;  3T56 B;  3SVM A;  1NE3 A;  2I07 B;  4HR7 B;  4DV3 Q;  1IBL L;  4ZUJ A;  5I9P A;  3I72 A;  1HNZ Q;  3PF4 A;  2LXK A;  1I4P A;  4DNR B;  3JAM L;  4HJ9 A;  1PLF A;  4A3M B;  5LMU Q;  2WAQ G;  3D6C A;  1S5C D;  1S40 A;  1MJE A;  2A69 D;  2KCN A;  2UXC L;  3TP7 A;  1PV4 A;  1X3P A;  2K03 A;  2EYF A;  4J1M A;  4X64 Q;  3A5Z B;  1VQK A;  3HOW B;  4LF9 Q;  2EYH A;  2F0W A;  1CZW A;  4RCO A;  3PIO 3;  1IKM A;  2RVL A;  2FIN B;  4NW2 A;  1Z7T A;  1CQF A;  1X56 A;  2EQS A;  5A2Q L;  5FO8 B;  1SEB D;  3D3R A;  2Z1C A;  4CKC A;  1J9O A;  1LTB D;  5IGF A;  2NVQ H;  1A63 A;  4K0K Q;  2HUG A;  3H09 A;  3PUX A;  3TS0 A;  3PO3 G;  3SGI A;  4U68 A;  2O5I C;  1DD2 A;  4YWL A;  1BVS A;  1Q82 C;  3J81 c;  3N6R A;  1PDQ A;  1JIC A;  3DMU A;  1F9R A;  1EEF D;  1K28 A;  1WCM H;  3U4Z A;  1N34 Q;  2UXB Q;  1BUV T;  1UE5 A;  3CF5 A;  4BXX H;  3MTS A;  4LUV A;  3M85 A;  4DR1 Q;  1JOQ A;  2PZW A;  5E4W C;  3OOC A;  3SDZ A;  2JA6 B;  1CA6 A;  1FVI A;  1RIP A;  3UI2 A;  2R92 G;  1RJT A;  3VA5 A;  4X65 Q;  1VQG A;  3FRP B;  5LL6 S;  3T16 A;  3PUV A;  4YHH Q;  1OXX K;  4DUY L;  5EBD A;  2NVY H;  2F0U A;  2Z9H A;  2KJX A;  3BS1 A;  3AMU A;  3H3V C;  5I4D A;  1BCP B;  2DJG C;  3K6O A;  3NHH A;  4GN3 B;  1I6V C;  4YCU A;  3A7A B;  3P20 A;  3PGZ A;  4RA8 A;  3C2P A;  3GV3 A;  1UWV A;  4KK7 A;  3TSS A;  3H94 A;  2CFM A;  2NYZ D;  5C4H A;  4GLV B;  4JC0 A;  1HTL D;  1I3Q B;  1B44 D;  1L2F A;  1KRT A;  5IGB A;  1AEX A;  1KHI A;  2VB2 X;  3CUC A;  4IFD H;  4KKT A;  1YHQ A;  4JPB W;  2VQF Q;  1Q12 A;  2K4K A;  3J80 L;  1PFN A;  2SDF A;  1SFO B;  5IWA Q;  1VQH A;  2DY8 A;  2KEC A;  2XGT A;  1GOZ A;  3I4M B;  3S16 B;  3HOX B;  1LTG D;  2F0K A;  3BZK A;  2EY6 A;  4UAI A;  4CDE C;  3LWE A;  4RKL A;  3HGB A;  1ZKO A;  2N78 A;  3U9S A;  2AUK A;  5C44 G;  1ZYR C;  3CCL A;  1HNX Q;  2VB3 X;  3HOZ H;  2OF1 A;  1VQ4 A;  4GOP A;  1HZA A;  2E2I B;  1X65 A;  3SE5 A;  5M3M G;  4JI6 Q;  1CT1 D;  2LKV A;  4OEM B;  2NWG A;  2Q2U A;  2B2U C;  4JV5 Q;  4DA2 A;  4IOA A;  4ITR A;  4A3J H;  1U4R A;  5AJ3 Q;  1AH9 A;  3LET A;  2HCI A;  3MWY W;  5DAU A;  5ELC A;  1FJG Q;  4PZ8 A;  5KGU A;  4A3I H;  1HR0 Q;  3K0X A;  4NB3 A;  4DV7 L;  4DR3 L;  2PYK A;  2QDB A;  4GKJ Q;  5ELD A;  3CPF A;  3T1H L;  2F3W A;  5HY6 A;  4KHV A;  2K5Q A;  3Q23 A;  4BBS B;  4EGV A;  2NB0 A;  3NE5 B;  5LL6 X;  4TRD A;  1RCV D;  2F0H A;  5FLM H;  1S4Z A;  2EOT A;  1VQ5 A;  2JA5 G;  5JEA H;  1LTL A;  4A3C H;  1VQC A;  4KV6 A;  3H6M A;  5JAV A;  2WP8 J;  2E2D C;  1H9K A;  1TKW B;  4A3E H;  4LAA A;  4KN7 C;  4Y7N H;  4DR4 Q;  3GTM H;  4FF2 A;  1KDB A;  4JOI C;  4XT3 B;  3FEW X;  4QIW E;  2KHJ A;  1GVP A;  1KLU D;  2IX0 A;  2A6E D;  3BDL A;  1QNU A;  4X6A H;  4J15 A;  4IFD J;  4N67 A;  1SJH D;  1U4M A;  2IHF A;  4R8N A;  4PNY A;  2F0J A;  1EY4 A;  2JQO A;  3E6Z X;  4JI1 L;  5IP7 G;  3KLS X;  4A3B B;  1U0L A;  4K14 A;  1I5F A;  4C1N I;  4PMB A;  1Y1V B;  2RDF A;  1ZEQ X;  1SYB A;  4DK1 A;  4LJZ C;  1V1P A;  4BA1 I;  3W5O A;  1AN8 A;  3OIQ A;  2UU9 Q;  4WRD A;  2CWA A;  3BYT B;  4TVA B;  3WWV A;  2K5D A;  5GRO A;  2E76 C;  3ER0 A;  4KD3 A;  1QB5 D;  1J5E Q;  1GM5 A;  4X66 Q;  3RN5 A;  3VYU A;  2FMM A;  1E22 A;  2KQ3 A;  2F0S A;  1IZ6 A;  1B8A A;  1X6O A;  3Q6S A;  5IE8 A;  5JOB A;  2DY7 A;  4A3K H;  1XNQ L;  3I4O A;  1SNC A;  4DV0 L;  2NVX H;  1G2S A;  5COR A;  1STB A;  3CMA A;  1K0S A;  1EFW A;  1B4O A;  5IT9 E;  3BYY B;  5D3I B;  3RZO H;  4IOC A;  2R7D A;  2H1E A;  1I4H A;  3J81 j;  3CCQ A;  1HH2 P;  2RA4 A;  3FKI G;  5LMN W;  2R6G A;  2CQO A;  3IFT A;  3K7A H;  2MGS A;  3S2D H;  1TQO A;  4DAY B;  1STA A;  4WJ3 M;  1RDP D;  2B2V C;  4ODG A;  5EBC A;  1A15 A;  2WIN B;  1MKH A;  1ESR A;  2B8F A;  2K5H A;  1XNR L;  1IYV A;  1ET9 A;  2QA4 A;  4YCW A;  1TWH B;  1SYE A;  4MHE A;  1BNZ A;  4X62 Q;  5IYC H;  1SNM A;  2BCO A;  4ULL A;  2MJ8 A;  4WOR A;  1Y1W G;  2B2U A;  2N88 A;  3RMH A;  1JC7 A;  4HIM A;  4BXX G;  4A93 H;  1LV9 A;  4H0L C;  4IUR A;  2PQA A;  4JBW A;  1HPC A;  4QQB X;  4KJN A;  2MHV A;  2B3G A;  1U4L A;  4DV6 Q;  4JI0 Q;  2XVS A;  1MJC A;  3C1F A;  3ERS X;  4DR7 L;  4L5T A;  1XPU A;  4V19 0;  5EPK A;  1UE6 A;  5FLX E;  5K36 H;  1STH A;  3DEP A;  3UDF A;  1Q86 C;  1LO5 D;  5DM6 3;  1F2Z A;  3M9B A;  1XMO L;  4A3M H;  4ZCK A;  1NUC A;  4A3D B;  4X3S A;  3L3O C;  5GAE C;  5G3L D;  1T9H A;  3KLW A;  1F2M A;  4LF6 Q;  3HOW H;  3FP9 A;  3IL8 A;  3I90 A;  5J3B A;  4A3G G;  3LWU A;  3HOV G;  2PMZ E;  3NK9 A;  1Q3L A;  2R3Z A;  1CHQ D;  3R2I A;  4V0B A;  2RBM A;  4R4T A;  2EJM A;  4G57 A;  3EA6 A;  3F2C A;  1PVO A;  4AQY Q;  4IPC A;  4JOI A;  2HD3 A;  2AQ3 B;  3H0G B;  1WCM B;  5C5L A;  4P75 A;  1VQ9 A;  3STB D;  3GTO B;  4AYB B;  3DWP A;  2OCE A;  4DNI A;  4LF4 L;  5JJ7 A;  1QWY A;  1S5D D;  4CJ1 B;  4KY7 A;  4CJ2 C;  3SEB A;  1BF4 A;  2Q8I B;  2NN6 H;  1EUJ A;  2EIF A;  1QCB D;  1CHP D;  2UUB Q;  1A3U A;  5K5P A;  1KDC A;  3OMC A;  4DR5 L;  2YYZ A;  3NPP A;  3K5N A;  4PQX A;  1PA6 A;  1S5E D;  2K05 A;  2C9O A;  4K5X A;  5D3D A;  1C48 A;  3OWE B;  1B50 A;  1D1I A;  4MTN A;  1QUQ A;  3V96 A;  2JA6 H;  3AFQ A;  4GNX C;  3RN2 A;  2ZXO A;  3PO2 H;  1ICF B;  2DUD A;  1K8M A;  4JI8 L;  2ZJP A;  2NBF A;  1SSO A;  3G6E A;  5EKI A;  4ZKC B;  4TQU S;  3N3U A;  1CA5 A;  2F4V Q;  2JYO A;  2XWJ B;  1H95 A;  4A3I G;  4IUU A;  1IBM L;  3KBX A;  1Q8K A;  1IBK L;  4APV A;  3L0O A;  3F2D A;  2L9H A;  1G6Z A;  3CKI B;  1RTN A;  1GUG A;  1OXS C;  1YNN D;  5CYU A;  2AHO B;  1P8L A;  2SOB A;  5CMD A;  3SHG A;  2WB1 G;  1KL9 A;  4DV1 L;  2UUC Q;  1XYI A;  1VQI A;  2BDN A;  4DXF A;  1A6X A;  2B2W C;  1I3Q H;  1JT8 A;  2CWP A;  2ENB A;  4IPG A;  3TZU A;  2B2V A;  2EJG C;  4JI3 L;  3HKZ E;  3EJI A;  1SFO H;  2B29 A;  1VMC A;  4XXE A;  2LY7 A;  3S16 H;  1HRJ A;  2IT1 A;  3HOX H;  4LFA L;  3R3O A;  4K2L A;  4C3I G;  2JA8 G;  2NVT B;  3D4W A;  2AMC B;  3LX0 A;  3BZD B;  1DJR D;  3BJU A;  1IYU A;  1VS0 A;  1EOV A;  4L8J A;  1E3P A;  3SXH A;  1BO0 A;  1XXG A;  1EU3 A;  4LF8 Q;  1WOC A;  2E2I H;  2HCC A;  3P1H A;  1HCZ A;  4DPG A;  2K75 A;  2K04 A;  2F1M A;  4JI5 L;  3W2D A;  5ELB A;  3C46 A;  5I9O A;  1MSH A;  3CQZ B;  1LT4 D;  4A3F G;  1YI2 A;  3I4L A;  3J81 i;  5JJK A;  5EAY A;  2KCT A;  1Z9F A;  1TR5 A;  4DUZ Q;  2K5W A;  1PH8 A;  1X3Q A;  1V1Q A;  5BR8 L;  4NP5 A;  3K59 A;  2X6L A;  4BBS H;  1JE4 A;  2H4O A;  4YY3 Q;  4B3S Q;  1JWU D;  2GA4 B;  3A8J E;  3NTI A;  1NR4 A;  3ERO A;  4C3J G;  2EYO A;  1CSP A;  4B08 A;  3HOY G;  3IFD A;  3MXN B;  2R93 B;  1MGS A;  4A3L H;  1ZYR D;  1EY0 A;  2K32 A;  1TWA B;  4LF7 L;  2RQX A;  1KNE A;  5KNB A;  1OO9 B;  4JBJ A;  2HHH Q;  1PFM A;  2E5L L;  1KDA A;  4BBR G;  3E5S A;  1KRS A;  4H02 A;  4JI4 Q;  1E2W A;  2PW7 A;  5LMN L;  4LF6 L;  1H9J A;  1JOO A;  4I65 A;  1CQV A;  2TSS A;  1JR0 D;  3FMC A;  2BH8 A;  2I5L X;  4CDF C;  3TP8 A;  2DNE A;  1VF5 C;  5E7N A;  1EQQ A;  3K7U C;  4YIJ A;  5IYC G;  3RUZ A;  4WJW A;  4DU9 A;  3JAM c;  4KKS A;  2ZM6 L;  3GTP B;  4TSS A;  4A3B H;  2OT2 A;  3NBI A;  4GNX A;  4LU4 A;  1C8C A;  3DWQ A;  4BY7 B;  2EXZ A;  5M3F G;  2E2H H;  1WFQ A;  2Y0S B;  3U4V A;  3GTK B;  2ATW A;  3G7L A;  1F2L A;  1J6Q A;  3VYT A;  4BS9 A;  2JEB I;  5CV8 A;  4A3K B;  3I3C A;  2NVX B;  1VQ6 A;  3K58 A;  3GV6 A;  3NXW A;  5G3L F;  2O2L D;  1HZC A;  5DNF A;  3GTG H;  1PFB A;  4H7B A;  1NY4 A;  3VR4 A;  4NXM L;  1V1O A;  1I94 Q;  1CKN B;  2B2W A;  5M5X B;  3HKZ G;  2IX3 A;  4XQN A;  3S14 B;  3BDO A;  3NTK A;  1I4G A;  5H1S E;  1JJ2 A;  4E6I A;  1K73 C;  3E9H A;  2Z6B A;  3HP3 A;  1ROD A;  1TT2 A;  3V2T A;  2UXD Q;  2RSN A;  2LS0 1;  4JI7 Q;  4BY1 B;  2I5M X;  1UAP A;  3CCV A;  3H91 A;  5CBA E;  1EY5 A;  2Z0S A;  2KCC A;  1N33 Q;  1G6P A;  3WOF A;  4FP5 D;  1HHV A;  3J7A F;  3KDF A;  2E8G A;  2N55 A;  1BCP C;  1TWH H;  1D6E C;  3J7A 5;  5CMT A;  2CQA A;  3STB C;  1TWC B;  4OX9 Q;  2EVB A;  5JVG 3;  2VXW A;  1ESF A;  1EU4 A;  2BDO A;  5ELE A;  3CRL C;  3TRE A;  4DV4 Q;  1U5K A;  1SE4 A;  1FGU A;  2PPB C;  3OTO Q;  1RD9 D;  4NKL A;  2CH4 A;  4OO1 I;  1VQ7 A;  1LM0 A;  4L6T B;  5IGD A;  5ISR A;  2JEA I;  1HTP A;  2QKI C;  5C3W A;  2MUY A;  4KLK A;  4DNT B;  1H9M A;  5KRU A;  3I4N B;  1FR3 A;  1O7I A;  4RGO S;  3NQT A;  2X69 A;  3TME A;  1STE A;  2IX1 A;  1WTX A;  3S15 B;  3SHL A;  4XYO A;  2N8N A;  4A3D H;  1BOS A;  1W2B A;  4R4I A;  1YVC A;  1Q1B A;  3ND8 A;  4QF4 A;  4LF8 L;  2L12 A;  2AQ1 B;  3H3V I;  4N8X 1;  5KYI A;  1M8A A;  2A74 C;  3J80 c;  3NWT A;  1K8A C;  4M1U B;  1PTO B;  5IIF A;  1A8V A;  1UE1 A;  3MAQ A;  2ICE C;  2VUM B;  3Q22 A;  3M4O H;  1YHB A;  1D5M C;  3MFG A;  2RF4 A;  1YNN C;  4U0U A;  1Q8I A;  4IJL A;  2I46 A;  3WOE A;  2QEJ C;  3KBG A;  1CFM A;  3H0G H;  4LMQ D;  2JA7 G;  3GTO H;  2LFN A;  3PQI A;  2WKD A;  3I4M G;  4IZ8 A;  2EYL A;  4TKO B;  2VNU D;  4IUV A;  5IYD G;  4K5W A;  2L0C A;  3PO2 B;  2E2J B;  1JCK B;  4HJ7 A;  4PMC A;  5C4X B;  3QWN A;  3NWS A;  1S3O A;  3T1Y L;  1W3S A;  4YWK A;  2D62 A;  1BKB A;  3S2H B;  1AE2 A;  2HHH L;  1SAP A;  3K0Y A;  3AU7 A;  1PYB A;  2KHI A;  4QJF A;  3CW2 C;  3TBI B;  5KYL A;  1M90 C;  1YNJ D;  4RGT A;  4BWG B;  1VQJ A;  1SMY C;  1UUP A;  2J0T D;  4JI2 L;  4X2D A;  3K81 C;  2WAQ B;  1PYS B;  4NXN L;  2M2L A;  4HCS A;  1XJV A;  4G4K A;  3BG3 A;  2B2T C;  2QCP X;  4G7H C;  4F8M A;  4LK1 C;  3PCO B;  1PHJ A;  2CCZ A;  3S1Q B;  1ZXT A;  5FJ8 H;  3UDG A;  4GOP B;  2K6A A;  4RG1 A;  1AZP A;  1WJJ A;  1N36 Q;  4JYA L;  1A0I A;  2IJ0 A;  2WV6 D;  4HSV A;  1ML0 D;  3PO3 B;  2R7Z H;  3S1M B;  1BBX C;  3NBH A;  4CGY B;  4QUF A;  3QOL A;  3S9W A;  1K83 B;  4H44 C;  3HOU G;  1B7Y B;  1MD2 D;  1SND A;  3WDN A;  3PIP 3;  5C4J B;  3NEN A;  1S5B D;  4HN7 A;  4ZLT F;  3IRB A;  2DGY A;  1YZ6 A;  2NVT H;  4C2M B;  3BVG A;  3DM3 A;  4HIK A;  1NSN S;  1O80 A;  3TP6 A;  3SK6 A;  4KHP Q;  1B53 A;  2NUD A;  3EBE A;  1TY0 A;  1NJI C;  1JWS D;  3R2T A;  2R92 B;  1YJW A;  4A3B G;  3LGJ A;  2A6H D;  1Y1V G;  4XDX A;  5EKK A;  2A68 C;  4K8I A;  3RR5 A;  4OEL B;  3QO2 A;  2KED A;  1NMF A;  3CCM A;  1HFN A;  3CQZ H;  1Q46 A;  1A2U A;  1PZI D;  2K1B A;  4DK0 A;  4U04 A;  4FF4 A;  1Q7Y C;  4BA2 I;  1B70 B;  1A2T A;  4WFN 3;  3MC0 B;  4AH6 A;  1YNX A;  4FO2 A;  1KC8 C;  1D1K A;  3V05 A;  1HJP A;  1EY8 A;  3F8T A;  1D5Z C;  4KMU C;  5KEE A;  4DV3 L;  3U9O A;  1HNZ L;  1Y69 U;  1PH5 A;  1VQB A;  5LMU L;  2A8V A;  2FJ2 A;  2AWO A;  3R8B A;  3F2B A;  1V1P B;  2R93 H;  3A74 A;  4X64 L;  4K2K A;  4LF9 L;  1LUZ A;  1T5E A;  1N8R C;  2PI2 A;  4RH6 A;  1MSG A;  1TWA H;  4HMI A;  3M7G A;  4U0Z A;  3AYH B;  1N32 Q;  4LFC Q;  2YTX A;  2EZV A;  5GQO A;  4K0K L;  3OYY A;  5CR3 A;  3DHQ A;  3G71 A;  4DGZ A;  1G51 A;  2SNM A;  4L5S A;  4CJ0 B;  4RHR A;  1I4X A;  2RSO A;  3K80 C;  3SE0 A;  4NPS A;  1L1O C;  2E2H B;  3CC4 A;  1J8I A;  1R4P B;  2KOL A;  4B9X A;  1GUN A;  3TZD A;  5M3M B;  2VQE Q;  2OWO A;  5IP9 H;  1X9N A;  3GTP H;  5E4X A;  3SN9 A;  3VDY A;  4KTA A;  3MVV A;  5CKL A;  3IAY A;  2JA9 A;  4PZ7 A;  4EQO A;  1PRT C;  4BY7 H;  4DR6 Q;  1N34 L;  3CD6 A;  2UXB L;  1VCI A;  1QG7 A;  4ZUI A;  3GTK H;  3L2P A;  5IYB H;  3D4R A;  1S5F D;  2F0E A;  2Q2I A;  3DXJ C;  3OPO A;  2B2T A;  3GTG B;  4N8F A;  4DR1 L;  3VR3 A;  4GKK Q;  3GTL B;  1CZG A;  3Q8D A;  2AKW B;  4X65 L;  4U67 3;  4YHH L;  1GD7 A;  4B3M Q;  1X3G A;  1PXU A;  2B63 B;  4Q5V A;  4F88 A;  3E0E A;  5FKA C;  2Z6K C;  3E9I A;  4C3H B;  1X54 A;  1HZ9 A;  2JA5 B;  3H15 A;  1XTD A;  1D8L A;  5M5X H;  2XTI A;  2ASB A;  1JJG A;  2WB1 E;  2EE1 A;  3S14 H;  1BR9 A;  2FFK B;  3PSI A;  4IJH A;  4DV2 Q;  1YIJ A;  1YEZ A;  1EIH A;  2K33 A;  4FNF A;  4X2C A;  5JEA J;  1NBW A;  3FPU B;  4BY1 H;  1V43 A;  4HID A;  1WCM G;  5EPJ A;  1HNW Q;  4AYB G;  5IGE A;  1WTR A;  1QVG A;  3X3M A;  1PH7 A;  3DUZ A;  3BVZ A;  1JOK A;  1PFS A;  2MNA A;  1E2Z A;  3R93 A;  3KUP A;  1EWI A;  3MXU A;  2VQF L;  1AZQ A;  5ELO A;  1W6J A;  1TWC H;  3CXC A;  1R9T B;  1I4Q A;  5IWA L;  4OIK A;  2XN9 C;  3NUC A;  2EDG A;  1VQ8 A;  3SK4 A;  1FD7 D;  4YCV A;  4DKA C;  1RL2 A;  3HS0 C;  3ITP A;  4CBV A;  5HGQ A;  3S6A A;  4P72 A;  3GTJ H;  3AFP A;  3ULL A;  1LT6 D;  2JXM B;  4RAU C;  3I4N H;  1HNX L;  3HEJ A;  1YBY A;  1H9R A;  2QEX A;  4QY7 A;  3CU7 A;  4JI6 L;  5E3F A;  2A5H A;  4DAY A;  1EL0 A;  5BN4 A;  1DOM A;  2F0T A;  4JV5 L;  1G91 A;  1Q81 C;  3AQQ A;  3S15 H;  1YNJ C;  2BH2 A;  5AJ3 L;  4B3T Q;  5C0X H;  1B9M A;  2PNR C;  3M4O B;  1GHK A;  3K8A A;  1BDO A;  1FJG L;  4R8I A;  4RWS C;  3JAM i;  1HR0 L;  4O0A A;  4OON A;  1L0W A;  3ZLM A;  2RDH A;  3S1N B;  4GKJ L;  1ET6 A;  5FJ8 G;  4UP8 A;  1BCP D;  1PTO H;  4IFD G;  4Z9C B;  1QUQ B;  2K28 A;  2EYP A;  3FKI B;  2F6S A;  2VUM H;  1FL0 A;  1C4Q A;  3IKJ A;  3HKS A;  1IHZ A;  5E1F A;  3BVM A;  3G4S A;  4G7O C;  3ZJY C;  1ONL A;  5D14 A;  4JCV E;  1W6K A;  1KAB A;  1YJN A;  2KHS A;  2SEB D;  1K8G A;  1AFP A;  1SE3 A;  1XMQ Q;  4DR2 Q;  1MHW C;  2DNC A;  1WTP A;  1CM9 A;  2ZTC A;  1L1O A;  3RLO A;  3OW7 A;  3HOZ G;  3CHB D;  3I2Z A;  1TS5 A;  3DWA A;  3OW2 A;  1Y1W B;  4DR4 L;  2E2J H;  1LLR D;  1KTK A;  5C4X H;  4LNQ A;  4I7A A;  2HT1 A;  1I6H B;  1SBB B;  5GAG C;  4A3J G;  3TDQ A;  3EQL C;  5CC4 A;  4O2D A;  3S2H H;  4ZYS A;  2PQE A;  4B9W A;  2QW7 A;  1X32 A;  3W1B A;  2IHE A;  4B3R Q;  4KKU A;  4MNO A;  1Z47 A;  4HCE A;  2XRS D;  4LFB Q;  1VQF A;  1HZB A;  1GUO A;  2C35 B;  3HG9 A;  2MFI A;  2AUJ D;  3NSW A;  5JFZ A;  1Z6H A;  2A6H C;  1BQQ T;  3CPW A;  3L7Z C;  5FLM G;  4R4C A;  3G6J B;  2UU9 L;  2ZT9 C;  1O7L A;  2Z6K A;  3TN2 A;  1SNQ A;  2QIL A;  3S1Q H;  1EQR A;  1QVF A;  2R7Z B;  5JEA G;  4U0S A;  4GN4 B;  4A3G B;  1BXT A;  1J5E L;  3M3Y B;  4X66 L;  2F0N A;  1QJO A;  3I70 A;  1CSQ A;  4LUZ A;  4A3C G;  3M4Y A;  2CH4 W;  5JJI A;  3QIA A;  2H5X A;  1TS2 A;  4QIW B;  4FF1 A;  3MA2 B;  4A3E G;  5IOC A;  2RCN A;  3G48 A;  2R93 G;  3J80 E;  2UUA Q;  3PO3 H;  3CC7 A;  3S1M H;  1ICW A;  1KD1 C;  1K83 H;  3F2U A;  2Q2T A;  3KF8 A;  1E1O A;  3UE1 A;  4QL5 A;  5C4J H;  3PV0 A;  3J81 E;  1QOH A;  1IBL Q;  1WD1 A;  1SMY D;  2XRQ D;  4C2M H;  3OMG A;  4RGN A;  4ID6 A;  3J80 i;  3KJO A;  2F52 A;  1C7Y A;  2XIW A;  2UXC Q;  3GDE A;  1GUW A;  3BZC A;  4DF7 A;  2MQH A;  4FXK C;  3CCU A;  4L5Q A;  5C0X I;  4KI0 A;  1NCV A;  4CKB A;  2R92 H;  4X62 L;  4EQP A;  4DFA A;  3OHX C;  1F9P A;  1M1K C;  1HNW L;  2Y0S G;  4M8A A;  3N52 A;  3NTH A;  3ULP A;  4KY6 A;  2A1A A;  1DZ1 A;  2DN8 A;  4OO1 H;  1EIG A;  3MHB A;  4A3K G;  3B6Y A;  4RFB A;  1SYG A;  4J6H A;  1CUK A;  3KYH C;  1JQY D;  1S72 A;  3W3A A;  3ZYY X;  4DV6 L;  4JI0 L;  3PIO A;  2OTJ A;  4GN5 A;  1GUS A;  1XWE A;  1OXT A;  5EU0 A;  3QOJ A;  4GNX B;  2JSO A;  3VR5 A;  3KF6 A;  1FNW A;  4O1N A;  2MPM A;  4KY5 A;  1E2V A;  4JVZ A;  1EQT A;  1RTO A;  3J7A V;  4RCN A;  4IUP A;  3H3V H;  3KLR A;  4GS3 A;  1K8O A;  1D7Q A;  1VF7 A;  3OWF A;  1A62 A;  1SMX A;  1YIT A;  5IY0 A;  3PMF A;  4OWX B;  4BY1 G;  2OQK A;  5C4Z A;  1SE8 A;  4C3I B;  4DUY Q;  3EVQ A;  1Y8N B;  2JA8 B;  1HUM A;  4ME5 A;  2A68 D;  2XNA C;  1QIL A;  2R61 A;  4AQY L;  2I5H A;  1DGS A;  2F0V A;  2D5D A;  4LF5 Q;  1SXT A;  4A93 G;  2IL8 A;  4RKB A;  3DM1 A;  3ZCB A;  1R4Q B;  5M3M H;  3S1R B;  2TMP A;  1WI5 A;  5JJL A;  1SJE D;  3ULJ A;  3BU2 A;  4U07 A;  3MXN A;  2UUB L;  5K36 G;  4I7Z C;  4A3F B;  2J4X A;  4A3M G;  1B9N A;  2PI2 E;  3FHW A;  3A0J A;  4DV5 Q;  2QF7 A;  1VQL A;  4OIJ A;  5DLQ E;  1H9S B;  1STN A;  3EN2 A;  3SR1 A;  4POG A;  3CCS A;  3HOW G;  4R4O A;  3GTL H;  2PMZ B;  3KDF B;  1F9S A;  1GXD C;  3PUZ A;  3VR2 A;  1WTV A;  5IOD A;  4H13 C;  3UDX A;  3RZD B;  1B1Z A;  1DOK A;  1ENC A;  1ENA A;  2F03 A;  5BN3 A;  1XPO A;  5CGL A;  3VA7 A;  1Y8O B;  5IT9 L;  2B63 H;  5KIX A;  4C3J B;  4C3H H;  1JMC A;  5FO7 B;  2F4V L;  1EY6 A;  2JP1 A;  3HOY B;  3OSO A;  5I6Y A;  1FYC A;  1BCP F;  2JA5 H;  2AQ2 B;  2D9U A;  4IAL A;  4R1J A;  5FO9 B;  1YJ9 A;  2JN4 A;  4ZQ3 A;  4LFB L;  1DOL A;  3S17 H;  4KN4 C;  2ICI A;  4UHV A;  4OWW B;  1UNS A;  4BBR B;  1SE2 A;  2KVM A;  3GQB A;  1KQS A;  1Q1E A;  3A7L A;  4K6D A;  4MTK A;  4X3U A;  5C3E B;  3URY A;  2NN6 G;  2EY5 A;  1PRT D;  3K57 A;  2UUC L;  1G29 1;  2N3S A;  2GVA A;  2MO1 A;  3I73 A;  5EKL A;  5GAH C;  4DV7 Q;  4DR3 Q;  2I0Q A;  4GZY C;  3T1H Q;  3GTJ B;  3P75 A;  4JBM A;  2L55 A;  1R9T H;  2JA6 G;  5D65 A;  4NMZ A;  4KD4 A;  4IPD A;  3RLF A;  3PO2 G;  5T1G A;  5C4X G;  4XTC S;  5M3F B;  4PY3 A;  1C0A A;  2F0O A;  2LXJ A;  4LW1 A;  1DCZ A;  2PZU A;  2EY2 A;  4K8J A;  4GLX A;  4UY8 C;  1PYW D;  1KXL A;  3PUW A;  1D5X C;  5FLX L;  1EYC A;  2DJF C;  5IGC A;  3EFX D;  4JG2 A;  5HUR A;  1PH4 A;  3W1G A;  1CK1 A;  1EQV A;  1F77 A;  2NZ1 D;  1NTG A;  1LYL A;  3A8K E;  4P74 A;  5KND A;  3D31 A;  1SDF A;  5COY A;  1MI2 A;  2VZA A;  2GVB A;  2LMC B;  1K9M C;  4KJO A;  1SN8 A;  1XPR A;  3A8I E;  5CV7 A;  2L11 A;  3A56 A;  4OGQ C;  1TWF B;  3HKZ B;  1HXY D;  4DUZ L;  4XI8 A;  3S1N H;  1EYD A;  1JJC B;  1EWC A;  1Y8P B;  1IL8 A;  2EXD A;  3MXG A;  5JJ6 A;  1OXU A;  1EYA A;  3QG1 A;  3FKI H;  4JI1 Q;  4CDD C;  2VS1 A;  2OTL A;  3P7J A;  4YY3 L;  1B3Q A;  2FMC A;  2F0L A;  3HOX G;  2MO0 A;  2C5C A;  4B3S L;  5C3X A;  4FYD A;  2RDG A;  4EVO A;  3K5L A;  3KK7 A;  1ILQ A;  1EZ8 A;  1L0Y B;  4CKE A;  3LNN A;  3CC2 A;  4DK3 C;  4Y52 H;  1O78 A;  3MXP A;  2Q8R E;  4M16 A;  1IL2 A;  1Y1W H;  4JI4 L;  2EPB A;  1I6H H;  5IGG A;  2PZT A;  2X6G A;  5M9O A;  1XNQ Q;  1K0R A;  1C9O A;  4UPA A;  1X3E A;  2KA7 A;  4DV0 Q;  3KJP A;  2Z4H A;  2XWB B;  2KBN A;  3NBH B;  3TEH B;  3T13 A;  2HDL A;  4L5R C;  4FXD A;  1E24 A;  1HR0 W;  1WTO A;  3UE0 A;  4BBS G;  1EYG A;  3DLL A;  2ZTD A;  4LF5 L;  2QGQ A;  4OO1 G;  5M5Y B;  1MBY A;  4HMJ A;  1GKH A;  4XQQ A;  1XNR Q;  5I2X A;  3GTQ B;  2RHS B;  5EPL A;  4PMW A;  3HRZ C;  4A3G H;  4A3L G;  3M3Y H;  3MEH A;  1U4P A;  3HOV H;  1GUT A;  3NQI A;  4A4I A;  1EWH A;  4KHZ A;  4DV5 L;  2IWH A;  4OXP A;  2JA7 B;  2KEE A;  1O7Y A;  4JK1 C;  1WVL A;  3HZX A;  1K3R A;  4HJ8 A;  2F0D A;  1IXR A;  1HA5 A;  1LTT D;  1I94 L;  2EYM A;  2HQL A;  2B2Y C;  2F0M A;  4AYB E;  4DR7 Q;  3I8Z A;  4QB4 A;  3U50 C;  4EQ5 A;  2O4X A;  1HUN A;  3NEM A;  3J81 L;  2IPK D;  2UXD L;  4WJ4 A;  4JI7 L;  1XMO Q;  1WD0 A;  4X3T A;  4IN3 A;  1P16 A;  2NTS A;  4FXG C;  1N33 L;  5KNC A;  2V4D A;  2SNS A;  2K5N A;  4IO9 A;  1PH9 A;  3RNU A;  4O42 A;  1B3A A;  4OX9 L;  1HFG A;  4C1N K;  5T1I A;  2CW0 C;  2Q8T A;  1XTC D;  2WKC A;  1HQR D;  4MN3 A;  4XYQ A;  1STG A;  4P71 A;  5EQ0 A;  2YTV A;  2F0Q A;  5GAD C;  5J1Z A; 
#chains in the Genus database with same CATH homology
 2JJQ A;  4JI6 L;  2UXC L;  2NZO A;  1PV4 A;  4DV4 L;  1PH8 A;  1V1Q A;  3OTO L;  4X64 Q;  3A5Z B;  1VQK A;  5BR8 L;  4JV5 L;  4LF9 Q;  1Q81 C;  3AQQ A;  4LUO A;  4BBS H;  3S15 H;  2BH2 A;  4P73 A;  4YY3 Q;  5AJ3 L;  4B3T Q;  1X56 A;  2EQS A;  3K8A A;  4LF4 Q;  3I7F A;  2VW9 A;  1FJG L;  4B3S Q;  3HFZ B;  3JAM i;  1HR0 L;  4O0A A;  4OON A;  4PZ6 A;  1L0W A;  3ZLM A;  1CSP A;  4GKJ L;  3KFU A;  3HOY G;  5FJ8 G;  2NVQ H;  4UP8 A;  3MXN B;  2B63 G;  4IFD G;  4K0K Q;  1A63 A;  1QUQ B;  3PUX A;  3TS0 A;  4A3L H;  2F6S A;  2VUM H;  4DR5 Q;  3PO3 G;  4LF7 L;  1FL0 A;  3SGI A;  1MIU A;  4QGU A;  4YWL A;  1PH6 A;  4JBJ A;  3HKS A;  1BVS A;  2HHH Q;  2E5L L;  4BBR G;  1Q82 C;  3J81 c;  3G4S A;  1I50 H;  1KRS A;  4H02 A;  4JI4 Q;  3ZJY C;  2BA1 A;  5LMN L;  4LF6 L;  4JCV E;  2ZJR A;  1BBW A;  1YJN A;  1K8G A;  1WCM H;  1PH2 A;  1XMQ Q;  3U4Z A;  2BH8 A;  2I5L X;  2R7F A;  4JI8 Q;  4DR2 Q;  4C3I H;  1N34 Q;  2UXB Q;  2JA8 H;  4POF A;  2ZTC A;  1L1O A;  2KEN A;  1UE5 A;  5E7N A;  3RLO A;  3HOZ G;  1EQQ A;  3I2Z A;  2G03 A;  3CF5 A;  3K7U C;  5IYC G;  4BXX H;  2VY3 A;  4LUV A;  3OW2 A;  2BA0 A;  4DR4 L;  3JAM c;  3M85 A;  2ZM6 L;  2E2J H;  4DR1 Q;  5C4X H;  4LNQ A;  2HT1 A;  4A3B H;  4GNX A;  1IBM Q;  1SLJ A;  5GAG C;  1IBK Q;  1FVI A;  2AWN A;  4A3J G;  1RIP A;  4LU4 A;  2R92 G;  4X65 Q;  1VQG A;  4YHH Q;  3PUV A;  4O2D A;  1OXX K;  5M3F G;  4DUY L;  3S1R H;  1WFQ A;  3U4V A;  2E2H H;  3TRZ A;  2NVY H;  2ATW A;  3NEL A;  1CKM A;  3W1B A;  2IHE A;  1J6Q A;  4B3R Q;  4MNO A;  2JEB I;  1Z47 A;  1E7Z A;  4LFB Q;  1VQF A;  4DV1 Q;  4A3F H;  1HZB A;  4GN3 B;  2C35 B;  2WFW A;  1VQ6 A;  2IY5 B;  2MFI A;  5JFZ A;  2A19 A;  4YCU A;  2CKZ B;  3CPW A;  4HJ5 A;  4A3D G;  3PGZ A;  4IFD I;  3L7Z C;  5FLM G;  4R4C A;  4UP9 A;  4JI3 Q;  4DUZ Q;  2UU9 L;  1HZC A;  2Z6K A;  1UWV A;  1CKO A;  3GTG H;  1VQD A;  3RZD H;  1NY4 A;  3M7N A;  3S1Q H;  1EQR A;  2CFM A;  4NXM L;  2PQA B;  5JEA G;  4U0S A;  4GN4 B;  1PH1 A;  1I94 Q;  3RLN A;  1J5E L;  4LFA Q;  1VQO A;  4X66 L;  1CKN B;  4A3C G;  4GLV B;  1CSQ A;  4LUZ A;  3HKZ G;  4JC0 A;  2VL6 A;  1KRT A;  1L2F A;  2F3I A;  1KHI A;  4C3J H;  5JJI A;  2ES2 A;  2H5X A;  3HOY H;  3CUC A;  3UDI A;  5H1S E;  1JJ2 A;  1YHQ A;  4A3E G;  2VQF Q;  1K73 C;  3E9H A;  1Q12 A;  2K4K A;  2RCN A;  2YTY A;  3G48 A;  2R93 G;  2UXD Q;  2UUA Q;  3H0G G;  4A75 A;  1EIY B;  3CC7 A;  4JI7 Q;  3S1M H;  3PO3 H;  3M4Q A;  5IWA Q;  1VQH A;  2I5M X;  2XGT A;  3CCV A;  1KD1 C;  1K83 H;  2Q2T A;  3J7Z C;  4BBR H;  2Z0S A;  1E1O A;  3UE1 A;  3BZK A;  1N33 Q;  4QL5 A;  2HIX A;  3PV0 A;  4ME3 A;  5C4J H;  1G6P A;  4ALP A;  5C3E H;  4JI5 Q;  1VQE A;  3KDF A;  2E8G A;  1N36 L;  1TWH H;  3S24 A;  2N78 A;  1IBL Q;  3J7A 5;  5CMT A;  3STB C;  5C44 G;  4OX9 Q;  3CCL A;  4C2M H;  1HNX Q;  3J80 i;  3KJO A;  2F52 A;  1C7Y A;  3HOZ H;  1VQ4 A;  4GOP A;  1HZA A;  2UXC Q;  1X65 A;  3SE5 A;  3GDE A;  3TRE A;  3BZC A;  1U5K A;  5M3M G;  4DV4 Q;  4JI6 Q;  1FGU A;  2MQH A;  3OTO Q;  3CCU A;  2Q2U A;  4L5Q A;  5BR8 Q;  4JV5 Q;  1SRO A;  5C0X I;  4OO1 I;  4IOA A;  4KI0 A;  4JBK A;  4ITR A;  4A3J H;  1VQ7 A;  1LM0 A;  2R92 H;  2JEA I;  2ALY B;  4X62 L;  5AJ3 Q;  5M3F H;  1AH9 A;  3LET A;  4KLK A;  1M1K C;  1V9P A;  1FJG Q;  1O7I A;  1HNW L;  4PZ8 A;  1GO3 E;  2Y0S G;  4A3I H;  1HR0 Q;  3K0X A;  4NB3 A;  4DV7 L;  4DR3 L;  4GKJ Q;  3CPF A;  3T1H L;  2Y0S E;  5HY6 A;  3ULP A;  4KHP L;  2A1A A;  2IX1 A;  3ICE A;  4A3K G;  3B6Y A;  4LF7 Q;  2N8N A;  4A3D H;  1W2B A;  4R4I A;  1CUK A;  1YVC A;  1Q1B A;  3KYH C;  1L1O B;  4LF8 L;  5FLM H;  3M4P A;  1S72 A;  4DV6 L;  3H3V I;  4JI0 L;  2E5L Q;  3J80 c;  3PIO A;  3GO5 A;  5LMN Q;  2OTJ A;  1K8A C;  1TXY A;  4GN5 A;  1VQ5 A;  4YWM A;  4A76 A;  2JA5 G;  4HIO A;  1A8V A;  5EU0 A;  1OXT A;  1LTL A;  1UE1 A;  4GNX B;  4A3C H;  1TWF H;  1VQC A;  1VQA A;  1YHB A;  3KF6 A;  3CCR A;  2R7Z G;  3M4O H;  2RF4 A;  4U0U A;  4IJL A;  2WP8 J;  4A3E H;  3S2H H;  3H3V H;  4GS3 A;  4Y7N H;  4DR4 Q;  2ZM6 Q;  3GTM H;  3H0G H;  4JOI C;  2JA7 G;  1D7Q A;  3GTO H;  1ASZ A;  1A62 A;  1SMX A;  4QIW E;  2LSS A;  2KHJ A;  4MZ9 A;  1YIT A;  1GVP A;  4OWX B;  1YHA A;  4BY1 G;  2OQK A;  2IX0 A;  5IY0 A;  1SE8 A;  4DUY Q;  3I4M G;  4X6A H;  1KAW A;  4J15 A;  1EIF A;  4IFD J;  1SR3 A;  2VNU D;  4N67 A;  3F1Z A;  2IHF A;  5IYD G;  2PNH A;  4AQY L;  2I5H A;  1VQN A;  1DGS A;  2JQO A;  4JI1 L;  4HJ7 A;  5IP7 G;  1S3O A;  1U0L A;  3T1Y L;  4LF5 Q;  4A93 G;  1I5F A;  1N32 L;  1W3S A;  4YWK A;  4LFC L;  3ZCB A;  2D62 A;  1Y14 B;  1BKB A;  5M3M H;  1AE2 A;  1QVF A;  4BA1 I;  1WI5 A;  2HHH L;  3W5O A;  2UU9 Q;  3ULJ A;  5JJL A;  3BU2 A;  2CWA A;  4U07 A;  4TVA B;  2GN5 A;  1PYB A;  2KHI A;  4QJF A;  3WWV A;  2UUB L;  3CW2 C;  5GRO A;  2FXQ A;  3ER0 A;  1M90 C;  4NXM Q;  5K36 G;  1VQJ A;  4JI2 L;  4A3M G;  4X2D A;  5JFF A;  1J5E Q;  3K81 C;  4X66 Q;  1GM5 A;  2PI2 E;  3FHW A;  1ASY A;  3A0J A;  1WYD A;  4DV5 Q;  3RN5 A;  1PYS B;  3KF8 B;  1VQL A;  4NXN L;  5DLQ E;  1VQP A;  1E22 A;  3EN2 A;  1XJV A;  2JK8 A;  4POG A;  2VQE L;  1IZ6 A;  3CCS A;  3HOW G;  1B8A A;  1UE7 A;  1X6O A;  4R4O A;  3GTL H;  3KDF B;  1SRU A;  5IE8 A;  3AEV A;  3PUZ A;  4A3K H;  1XNQ L;  3UDX A;  3I4O A;  4DV0 L;  2NVX H;  3PCO B;  1PHJ A;  2CCZ A;  4DR6 L;  1UEB A;  1XPO A;  5CGL A;  5M5Y H;  4LWC A;  2HIV A;  3CMA A;  1EFW A;  5FJ8 H;  3UDG A;  5ELN A;  4GOP B;  2B63 H;  3CAM A;  3RZO H;  4IOC A;  4IPH A;  4C3H H;  3JC6 6;  1JMC A;  2F4V L;  2R7D A;  4RG1 A;  4WGJ A;  1N9W A;  3GTQ H;  1WJJ A;  1N36 Q;  4JYA L;  2JA5 H;  1A0I A;  3J81 j;  3CCQ A;  4GKK L;  1HH2 P;  3A5U A;  3FKI G;  5C0X J;  2D0O A;  4R1J A;  1YJ9 A;  5LMN W;  3MEF A;  2R7Z H;  2R6G A;  2CQO A;  4LFB L;  3CCJ A;  2KCM A;  3S17 H;  3K7A H;  3S2D H;  3ZC7 A;  4DAY B;  4OWW B;  1B7Y B;  4B3M L;  3HOU G;  4WJ3 M;  3NEN A;  2JA7 H;  1MKH A;  1XNR L;  1E1T A;  2K5H A;  1Q1E A;  1KIX A;  1KQS A;  2QA4 A;  4YCW A;  3IRB A;  2NN6 G;  2UUC L;  4X62 Q;  1G29 1;  2DGY A;  2N3S A;  2RHQ B;  1YZ6 A;  3I4M H;  2NVT H;  2GVA A;  2MO1 A;  3CP0 A;  4GLA C;  5IYC H;  4XIG S;  3DM3 A;  4DV2 L;  4HIK A;  5GAH C;  5IYD H;  4DV7 Q;  4DR3 Q;  2I0Q A;  3GD7 A;  1Y1W G;  3T1H Q;  4JBM A;  4KHP Q;  4HIM A;  1R9T H;  5IP9 G;  1JE5 A;  2JA6 G;  4BXX G;  4A93 H;  3EBE A;  4IPD A;  3RLF A;  1NJI C;  3PO2 G;  4BY7 H;  1YJW A;  5C4X G;  2PQA A;  4XTC S;  4JBW A;  4A3B G;  4QQB X;  3LGJ A;  4BY7 G;  3KF6 B;  4PY3 A;  1BBU A;  1C0A A;  2K50 A;  2LXJ A;  1Y1V G;  2B3G A;  4DV6 Q;  4LW1 A;  4JI0 Q;  1MJC A;  3ERS X;  3RR5 A;  4DR7 L;  4L5T A;  5IYB G;  1KXL A;  4OWT B;  4GLX A;  1X3F A;  4UY8 C;  1XPU A;  3PUW A;  2V1C C;  1NMF A;  1UE6 A;  3CCM A;  3UDF A;  3CQZ H;  2JE6 I;  1Q46 A;  4JG2 A;  1Q86 C;  2NZH A;  3M9B A;  1XMO L;  3W1G A;  4A3M H;  5IT9 c;  1PH4 A;  4U04 A;  1X55 A;  3CCE A;  1Q7Y C;  2ID0 A;  4BA2 I;  1B70 B;  1NTG A;  1LYL A;  4P74 A;  5GAE C;  1T9H A;  3D31 A;  4AH6 A;  3KLW A;  1YNX A;  4LF6 Q;  3HOW H;  1KC8 C;  2WAQ E;  1HJP A;  2VZA A;  3FP9 A;  2GVB A;  3F8T A;  5M5W H;  4DV3 L;  1K9M C;  4UP7 A;  2N49 A;  3KOJ A;  1HNZ L;  1SN8 A;  1XPR A;  5J3B A;  2ZTE A;  4PG3 A;  4A3G G;  1PH5 A;  1VQB A;  5LMU L;  2A8V A;  3HOV G;  2PMZ E;  1OXV A;  2D0P A;  2AWO A;  4DUZ L;  4XI8 A;  3F2B A;  3S1N H;  4QY7 A;  1JJC B;  1OTC A;  2NN6 I;  4R4T A;  2R93 H;  3A74 A;  3F2C A;  1PVO A;  4X64 L;  2EXD A;  4AQY Q;  5JJ6 A;  1NMG A;  1OXU A;  2ZJQ A;  4LF9 L;  4IPC A;  1LUZ A;  3FKI H;  1N8R C;  1IYJ B;  2PI2 A;  4JOI A;  4JI1 Q;  1TWA H;  2VS1 A;  4P75 A;  1VQ9 A;  3STB D;  3T1Y Q;  3D0F A;  2OTL A;  4YY3 L;  4U0Z A;  3AYH B;  4B3T L;  4LFC Q;  1N32 Q;  2YTX A;  2OCE A;  4DNI A;  3TS2 A;  4LF4 L;  3HOX G;  5GQO A;  3EIV A;  3HOU H;  2MO0 A;  4B3S L;  5JJ7 A;  4DR6 Q;  5C44 H;  4K0K L;  3OYY A;  1EUJ A;  2EIF A;  3G71 A;  3TQY A;  1VQM A;  1G51 A;  2UUB Q;  5C3E G;  4L5S A;  2UXB L;  4DR5 L;  3PF5 A;  3CC2 A;  3K80 C;  2YYZ A;  4JI2 Q;  4DK3 C;  4NPS A;  1L1O C;  4Y52 H;  1PA6 A;  3CC4 A;  4DAM A;  4NXN Q;  5FLX c;  4M16 A;  1IL2 A;  1Y1W H;  4JI4 L;  2VQE Q;  1QVC A;  4MTN A;  5IP9 H;  1QUQ A;  1X9N A;  2OWO A;  2JA6 H;  3GTP H;  3AFQ A;  1I6H H;  4AIM A;  3SN9 A;  4GNX C;  3RN2 A;  3VDY A;  3PO2 H;  1XNQ Q;  5CKL A;  2JA9 A;  1K0R A;  1C9O A;  2K52 A;  1X3E A;  2DUD A;  4PZ7 A;  4UPA A;  4DV0 Q;  4DR2 L;  4JI8 L;  3KJP A;  2ZJP A;  1XMQ L;  1N34 L;  1VCI A;  3CD6 A;  4HJA A;  3NBH B;  2KBN A;  1Y1V H;  3TEH B;  3L2P A;  3GTK H;  3I4N G;  2YU9 H;  3G6E A;  4L5R C;  5IYB H;  4TQU S;  3N3U A;  2Q2I A;  1E24 A;  2F4V Q;  1HR0 W;  1H95 A;  4A3I G;  4JYA Q;  4DR1 L;  4GKK Q;  1TWG H;  1IBM L;  3UE0 A;  1Q8K A;  1IBK L;  1JB7 A;  4APV A;  1EYG A;  3L0O A;  3Q8D A;  3DLL A;  3F2D A;  4BBS G;  2AKW B;  2ZTD A;  4X65 L;  4LF5 L;  2QGQ A;  4YHH L;  5C0X G;  4OO1 G;  1OXS C;  1GD7 A;  3I55 A;  4B3M Q;  1X3G A;  1GKH A;  2AHO B;  1P8L A;  4B3R L;  3E0E A;  2Z6K C;  3E9I A;  2L15 A;  1PH3 A;  1X54 A;  1XNR Q;  3SHG A;  4FDB A;  2RHS B;  4PMW A;  1HZ9 A;  4A3G H;  2WB1 G;  1KL9 A;  4DV1 L;  4A3L G;  3H15 A;  2UUC Q;  3M3Y H;  3HOV H;  1VQI A;  1XTD A;  1D8L A;  3PUY A;  2VUM G;  4DK6 C;  2XTI A;  5M5X H;  2ASB A;  1I3Q H;  1JJG A;  2WB1 E;  1JT8 A;  2CWP A;  3S14 H;  2K14 A;  4A4I A;  3PSI A;  4IJH A;  4DV2 Q;  4KHZ A;  4IPG A;  4DV5 L;  2OQ0 A;  1YIJ A;  1YEZ A;  4OXP A;  4JI3 L;  4X2E A;  3CME A;  4X2C A;  5JEA J;  3HKZ E;  1NBW A;  1SFO H;  2B29 A;  4BY1 H;  1QZG A;  1V43 A;  3S16 H;  1K3R A;  4HJ8 A;  4HID A;  1QZH A;  1IXR A;  2IT1 A;  1WCM G;  1I94 L;  3HOX H;  4LFA L;  1HNW Q;  4AYB G;  3PIP A;  2JA8 G;  3I56 A;  1QVG A;  3U58 A;  2HQL A;  2Q2H A;  1PH7 A;  4AYB E;  1PFS A;  2AMC B;  2K5V A;  4DR7 Q;  2MNA A;  3BJU A;  1VS0 A;  3U50 C;  1EWI A;  1EOV A;  4EQ5 A;  5IP7 H;  2VQF L;  3NEM A;  5ELO A;  4WJ4 A;  1TWC H;  4RMF A;  1E3P A;  2UXD L;  2UUA L;  4EX5 A;  3CXC A;  4JI7 L;  1XMO Q;  5IWA L;  2YV5 A;  1CKN A;  4LF8 Q;  1WOC A;  1P16 A;  4GOP C;  2E2I H;  1VQ8 A;  4DKA C;  4YCV A;  4R4Q A;  1N33 L;  4DPG A;  1RL2 A;  1AE3 A;  2K75 A;  1NE3 A;  5HGQ A;  3S6A A;  4JI5 L;  4P72 A;  2K5N A;  3GTJ H;  4IO9 A;  1PH9 A;  3RNU A;  3AFP A;  3ULL A;  4DV3 Q;  1IBL L;  3PF4 A;  1HNZ Q;  4OX9 L;  2LXK A;  4HJ9 A;  4A3F G;  1YI2 A;  3I4N H;  1HNX L;  5LMU Q;  3J81 i;  1YBY A;  5JJK A;  2WAQ G;  1S40 A;  4P71 A;  5GAD C;  1MJE A;  2QEX A;  2YTV A;  5EAY A;  2KCT A;  1Z9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...