4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
molecule tags Cell adhesion
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
4A3GH 2NVQH 4LF7L 4JG2A 2MQHA 5C44H 1VQ5A 4DR4L 1YHQA 3HFZB 4QJFA 2NVTH 3GTJH 1Q81C 4AQYL 3F8TA 3S15H 4JI6Q 4LFAL 5IT9c 1SE8A 2NN6G 1E22A 1L1OB 2HT1A 2JEAI 1NJIC 5M5YH 1IBMQ 3K80C 4A75A 2WB1E 5GROA 2UUCL 4NXMQ 1C9OA 5AJ3Q 4LF5L 2EXDA 1Q86C 1YHAA 4DV3L 4IOAA 4LF9Q 1J6QA 3CAMA 3LGJA 3G4SA 1YJNA 5IYCG 2A1AA 3J80c 1KD1C 1CSPA 1EQRA 4DV5L 4WGJA 4JI2L 4DR1Q 5IWAQ 3F1ZA 1HNZQ 1VQCA 3BU2A 3HKZG 1Q46A 4X66Q 4DV1L 1YEZA 1VQIA 3GDEA 3NBHB 1HR0L 1J5EQ 2UU9Q 3Q8DA 4JBJA 3CC7A 3GTGH 1EFWA 4DAMA 1GD7A 1I3QH 3U4ZA 3KDFA 2XTIA 3K0XA 4JI5L 1BKBA 5JJKA 4DV2L 3VDYA 1XMQL 3CC2A 3L0OA 3CC4A 4OX9L 1XNQL 4LNQA 5CMTA 3GTPH 1PH4A 3ZLMA 3K7AH 4UP8A 4UY8C 2D62A 1UEBA 2AHOB 4IFDJ 1QUQB 2E2HH 4P74A 2FXQA 3KF6A 2KENA 3J80i 1SMXA 4B3TL 3J7A5 4LUZA 4A3LH 3K7UC 1XTDA 4AYBE 5GAGC 3UDIA 4XTCS 3D31A 1TXYA 1XPUA 3GTQH 5E7NA 3S2HH 2EQSA 4A3DG 1PH9A 5EU0A 1QZHA 1S3OA 4DR7L 2F52A 4GNXA 5FLMH 4POGA 2UXBQ 1H95A 1Y1VH 3I55A 2VQFL 4IO9A 2HHHQ 2JA5H 4JI4L 2B63H 2JA8G 5IYDH 1X56A 4YWLA 1JMCA 1YBYA 4WJ3M 4GOPB 1VQLA 4NPSA 4A76A 2VQEL 4X2EA 1NMGA 4MNOA 4DK6C 1VQKA 4A3CH 2QEXA 1NTGA 1L0WA 3I4OA 5IE8A 3M85A 1JJ2A 1B7YB 1IBKL 4LFBL 5FJ8H 1SFOH 4X65L 2BA1A 5H1SE 2B3GA 1Y14B 2OQKA 3OTOL 1YHBA 1HZAA 1WYDA 3AFQA 1GM5A 1KXLA 2IX0A 1EUJA 4GKKQ 4DR3L 2K5VA 4X62L 2F4VQ 3HKSA 1U5KA 1IXRA 1IYJB 1IZ6A 5GQOA 4PMWA 1E7ZA 4DR5L 1XJVA 2ZM6L 1W2BA 1IBLQ 2WP8J 1HZ9A 1WJJA 3HOWG 1PH5A 3STBD 5BR8Q 4A3CG 4A3JH 4DV7L 4YY3Q 1T9HA 3S24A 2AWNA 5IYBH 2ALYB 3CCJA 3I2ZA 2YV5A 4JI7Q 1PYBA 5HGQA 1LTLA 3I7FA 3CP0A 4YHHQ 1N33Q 4X2CA 2K50A 4GLVB 1XPRA 2WAQE 5C0XJ 2VS1A 1R9TH 1N34L 1JB7A 3CCEA 3M3YH 1VQAA 1FJGQ 5GAEC 1OXXK 5M3FH 1YNXA 4LF7Q 1HNWL 2JA7H 1WFQA 1LM0A 1KL9A 3OYYA 4OWTB 4DR4Q 1YIJA 2UXDL 4HIKA 4DR2L 3CXCA 5C3EH 4AQYQ 3J81c 4YWKA 3PSIA 4LFAQ 2C35B 3U4VA 2OQ0A 5JJLA 4OONA 4GLXA 1TWCH 3D0FA 1HNXL 2E5LL 4JV5Q 2BH8A 2WB1G 2Y0SE 1RL2A 4A3FH 1K3RA 5M5WH 1VQFA 2UUCQ 1AH9A 1P8LA 1EOVA 2PQAA 4LF5Q 5IP9H 1N9WA 5JEAG 5M3FG 3WWVA 4GN4B 2IHEA 4GNXC 4R4OA 4A3MG 2JA7G 4DV3Q 1MJEA 1UWVA 4L5RC 1YJWA 1ASYA 2QA4A 4HIOA 3GTKH 4DV5Q 3G48A 4JI2Q 3ULPA 3KJOA 1OXUA 4ME3A 3T1HL 3F2CA 3M4QA 3J81i 4A93G 2I5HA 2Q2TA 2JA9A 1HR0Q 1N32L 1PVOA 4R4TA 1D8LA 5IP9G 3ERSX 3PUWA 3M7NA 1P16A 4K0KL 1KRSA 2KCTA 3I4MG 5C4JH 4JI5Q 4KI0A 5IYCH 4DV2Q 1X6OA 1XMQQ 3PGZA 1Q7YC 1XNQQ 1UE5A 4OX9Q 4OO1G 5HY6A 1TWHH 1KQSA 3FHWA 4DV0L 1QVFA 4X6AH 1EIFA 2OCEA 2YTYA 1G6PA 2MNAA 3EIVA 1I50H 3FKIH 4B3TQ 1N36L 1GO3E 3U50C 4LF6L 2I5LX 1SR3A 3CCQA 4U07A 1I94L 4LF4L 1FVIA 2ZJPA 1CKNA 1UE7A 3L7ZC 3MXNB 3SHGA 4JI3L 3SE5A 3G6EA 3HOVG 5JJ7A 4RG1A 4R4CA 4C3HH 1IL2A 1K73C 1XMOL 1MIUA 3CCMA 5LMUL 3CMAA 4DV4Q 2R92H 2D0OA 1C0AA 2JQOA 1X3FA 2VQFQ 3U58A 4JI4Q 3FKIG 4U0SA 3M4PA 2KCMA 1HJPA 2K52A 2CCZA 3TRZA 2K75A 1HH2P 2K14A 4U04A 5ELNA 3AFPA 4C3JH 3HOXH 2VQEQ 4A3DH 2N49A 4NB3A 4DV6Q 1Z47A 4GS3A 1JT8A 1E3PA 2L15A 1PH2A 2QGQA 2JA6G 5EAYA 4LFBQ 1VQJA 1IBKQ 3FP9A 2YYZA 1VQOA 4X65Q 2JA8H 2R92G 3UDXA 4JI0L 3W1GA 2BH2A 2CKZB 2ES2A 5GAHC 1X65A 4C2MH 4DR3Q 4KHPQ 4X62Q 1K83H 2DGYA 2UUAL 1UE1A 4DR5Q 3HOUH 4IPDA 2AMCB 3HOXG 4P75A 3N3UA 2KHJA 1VQ8A 3BZCA 2E2JH 1Q12A 4DK3C 1VQGA 2VZAA 5LMNW 4DV7Q 4JYAL 4L5QA 3DM3A 3M9BA 3JAMc 4X64L 2EIFA 5C0XG 1G51A 4DUZL 5K36G 4N67A 4FDBA 4PY3A 1A0IA 5JJIA 3GO5A 3SGIA 3CCLA 2WAQG 2Q2HA 1UE6A 4O0AA 3HOWH 4JI8Q 1KAWA 5GADC 4GKJL 1FL0A 1B8AA 2E2IH 1HNWQ 5JFFA 3KLWA 2GVBA 4DR6L 1PH7A 4DR2Q 2NN6I 4QIWE 2E8GA 1OXVA 3A5ZB 2NVXH 2VY3A 1YVCA 2ZTEA 4POFA 3CPWA 1YJ9A 3I4NG 3W5OA 4TVAB 4HIMA 3JAMi 1QVGA 1HNXQ 3PCOB 2E5LQ 4B3RQ 4IOCA 4BA2I 1YI2A 2JK8A 3A74A 3KF8B 3RLFA 1WOCA 5FLXc 4ALPA 4U0UA 3E0EA 2N78A 4HIDA 3HOYG 1M1KC 2IT1A 2B29A 3HOZG 3S1MH 3BJUA 1BBUA 4Y52H 1PH8A 2Q2IA 5IY0A 1VQHA 2ZJRA 1QZGA 4LU4A 5DLQE 1PV4A 1A8VA 3PV0A 4B3ML 3ZC7A 4JI1Q 1VCIA 2GN5A 1G291 1PH3A 4BY7G 4QGUA 2UXCL 1Y1WG 4NXNL 2LSSA 3KDFB 4LUOA 3T1HQ 1V9PA 4BXXG 1O7IA 4A3MH 1HR0W 2UUBL 3H15A 1Z9FA 1N32Q 1L1OA 3PO2G 4K0KQ 3JC66 4A3BG 1SROA 4IPHA 4OXPA 2PI2A 3DLLA 1AE3A 1WCMH 3STBC 3KF6B 3BZKA 4DV0Q 3IRBA 4P73A 2ATWA 4GLAC 4EX5A 2HQLA 4GN3B 2ID0A 3AEVA 3E9HA 4A93H 2AKWB 1N36Q 1PYSB 2KBNA 2CWAA 4R1JA 3K8AA 1KRTA 3CCVA 4LF6Q 2RF4A 3TS0A 1I6HH 1X3GA 4LF4Q 1JJCB 3CW2C 1X9NA 4UP7A 1I94Q 3I4MH 4HJ9A 4GNXB 2XGTA 4RMFA 1K8AC 2R7DA 2G03A 4IJHA 3I56A 1WCMG 4XI8A 3S14H 4BY1G 3L2PA 3PF4A 1A63A 1NBWA 2D0PA 2ZTDA 1MJCA 1OTCA 2A8VA 5LMUQ 3CCSA 1HZCA 4LF8L 4DV1Q 1HZBA 1W3SA 3PF5A 4ITRA 3G71A 2GVAA 2VL6A 3A5UA 2OWOA 1FGUA 2YU9H 2R7ZH 4LWCA 5IP7G 4P71A 3PIPA 3H3VH 4YCVA 3HOVH 2YTVA 4MZ9A 2ASBA 2MO0A 2Z0SA 1QUQA 4DKAC 4C3IH 4OWXB 3PUZA 1BBWA 3UDGA 3M4OH 4IFDG 2PNHA 3T1YL 4A3LG 3PUVA 3CF5A 5LMNL 4EQ5A 4YY3L 2Q2UA 3S2DH 5CGLA 1CSQA 4KLKA 2N3SA 4JI0Q 4WJ4A 3AYHB 5M3MH 1M90C 2V1CC 3NELA 3RN2A 3KFUA 4AYBG 3S1QH 2R7ZG 3UDFA 2UUAQ 3MEFA 1SN8A 5JFZA 4KHPL 3ULJA 4DAYB 4GOPA 2JA6H 2AWOA 2HIVA 1VQPA 1K9MC 4DUYL 3J81j 1XNRL 4DR7Q 4JYAQ 4X64Q 3KOJA 2R93H 5C4XG 4DUZQ 2CFMA 2K5HA 3RR5A 1L1OC 1OXSC 1RIPA 4LW1A 4A4IA 1NMFA 4HJ8A 3S17H 4JV5L 4IJLA 5M3MG 1I5FA 2R93G 3RZDH 4TQUS 5JJ6A 3F2DA 4A3IH 1JJGA 4GKJQ 4A3GG 1Q1EA 3W1BA 4BBRH 1TWFH 2K5NA 5C44G 4B3SL 2NZHA 4DR6Q 1NE3A 3SN9A 4L5SA 1VQBA 4JBKA 1GVPA 1AE2A 4DPGA 3OTOQ 1VQMA 1X55A 2PI2E 4PZ8A 4M16A 5JEAJ 2PQAB 2WFWA 4LFCL 1L2FA 4JOIA 3B6YA 1N8RC 3CUCA 4J15A 1VQ6A 3OW2A 2HIXA 1A62A 5ELOA 2ZM6Q 3KJPA 1TWAH 4A3IG 3PIOA 3S16H 1KIXA 4IPGA 3S1NH 1CUKA 3NEMA 1QVCA 1BVSA 3UE1A 2H5XA 4YCWA 4BBRG 3CD6A 4HJ7A 4GN5A 1K0RA 2IX1A 1SRUA 1TWGH 4JI6L 1NY4A 1PHJA 1Q8KA 3TQYA 1C7YA 3I4NH 2I5MX 4B3MQ 4OWWB 4JBWA 4JC0A 1IBML 2UXCQ 4H02A 1CKOA 1EYGA 1EIYB 1U0LA 4NXNQ 4NXML 5AJ3L 1N34Q 1LYLA 3PUYA 1PA6A 3HOYH 2F6SA 3HOZH 2UUBQ 3NENA 4PG3A 1E1OA 1EWIA 4X2DA 1LUZA 3AQQA 3UE0A 3ICEA 4IFDI 2PMZE 4LF9L 4OO1I 2UXDQ 2NZOA 4XIGS 1XPOA 2ZJQA 1DGSA 3EN2A 1VQ4A 4UPAA 4DR1L 3CPFA 5IWAL 1VQDA 1HNZL 5J3BA 1VQ7A 2LXKA 4BY7H 4DV4L 1Y1WH 1CKNB 1VQEA 1X54A 2R6GA 2Y0SG 3HKZE 3K81C 4IPCA 3PUXA 4QY7A 4X66L 4GOPC 2I0QA 2UU9L 1J5EL 3H3VI 4BXXH 4L5TA 1WI5A 1EQQA 3E9IA 2Z6KA 1JE5A 1B70B 2RHQB 1X3EA 1S40A 2RHSB 1VQ9A 3PO2H 4A3BH 1PFSA 4U0ZA 3CCUA 3TREA 4JCVE 2ZTCA 4A3EH 4APVA 3GTOH 1E24A 4DV6L 3RLNA 1VS0A 4MTNA 1PH1A 3F2BA 4JBMA 4BBSH 1GKHA 3RN5A 3ZCBA 2NVYH 2KHIA 5FLMG 4LF8Q 1Y1VG 3KYHC 4HJAA 1Q82C 2B63G 2JA5G 5IYDG 4P72A 4AH6A 2OTLA 3LETA 4Y7NH 2CQOA 3S1RH 4UP9A 1SLJA 1YZ6A 1VQNA 5CKLA 1YITA 4JOIC 4A3EG 4A3KH 2VUMH 2OTJA 3T1YQ 4BY1H 2K4KA 5LMNQ 2RCNA 4BBSG 3RLOA 3GD7A 2UXBL 5FJ8G 5M5XH 3PO3H 3S6AA 2JJQA 2HHHL 4BA1I 3CMEA 4HJ5A 3TS2A 4YWMA 5IP7H 4R4QA 3H0GH 3CCRA 3HOUG 1D7QA 4PZ6A 4JI3Q 4JI8L 3ULLA 4LUVA 4YCUA 4AIMA 4QL5A 1OXTA 5C0XI 4A3KG 2VUMG 2A19A 3J7ZC 1FJGL 3RNUA 4A3JG 2MFIA 1E1TA 1KHIA 2VW9A 4DUYQ 1XMOQ 1XNRQ 3RZOH 5IYBG 1PH6A 1CKMA 1MKHA 3A0JA 2JE6I 3PO3G 4GKKL 4DNIA 2F4VL 2IHFA 2R7FA 1K8GA 4B3RL 2JEBI 3GTLH 3H0GG 1IBLL 2N8NA 3EBEA 1Q1BA 1V43A 3TEHB 2IY5B 4PZ7A 5BR8L 4KHZA 4B3SQ 1KC8C 2VNUD 5C4XH 4JI7L 2YTXA 5C3EG 2Z6KC 2F3IA 2DUDA 1N33L 4JI1L 2BA0A 4YHHL 4LFCQ 3ZJYC 1V1QA 2CWPA 2MO1A 4QQBX 4O2DA 1S72A 3GTMH 2LXJA 3CQZH 4R4IA 4A3FG 3ER0A 1ASZA
chains in the Genus database with same CATH superfamily
2EOTA 2DY8A 2MQHA 5T1GA 1A6XA 1VQ5A 1SE2A 1H9SA 4RWSC 4DR4L 4CDDC 2NVTH 1Q81C 1R9TB 4H13C 4ZQ3A 1L1OB 2HT1A 2JEAI 3RZOB 3WOFA 2A74C 2EXDA 1RHPA 5EJWA 4X3SA 4IOAA 1CI3M 1TWCB 1ICFB 1ET9A 2RKSA 4K2LA 3G4SA 2F0HA 2K28A 4RKBA 1HUNA 3DWPA 3VR4A 2E75C 5C4ZA 4U673 3TN2A 1Q46A 4X66Q 2IJ0A 5C4HA 3BVMA 3MFYA 1EFWA 1GD7A 1HUMA 1KABA 3L3OC 2XTIA 3K0XA 3JAML 5DAUA 3FMCA 1XMQL 3P75A 2KECA 3AB9A 4LNQA 5CMTA 3ZLMA 3K7AH 2D62A 2F0SA 3I72A 1A15A 2AHOB 2E2HH 1TWHB 4FXKC 4KN7C 1XTDA 4DAVA 5GAGC 1LTSD 2Z6BA 3UDIA 4XTCS 5AFWA 4J1MA 1XPUA 1STNA 3NHHA 5E7NA 4PMBA 1PH9A 2DJFC 4H7BA 1QZHA 3K5OA 1E2VA 1MSHA 2EYLA 3T53B 5KRUA 4K6DA 4GNXA 2UXBQ 3I55A 4JI4L 1YNJC 4IO9A 2JA8G 4YWLA 1LV9A 1SJED 4IUTA 3NUCA 3FEWX 4A76A 1QOHA 2VQEL 1ZYRD 1VQKA 1EEFD 2NBFA 3V05A 4LFBL 1I3QB 1AW7A 2BA1A 2SOBA 1Y14B 3AFQA 3TZDA 4GKKQ 2F4VQ 2K5VA 1U5KA 5GQOA 1CZGA 3I90A 2JA8B 2WP8J 1WJJA 1G2SA 3STBD 1PZJD 2HDLA 2F03A 1BUVT 1K83B 2RVLA 1DM0B 4CJ2C 5IGGA 2YV5A 4B9WA 2FFKB 2PZTA 1LTLA 3S2HB 4DAYA 1B50A 1EFID 1G6ZA 2K50A 4GLVB 2JP1A 2Q8TA 3V2TA 4LF7Q 1HNWL 4KV6A 1EQTA 1SE4A 2E76C 1YIJA 4HIKA 3R3OA 3PSIA 4LFAQ 3U4VA 5EGTA 2Z4HA 1C4QA 4GLXA 3D0FA 3D4DA 1HA6A 1RL2A 1QB5D 1IYUA 2UUCQ 4LF5Q 4GNXC 5I2XA 4DV3Q 1LTRD 3FRPB 1ASYA 3Q24A 2NN6H 4KJNA 1GJXA 1PFBA 1SSOA 5I2YA 5LL6S 3T1HL 3M4QA 5FLXE 1UEAB 2I5HA 2IX3A 2JA9A 2K6AA 1HR0Q 1PVOA 3LNNA 3ERSX 4K0KL 2RQXA 1UAPA 3I4MG 2F0JA 4KI0A 5IYCH 2X69A 3K58A 2M00A 4DV0L 1QVFA 2YTYA 1WD1A 3TP7A 5ELBA 1N36L 1GO3E 3I8ZA 2EE1A 1SR3A 1FVIA 2ZJPA 3HOVG 2SEBD 4F7XA 5JJ7A 1IL2A 3CCMA 5EKKA 1C0AA 3GTKB 2KCMA 2K52A 3TP5A 2A6EC 2L5TA 5CYUA 1E3PA 1JCKB 1DD2A 2JA6G 2DY7A 2PMZB 5EAYA 3HOVB 5K36H 3FP9A 1VQOA 2R92G 3UDXA 1DCZA 3W1GA 4DXGA 3KUPA 1W6JA 4C2MH 3NQTA 4DR3Q 4KHPQ 2GA4B 1RTNA 2DGYA 5ELEA 4DR5Q 4P75A 2KHJA 4KHVA 3BZCA 1RJTA 1Q12A 4DFAA 4DK3C 3JAMc 1GHJA 2HD3A 4FDBA 4N9PA 3CKIB 4DAPA 3D3RA 4EQNA 3CCLA 1PRTD 4L8JA 1UE6A 2R92B 2K01A 3SVMA 1KAWA 3MXPA 5GADC 1LABA 3G7LA 2X6LA 4DR6L 4CKCA 4G57A 1OXVA 5CORA 2NVXH 2ZTEA 1PFMA 1V1OA 1TWFB 4ZYSA 4HIMA 1HNXQ 1A3TA 2JK8A 3KF8B 4NW2A 1WOCA 4O1NA 3HOYG 1B44D 3HOZG 1RKNA 2IT1A 5I9PA 3BJUA 1BBUA 2F0GA 2OT2A 4LAAA 2Q2IA 1TWAB 5IGFA 1PV4A 3ZC7A 4JI1Q 2KVMA 2GN5A 2UXCL 1PH3A 3HG9A 4QGUA 4BY7G 4IALA 2EJFC 3KDFB 1AEXA 4LUOA 4BXXG 2UUBL 1N32Q 1Z9FA 1L1OA 2KJXA 5ELDA 3JAME 4H0LC 1F2ZA 2C9OA 1SNCA 3HOYB 1G8ZD 3HOZB 3I4LA 4JK1C 1D1IA 1LT4D 4EX5A 2HQLA 4A93H 3WDNA 4LJZC 5JVG3 5EKIA 4LF6Q 1I6HH 1W6KA 4BY7B 1I94Q 1X9NA 2JYOA 4UP7A 3AU7A 3EFXD 1X3QA 4OO1H 1RF2D 2R7DA 3I56A 2K03A 1A63A 3W2DA 1TVXA 1OTCA 1I6VC 5HGTA 2NZ1D 1HZCA 1LT3D 2J4XA 3TDQA 4CDCC 3A5UA 2YU9H 3H3VH 2NVYB 3PIPA 2MO0A 3UDGA 4C3IH 1WTOA 4F87A 3T1YL 5IT9L 3CF5A 4YY3L 1BDOA 1VDZA 1GUSA 2ZT9C 1TS4A 1E2WA 2WACA 2V1CC 3NELA 3RN2A 3UDFA 2CHBD 3MEFA 5JFZA 1PTOH 2RA4A 3J80L 4YIJA 3NTHA 5D3IB 1PYWD 3J81j 2MJ8A 4DNTB 3F2UA 5C4XG 1L1OC 1NSNS 2CH4W 3CRLC 1LTTD 4A4IA 4HJ8A 4JV5L 2E2DC 5M3MG 1HQRD 2CW0C 4WJWA 4RGOS 3F2DA 1WTVA 4GKJQ 2NZHA 2F0WA 3GTLB 3SHLA 3SN9A 4L5SA 4JBKA 1ENFA 2PNRC 4DPGA 1KTKA 1ONLA 3OTOQ 1X55A 1VQMA 4M16A 3HS0C 4LFCL 3B6YA 1N8RC 3CUCA 1L0XB 5C4XB 1A62A 2ZM6Q 2G9HD 3S16H 4IPGA 1S5FD 4I7ZC 5M3MB 4BBRG 2MHVA 3KBXA 1SRUA 1PHJA 3TQYA 3I4NH 2I5MX 4GZYC 4QIWB 1H9SB 2NVTB 3K5LA 3E5SA 4NXML 1EIHA 1LYLA 1EWIA 4KD3A 3MFGA 3UE0A 4V0BA 4LF9L 2NZOA 4XIGS 5CBAE 5C3XA 4BBRB 5DNFA 1VQ7A 2LXKA 4DV4L 1CKNB 1X54A 1CZWA 2R6GA 4EQPA 4QY7A 4B08A 2UU9L 4ZUIA 1EQQA 2ATWA 2Z6KA 2RHQB 1AP0A 2I46A 5KNCA 4U0ZA 1PXUA 3CCUA 2F3VA 4DV6L 3RLNA 5FKAC 4CDEC 5DM73 3F2BA 3N52A 1JORA 3RN5A 1ZXTA 4XQJA 2SNMA 2L9HA 4KY6A 4LF8Q 4HJAA 3K7AB 1U4MA 4UP9A 1SLJA 1II3A 2E2HB 4BY1H 2RCNA 2Z8LA 3GD7A 5KYLA 5M5XH 3PO3H 2JJQA 5CC4A 5CV8A 3DHQA 4WORA 1SYBA 3MXGA 3O13A 3U9SA 4JI3Q 4LUVA 1A3VA 5C0XI 4C1NK 1I4XA 2BE5C 2F0FA 1XMOQ 1PH6A 3E0JA 3SK5A 1GUWA 1CKMA 1MI2A 1EYCA 1MKHA 3A0JA 3GTOB 3H0GG 1IBLL 1JC7A 1V43A 3SR1A 2IY5B 1JOKA 4DU9A 1H9RA 4B3SQ 1LT6D 4JI7L 2P5ZX 3VA5A 1F9SA 4HTHA 2Z6KC 2F3IA 3ONAB 2BA0A 1EIGA 1TY0A 2MO1A 2ZXOA 4QQBX 3CQZH 4R4IA 3ER0A 5EPLA 1RODA 4JG2A 5EKLA 2FMMA 2F3WA 3D4RA 3H0GB 3HFZB 4QJFA 3R2IA 4JI6Q 5I9OA 5IT9c 2NN6G 2F0IA 3URYA 2A5HA 1NJIC 5M5YH 1IBMQ 4PNYA 3K80C 3C1EA 5GROA 5AJ3Q 1Q86C 3K0YA 4TSSA 2JSOA 3J81E 1EU4A 3OWFA 3KF8A 5IYCG 2KHSA 3NTKA 3J80c 3L9AX 1CSPA 1EQRA 1Q3LA 4Q0FA 4JI2L 5IWAQ 3F1ZA 1HNZQ 4NDXA 3BYYB 4QMGA 1ET6A 1LTAD 2KOLA 4DV1L 2XN9C 5CV4A 4Z9CB 3Q8DA 3GTGH 1PTOD 3KDFA 4DV2L 1C8CA 3CC2A 4OX9L 4FXDA 1SNQA 1PH4A 2NVQB 5C44B 1UEBA 3GV3A 3V96A 1TS2A 2O5JC 4LUZA 3K7UC 3K6OA 5IT9E 1TXYA 4KK7A 1S3OA 1GUGA 4DR7L 3Q23A 3QB3A 3SEBA 5FLMH 4POGA 2B63H 2G5DA 2JA5H 5IYDH 5D3DA 3HRZC 4BWGB 5FLXL 4OELB 1VQLA 2LKVA 3BDOA 4NPSA 3K5NA 1SE3A 4X2EA 3EJIA 1NR2A 4MNOA 4A3CH 1F77A 1NTGA 1L0WA 5IE8A 1JJ2A 3BG3A 5D14A 1F2YA 1JE4A 5H1SE 1KXLA 2OQKA 1YHBA 1CT1D 1V1PB 2IX0A 3GP7A 3GTPB 4X62L 1IZ6A 1XJVA 1GUOA 4PMWA 4S3SA 1PH5A 4C2MB 4I65A 4LK1C 1KDBA 2AWNA 2ALYB 2EVBA 1I4RA 2XVSA 4CBVA 1ZYRC 1PYBA 2LS01 1A2TA 3GTQB 1N33Q 3CP0A 4YHHQ 4X2CA 5IOCA 5C0XJ 2RBMA 1QNUA 2VS1A 1JB7A 1VQAA 2EY2A 5GAEC 1OXXK 5M3FH 1YNXA 5K5PA 2JA7H 3M4YA 3M7GA 3OYYA 4DR4Q 5C3EH 4PV1C 2C35B 3DWAA 3TBIB 4OONA 2WB1G 2Y0SE 4A3FH 1AH9A 1SFOB 1CHPD 3ND8A 1CFMA 1P8LA 4CJ1B 4G7OC 5IP9H 1N9WA 1FD7D 4HSVA 1YJWA 4IQZA 4OGQC 2QA4A 2XWJB 4RA8A 3ULPA 3KJOA 4R8IA 1WTRA 5I6WA 4A93G 2Q2TA 4LMQD 3M7NA 1KRSA 1ICWA 3MAQA 4OO1G 4O42A 1XMQQ 3PGZA 4IUVA 4K5XA 1AN8A 2VXWA 3FKIH 4XQNA 4LF4L 2A73B 3ND9A 1CKNA 3L7ZC 3SHGA 3G6EA 4A93B 4C3IG 2D5DA 1R4QB 2H1EA 3X3NA 4C3HH 3E6ZX 4I7AA 4ODGA 1I6HB 1JR0D 4JI4Q 3A7AB 3TRZA 2K75A 4C3JH 3HOXH 4U04A 2VQEQ 4A3DH 2BCOA 3H09A 2L15A 4LFBQ 2J0TD 5CMDA 1AZQA 1M8AA 3OMCA 4RH6A 1DOMA 2CKZB 3OOCA 3QR8A 2BH2A 1X65A 3VR6A 1B9NA 4IPDA 2AMCB 2A68D 4C1NI 4X3TA 2B2WC 4L5QA 3DM3A 4H44C 3M9BA 1G51A 4DUZL 1SEBD 4N67A 1PTOB 2OEOA 4PY3A 3GO5A 2DNCA 2WAQG 4ZUJA 2Q2HA 4HR7B 3HOWH 4JI8Q 1B8AA 2E2IH 3LWEA 1HNWQ 2GVBA 1DOLA 1B53A 2HCIA 5CV6A 4QIWE 3GQBA 3EA6A 2F0DA 1YVCA 3CPWA 3I4NG 4MTKA 3W5OA 5EBCA 5EBDA 1EU3A 1GUNA 3JAMi 3P20A 1GHKA 4BA2I 3NQIA 1SNPA 1ML0D 4IN3A 3SE0A 5JOBA 5FLXc 3S1MH 4OIJA 2N78A 1PRTC 4RAUC 2B29A 2WAQB 2PZUA 1PDQA 4LU4A 3S16B 1SYGA 4FVMA 1STAA 5DLQE 2E2JB 1BXTA 2BDOA 2CQAA 3T1HQ 2ZXRA 1V9PA 3I4NB 4A3MH 5JEAH 5F2DA 1B9MA 4K0KQ 3NWTA 4IPHA 4OXPA 2PI2A 3DLLA 4K8IA 3BZKA 5T1IA 4DV0Q 1LACA 1STHA 4GLAC 1NNXA 2ID0A 1N36Q 2KBNA 2ZXPA 1KRTA 2RF4A 1X3GA 1JJCB 3CW2C 3A8KE 2NB0A 1K8AC 3S14H 4IJHA 5EPKA 1WCMG 1IKMA 5D65A 2KCCA 2K32A 4BY1G 3L2PA 5G3LD 1MJCA 4XYQA 3CCSA 1SDFA 3C1FA 3PF5A 4ITRA 1TT2A 3U9OA 2R7ZH 4LWCA 1WTQA 4KKTA 5CV7A 1DJRD 4MZ9A 3M4OH 4DKAC 1ILQA 4OWXB 4IFDG 1D6EC 1OO9B 4HN7A 3NWSA 5LMNL 4EQ5A 3S2DH 4HMIA 3MEHA 2PZWA 1EY0A 4KLKA 3A8IE 1WCMB 1RDPD 4BY1B 1H9JA 5FOBB 1SN8A 2NUNA 1JOQA 3DMUA 2Q8RE 1H9KA 1SNOA 1S5BD 1VQPA 1K9MC 4P2CB 3I4MB 5FK9C 4CDFC 3RR5A 1LLRD 4IUQA 5FO7B 3BS1A 1G2TA 3S17H 3CRKC 4IJLA 1I5FA 1FR3A 4RFBA 2XWBB 1V1PA 1JJGA 2V4DA 2FINB 3S1QB 4DR6Q 3OW7A 3A54A 1AE2A 2PI2E 1GOZA 1CA5A 2WFWA 3OW2A 5ELOA 5C3WA 2L0CA 4A3IG 4G4KA 1KIXA 2HCCA 3NEMA 2H4OA 1QVCA 4IZ8A 1BVSA 4YCWA 2NUCA 3CD6A 1K0RA 2IX1A 3CQZB 1JWSD 1TWGH 4QF4A 1C7YA 3GV6A 4DF7A 3MZ5A 2JA6B 3MVVA 4JC0A 2UXCQ 2EZVA 1N34Q 2UUBQ 4IFDI 1LUZA 3AQQA 2UXDQ 3N6RA 4KKUA 2ZJQA 4A3IB 3K59A 2FHTA 3EN2A 1BQQT 1D5MC 2BOSA 4DR1L 1J8IA 5J3BA 5J39A 2Y0SG 4R9WA 4DXFA 4ZK9B 2I0QA 2R93G 1HRJA 1J5EL 5C6AA 1WI5A 3RMHA 2RHSB 3PQIA 2K1BA 1EL0A 4G7ZC 2ZTCA 4A3EH 4XT1B 2OXPA 4BBSH 3ZCBA 4K5WA 1S5DD 2KHIA 1CTMA 5FLMG 2B39A 2F0VA 2B63G 4ZRZA 5IYDG 2JA5G 4XYOA 1IYVA 3T16A 2CQOA 3S1RH 1HTPA 2Z9HA 4MHEA 2Y0SB 2R93B 1DOKA 1Q90A 2EJGC 2MPMA 5CKLA 4JW0A 3J81L 2VUMH 1GUTA 3T1YQ 2K4KA 3S9WA 3RLOA 3OPOA 3QO2A 4NMZA 2HHHL 4BA1I 1LO5D 3CMEA 4HJ5A 1H9MA 1D7QA 3CCRA 1Z7TA 4PZ6A 2A69D 2B63B 4YCUA 2JA5B 1OXTA 4A3KG 3J7ZC 4DA2A 3RZOH 3IAYA 1K0SA 3SXHA 2EDGA 2IHFA 2QCPX 2JEBI 2PCFB 2BDNA 3OIPA 1AZPA 3NBIA 5BR8L 2RDHA 1LTBD 1KC8C 2VNUD 2EYPA 2YTXA 5C3EG 4A3KB 4JI1L 4ULLA 4LFCQ 2CWPA 1X32A 4O2DA 1S72A 3GTMH 2LXJA 4A3FG 4HAEA 3ITPA 1FJGL 4A3GH 3BYTB 3GTJH 4AQYL 4M1UB 1G91A 1E22A 1WVLA 2C5CA 4A75A 5C3EB 2WB1E 4NXMQ 2F0PA 3SDZA 2QEJC 1YHAA 1CHQD 4LF9Q 1J6QA 3CAMA 3LGJA 4A3FB 1YJNA 1KD1C 1BNZA 2KEEA 1DZ1A 4DV5L 2RSOA 1MSGA 4IUUA 1VQCA 3HKZG 1EY7A 1CA6A 1YEZA 1JQYD 1T5XD 3WOEA 1WTWA 2UU9Q 1FYCA 1F9QA 4JBJA 4ZKCB 4OEMB 5E1FA 1I3QH 3EVQA 4JI5L 1BKBA 5JJKA 1PRTF 3H3VC 3L0OA 1B3QA 1XNQL 5J22A 2A6HD 4B9XA 4UY8C 4C3HG 2VB3X 4IFDJ 4B3TL 2FXQA 3J80i 2EJMA 2NTSA 3PIP3 4A3LH 4ILWA 4AYBE 3HKZB 1SBBB 3S2HH 2EQSA 1BBXC 4A3DG 4QB4A 2XRQD 1PTOC 2SNSA 3OMGA 1QJOA 2EXZA 3I3CA 4RGNA 2VQFL 1X56A 1JMCA 2FJ2A 1YBYA 2EYOA 2O2LD 4C3HB 4GOPB 4UAIA 2L11A 1PRTB 1NMGA 4DK6C 2QEXA 1QE6A 3I4OA 1IHZA 1FNWA 1IBKL 5FJ8H 4X65L 3OTOL 2B3GA 1GM5A 2EYJA 4A3DB 2J7ZA 2LMCB 1EUJA 2N55A 4KY7A 1MHWC 3BDCA 3HKSA 1IYJB 1QCBD 3OSOA 2ZM6L 1XWEA 1W2BA 1IBLQ 5JJZA 1HZ9A 3HOWG 4DV7L 3VYTA 3D8GA 3S24A 5IYBH 3CCJA 1XYIA 3QWNA 4JI7Q 1IL8A 1HCZA 3KLSA 1I4QA 1ZEQX 1XPRA 2WAQE 2NTTA 5KGUA 3CCEA 3M3YH 1ZKOA 2PO4A 3R93A 3R2TA 4OWTB 2K5QA 4DR2L 3CXCA 2I07B 3HOWB 3J81c 1L0YB 1BCPD 1F9PA 3SK6A 5LL6X 1QILA 3KLSX 2E5LL 2B2VA 2BH8A 4OL7A 4N8X1 5KIXA 1SNDA 5M5WH 4A3MG 3PMFA 5JEAG 3WWVA 4GN4B 2IHEA 3DWQA 2F0TA 1JICA 4Q5VA 1GXDC 3S1MB 3GTKH 4JI2Q 4ME3A 5JVH3 4R4TA 1D8LA 3PUWA 1P16A 1EWHA 2KCTA 4G7HC 3D6CA 5C4JH 1NR4A 1ESRA 1HHVA 4DV2Q 1X6OA 4OX9Q 4A3MB 2F0KA 5HY6A 1CQVA 5DM63 2K05A 1KQSA 4V190 4X6AH 2OCEA 1G6PA 1I50H 1PLFA 2ENBA 4K8JA 2I5LX 1UNSA 2EY5A 4U07A 2L12A 1UE7A 4NP5A 4JI3L 2JXMB 2RCFA 3DEOA 4RG1A 4K5VA 2M2LA 1K73C 1XMOL 1MIUA 5LMUL 3CMAA 2R92H 3W3AA 2JQOA 1X3FA 4U0SA 1HJPA 2FMCA 2CCZA 4OIKA 5ELNA 1HH2P 2K14A 3AFPA 1EZ6A 1JT8A 1Z47A 4GS3A 2B2VC 1PH2A 3OWEB 3IFTA 1VQJA 4HEDA 3M4OB 2EPBA 2B8GA 4JI0L 3C46A 2L55A 4ZCKA 4X3KA 1HXYD 3H6MA 4X62Q 2UUAL 5CV9A 5I4DA 1MGSA 1RTOA 1TS3A 2PPBC 3IL8A 3N3UA 1VQ8A 5E4XA 3DM1A 2VZAA 5NUCA 4JYAL 1D5XC 4X64L 5K36G 4J6HA 2AQ2B 5BN3A 2QW7A 2F0OA 3SGIA 2QKIC 1ENAA 1F2MA 4O0AA 1Y8OB 3S17B 1Y69U 3KLWA 1E2ZA 1V8QA 1YNND 2NN6I 2E8GA 2A68C 3A5ZB 4CKEA 1R4PB 3ZYYX 4POFA 2NUDA 1Z6HA 4TVAB 4HCSA 2IPKD 4B3RQ 1TY2A 3RLFA 4HIDA 4Y52H 1PH8A 3T4AC 2HDMA 1QZGA 1A8VA 4B3ML 1JWUD 1G291 4K2KA 2DJGC 1K3BC 4NXNL 2M9VA 2B2UA 1EY6A 4IUNA 1EZ8A 1O7IA 1E0BA 4QCLA 1FGBD 3JC66 2XRSD 1AE3A 4U68A 3STBC 3KF6B 4P73A 2MP1A 3E9HA 2AKWB 2NVXB 1PYSB 4R1JA 3CCVA 4LF4Q 1U4PA 3HP3A 3MTSA 4HJ9A 3J7AF 1IW7D 2XGTA 4RMFA 2G03A 1B2TA 4XI8A 2WIIB 3PF4A 3CHBD 1SXTA 4WFN3 2A8VA 2B2WA 5HURA 4RHRA 3G71A 1BCPB 2OWOA 1HTLD 4P71A 1O78A 4YCVA 2WB1B 4RHSA 2Z0SA 5C5LA 1TU2B 1EY8A 3NE5B 3FVQA 4K6LA 3S1RB 1AFPA 2N3SA 5IGBA 5M3MH 1M90C 3KFUA 1WTHA 4AYBG 4ME5A 1NAPA 2EY1A 4TKOB 2MGSA 4GOPA 2AWOA 1CK1A 2F0EA 2B2UC 4DUYL 1XNRL 4HMJA 3J7AV 4DUZQ 2CFMA 2PW5A 1OXSC 1STGA 1PTOF 4EQOA 3RZDH 4TQUS 5JJ6A 4A3GG 1Q1EA 3BVZA 3W1BA 4BBRH 4DN4M 4AYBB 2YU9B 5C0XH 1NE3A 2HQEA 1VQBA 1GVPA 3QG1A 4C3IB 5BN4A 4FF2A 1C48A 2ICEC 4PZ8A 5JEAJ 2PQAB 1L2FA 2Z4IA 2KA7A 5IGEA 1SMYD 4HCEA 2HIXA 5IIFA 2IW3A 3KJPA 3PIOA 3S1NH 1T5EA 2XNAC 4HJ7A 3GTMB 4GN5A 4ZKBB 3Q22A 2B8FA 4KY5A 3TZUA 4A3GB 3KK7A 4OWWB 4JBWA 2N88A 1CKOA 1BR9A 3GTJB 1SYCA 1U0LA 3NXWA 1PA6A 1EQVA 3X3MA 1KNEA 1E1OA 4X2DA 4OO1I 2QILA 2F0LA 5FO8B 5KEEA 1Y8PB 1B1ZA 1DGSA 4UPAA 3CPFA 5M9OA 1Y1WH 3MC0B 2F0NA 3HKZE 4X66L 3PUXA 4GOPC 3H3VI 1S4ZA 4A3LG 3E9IA 1JE5A 1S40A 1X3EA 1VQ9A 3PO2H 4E6IA 4A3BH 4RGMA 3VA7A 3TREA 2LY7A 4KTAA 4APVA 3GTOH 1E24A 1STEA 1KDCA 4MTNA 1PH1A 1EY9A 1GKHA 3DUZA 1K28A 3KYHC 4P72A 2OTLA 2O5IC 2EYFA 4Y7NH 4XT3B 2QDLA 1BO0A 2SDFA 1VQNA 4UDUC 3ERQA 5KNDA 3HEJA 1YITA 4FO2A 2WKDA 5LMNQ 1HFNA 5EPJA 1HQMC 2UXBL 5FJ8G 3S6AA 1SYDA 3TSSA 3TS2A 3NTIA 5IP7H 4R4QA 3H0GH 3PIO3 2Q8IB 3VYRA 4KKSA 4JI8L 4QL5A 2A19A 1E1TA 3RD4A 5IYBG 3QIAA 3PO3G 3J7YW 4GKKL 4DNIA 2F4VL 1EOTA 5COYA 4F8MA 2N8NA 3EBEA 1Q1BA 3TEHB 1SYEA 2AQ3B 4PZ7A 2F0MA 4KMUC 1NCVA 3VR5A 2A69C 4TRDA 3SK8A 2F4IA 1BF4A 3ZJYC 1V1QA 1KNAA 3A7LA 5M5XB 1BOSA 3PO3B 4L5TA 4J8QA 1ASZA 2NVQH 4LF7L 4DK0A 5C44H 5L37A 1YHQA 1EY5A 3F8TA 3S15H 3M3YB 4LFAL 1SE8A 3DEPA 1LTID 5LHY1 3LWUA 2QDBA 5ISRA 2UUCL 1C9OA 4LF5L 4DV3L 1EWCA 2VB2X 5M5WB 4JVZA 2A1AA 1K8MA 3TP8A 4RKLA 4WGJA 1KLUD 4DR1Q 3BU2A 4PQXA 2E74C 1VQIA 3GDEA 3NBHB 5I6YA 1J5EQ 1HR0L 3CC7A 3KBGA 1D5ZC 4DAMA 3VYSA 3U4ZA 4CGYB 1O7YA 3VDYA 2R61A 3CC4A 1WTXA 1YNJD 3GTPH 5J1ZA 2WKCA 4KD4A 4UP8A 3AMUA 4N8FA 5C4JB 1QUQB 3J7A5 4P74A 3KF6A 2K7VA 2KENA 1SMXA 1LTGD 1LT5D 1KLGD 5M5YB 1EY4A 1I50B 3D31A 3HZXA 3GTQH 1M4VA 3P7JA 5EU0A 3NSWA 1S5ED 2F52A 1MBYA 1H95A 1Y1VH 2HHHQ 2A6HC 4WJ3M 2R3ZA 3VR2A 3RUZA 1TIID 3GTGB 3M85A 1B7YB 5ELFA 1SFOH 1HZAA 1WYDA 1SYFA 2JN4A 4DR3L 3HOUH 3LX0A 4KHPL 1IXRA 3Q6SA 4DR5L 1E7ZA 3E3XA 4QUFA 1STBA 4PMCA 1NUCA 5BR8Q 4A3CG 2CH4A 2K04A 4A3JH 4YY3Q 1T9HA 1TR5A 1TQOA 3CU7A 3I2ZA 3C3LA 5HGQA 4F88A 3I7FA 1R9TH 3QOJA 1N34L 5G3LF 1FJGQ 1WD0A 5IODA 1LM0A 1WFQA 1KL9A 2IWHA 2UXDL 3TP6A 4AQYQ 3FPPA 2B2TA 4YWKA 2OQ0A 5JJLA 3MHBA 4JV5Q 1TWCH 1HNXL 1O7ZA 1ILPA 1ENCA 1K3RA 1VQFA 1EOVA 2PQAA 5M3FG 4R4OA 5ELCA 2JA7G 1MJEA 1UWVA 4L5RC 1CM9A 5KNBA 2DNEA 3A55A 3OHXC 4R8NA 4HIOA 4M8AA 4DV5Q 3G48A 1EYDA 1XXGA 3I73A 1OXUA 2EYHA 3H94A 3F2CA 1NH1A 3J81i 1BCPC 1UUPA 3D6WA 1N32L 1U4LA 3VR3A 5IP9G 2AUJD 1D1KA 5BN5A 4JI5Q 3C2PA 1Q7YC 1XNQQ 1UE5A 3K5MA 5M3FB 2O4XA 1TWHH 5E3FA 3FHWA 2JA7B 1EIFA 1SAPA 2MNAA 3EIVA 4B3TQ 1XX8A 2A6ED 3U50C 4LF6L 3CCQA 1I94L 4L6TB 3MXNB 3SE5A 4HSPA 4FNFA 3H91A 4R4CA 1B3AA 1TKWB 5A35A 1I4GA 4DV4Q 2DN8A 2D0OA 2VQFQ 3U58A 3FKIG 3M4PA 4XDXA 2IL8A 2EY6A 2B2TC 1F2LA 3BVGA 3UI2A 2X6GA 2N49A 4NB3A 4DV6Q 1ESFA 2QGQA 4WRDA 5A2QL 1IBKQ 2YYZA 4ABNA 5FO9B 4X65Q 2JA8H 2ES2A 1O7LA 5GAHC 3MWYW 1PZKD 1K83H 1UE1A 4C3JG 3HOXG 3FKIB 4ZAIA 2E2JH 1PMRA 1VQGA 2AQ1B 3P1HA 5LMNW 4DV7Q 1WTPA 5C0XG 2EIFA 5KYIA 3EQLC 5JJIA 1A0IA 1RCVD 5TSSA 1DXMA 3OIQA 4X3UA 4GKJL 1FL0A 2QF7A 2RDFA 5JFFA 1PFNA 1PH7A 3RZDB 4DR2Q 4C3JB 2TSSA 3HOXB 1HPCA 2D2CC 2VY3A 2PW7A 3Q0AA 1YJ9A 2E5LQ 1CQFA 1QVGA 3PCOB 4IOCA 1YI2A 1EEID 3A74A 4C56C 4ALPA 3E0EA 4U0UA 2B2YA 4ZLTF 2WINB 1M1KC 3HGBA 1IKLA 5IY0A 1VQHA 2ZJRA 2PQEA 3S1NB 3PV0A 5CV5A 1YNNC 4IURA 1VCIA 2EYMA 4RCNA 1JB3A 1Y1WG 2WV6D 2LSSA 2NWGA 1FNUA 1HFGA 3FDTA 1I4PA 2K33A 1HR0W 3H15A 1EYAA 3DXJC 4EGVA 2LFNA 3PO2G 3VYUA 3FPUB 4A3BG 1SROA 1WCMH 3MA2B 2E2IB 1VF5C 3IRBA 3AEVA 4GN3B 4FF1A 4MIUA 2CWAA 3K8AA 4OHJA 3TS0A 2TMPA 3I4MH 1Y1WB 4GNXB 4IFDH 3NBHA 1QNKA 3QOLA 3PO2B 1NBWA 2D0PA 1TS5A 2ZTDA 4A3BB 2L4NA 4K14A 5LMUQ 4LF8L 4DV1Q 1HZBA 1W3SA 2F0QA 2GVAA 2VL6A 5CBEE 1FGUA 3S1QH 5JPNC 5IP7G 4QUCA 3HOVH 2YTVA 2ASBA 1HA5A 1QUQA 1SJHD 2K5DA 1BBWA 3PUZA 2PNHA 1STYA 2RDGA 3PUVA 2CVRA 2Q2UA 5CGLA 4Y7NB 1Q8IA 1CSQA 1IW7C 1QG7A 2CW0D 2B2YC 4FF3A 4JI0Q 4WJ4A 2F1MA 3AYHB 2R7ZG 2UUAQ 3NP8A 4RCOA 4XXEA 4DGZA 2OF1A 3ULJA 4DAYB 5CR3A 2JA6H 1KAAA 2HIVA 4JYAQ 4DR7Q 1B4OA 2KUMA 4X64Q 3KOJA 4CHTB 2PYKA 1PZID 2K5HA 5JPMC 1RIPA 3S14B 1KDAA 1VMPA 4LW1A 1NMFA 4L63B 5DEHA 2Z1CA 4A3IH 3BZDB 1JWMD 1O80A 3A8JE 4FP5D 1TWFH 2K5NA 3NK9A 5C44G 4B3SL 2R7ZB 5IGCA 3ICEA 2F0UA 1VMCA 3S2DB 4JOIA 2G9DA 4XQQA 4J15A 4EVOA 1VQ6A 1TWAH 3IFDA 3G6JB 1CUKA 2MUYA 3UE1A 2H5XA 4FF4A 3QJYA 3SK4A 1D2BA 1A3UA 4JI6L 1NY4A 1Q8KA 3K57A 4B3MQ 1IBML 5EQ0A 4H02A 2R93H 1EYGA 1EIYB 1X3PA 4NXNQ 5AJ3L 3S15B 3PUYA 1Y8NB 3A56A 3HOYH 2F6SA 3HOZH 3NENA 4PG3A 1SNMA 1SMYC 2PMZE 4BS9A 4ID6A 2XIWA 3KLRA 1XPOA 1FNVA 1VQ4A 4JPBW 5IWAL 1VQDA 2D9UA 4UHVA 1HNZL 4BY7H 3D4WA 1VQEA 3K81C 3BDLA 1MD2D 1VF7A 2K5WA 4IPCA 4BXXH 1B70B 1PFSA 4JCVE 3J80E 2HUGA 3TMEA 3MXUA 5JAVA 1VS0A 4JBMA 1K8OA 4CKBA 4IUPA 2NVYH 3IKJA 1TWGB 1Y1VG 1Q82C 3T13A 4AH6A 3LETA 1QWYA 1BCPF 1YZ6A 2BE5D 4JOIC 4A3EG 4A3KH 2KCNA 5CGKA 5A2QE 2OTJA 1DONA 4BBSG 3MXNA 3R8BA 4NKLA 1U4RA 2NYZD 1U9RA 4YWMA 3EROA 4FXGC 3HOUG 5E4WC 5IGDA 4N9TA 2AUKA 2L1BA 3ULLA 1Y1VB 3I91A 5C5MA 2KQ3A 4AIMA 4RGTA 2VUMG 3RNUA 4A3JG 2MFIA 1KHIA 2VW9A 4DUYQ 1XNRQ 1JOOA 4A3EB 2JE6I 2XSCA 3I70A 3T56B 4BBSB 1K8GA 2R7FA 4B3RL 3GTLH 4MN3A 1F9RA 4DK1A 1RD9D 1S5CD 4KN4C 2KEDA 1A2UA 3T51B 3HOUB 4KHZA 1J9OA 1XTCD 1DYQA 4KJOA 5C4XH 2DUDA 4FYDA 1N33L 2VUMB 4YHHL 4A3JB 4CJ0B 2RSNA 2ICIA 4DNRB 1I4HA 3NPPA
chains in the Genus database with same CATH topology
4A3GH 2NVQH 4LF7L 4JG2A 2MQHA 5C44H 1VQ5A 4DR4L 1YHQA 3HFZB 4QJFA 2NVTH 3GTJH 1Q81C 4AQYL 3F8TA 3S15H 4JI6Q 4LFAL 5IT9c 1SE8A 2NN6G 1E22A 1L1OB 2HT1A 2JEAI 1NJIC 5M5YH 1IBMQ 3K80C 4A75A 2WB1E 5GROA 2UUCL 4NXMQ 1C9OA 5AJ3Q 4LF5L 2EXDA 1Q86C 1YHAA 4DV3L 4IOAA 4LF9Q 1J6QA 3CAMA 3LGJA 3G4SA 1YJNA 5IYCG 2A1AA 3J80c 1KD1C 1CSPA 1EQRA 4DV5L 4WGJA 4JI2L 4DR1Q 5IWAQ 3F1ZA 1HNZQ 1VQCA 3BU2A 3HKZG 1Q46A 4X66Q 4DV1L 1YEZA 1VQIA 3GDEA 3NBHB 1HR0L 1J5EQ 2UU9Q 3Q8DA 4JBJA 3CC7A 3GTGH 1EFWA 4DAMA 1GD7A 1I3QH 3U4ZA 3KDFA 2XTIA 3K0XA 4JI5L 1BKBA 5JJKA 4DV2L 3VDYA 1XMQL 3CC2A 3L0OA 3CC4A 4OX9L 1XNQL 4LNQA 5CMTA 3GTPH 1PH4A 3ZLMA 3K7AH 4UP8A 4UY8C 2D62A 1UEBA 2AHOB 4IFDJ 1QUQB 2E2HH 4P74A 2FXQA 3KF6A 2KENA 3J80i 1SMXA 4B3TL 3J7A5 4LUZA 4A3LH 3K7UC 1XTDA 4AYBE 5GAGC 3UDIA 4XTCS 3D31A 1TXYA 1XPUA 3GTQH 5E7NA 3S2HH 2EQSA 4A3DG 1PH9A 5EU0A 1QZHA 1S3OA 4DR7L 2F52A 4GNXA 5FLMH 4POGA 2UXBQ 1H95A 1Y1VH 3I55A 2VQFL 4IO9A 2HHHQ 2JA5H 4JI4L 2B63H 2JA8G 5IYDH 1X56A 4YWLA 1JMCA 1YBYA 4WJ3M 4GOPB 1VQLA 4NPSA 4A76A 2VQEL 4X2EA 1NMGA 4MNOA 4DK6C 1VQKA 4A3CH 2QEXA 1NTGA 1L0WA 3I4OA 5IE8A 3M85A 1JJ2A 1B7YB 1IBKL 4LFBL 5FJ8H 1SFOH 4X65L 2BA1A 5H1SE 2B3GA 1Y14B 2OQKA 3OTOL 1YHBA 1HZAA 1WYDA 3AFQA 1GM5A 1KXLA 2IX0A 1EUJA 4GKKQ 4DR3L 2K5VA 4X62L 2F4VQ 3HKSA 1U5KA 1IXRA 1IYJB 1IZ6A 5GQOA 4PMWA 1E7ZA 4DR5L 1XJVA 2ZM6L 1W2BA 1IBLQ 2WP8J 1HZ9A 1WJJA 3HOWG 1PH5A 3STBD 5BR8Q 4A3CG 4A3JH 4DV7L 4YY3Q 1T9HA 3S24A 2AWNA 5IYBH 2ALYB 3CCJA 3I2ZA 2YV5A 4JI7Q 1PYBA 5HGQA 1LTLA 3I7FA 3CP0A 4YHHQ 1N33Q 4X2CA 2K50A 4GLVB 1XPRA 2WAQE 5C0XJ 2VS1A 1R9TH 1N34L 1JB7A 3CCEA 3M3YH 1VQAA 1FJGQ 5GAEC 1OXXK 5M3FH 1YNXA 4LF7Q 1HNWL 2JA7H 1WFQA 1LM0A 1KL9A 3OYYA 4OWTB 4DR4Q 1YIJA 2UXDL 4HIKA 4DR2L 3CXCA 5C3EH 4AQYQ 3J81c 4YWKA 3PSIA 4LFAQ 2C35B 3U4VA 2OQ0A 5JJLA 4OONA 4GLXA 1TWCH 3D0FA 1HNXL 2E5LL 4JV5Q 2BH8A 2WB1G 2Y0SE 1RL2A 4A3FH 1K3RA 5M5WH 1VQFA 2UUCQ 1AH9A 1P8LA 1EOVA 2PQAA 4LF5Q 5IP9H 1N9WA 5JEAG 5M3FG 3WWVA 4GN4B 2IHEA 4GNXC 4R4OA 4A3MG 2JA7G 4DV3Q 1MJEA 1UWVA 4L5RC 1YJWA 1ASYA 2QA4A 4HIOA 3GTKH 4DV5Q 3G48A 4JI2Q 3ULPA 3KJOA 1OXUA 4ME3A 3T1HL 3F2CA 3M4QA 3J81i 4A93G 2I5HA 2Q2TA 2JA9A 1HR0Q 1N32L 1PVOA 4R4TA 1D8LA 5IP9G 3ERSX 3PUWA 3M7NA 1P16A 4K0KL 1KRSA 2KCTA 3I4MG 5C4JH 4JI5Q 4KI0A 5IYCH 4DV2Q 1X6OA 1XMQQ 3PGZA 1Q7YC 1XNQQ 1UE5A 4OX9Q 4OO1G 5HY6A 1TWHH 1KQSA 3FHWA 4DV0L 1QVFA 4X6AH 1EIFA 2OCEA 2YTYA 1G6PA 2MNAA 3EIVA 1I50H 3FKIH 4B3TQ 1N36L 1GO3E 3U50C 4LF6L 2I5LX 1SR3A 3CCQA 4U07A 1I94L 4LF4L 1FVIA 2ZJPA 1CKNA 1UE7A 3L7ZC 3MXNB 3SHGA 4JI3L 3SE5A 3G6EA 3HOVG 5JJ7A 4RG1A 4R4CA 4C3HH 1IL2A 1K73C 1XMOL 1MIUA 3CCMA 5LMUL 3CMAA 4DV4Q 2R92H 2D0OA 1C0AA 2JQOA 1X3FA 2VQFQ 3U58A 4JI4Q 3FKIG 4U0SA 3M4PA 2KCMA 1HJPA 2K52A 2CCZA 3TRZA 2K75A 1HH2P 2K14A 4U04A 5ELNA 3AFPA 4C3JH 3HOXH 2VQEQ 4A3DH 2N49A 4NB3A 4DV6Q 1Z47A 4GS3A 1JT8A 1E3PA 2L15A 1PH2A 2QGQA 2JA6G 5EAYA 4LFBQ 1VQJA 1IBKQ 3FP9A 2YYZA 1VQOA 4X65Q 2JA8H 2R92G 3UDXA 4JI0L 3W1GA 2BH2A 2CKZB 2ES2A 5GAHC 1X65A 4C2MH 4DR3Q 4KHPQ 4X62Q 1K83H 2DGYA 2UUAL 1UE1A 4DR5Q 3HOUH 4IPDA 2AMCB 3HOXG 4P75A 3N3UA 2KHJA 1VQ8A 3BZCA 2E2JH 1Q12A 4DK3C 1VQGA 2VZAA 5LMNW 4DV7Q 4JYAL 4L5QA 3DM3A 3M9BA 3JAMc 4X64L 2EIFA 5C0XG 1G51A 4DUZL 5K36G 4N67A 4FDBA 4PY3A 1A0IA 5JJIA 3GO5A 3SGIA 3CCLA 2WAQG 2Q2HA 1UE6A 4O0AA 3HOWH 4JI8Q 1KAWA 5GADC 4GKJL 1FL0A 1B8AA 2E2IH 1HNWQ 5JFFA 3KLWA 2GVBA 4DR6L 1PH7A 4DR2Q 2NN6I 4QIWE 2E8GA 1OXVA 3A5ZB 2NVXH 2VY3A 1YVCA 2ZTEA 4POFA 3CPWA 1YJ9A 3I4NG 3W5OA 4TVAB 4HIMA 3JAMi 1QVGA 1HNXQ 3PCOB 2E5LQ 4B3RQ 4IOCA 4BA2I 1YI2A 2JK8A 3A74A 3KF8B 3RLFA 1WOCA 5FLXc 4ALPA 4U0UA 3E0EA 2N78A 4HIDA 3HOYG 1M1KC 2IT1A 2B29A 3HOZG 3S1MH 3BJUA 1BBUA 4Y52H 1PH8A 2Q2IA 5IY0A 1VQHA 2ZJRA 1QZGA 4LU4A 5DLQE 1PV4A 1A8VA 3PV0A 4B3ML 3ZC7A 4JI1Q 1VCIA 2GN5A 1G291 1PH3A 4BY7G 4QGUA 2UXCL 1Y1WG 4NXNL 2LSSA 3KDFB 4LUOA 3T1HQ 1V9PA 4BXXG 1O7IA 4A3MH 1HR0W 2UUBL 3H15A 1Z9FA 1N32Q 1L1OA 3PO2G 4K0KQ 3JC66 4A3BG 1SROA 4IPHA 4OXPA 2PI2A 3DLLA 1AE3A 1WCMH 3STBC 3KF6B 3BZKA 4DV0Q 3IRBA 4P73A 2ATWA 4GLAC 4EX5A 2HQLA 4GN3B 2ID0A 3AEVA 3E9HA 4A93H 2AKWB 1N36Q 1PYSB 2KBNA 2CWAA 4R1JA 3K8AA 1KRTA 3CCVA 4LF6Q 2RF4A 3TS0A 1I6HH 1X3GA 4LF4Q 1JJCB 3CW2C 1X9NA 4UP7A 1I94Q 3I4MH 4HJ9A 4GNXB 2XGTA 4RMFA 1K8AC 2R7DA 2G03A 4IJHA 3I56A 1WCMG 4XI8A 3S14H 4BY1G 3L2PA 3PF4A 1A63A 1NBWA 2D0PA 2ZTDA 1MJCA 1OTCA 2A8VA 5LMUQ 3CCSA 1HZCA 4LF8L 4DV1Q 1HZBA 1W3SA 3PF5A 4ITRA 3G71A 2GVAA 2VL6A 3A5UA 2OWOA 1FGUA 2YU9H 2R7ZH 4LWCA 5IP7G 4P71A 3PIPA 3H3VH 4YCVA 3HOVH 2YTVA 4MZ9A 2ASBA 2MO0A 2Z0SA 1QUQA 4DKAC 4C3IH 4OWXB 3PUZA 1BBWA 3UDGA 3M4OH 4IFDG 2PNHA 3T1YL 4A3LG 3PUVA 3CF5A 5LMNL 4EQ5A 4YY3L 2Q2UA 3S2DH 5CGLA 1CSQA 4KLKA 2N3SA 4JI0Q 4WJ4A 3AYHB 5M3MH 1M90C 2V1CC 3NELA 3RN2A 3KFUA 4AYBG 3S1QH 2R7ZG 3UDFA 2UUAQ 3MEFA 1SN8A 5JFZA 4KHPL 3ULJA 4DAYB 4GOPA 2JA6H 2AWOA 2HIVA 1VQPA 1K9MC 4DUYL 3J81j 1XNRL 4DR7Q 4JYAQ 4X64Q 3KOJA 2R93H 5C4XG 4DUZQ 2CFMA 2K5HA 3RR5A 1L1OC 1OXSC 1RIPA 4LW1A 4A4IA 1NMFA 4HJ8A 3S17H 4JV5L 4IJLA 5M3MG 1I5FA 2R93G 3RZDH 4TQUS 5JJ6A 3F2DA 4A3IH 1JJGA 4GKJQ 4A3GG 1Q1EA 3W1BA 4BBRH 1TWFH 2K5NA 5C44G 4B3SL 2NZHA 4DR6Q 1NE3A 3SN9A 4L5SA 1VQBA 4JBKA 1GVPA 1AE2A 4DPGA 3OTOQ 1VQMA 1X55A 2PI2E 4PZ8A 4M16A 5JEAJ 2PQAB 2WFWA 4LFCL 1L2FA 4JOIA 3B6YA 1N8RC 3CUCA 4J15A 1VQ6A 3OW2A 2HIXA 1A62A 5ELOA 2ZM6Q 3KJPA 1TWAH 4A3IG 3PIOA 3S16H 1KIXA 4IPGA 3S1NH 1CUKA 3NEMA 1QVCA 1BVSA 3UE1A 2H5XA 4YCWA 4BBRG 3CD6A 4HJ7A 4GN5A 1K0RA 2IX1A 1SRUA 1TWGH 4JI6L 1NY4A 1PHJA 1Q8KA 3TQYA 1C7YA 3I4NH 2I5MX 4B3MQ 4OWWB 4JBWA 4JC0A 1IBML 2UXCQ 4H02A 1CKOA 1EYGA 1EIYB 1U0LA 4NXNQ 4NXML 5AJ3L 1N34Q 1LYLA 3PUYA 1PA6A 3HOYH 2F6SA 3HOZH 2UUBQ 3NENA 4PG3A 1E1OA 1EWIA 4X2DA 1LUZA 3AQQA 3UE0A 3ICEA 4IFDI 2PMZE 4LF9L 4OO1I 2UXDQ 2NZOA 4XIGS 1XPOA 2ZJQA 1DGSA 3EN2A 1VQ4A 4UPAA 4DR1L 3CPFA 5IWAL 1VQDA 1HNZL 5J3BA 1VQ7A 2LXKA 4BY7H 4DV4L 1Y1WH 1CKNB 1VQEA 1X54A 2R6GA 2Y0SG 3HKZE 3K81C 4IPCA 3PUXA 4QY7A 4X66L 4GOPC 2I0QA 2UU9L 1J5EL 3H3VI 4BXXH 4L5TA 1WI5A 1EQQA 3E9IA 2Z6KA 1JE5A 1B70B 2RHQB 1X3EA 1S40A 2RHSB 1VQ9A 3PO2H 4A3BH 1PFSA 4U0ZA 3CCUA 3TREA 4JCVE 2ZTCA 4A3EH 4APVA 3GTOH 1E24A 4DV6L 3RLNA 1VS0A 4MTNA 1PH1A 3F2BA 4JBMA 4BBSH 1GKHA 3RN5A 3ZCBA 2NVYH 2KHIA 5FLMG 4LF8Q 1Y1VG 3KYHC 4HJAA 1Q82C 2B63G 2JA5G 5IYDG 4P72A 4AH6A 2OTLA 3LETA 4Y7NH 2CQOA 3S1RH 4UP9A 1SLJA 1YZ6A 1VQNA 5CKLA 1YITA 4JOIC 4A3EG 4A3KH 2VUMH 2OTJA 3T1YQ 4BY1H 2K4KA 5LMNQ 2RCNA 4BBSG 3RLOA 3GD7A 2UXBL 5FJ8G 5M5XH 3PO3H 3S6AA 2JJQA 2HHHL 4BA1I 3CMEA 4HJ5A 3TS2A 4YWMA 5IP7H 4R4QA 3H0GH 3CCRA 3HOUG 1D7QA 4PZ6A 4JI3Q 4JI8L 3ULLA 4LUVA 4YCUA 4AIMA 4QL5A 1OXTA 5C0XI 4A3KG 2VUMG 2A19A 3J7ZC 1FJGL 3RNUA 4A3JG 2MFIA 1E1TA 1KHIA 2VW9A 4DUYQ 1XMOQ 1XNRQ 3RZOH 5IYBG 1PH6A 1CKMA 1MKHA 3A0JA 2JE6I 3PO3G 4GKKL 4DNIA 2F4VL 2IHFA 2R7FA 1K8GA 4B3RL 2JEBI 3GTLH 3H0GG 1IBLL 2N8NA 3EBEA 1Q1BA 1V43A 3TEHB 2IY5B 4PZ7A 5BR8L 4KHZA 4B3SQ 1KC8C 2VNUD 5C4XH 4JI7L 2YTXA 5C3EG 2Z6KC 2F3IA 2DUDA 1N33L 4JI1L 2BA0A 4YHHL 4LFCQ 3ZJYC 1V1QA 2CWPA 2MO1A 4QQBX 4O2DA 1S72A 3GTMH 2LXJA 3CQZH 4R4IA 4A3FG 3ER0A 1ASZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G H;  2NVQ H;  4LF7 L;  4JG2 A;  2MQH A;  5C44 H;  1VQ5 A;  4DR4 L;  1YHQ A;  3HFZ B;  4QJF A;  2NVT H;  3GTJ H;  1Q81 C;  4AQY L;  3F8T A;  3S15 H;  4JI6 Q;  4LFA L;  5IT9 c;  1SE8 A;  2NN6 G;  1E22 A;  1L1O B;  2HT1 A;  2JEA I;  1NJI C;  5M5Y H;  1IBM Q;  3K80 C;  4A75 A;  2WB1 E;  5GRO A;  2UUC L;  4NXM Q;  1C9O A;  5AJ3 Q;  4LF5 L;  2EXD A;  1Q86 C;  1YHA A;  4DV3 L;  4IOA A;  4LF9 Q;  1J6Q A;  3CAM A;  3LGJ A;  3G4S A;  1YJN A;  5IYC G;  2A1A A;  3J80 c;  1KD1 C;  1CSP A;  1EQR A;  4DV5 L;  4WGJ A;  4JI2 L;  4DR1 Q;  5IWA Q;  3F1Z A;  1HNZ Q;  1VQC A;  3BU2 A;  3HKZ G;  1Q46 A;  4X66 Q;  4DV1 L;  1YEZ A;  1VQI A;  3GDE A;  3NBH B;  1HR0 L;  1J5E Q;  2UU9 Q;  3Q8D A;  4JBJ A;  3CC7 A;  3GTG H;  1EFW A;  4DAM A;  1GD7 A;  1I3Q H;  3U4Z A;  3KDF A;  2XTI A;  3K0X A;  4JI5 L;  1BKB A;  5JJK A;  4DV2 L;  3VDY A;  1XMQ L;  3CC2 A;  3L0O A;  3CC4 A;  4OX9 L;  1XNQ L;  4LNQ A;  5CMT A;  3GTP H;  1PH4 A;  3ZLM A;  3K7A H;  4UP8 A;  4UY8 C;  2D62 A;  1UEB A;  2AHO B;  4IFD J;  1QUQ B;  2E2H H;  4P74 A;  2FXQ A;  3KF6 A;  2KEN A;  3J80 i;  1SMX A;  4B3T L;  3J7A 5;  4LUZ A;  4A3L H;  3K7U C;  1XTD A;  4AYB E;  5GAG C;  3UDI A;  4XTC S;  3D31 A;  1TXY A;  1XPU A;  3GTQ H;  5E7N A;  3S2H H;  2EQS A;  4A3D G;  1PH9 A;  5EU0 A;  1QZH A;  1S3O A;  4DR7 L;  2F52 A;  4GNX A;  5FLM H;  4POG A;  2UXB Q;  1H95 A;  1Y1V H;  3I55 A;  2VQF L;  4IO9 A;  2HHH Q;  2JA5 H;  4JI4 L;  2B63 H;  2JA8 G;  5IYD H;  1X56 A;  4YWL A;  1JMC A;  1YBY A;  4WJ3 M;  4GOP B;  1VQL A;  4NPS A;  4A76 A;  2VQE L;  4X2E A;  1NMG A;  4MNO A;  4DK6 C;  1VQK A;  4A3C H;  2QEX A;  1NTG A;  1L0W A;  3I4O A;  5IE8 A;  3M85 A;  1JJ2 A;  1B7Y B;  1IBK L;  4LFB L;  5FJ8 H;  1SFO H;  4X65 L;  2BA1 A;  5H1S E;  2B3G A;  1Y14 B;  2OQK A;  3OTO L;  1YHB A;  1HZA A;  1WYD A;  3AFQ A;  1GM5 A;  1KXL A;  2IX0 A;  1EUJ A;  4GKK Q;  4DR3 L;  2K5V A;  4X62 L;  2F4V Q;  3HKS A;  1U5K A;  1IXR A;  1IYJ B;  1IZ6 A;  5GQO A;  4PMW A;  1E7Z A;  4DR5 L;  1XJV A;  2ZM6 L;  1W2B A;  1IBL Q;  2WP8 J;  1HZ9 A;  1WJJ A;  3HOW G;  1PH5 A;  3STB D;  5BR8 Q;  4A3C G;  4A3J H;  4DV7 L;  4YY3 Q;  1T9H A;  3S24 A;  2AWN A;  5IYB H;  2ALY B;  3CCJ A;  3I2Z A;  2YV5 A;  4JI7 Q;  1PYB A;  5HGQ A;  1LTL A;  3I7F A;  3CP0 A;  4YHH Q;  1N33 Q;  4X2C A;  2K50 A;  4GLV B;  1XPR A;  2WAQ E;  5C0X J;  2VS1 A;  1R9T H;  1N34 L;  1JB7 A;  3CCE A;  3M3Y H;  1VQA A;  1FJG Q;  5GAE C;  1OXX K;  5M3F H;  1YNX A;  4LF7 Q;  1HNW L;  2JA7 H;  1WFQ A;  1LM0 A;  1KL9 A;  3OYY A;  4OWT B;  4DR4 Q;  1YIJ A;  2UXD L;  4HIK A;  4DR2 L;  3CXC A;  5C3E H;  4AQY Q;  3J81 c;  4YWK A;  3PSI A;  4LFA Q;  2C35 B;  3U4V A;  2OQ0 A;  5JJL A;  4OON A;  4GLX A;  1TWC H;  3D0F A;  1HNX L;  2E5L L;  4JV5 Q;  2BH8 A;  2WB1 G;  2Y0S E;  1RL2 A;  4A3F H;  1K3R A;  5M5W H;  1VQF A;  2UUC Q;  1AH9 A;  1P8L A;  1EOV A;  2PQA A;  4LF5 Q;  5IP9 H;  1N9W A;  5JEA G;  5M3F G;  3WWV A;  4GN4 B;  2IHE A;  4GNX C;  4R4O A;  4A3M G;  2JA7 G;  4DV3 Q;  1MJE A;  1UWV A;  4L5R C;  1YJW A;  1ASY A;  2QA4 A;  4HIO A;  3GTK H;  4DV5 Q;  3G48 A;  4JI2 Q;  3ULP A;  3KJO A;  1OXU A;  4ME3 A;  3T1H L;  3F2C A;  3M4Q A;  3J81 i;  4A93 G;  2I5H A;  2Q2T A;  2JA9 A;  1HR0 Q;  1N32 L;  1PVO A;  4R4T A;  1D8L A;  5IP9 G;  3ERS X;  3PUW A;  3M7N A;  1P16 A;  4K0K L;  1KRS A;  2KCT A;  3I4M G;  5C4J H;  4JI5 Q;  4KI0 A;  5IYC H;  4DV2 Q;  1X6O A;  1XMQ Q;  3PGZ A;  1Q7Y C;  1XNQ Q;  1UE5 A;  4OX9 Q;  4OO1 G;  5HY6 A;  1TWH H;  1KQS A;  3FHW A;  4DV0 L;  1QVF A;  4X6A H;  1EIF A;  2OCE A;  2YTY A;  1G6P A;  2MNA A;  3EIV A;  1I50 H;  3FKI H;  4B3T Q;  1N36 L;  1GO3 E;  3U50 C;  4LF6 L;  2I5L X;  1SR3 A;  3CCQ A;  4U07 A;  1I94 L;  4LF4 L;  1FVI A;  2ZJP A;  1CKN A;  1UE7 A;  3L7Z C;  3MXN B;  3SHG A;  4JI3 L;  3SE5 A;  3G6E A;  3HOV G;  5JJ7 A;  4RG1 A;  4R4C A;  4C3H H;  1IL2 A;  1K73 C;  1XMO L;  1MIU A;  3CCM A;  5LMU L;  3CMA A;  4DV4 Q;  2R92 H;  2D0O A;  1C0A A;  2JQO A;  1X3F A;  2VQF Q;  3U58 A;  4JI4 Q;  3FKI G;  4U0S A;  3M4P A;  2KCM A;  1HJP A;  2K52 A;  2CCZ A;  3TRZ A;  2K75 A;  1HH2 P;  2K14 A;  4U04 A;  5ELN A;  3AFP A;  4C3J H;  3HOX H;  2VQE Q;  4A3D H;  2N49 A;  4NB3 A;  4DV6 Q;  1Z47 A;  4GS3 A;  1JT8 A;  1E3P A;  2L15 A;  1PH2 A;  2QGQ A;  2JA6 G;  5EAY A;  4LFB Q;  1VQJ A;  1IBK Q;  3FP9 A;  2YYZ A;  1VQO A;  4X65 Q;  2JA8 H;  2R92 G;  3UDX A;  4JI0 L;  3W1G A;  2BH2 A;  2CKZ B;  2ES2 A;  5GAH C;  1X65 A;  4C2M H;  4DR3 Q;  4KHP Q;  4X62 Q;  1K83 H;  2DGY A;  2UUA L;  1UE1 A;  4DR5 Q;  3HOU H;  4IPD A;  2AMC B;  3HOX G;  4P75 A;  3N3U A;  2KHJ A;  1VQ8 A;  3BZC A;  2E2J H;  1Q12 A;  4DK3 C;  1VQG A;  2VZA A;  5LMN W;  4DV7 Q;  4JYA L;  4L5Q A;  3DM3 A;  3M9B A;  3JAM c;  4X64 L;  2EIF A;  5C0X G;  1G51 A;  4DUZ L;  5K36 G;  4N67 A;  4FDB A;  4PY3 A;  1A0I A;  5JJI A;  3GO5 A;  3SGI A;  3CCL A;  2WAQ G;  2Q2H A;  1UE6 A;  4O0A A;  3HOW H;  4JI8 Q;  1KAW A;  5GAD C;  4GKJ L;  1FL0 A;  1B8A A;  2E2I H;  1HNW Q;  5JFF A;  3KLW A;  2GVB A;  4DR6 L;  1PH7 A;  4DR2 Q;  2NN6 I;  4QIW E;  2E8G A;  1OXV A;  3A5Z B;  2NVX H;  2VY3 A;  1YVC A;  2ZTE A;  4POF A;  3CPW A;  1YJ9 A;  3I4N G;  3W5O A;  4TVA B;  4HIM A;  3JAM i;  1QVG A;  1HNX Q;  3PCO B;  2E5L Q;  4B3R Q;  4IOC A;  4BA2 I;  1YI2 A;  2JK8 A;  3A74 A;  3KF8 B;  3RLF A;  1WOC A;  5FLX c;  4ALP A;  4U0U A;  3E0E A;  2N78 A;  4HID A;  3HOY G;  1M1K C;  2IT1 A;  2B29 A;  3HOZ G;  3S1M H;  3BJU A;  1BBU A;  4Y52 H;  1PH8 A;  2Q2I A;  5IY0 A;  1VQH A;  2ZJR A;  1QZG A;  4LU4 A;  5DLQ E;  1PV4 A;  1A8V A;  3PV0 A;  4B3M L;  3ZC7 A;  4JI1 Q;  1VCI A;  2GN5 A;  1G29 1;  1PH3 A;  4BY7 G;  4QGU A;  2UXC L;  1Y1W G;  4NXN L;  2LSS A;  3KDF B;  4LUO A;  3T1H Q;  1V9P A;  4BXX G;  1O7I A;  4A3M H;  1HR0 W;  2UUB L;  3H15 A;  1Z9F A;  1N32 Q;  1L1O A;  3PO2 G;  4K0K Q;  3JC6 6;  4A3B G;  1SRO A;  4IPH A;  4OXP A;  2PI2 A;  3DLL A;  1AE3 A;  1WCM H;  3STB C;  3KF6 B;  3BZK A;  4DV0 Q;  3IRB A;  4P73 A;  2ATW A;  4GLA C;  4EX5 A;  2HQL A;  4GN3 B;  2ID0 A;  3AEV A;  3E9H A;  4A93 H;  2AKW B;  1N36 Q;  1PYS B;  2KBN A;  2CWA A;  4R1J A;  3K8A A;  1KRT A;  3CCV A;  4LF6 Q;  2RF4 A;  3TS0 A;  1I6H H;  1X3G A;  4LF4 Q;  1JJC B;  3CW2 C;  1X9N A;  4UP7 A;  1I94 Q;  3I4M H;  4HJ9 A;  4GNX B;  2XGT A;  4RMF A;  1K8A C;  2R7D A;  2G03 A;  4IJH A;  3I56 A;  1WCM G;  4XI8 A;  3S14 H;  4BY1 G;  3L2P A;  3PF4 A;  1A63 A;  1NBW A;  2D0P A;  2ZTD A;  1MJC A;  1OTC A;  2A8V A;  5LMU Q;  3CCS A;  1HZC A;  4LF8 L;  4DV1 Q;  1HZB A;  1W3S A;  3PF5 A;  4ITR A;  3G71 A;  2GVA A;  2VL6 A;  3A5U A;  2OWO A;  1FGU A;  2YU9 H;  2R7Z H;  4LWC A;  5IP7 G;  4P71 A;  3PIP A;  3H3V H;  4YCV A;  3HOV H;  2YTV A;  4MZ9 A;  2ASB A;  2MO0 A;  2Z0S A;  1QUQ A;  4DKA C;  4C3I H;  4OWX B;  3PUZ A;  1BBW A;  3UDG A;  3M4O H;  4IFD G;  2PNH A;  3T1Y L;  4A3L G;  3PUV A;  3CF5 A;  5LMN L;  4EQ5 A;  4YY3 L;  2Q2U A;  3S2D H;  5CGL A;  1CSQ A;  4KLK A;  2N3S A;  4JI0 Q;  4WJ4 A;  3AYH B;  5M3M H;  1M90 C;  2V1C C;  3NEL A;  3RN2 A;  3KFU A;  4AYB G;  3S1Q H;  2R7Z G;  3UDF A;  2UUA Q;  3MEF A;  1SN8 A;  5JFZ A;  4KHP L;  3ULJ A;  4DAY B;  4GOP A;  2JA6 H;  2AWO A;  2HIV A;  1VQP A;  1K9M C;  4DUY L;  3J81 j;  1XNR L;  4DR7 Q;  4JYA Q;  4X64 Q;  3KOJ A;  2R93 H;  5C4X G;  4DUZ Q;  2CFM A;  2K5H A;  3RR5 A;  1L1O C;  1OXS C;  1RIP A;  4LW1 A;  4A4I A;  1NMF A;  4HJ8 A;  3S17 H;  4JV5 L;  4IJL A;  5M3M G;  1I5F A;  2R93 G;  3RZD H;  4TQU S;  5JJ6 A;  3F2D A;  4A3I H;  1JJG A;  4GKJ Q;  4A3G G;  1Q1E A;  3W1B A;  4BBR H;  1TWF H;  2K5N A;  5C44 G;  4B3S L;  2NZH A;  4DR6 Q;  1NE3 A;  3SN9 A;  4L5S A;  1VQB A;  4JBK A;  1GVP A;  1AE2 A;  4DPG A;  3OTO Q;  1VQM A;  1X55 A;  2PI2 E;  4PZ8 A;  4M16 A;  5JEA J;  2PQA B;  2WFW A;  4LFC L;  1L2F A;  4JOI A;  3B6Y A;  1N8R C;  3CUC A;  4J15 A;  1VQ6 A;  3OW2 A;  2HIX A;  1A62 A;  5ELO A;  2ZM6 Q;  3KJP A;  1TWA H;  4A3I G;  3PIO A;  3S16 H;  1KIX A;  4IPG A;  3S1N H;  1CUK A;  3NEM A;  1QVC A;  1BVS A;  3UE1 A;  2H5X A;  4YCW A;  4BBR G;  3CD6 A;  4HJ7 A;  4GN5 A;  1K0R A;  2IX1 A;  1SRU A;  1TWG H;  4JI6 L;  1NY4 A;  1PHJ A;  1Q8K A;  3TQY A;  1C7Y A;  3I4N H;  2I5M X;  4B3M Q;  4OWW B;  4JBW A;  4JC0 A;  1IBM L;  2UXC Q;  4H02 A;  1CKO A;  1EYG A;  1EIY B;  1U0L A;  4NXN Q;  4NXM L;  5AJ3 L;  1N34 Q;  1LYL A;  3PUY A;  1PA6 A;  3HOY H;  2F6S A;  3HOZ H;  2UUB Q;  3NEN A;  4PG3 A;  1E1O A;  1EWI A;  4X2D A;  1LUZ A;  3AQQ A;  3UE0 A;  3ICE A;  4IFD I;  2PMZ E;  4LF9 L;  4OO1 I;  2UXD Q;  2NZO A;  4XIG S;  1XPO A;  2ZJQ A;  1DGS A;  3EN2 A;  1VQ4 A;  4UPA A;  4DR1 L;  3CPF A;  5IWA L;  1VQD A;  1HNZ L;  5J3B A;  1VQ7 A;  2LXK A;  4BY7 H;  4DV4 L;  1Y1W H;  1CKN B;  1VQE A;  1X54 A;  2R6G A;  2Y0S G;  3HKZ E;  3K81 C;  4IPC A;  3PUX A;  4QY7 A;  4X66 L;  4GOP C;  2I0Q A;  2UU9 L;  1J5E L;  3H3V I;  4BXX H;  4L5T A;  1WI5 A;  1EQQ A;  3E9I A;  2Z6K A;  1JE5 A;  1B70 B;  2RHQ B;  1X3E A;  1S40 A;  2RHS B;  1VQ9 A;  3PO2 H;  4A3B H;  1PFS A;  4U0Z A;  3CCU A;  3TRE A;  4JCV E;  2ZTC A;  4A3E H;  4APV A;  3GTO H;  1E24 A;  4DV6 L;  3RLN A;  1VS0 A;  4MTN A;  1PH1 A;  3F2B A;  4JBM A;  4BBS H;  1GKH A;  3RN5 A;  3ZCB A;  2NVY H;  2KHI A;  5FLM G;  4LF8 Q;  1Y1V G;  3KYH C;  4HJA A;  1Q82 C;  2B63 G;  2JA5 G;  5IYD G;  4P72 A;  4AH6 A;  2OTL A;  3LET A;  4Y7N H;  2CQO A;  3S1R H;  4UP9 A;  1SLJ A;  1YZ6 A;  1VQN A;  5CKL A;  1YIT A;  4JOI C;  4A3E G;  4A3K H;  2VUM H;  2OTJ A;  3T1Y Q;  4BY1 H;  2K4K A;  5LMN Q;  2RCN A;  4BBS G;  3RLO A;  3GD7 A;  2UXB L;  5FJ8 G;  5M5X H;  3PO3 H;  3S6A A;  2JJQ A;  2HHH L;  4BA1 I;  3CME A;  4HJ5 A;  3TS2 A;  4YWM A;  5IP7 H;  4R4Q A;  3H0G H;  3CCR A;  3HOU G;  1D7Q A;  4PZ6 A;  4JI3 Q;  4JI8 L;  3ULL A;  4LUV A;  4YCU A;  4AIM A;  4QL5 A;  1OXT A;  5C0X I;  4A3K G;  2VUM G;  2A19 A;  3J7Z C;  1FJG L;  3RNU A;  4A3J G;  2MFI A;  1E1T A;  1KHI A;  2VW9 A;  4DUY Q;  1XMO Q;  1XNR Q;  3RZO H;  5IYB G;  1PH6 A;  1CKM A;  1MKH A;  3A0J A;  2JE6 I;  3PO3 G;  4GKK L;  4DNI A;  2F4V L;  2IHF A;  2R7F A;  1K8G A;  4B3R L;  2JEB I;  3GTL H;  3H0G G;  1IBL L;  2N8N A;  3EBE A;  1Q1B A;  1V43 A;  3TEH B;  2IY5 B;  4PZ7 A;  5BR8 L;  4KHZ A;  4B3S Q;  1KC8 C;  2VNU D;  5C4X H;  4JI7 L;  2YTX A;  5C3E G;  2Z6K C;  2F3I A;  2DUD A;  1N33 L;  4JI1 L;  2BA0 A;  4YHH L;  4LFC Q;  3ZJY C;  1V1Q A;  2CWP A;  2MO1 A;  4QQB X;  4O2D A;  1S72 A;  3GTM H;  2LXJ A;  3CQZ H;  4R4I A;  4A3F G;  3ER0 A;  1ASZ A; 
#chains in the Genus database with same CATH topology
 2EOT A;  2DY8 A;  2MQH A;  5T1G A;  1A6X A;  1VQ5 A;  1SE2 A;  1H9S A;  4RWS C;  4DR4 L;  4CDD C;  2NVT H;  1Q81 C;  1R9T B;  4H13 C;  4ZQ3 A;  1L1O B;  2HT1 A;  2JEA I;  3RZO B;  3WOF A;  2A74 C;  2EXD A;  1RHP A;  5EJW A;  4X3S A;  4IOA A;  1CI3 M;  1TWC B;  1ICF B;  1ET9 A;  2RKS A;  4K2L A;  3G4S A;  2F0H A;  2K28 A;  4RKB A;  1HUN A;  3DWP A;  3VR4 A;  2E75 C;  5C4Z A;  4U67 3;  3TN2 A;  1Q46 A;  4X66 Q;  2IJ0 A;  5C4H A;  3BVM A;  3MFY A;  1EFW A;  1GD7 A;  1HUM A;  1KAB A;  3L3O C;  2XTI A;  3K0X A;  3JAM L;  5DAU A;  3FMC A;  1XMQ L;  3P75 A;  2KEC A;  3AB9 A;  4LNQ A;  5CMT A;  3ZLM A;  3K7A H;  2D62 A;  2F0S A;  3I72 A;  1A15 A;  2AHO B;  2E2H H;  1TWH B;  4FXK C;  4KN7 C;  1XTD A;  4DAV A;  5GAG C;  1LTS D;  2Z6B A;  3UDI A;  4XTC S;  5AFW A;  4J1M A;  1XPU A;  1STN A;  3NHH A;  5E7N A;  4PMB A;  1PH9 A;  2DJF C;  4H7B A;  1QZH A;  3K5O A;  1E2V A;  1MSH A;  2EYL A;  3T53 B;  5KRU A;  4K6D A;  4GNX A;  2UXB Q;  3I55 A;  4JI4 L;  1YNJ C;  4IO9 A;  2JA8 G;  4YWL A;  1LV9 A;  1SJE D;  4IUT A;  3NUC A;  3FEW X;  4A76 A;  1QOH A;  2VQE L;  1ZYR D;  1VQK A;  1EEF D;  2NBF A;  3V05 A;  4LFB L;  1I3Q B;  1AW7 A;  2BA1 A;  2SOB A;  1Y14 B;  3AFQ A;  3TZD A;  4GKK Q;  2F4V Q;  2K5V A;  1U5K A;  5GQO A;  1CZG A;  3I90 A;  2JA8 B;  2WP8 J;  1WJJ A;  1G2S A;  3STB D;  1PZJ D;  2HDL A;  2F03 A;  1BUV T;  1K83 B;  2RVL A;  1DM0 B;  4CJ2 C;  5IGG A;  2YV5 A;  4B9W A;  2FFK B;  2PZT A;  1LTL A;  3S2H B;  4DAY A;  1B50 A;  1EFI D;  1G6Z A;  2K50 A;  4GLV B;  2JP1 A;  2Q8T A;  3V2T A;  4LF7 Q;  1HNW L;  4KV6 A;  1EQT A;  1SE4 A;  2E76 C;  1YIJ A;  4HIK A;  3R3O A;  3PSI A;  4LFA Q;  3U4V A;  5EGT A;  2Z4H A;  1C4Q A;  4GLX A;  3D0F A;  3D4D A;  1HA6 A;  1RL2 A;  1QB5 D;  1IYU A;  2UUC Q;  4LF5 Q;  4GNX C;  5I2X A;  4DV3 Q;  1LTR D;  3FRP B;  1ASY A;  3Q24 A;  2NN6 H;  4KJN A;  1GJX A;  1PFB A;  1SSO A;  5I2Y A;  5LL6 S;  3T1H L;  3M4Q A;  5FLX E;  1UEA B;  2I5H A;  2IX3 A;  2JA9 A;  2K6A A;  1HR0 Q;  1PVO A;  3LNN A;  3ERS X;  4K0K L;  2RQX A;  1UAP A;  3I4M G;  2F0J A;  4KI0 A;  5IYC H;  2X69 A;  3K58 A;  2M00 A;  4DV0 L;  1QVF A;  2YTY A;  1WD1 A;  3TP7 A;  5ELB A;  1N36 L;  1GO3 E;  3I8Z A;  2EE1 A;  1SR3 A;  1FVI A;  2ZJP A;  3HOV G;  2SEB D;  4F7X A;  5JJ7 A;  1IL2 A;  3CCM A;  5EKK A;  1C0A A;  3GTK B;  2KCM A;  2K52 A;  3TP5 A;  2A6E C;  2L5T A;  5CYU A;  1E3P A;  1JCK B;  1DD2 A;  2JA6 G;  2DY7 A;  2PMZ B;  5EAY A;  3HOV B;  5K36 H;  3FP9 A;  1VQO A;  2R92 G;  3UDX A;  1DCZ A;  3W1G A;  4DXG A;  3KUP A;  1W6J A;  4C2M H;  3NQT A;  4DR3 Q;  4KHP Q;  2GA4 B;  1RTN A;  2DGY A;  5ELE A;  4DR5 Q;  4P75 A;  2KHJ A;  4KHV A;  3BZC A;  1RJT A;  1Q12 A;  4DFA A;  4DK3 C;  3JAM c;  1GHJ A;  2HD3 A;  4FDB A;  4N9P A;  3CKI B;  4DAP A;  3D3R A;  4EQN A;  3CCL A;  1PRT D;  4L8J A;  1UE6 A;  2R92 B;  2K01 A;  3SVM A;  1KAW A;  3MXP A;  5GAD C;  1LAB A;  3G7L A;  2X6L A;  4DR6 L;  4CKC A;  4G57 A;  1OXV A;  5COR A;  2NVX H;  2ZTE A;  1PFM A;  1V1O A;  1TWF B;  4ZYS A;  4HIM A;  1HNX Q;  1A3T A;  2JK8 A;  3KF8 B;  4NW2 A;  1WOC A;  4O1N A;  3HOY G;  1B44 D;  3HOZ G;  1RKN A;  2IT1 A;  5I9P A;  3BJU A;  1BBU A;  2F0G A;  2OT2 A;  4LAA A;  2Q2I A;  1TWA B;  5IGF A;  1PV4 A;  3ZC7 A;  4JI1 Q;  2KVM A;  2GN5 A;  2UXC L;  1PH3 A;  3HG9 A;  4QGU A;  4BY7 G;  4IAL A;  2EJF C;  3KDF B;  1AEX A;  4LUO A;  4BXX G;  2UUB L;  1N32 Q;  1Z9F A;  1L1O A;  2KJX A;  5ELD A;  3JAM E;  4H0L C;  1F2Z A;  2C9O A;  1SNC A;  3HOY B;  1G8Z D;  3HOZ B;  3I4L A;  4JK1 C;  1D1I A;  1LT4 D;  4EX5 A;  2HQL A;  4A93 H;  3WDN A;  4LJZ C;  5JVG 3;  5EKI A;  4LF6 Q;  1I6H H;  1W6K A;  4BY7 B;  1I94 Q;  1X9N A;  2JYO A;  4UP7 A;  3AU7 A;  3EFX D;  1X3Q A;  4OO1 H;  1RF2 D;  2R7D A;  3I56 A;  2K03 A;  1A63 A;  3W2D A;  1TVX A;  1OTC A;  1I6V C;  5HGT A;  2NZ1 D;  1HZC A;  1LT3 D;  2J4X A;  3TDQ A;  4CDC C;  3A5U A;  2YU9 H;  3H3V H;  2NVY B;  3PIP A;  2MO0 A;  3UDG A;  4C3I H;  1WTO A;  4F87 A;  3T1Y L;  5IT9 L;  3CF5 A;  4YY3 L;  1BDO A;  1VDZ A;  1GUS A;  2ZT9 C;  1TS4 A;  1E2W A;  2WAC A;  2V1C C;  3NEL A;  3RN2 A;  3UDF A;  2CHB D;  3MEF A;  5JFZ A;  1PTO H;  2RA4 A;  3J80 L;  4YIJ A;  3NTH A;  5D3I B;  1PYW D;  3J81 j;  2MJ8 A;  4DNT B;  3F2U A;  5C4X G;  1L1O C;  1NSN S;  2CH4 W;  3CRL C;  1LTT D;  4A4I A;  4HJ8 A;  4JV5 L;  2E2D C;  5M3M G;  1HQR D;  2CW0 C;  4WJW A;  4RGO S;  3F2D A;  1WTV A;  4GKJ Q;  2NZH A;  2F0W A;  3GTL B;  3SHL A;  3SN9 A;  4L5S A;  4JBK A;  1ENF A;  2PNR C;  4DPG A;  1KTK A;  1ONL A;  3OTO Q;  1X55 A;  1VQM A;  4M16 A;  3HS0 C;  4LFC L;  3B6Y A;  1N8R C;  3CUC A;  1L0X B;  5C4X B;  1A62 A;  2ZM6 Q;  2G9H D;  3S16 H;  4IPG A;  1S5F D;  4I7Z C;  5M3M B;  4BBR G;  2MHV A;  3KBX A;  1SRU A;  1PHJ A;  3TQY A;  3I4N H;  2I5M X;  4GZY C;  4QIW B;  1H9S B;  2NVT B;  3K5L A;  3E5S A;  4NXM L;  1EIH A;  1LYL A;  1EWI A;  4KD3 A;  3MFG A;  3UE0 A;  4V0B A;  4LF9 L;  2NZO A;  4XIG S;  5CBA E;  5C3X A;  4BBR B;  5DNF A;  1VQ7 A;  2LXK A;  4DV4 L;  1CKN B;  1X54 A;  1CZW A;  2R6G A;  4EQP A;  4QY7 A;  4B08 A;  2UU9 L;  4ZUI A;  1EQQ A;  2ATW A;  2Z6K A;  2RHQ B;  1AP0 A;  2I46 A;  5KNC A;  4U0Z A;  1PXU A;  3CCU A;  2F3V A;  4DV6 L;  3RLN A;  5FKA C;  4CDE C;  5DM7 3;  3F2B A;  3N52 A;  1JOR A;  3RN5 A;  1ZXT A;  4XQJ A;  2SNM A;  2L9H A;  4KY6 A;  4LF8 Q;  4HJA A;  3K7A B;  1U4M A;  4UP9 A;  1SLJ A;  1II3 A;  2E2H B;  4BY1 H;  2RCN A;  2Z8L A;  3GD7 A;  5KYL A;  5M5X H;  3PO3 H;  2JJQ A;  5CC4 A;  5CV8 A;  3DHQ A;  4WOR A;  1SYB A;  3MXG A;  3O13 A;  3U9S A;  4JI3 Q;  4LUV A;  1A3V A;  5C0X I;  4C1N K;  1I4X A;  2BE5 C;  2F0F A;  1XMO Q;  1PH6 A;  3E0J A;  3SK5 A;  1GUW A;  1CKM A;  1MI2 A;  1EYC A;  1MKH A;  3A0J A;  3GTO B;  3H0G G;  1IBL L;  1JC7 A;  1V43 A;  3SR1 A;  2IY5 B;  1JOK A;  4DU9 A;  1H9R A;  4B3S Q;  1LT6 D;  4JI7 L;  2P5Z X;  3VA5 A;  1F9S A;  4HTH A;  2Z6K C;  2F3I A;  3ONA B;  2BA0 A;  1EIG A;  1TY0 A;  2MO1 A;  2ZXO A;  4QQB X;  3CQZ H;  4R4I A;  3ER0 A;  5EPL A;  1ROD A;  4JG2 A;  5EKL A;  2FMM A;  2F3W A;  3D4R A;  3H0G B;  3HFZ B;  4QJF A;  3R2I A;  4JI6 Q;  5I9O A;  5IT9 c;  2NN6 G;  2F0I A;  3URY A;  2A5H A;  1NJI C;  5M5Y H;  1IBM Q;  4PNY A;  3K80 C;  3C1E A;  5GRO A;  5AJ3 Q;  1Q86 C;  3K0Y A;  4TSS A;  2JSO A;  3J81 E;  1EU4 A;  3OWF A;  3KF8 A;  5IYC G;  2KHS A;  3NTK A;  3J80 c;  3L9A X;  1CSP A;  1EQR A;  1Q3L A;  4Q0F A;  4JI2 L;  5IWA Q;  3F1Z A;  1HNZ Q;  4NDX A;  3BYY B;  4QMG A;  1ET6 A;  1LTA D;  2KOL A;  4DV1 L;  2XN9 C;  5CV4 A;  4Z9C B;  3Q8D A;  3GTG H;  1PTO D;  3KDF A;  4DV2 L;  1C8C A;  3CC2 A;  4OX9 L;  4FXD A;  1SNQ A;  1PH4 A;  2NVQ B;  5C44 B;  1UEB A;  3GV3 A;  3V96 A;  1TS2 A;  2O5J C;  4LUZ A;  3K7U C;  3K6O A;  5IT9 E;  1TXY A;  4KK7 A;  1S3O A;  1GUG A;  4DR7 L;  3Q23 A;  3QB3 A;  3SEB A;  5FLM H;  4POG A;  2B63 H;  2G5D A;  2JA5 H;  5IYD H;  5D3D A;  3HRZ C;  4BWG B;  5FLX L;  4OEL B;  1VQL A;  2LKV A;  3BDO A;  4NPS A;  3K5N A;  1SE3 A;  4X2E A;  3EJI A;  1NR2 A;  4MNO A;  4A3C H;  1F77 A;  1NTG A;  1L0W A;  5IE8 A;  1JJ2 A;  3BG3 A;  5D14 A;  1F2Y A;  1JE4 A;  5H1S E;  1KXL A;  2OQK A;  1YHB A;  1CT1 D;  1V1P B;  2IX0 A;  3GP7 A;  3GTP B;  4X62 L;  1IZ6 A;  1XJV A;  1GUO A;  4PMW A;  4S3S A;  1PH5 A;  4C2M B;  4I65 A;  4LK1 C;  1KDB A;  2AWN A;  2ALY B;  2EVB A;  1I4R A;  2XVS A;  4CBV A;  1ZYR C;  1PYB A;  2LS0 1;  1A2T A;  3GTQ B;  1N33 Q;  3CP0 A;  4YHH Q;  4X2C A;  5IOC A;  5C0X J;  2RBM A;  1QNU A;  2VS1 A;  1JB7 A;  1VQA A;  2EY2 A;  5GAE C;  1OXX K;  5M3F H;  1YNX A;  5K5P A;  2JA7 H;  3M4Y A;  3M7G A;  3OYY A;  4DR4 Q;  5C3E H;  4PV1 C;  2C35 B;  3DWA A;  3TBI B;  4OON A;  2WB1 G;  2Y0S E;  4A3F H;  1AH9 A;  1SFO B;  1CHP D;  3ND8 A;  1CFM A;  1P8L A;  4CJ1 B;  4G7O C;  5IP9 H;  1N9W A;  1FD7 D;  4HSV A;  1YJW A;  4IQZ A;  4OGQ C;  2QA4 A;  2XWJ B;  4RA8 A;  3ULP A;  3KJO A;  4R8I A;  1WTR A;  5I6W A;  4A93 G;  2Q2T A;  4LMQ D;  3M7N A;  1KRS A;  1ICW A;  3MAQ A;  4OO1 G;  4O42 A;  1XMQ Q;  3PGZ A;  4IUV A;  4K5X A;  1AN8 A;  2VXW A;  3FKI H;  4XQN A;  4LF4 L;  2A73 B;  3ND9 A;  1CKN A;  3L7Z C;  3SHG A;  3G6E A;  4A93 B;  4C3I G;  2D5D A;  1R4Q B;  2H1E A;  3X3N A;  4C3H H;  3E6Z X;  4I7A A;  4ODG A;  1I6H B;  1JR0 D;  4JI4 Q;  3A7A B;  3TRZ A;  2K75 A;  4C3J H;  3HOX H;  4U04 A;  2VQE Q;  4A3D H;  2BCO A;  3H09 A;  2L15 A;  4LFB Q;  2J0T D;  5CMD A;  1AZQ A;  1M8A A;  3OMC A;  4RH6 A;  1DOM A;  2CKZ B;  3OOC A;  3QR8 A;  2BH2 A;  1X65 A;  3VR6 A;  1B9N A;  4IPD A;  2AMC B;  2A68 D;  4C1N I;  4X3T A;  2B2W C;  4L5Q A;  3DM3 A;  4H44 C;  3M9B A;  1G51 A;  4DUZ L;  1SEB D;  4N67 A;  1PTO B;  2OEO A;  4PY3 A;  3GO5 A;  2DNC A;  2WAQ G;  4ZUJ A;  2Q2H A;  4HR7 B;  3HOW H;  4JI8 Q;  1B8A A;  2E2I H;  3LWE A;  1HNW Q;  2GVB A;  1DOL A;  1B53 A;  2HCI A;  5CV6 A;  4QIW E;  3GQB A;  3EA6 A;  2F0D A;  1YVC A;  3CPW A;  3I4N G;  4MTK A;  3W5O A;  5EBC A;  5EBD A;  1EU3 A;  1GUN A;  3JAM i;  3P20 A;  1GHK A;  4BA2 I;  3NQI A;  1SNP A;  1ML0 D;  4IN3 A;  3SE0 A;  5JOB A;  5FLX c;  3S1M H;  4OIJ A;  2N78 A;  1PRT C;  4RAU C;  2B29 A;  2WAQ B;  2PZU A;  1PDQ A;  4LU4 A;  3S16 B;  1SYG A;  4FVM A;  1STA A;  5DLQ E;  2E2J B;  1BXT A;  2BDO A;  2CQA A;  3T1H Q;  2ZXR A;  1V9P A;  3I4N B;  4A3M H;  5JEA H;  5F2D A;  1B9M A;  4K0K Q;  3NWT A;  4IPH A;  4OXP A;  2PI2 A;  3DLL A;  4K8I A;  3BZK A;  5T1I A;  4DV0 Q;  1LAC A;  1STH A;  4GLA C;  1NNX A;  2ID0 A;  1N36 Q;  2KBN A;  2ZXP A;  1KRT A;  2RF4 A;  1X3G A;  1JJC B;  3CW2 C;  3A8K E;  2NB0 A;  1K8A C;  3S14 H;  4IJH A;  5EPK A;  1WCM G;  1IKM A;  5D65 A;  2KCC A;  2K32 A;  4BY1 G;  3L2P A;  5G3L D;  1MJC A;  4XYQ A;  3CCS A;  1SDF A;  3C1F A;  3PF5 A;  4ITR A;  1TT2 A;  3U9O A;  2R7Z H;  4LWC A;  1WTQ A;  4KKT A;  5CV7 A;  1DJR D;  4MZ9 A;  3M4O H;  4DKA C;  1ILQ A;  4OWX B;  4IFD G;  1D6E C;  1OO9 B;  4HN7 A;  3NWS A;  5LMN L;  4EQ5 A;  3S2D H;  4HMI A;  3MEH A;  2PZW A;  1EY0 A;  4KLK A;  3A8I E;  1WCM B;  1RDP D;  4BY1 B;  1H9J A;  5FOB B;  1SN8 A;  2NUN A;  1JOQ A;  3DMU A;  2Q8R E;  1H9K A;  1SNO A;  1S5B D;  1VQP A;  1K9M C;  4P2C B;  3I4M B;  5FK9 C;  4CDF C;  3RR5 A;  1LLR D;  4IUQ A;  5FO7 B;  3BS1 A;  1G2T A;  3S17 H;  3CRK C;  4IJL A;  1I5F A;  1FR3 A;  4RFB A;  2XWB B;  1V1P A;  1JJG A;  2V4D A;  2FIN B;  3S1Q B;  4DR6 Q;  3OW7 A;  3A54 A;  1AE2 A;  2PI2 E;  1GOZ A;  1CA5 A;  2WFW A;  3OW2 A;  5ELO A;  5C3W A;  2L0C A;  4A3I G;  4G4K A;  1KIX A;  2HCC A;  3NEM A;  2H4O A;  1QVC A;  4IZ8 A;  1BVS A;  4YCW A;  2NUC A;  3CD6 A;  1K0R A;  2IX1 A;  3CQZ B;  1JWS D;  1TWG H;  4QF4 A;  1C7Y A;  3GV6 A;  4DF7 A;  3MZ5 A;  2JA6 B;  3MVV A;  4JC0 A;  2UXC Q;  2EZV A;  1N34 Q;  2UUB Q;  4IFD I;  1LUZ A;  3AQQ A;  2UXD Q;  3N6R A;  4KKU A;  2ZJQ A;  4A3I B;  3K59 A;  2FHT A;  3EN2 A;  1BQQ T;  1D5M C;  2BOS A;  4DR1 L;  1J8I A;  5J3B A;  5J39 A;  2Y0S G;  4R9W A;  4DXF A;  4ZK9 B;  2I0Q A;  2R93 G;  1HRJ A;  1J5E L;  5C6A A;  1WI5 A;  3RMH A;  2RHS B;  3PQI A;  2K1B A;  1EL0 A;  4G7Z C;  2ZTC A;  4A3E H;  4XT1 B;  2OXP A;  4BBS H;  3ZCB A;  4K5W A;  1S5D D;  2KHI A;  1CTM A;  5FLM G;  2B39 A;  2F0V A;  2B63 G;  4ZRZ A;  5IYD G;  2JA5 G;  4XYO A;  1IYV A;  3T16 A;  2CQO A;  3S1R H;  1HTP A;  2Z9H A;  4MHE A;  2Y0S B;  2R93 B;  1DOK A;  1Q90 A;  2EJG C;  2MPM A;  5CKL A;  4JW0 A;  3J81 L;  2VUM H;  1GUT A;  3T1Y Q;  2K4K A;  3S9W A;  3RLO A;  3OPO A;  3QO2 A;  4NMZ A;  2HHH L;  4BA1 I;  1LO5 D;  3CME A;  4HJ5 A;  1H9M A;  1D7Q A;  3CCR A;  1Z7T A;  4PZ6 A;  2A69 D;  2B63 B;  4YCU A;  2JA5 B;  1OXT A;  4A3K G;  3J7Z C;  4DA2 A;  3RZO H;  3IAY A;  1K0S A;  3SXH A;  2EDG A;  2IHF A;  2QCP X;  2JEB I;  2PCF B;  2BDN A;  3OIP A;  1AZP A;  3NBI A;  5BR8 L;  2RDH A;  1LTB D;  1KC8 C;  2VNU D;  2EYP A;  2YTX A;  5C3E G;  4A3K B;  4JI1 L;  4ULL A;  4LFC Q;  2CWP A;  1X32 A;  4O2D A;  1S72 A;  3GTM H;  2LXJ A;  4A3F G;  4HAE A;  3ITP A;  1FJG L;  4A3G H;  3BYT B;  3GTJ H;  4AQY L;  4M1U B;  1G91 A;  1E22 A;  1WVL A;  2C5C A;  4A75 A;  5C3E B;  2WB1 E;  4NXM Q;  2F0P A;  3SDZ A;  2QEJ C;  1YHA A;  1CHQ D;  4LF9 Q;  1J6Q A;  3CAM A;  3LGJ A;  4A3F B;  1YJN A;  1KD1 C;  1BNZ A;  2KEE A;  1DZ1 A;  4DV5 L;  2RSO A;  1MSG A;  4IUU A;  1VQC A;  3HKZ G;  1EY7 A;  1CA6 A;  1YEZ A;  1JQY D;  1T5X D;  3WOE A;  1WTW A;  2UU9 Q;  1FYC A;  1F9Q A;  4JBJ A;  4ZKC B;  4OEM B;  5E1F A;  1I3Q H;  3EVQ A;  4JI5 L;  1BKB A;  5JJK A;  1PRT F;  3H3V C;  3L0O A;  1B3Q A;  1XNQ L;  5J22 A;  2A6H D;  4B9X A;  4UY8 C;  4C3H G;  2VB3 X;  4IFD J;  4B3T L;  2FXQ A;  3J80 i;  2EJM A;  2NTS A;  3PIP 3;  4A3L H;  4ILW A;  4AYB E;  3HKZ B;  1SBB B;  3S2H H;  2EQS A;  1BBX C;  4A3D G;  4QB4 A;  2XRQ D;  1PTO C;  2SNS A;  3OMG A;  1QJO A;  2EXZ A;  3I3C A;  4RGN A;  2VQF L;  1X56 A;  1JMC A;  2FJ2 A;  1YBY A;  2EYO A;  2O2L D;  4C3H B;  4GOP B;  4UAI A;  2L11 A;  1PRT B;  1NMG A;  4DK6 C;  2QEX A;  1QE6 A;  3I4O A;  1IHZ A;  1FNW A;  1IBK L;  5FJ8 H;  4X65 L;  3OTO L;  2B3G A;  1GM5 A;  2EYJ A;  4A3D B;  2J7Z A;  2LMC B;  1EUJ A;  2N55 A;  4KY7 A;  1MHW C;  3BDC A;  3HKS A;  1IYJ B;  1QCB D;  3OSO A;  2ZM6 L;  1XWE A;  1W2B A;  1IBL Q;  5JJZ A;  1HZ9 A;  3HOW G;  4DV7 L;  3VYT A;  3D8G A;  3S24 A;  5IYB H;  3CCJ A;  1XYI A;  3QWN A;  4JI7 Q;  1IL8 A;  1HCZ A;  3KLS A;  1I4Q A;  1ZEQ X;  1XPR A;  2WAQ E;  2NTT A;  5KGU A;  3CCE A;  3M3Y H;  1ZKO A;  2PO4 A;  3R93 A;  3R2T A;  4OWT B;  2K5Q A;  4DR2 L;  3CXC A;  2I07 B;  3HOW B;  3J81 c;  1L0Y B;  1BCP D;  1F9P A;  3SK6 A;  5LL6 X;  1QIL A;  3KLS X;  2E5L L;  2B2V A;  2BH8 A;  4OL7 A;  4N8X 1;  5KIX A;  1SND A;  5M5W H;  4A3M G;  3PMF A;  5JEA G;  3WWV A;  4GN4 B;  2IHE A;  3DWQ A;  2F0T A;  1JIC A;  4Q5V A;  1GXD C;  3S1M B;  3GTK H;  4JI2 Q;  4ME3 A;  5JVH 3;  4R4T A;  1D8L A;  3PUW A;  1P16 A;  1EWH A;  2KCT A;  4G7H C;  3D6C A;  5C4J H;  1NR4 A;  1ESR A;  1HHV A;  4DV2 Q;  1X6O A;  4OX9 Q;  4A3M B;  2F0K A;  5HY6 A;  1CQV A;  5DM6 3;  2K05 A;  1KQS A;  4V19 0;  4X6A H;  2OCE A;  1G6P A;  1I50 H;  1PLF A;  2ENB A;  4K8J A;  2I5L X;  1UNS A;  2EY5 A;  4U07 A;  2L12 A;  1UE7 A;  4NP5 A;  4JI3 L;  2JXM B;  2RCF A;  3DEO A;  4RG1 A;  4K5V A;  2M2L A;  1K73 C;  1XMO L;  1MIU A;  5LMU L;  3CMA A;  2R92 H;  3W3A A;  2JQO A;  1X3F A;  4U0S A;  1HJP A;  2FMC A;  2CCZ A;  4OIK A;  5ELN A;  1HH2 P;  2K14 A;  3AFP A;  1EZ6 A;  1JT8 A;  1Z47 A;  4GS3 A;  2B2V C;  1PH2 A;  3OWE B;  3IFT A;  1VQJ A;  4HED A;  3M4O B;  2EPB A;  2B8G A;  4JI0 L;  3C46 A;  2L55 A;  4ZCK A;  4X3K A;  1HXY D;  3H6M A;  4X62 Q;  2UUA L;  5CV9 A;  5I4D A;  1MGS A;  1RTO A;  1TS3 A;  2PPB C;  3IL8 A;  3N3U A;  1VQ8 A;  5E4X A;  3DM1 A;  2VZA A;  5NUC A;  4JYA L;  1D5X C;  4X64 L;  5K36 G;  4J6H A;  2AQ2 B;  5BN3 A;  2QW7 A;  2F0O A;  3SGI A;  2QKI C;  1ENA A;  1F2M A;  4O0A A;  1Y8O B;  3S17 B;  1Y69 U;  3KLW A;  1E2Z A;  1V8Q A;  1YNN D;  2NN6 I;  2E8G A;  2A68 C;  3A5Z B;  4CKE A;  1R4P B;  3ZYY X;  4POF A;  2NUD A;  1Z6H A;  4TVA B;  4HCS A;  2IPK D;  4B3R Q;  1TY2 A;  3RLF A;  4HID A;  4Y52 H;  1PH8 A;  3T4A C;  2HDM A;  1QZG A;  1A8V A;  4B3M L;  1JWU D;  1G29 1;  4K2K A;  2DJG C;  1K3B C;  4NXN L;  2M9V A;  2B2U A;  1EY6 A;  4IUN A;  1EZ8 A;  1O7I A;  1E0B A;  4QCL A;  1FGB D;  3JC6 6;  2XRS D;  1AE3 A;  4U68 A;  3STB C;  3KF6 B;  4P73 A;  2MP1 A;  3E9H A;  2AKW B;  2NVX B;  1PYS B;  4R1J A;  3CCV A;  4LF4 Q;  1U4P A;  3HP3 A;  3MTS A;  4HJ9 A;  3J7A F;  1IW7 D;  2XGT A;  4RMF A;  2G03 A;  1B2T A;  4XI8 A;  2WII B;  3PF4 A;  3CHB D;  1SXT A;  4WFN 3;  2A8V A;  2B2W A;  5HUR A;  4RHR A;  3G71 A;  1BCP B;  2OWO A;  1HTL D;  4P71 A;  1O78 A;  4YCV A;  2WB1 B;  4RHS A;  2Z0S A;  5C5L A;  1TU2 B;  1EY8 A;  3NE5 B;  3FVQ A;  4K6L A;  3S1R B;  1AFP A;  2N3S A;  5IGB A;  5M3M H;  1M90 C;  3KFU A;  1WTH A;  4AYB G;  4ME5 A;  1NAP A;  2EY1 A;  4TKO B;  2MGS A;  4GOP A;  2AWO A;  1CK1 A;  2F0E A;  2B2U C;  4DUY L;  1XNR L;  4HMJ A;  3J7A V;  4DUZ Q;  2CFM A;  2PW5 A;  1OXS C;  1STG A;  1PTO F;  4EQO A;  3RZD H;  4TQU S;  5JJ6 A;  4A3G G;  1Q1E A;  3BVZ A;  3W1B A;  4BBR H;  4DN4 M;  4AYB B;  2YU9 B;  5C0X H;  1NE3 A;  2HQE A;  1VQB A;  1GVP A;  3QG1 A;  4C3I B;  5BN4 A;  4FF2 A;  1C48 A;  2ICE C;  4PZ8 A;  5JEA J;  2PQA B;  1L2F A;  2Z4I A;  2KA7 A;  5IGE A;  1SMY D;  4HCE A;  2HIX A;  5IIF A;  2IW3 A;  3KJP A;  3PIO A;  3S1N H;  1T5E A;  2XNA C;  4HJ7 A;  3GTM B;  4GN5 A;  4ZKB B;  3Q22 A;  2B8F A;  4KY5 A;  3TZU A;  4A3G B;  3KK7 A;  4OWW B;  4JBW A;  2N88 A;  1CKO A;  1BR9 A;  3GTJ B;  1SYC A;  1U0L A;  3NXW A;  1PA6 A;  1EQV A;  3X3M A;  1KNE A;  1E1O A;  4X2D A;  4OO1 I;  2QIL A;  2F0L A;  5FO8 B;  5KEE A;  1Y8P B;  1B1Z A;  1DGS A;  4UPA A;  3CPF A;  5M9O A;  1Y1W H;  3MC0 B;  2F0N A;  3HKZ E;  4X66 L;  3PUX A;  4GOP C;  3H3V I;  1S4Z A;  4A3L G;  3E9I A;  1JE5 A;  1S40 A;  1X3E A;  1VQ9 A;  3PO2 H;  4E6I A;  4A3B H;  4RGM A;  3VA7 A;  3TRE A;  2LY7 A;  4KTA A;  4APV A;  3GTO H;  1E24 A;  1STE A;  1KDC A;  4MTN A;  1PH1 A;  1EY9 A;  1GKH A;  3DUZ A;  1K28 A;  3KYH C;  4P72 A;  2OTL A;  2O5I C;  2EYF A;  4Y7N H;  4XT3 B;  2QDL A;  1BO0 A;  2SDF A;  1VQN A;  4UDU C;  3ERQ A;  5KND A;  3HEJ A;  1YIT A;  4FO2 A;  2WKD A;  5LMN Q;  1HFN A;  5EPJ A;  1HQM C;  2UXB L;  5FJ8 G;  3S6A A;  1SYD A;  3TSS A;  3TS2 A;  3NTI A;  5IP7 H;  4R4Q A;  3H0G H;  3PIO 3;  2Q8I B;  3VYR A;  4KKS A;  4JI8 L;  4QL5 A;  2A19 A;  1E1T A;  3RD4 A;  5IYB G;  3QIA A;  3PO3 G;  3J7Y W;  4GKK L;  4DNI A;  2F4V L;  1EOT A;  5COY A;  4F8M A;  2N8N A;  3EBE A;  1Q1B A;  3TEH B;  1SYE A;  2AQ3 B;  4PZ7 A;  2F0M A;  4KMU C;  1NCV A;  3VR5 A;  2A69 C;  4TRD A;  3SK8 A;  2F4I A;  1BF4 A;  3ZJY C;  1V1Q A;  1KNA A;  3A7L A;  5M5X B;  1BOS A;  3PO3 B;  4L5T A;  4J8Q A;  1ASZ A;  2NVQ H;  4LF7 L;  4DK0 A;  5C44 H;  5L37 A;  1YHQ A;  1EY5 A;  3F8T A;  3S15 H;  3M3Y B;  4LFA L;  1SE8 A;  3DEP A;  1LTI D;  5LHY 1;  3LWU A;  2QDB A;  5ISR A;  2UUC L;  1C9O A;  4LF5 L;  4DV3 L;  1EWC A;  2VB2 X;  5M5W B;  4JVZ A;  2A1A A;  1K8M A;  3TP8 A;  4RKL A;  4WGJ A;  1KLU D;  4DR1 Q;  3BU2 A;  4PQX A;  2E74 C;  1VQI A;  3GDE A;  3NBH B;  5I6Y A;  1J5E Q;  1HR0 L;  3CC7 A;  3KBG A;  1D5Z C;  4DAM A;  3VYS A;  3U4Z A;  4CGY B;  1O7Y A;  3VDY A;  2R61 A;  3CC4 A;  1WTX A;  1YNJ D;  3GTP H;  5J1Z A;  2WKC A;  4KD4 A;  4UP8 A;  3AMU A;  4N8F A;  5C4J B;  1QUQ B;  3J7A 5;  4P74 A;  3KF6 A;  2K7V A;  2KEN A;  1SMX A;  1LTG D;  1LT5 D;  1KLG D;  5M5Y B;  1EY4 A;  1I50 B;  3D31 A;  3HZX A;  3GTQ H;  1M4V A;  3P7J A;  5EU0 A;  3NSW A;  1S5E D;  2F52 A;  1MBY A;  1H95 A;  1Y1V H;  2HHH Q;  2A6H C;  4WJ3 M;  2R3Z A;  3VR2 A;  3RUZ A;  1TII D;  3GTG B;  3M85 A;  1B7Y B;  5ELF A;  1SFO H;  1HZA A;  1WYD A;  1SYF A;  2JN4 A;  4DR3 L;  3HOU H;  3LX0 A;  4KHP L;  1IXR A;  3Q6S A;  4DR5 L;  1E7Z A;  3E3X A;  4QUF A;  1STB A;  4PMC A;  1NUC A;  5BR8 Q;  4A3C G;  2CH4 A;  2K04 A;  4A3J H;  4YY3 Q;  1T9H A;  1TR5 A;  1TQO A;  3CU7 A;  3I2Z A;  3C3L A;  5HGQ A;  4F88 A;  3I7F A;  1R9T H;  3QOJ A;  1N34 L;  5G3L F;  1FJG Q;  1WD0 A;  5IOD A;  1LM0 A;  1WFQ A;  1KL9 A;  2IWH A;  2UXD L;  3TP6 A;  4AQY Q;  3FPP A;  2B2T A;  4YWK A;  2OQ0 A;  5JJL A;  3MHB A;  4JV5 Q;  1TWC H;  1HNX L;  1O7Z A;  1ILP A;  1ENC A;  1K3R A;  1VQF A;  1EOV A;  2PQA A;  5M3F G;  4R4O A;  5ELC A;  2JA7 G;  1MJE A;  1UWV A;  4L5R C;  1CM9 A;  5KNB A;  2DNE A;  3A55 A;  3OHX C;  4R8N A;  4HIO A;  4M8A A;  4DV5 Q;  3G48 A;  1EYD A;  1XXG A;  3I73 A;  1OXU A;  2EYH A;  3H94 A;  3F2C A;  1NH1 A;  3J81 i;  1BCP C;  1UUP A;  3D6W A;  1N32 L;  1U4L A;  3VR3 A;  5IP9 G;  2AUJ D;  1D1K A;  5BN5 A;  4JI5 Q;  3C2P A;  1Q7Y C;  1XNQ Q;  1UE5 A;  3K5M A;  5M3F B;  2O4X A;  1TWH H;  5E3F A;  3FHW A;  2JA7 B;  1EIF A;  1SAP A;  2MNA A;  3EIV A;  4B3T Q;  1XX8 A;  2A6E D;  3U50 C;  4LF6 L;  3CCQ A;  1I94 L;  4L6T B;  3MXN B;  3SE5 A;  4HSP A;  4FNF A;  3H91 A;  4R4C A;  1B3A A;  1TKW B;  5A35 A;  1I4G A;  4DV4 Q;  2DN8 A;  2D0O A;  2VQF Q;  3U58 A;  3FKI G;  3M4P A;  4XDX A;  2IL8 A;  2EY6 A;  2B2T C;  1F2L A;  3BVG A;  3UI2 A;  2X6G A;  2N49 A;  4NB3 A;  4DV6 Q;  1ESF A;  2QGQ A;  4WRD A;  5A2Q L;  1IBK Q;  2YYZ A;  4ABN A;  5FO9 B;  4X65 Q;  2JA8 H;  2ES2 A;  1O7L A;  5GAH C;  3MWY W;  1PZK D;  1K83 H;  1UE1 A;  4C3J G;  3HOX G;  3FKI B;  4ZAI A;  2E2J H;  1PMR A;  1VQG A;  2AQ1 B;  3P1H A;  5LMN W;  4DV7 Q;  1WTP A;  5C0X G;  2EIF A;  5KYI A;  3EQL C;  5JJI A;  1A0I A;  1RCV D;  5TSS A;  1DXM A;  3OIQ A;  4X3U A;  4GKJ L;  1FL0 A;  2QF7 A;  2RDF A;  5JFF A;  1PFN A;  1PH7 A;  3RZD B;  4DR2 Q;  4C3J B;  2TSS A;  3HOX B;  1HPC A;  2D2C C;  2VY3 A;  2PW7 A;  3Q0A A;  1YJ9 A;  2E5L Q;  1CQF A;  1QVG A;  3PCO B;  4IOC A;  1YI2 A;  1EEI D;  3A74 A;  4C56 C;  4ALP A;  3E0E A;  4U0U A;  2B2Y A;  4ZLT F;  2WIN B;  1M1K C;  3HGB A;  1IKL A;  5IY0 A;  1VQH A;  2ZJR A;  2PQE A;  3S1N B;  3PV0 A;  5CV5 A;  1YNN C;  4IUR A;  1VCI A;  2EYM A;  4RCN A;  1JB3 A;  1Y1W G;  2WV6 D;  2LSS A;  2NWG A;  1FNU A;  1HFG A;  3FDT A;  1I4P A;  2K33 A;  1HR0 W;  3H15 A;  1EYA A;  3DXJ C;  4EGV A;  2LFN A;  3PO2 G;  3VYU A;  3FPU B;  4A3B G;  1SRO A;  1WCM H;  3MA2 B;  2E2I B;  1VF5 C;  3IRB A;  3AEV A;  4GN3 B;  4FF1 A;  4MIU A;  2CWA A;  3K8A A;  4OHJ A;  3TS0 A;  2TMP A;  3I4M H;  1Y1W B;  4GNX B;  4IFD H;  3NBH A;  1QNK A;  3QOL A;  3PO2 B;  1NBW A;  2D0P A;  1TS5 A;  2ZTD A;  4A3B B;  2L4N A;  4K14 A;  5LMU Q;  4LF8 L;  4DV1 Q;  1HZB A;  1W3S A;  2F0Q A;  2GVA A;  2VL6 A;  5CBE E;  1FGU A;  3S1Q H;  5JPN C;  5IP7 G;  4QUC A;  3HOV H;  2YTV A;  2ASB A;  1HA5 A;  1QUQ A;  1SJH D;  2K5D A;  1BBW A;  3PUZ A;  2PNH A;  1STY A;  2RDG A;  3PUV A;  2CVR A;  2Q2U A;  5CGL A;  4Y7N B;  1Q8I A;  1CSQ A;  1IW7 C;  1QG7 A;  2CW0 D;  2B2Y C;  4FF3 A;  4JI0 Q;  4WJ4 A;  2F1M A;  3AYH B;  2R7Z G;  2UUA Q;  3NP8 A;  4RCO A;  4XXE A;  4DGZ A;  2OF1 A;  3ULJ A;  4DAY B;  5CR3 A;  2JA6 H;  1KAA A;  2HIV A;  4JYA Q;  4DR7 Q;  1B4O A;  2KUM A;  4X64 Q;  3KOJ A;  4CHT B;  2PYK A;  1PZI D;  2K5H A;  5JPM C;  1RIP A;  3S14 B;  1KDA A;  1VMP A;  4LW1 A;  1NMF A;  4L63 B;  5DEH A;  2Z1C A;  4A3I H;  3BZD B;  1JWM D;  1O80 A;  3A8J E;  4FP5 D;  1TWF H;  2K5N A;  3NK9 A;  5C44 G;  4B3S L;  2R7Z B;  5IGC A;  3ICE A;  2F0U A;  1VMC A;  3S2D B;  4JOI A;  2G9D A;  4XQQ A;  4J15 A;  4EVO A;  1VQ6 A;  1TWA H;  3IFD A;  3G6J B;  1CUK A;  2MUY A;  3UE1 A;  2H5X A;  4FF4 A;  3QJY A;  3SK4 A;  1D2B A;  1A3U A;  4JI6 L;  1NY4 A;  1Q8K A;  3K57 A;  4B3M Q;  1IBM L;  5EQ0 A;  4H02 A;  2R93 H;  1EYG A;  1EIY B;  1X3P A;  4NXN Q;  5AJ3 L;  3S15 B;  3PUY A;  1Y8N B;  3A56 A;  3HOY H;  2F6S A;  3HOZ H;  3NEN A;  4PG3 A;  1SNM A;  1SMY C;  2PMZ E;  4BS9 A;  4ID6 A;  2XIW A;  3KLR A;  1XPO A;  1FNV A;  1VQ4 A;  4JPB W;  5IWA L;  1VQD A;  2D9U A;  4UHV A;  1HNZ L;  4BY7 H;  3D4W A;  1VQE A;  3K81 C;  3BDL A;  1MD2 D;  1VF7 A;  2K5W A;  4IPC A;  4BXX H;  1B70 B;  1PFS A;  4JCV E;  3J80 E;  2HUG A;  3TME A;  3MXU A;  5JAV A;  1VS0 A;  4JBM A;  1K8O A;  4CKB A;  4IUP A;  2NVY H;  3IKJ A;  1TWG B;  1Y1V G;  1Q82 C;  3T13 A;  4AH6 A;  3LET A;  1QWY A;  1BCP F;  1YZ6 A;  2BE5 D;  4JOI C;  4A3E G;  4A3K H;  2KCN A;  5CGK A;  5A2Q E;  2OTJ A;  1DON A;  4BBS G;  3MXN A;  3R8B A;  4NKL A;  1U4R A;  2NYZ D;  1U9R A;  4YWM A;  3ERO A;  4FXG C;  3HOU G;  5E4W C;  5IGD A;  4N9T A;  2AUK A;  2L1B A;  3ULL A;  1Y1V B;  3I91 A;  5C5M A;  2KQ3 A;  4AIM A;  4RGT A;  2VUM G;  3RNU A;  4A3J G;  2MFI A;  1KHI A;  2VW9 A;  4DUY Q;  1XNR Q;  1JOO A;  4A3E B;  2JE6 I;  2XSC A;  3I70 A;  3T56 B;  4BBS B;  1K8G A;  2R7F A;  4B3R L;  3GTL H;  4MN3 A;  1F9R A;  4DK1 A;  1RD9 D;  1S5C D;  4KN4 C;  2KED A;  1A2U A;  3T51 B;  3HOU B;  4KHZ A;  1J9O A;  1XTC D;  1DYQ A;  4KJO A;  5C4X H;  2DUD A;  4FYD A;  1N33 L;  2VUM B;  4YHH L;  4A3J B;  4CJ0 B;  2RSN A;  2ICI A;  4DNR B;  1I4H A;  3NPP A; 
#chains in the Genus database with same CATH homology
 4A3G H;  2NVQ H;  4LF7 L;  4JG2 A;  2MQH A;  5C44 H;  1VQ5 A;  4DR4 L;  1YHQ A;  3HFZ B;  4QJF A;  2NVT H;  3GTJ H;  1Q81 C;  4AQY L;  3F8T A;  3S15 H;  4JI6 Q;  4LFA L;  5IT9 c;  1SE8 A;  2NN6 G;  1E22 A;  1L1O B;  2HT1 A;  2JEA I;  1NJI C;  5M5Y H;  1IBM Q;  3K80 C;  4A75 A;  2WB1 E;  5GRO A;  2UUC L;  4NXM Q;  1C9O A;  5AJ3 Q;  4LF5 L;  2EXD A;  1Q86 C;  1YHA A;  4DV3 L;  4IOA A;  4LF9 Q;  1J6Q A;  3CAM A;  3LGJ A;  3G4S A;  1YJN A;  5IYC G;  2A1A A;  3J80 c;  1KD1 C;  1CSP A;  1EQR A;  4DV5 L;  4WGJ A;  4JI2 L;  4DR1 Q;  5IWA Q;  3F1Z A;  1HNZ Q;  1VQC A;  3BU2 A;  3HKZ G;  1Q46 A;  4X66 Q;  4DV1 L;  1YEZ A;  1VQI A;  3GDE A;  3NBH B;  1HR0 L;  1J5E Q;  2UU9 Q;  3Q8D A;  4JBJ A;  3CC7 A;  3GTG H;  1EFW A;  4DAM A;  1GD7 A;  1I3Q H;  3U4Z A;  3KDF A;  2XTI A;  3K0X A;  4JI5 L;  1BKB A;  5JJK A;  4DV2 L;  3VDY A;  1XMQ L;  3CC2 A;  3L0O A;  3CC4 A;  4OX9 L;  1XNQ L;  4LNQ A;  5CMT A;  3GTP H;  1PH4 A;  3ZLM A;  3K7A H;  4UP8 A;  4UY8 C;  2D62 A;  1UEB A;  2AHO B;  4IFD J;  1QUQ B;  2E2H H;  4P74 A;  2FXQ A;  3KF6 A;  2KEN A;  3J80 i;  1SMX A;  4B3T L;  3J7A 5;  4LUZ A;  4A3L H;  3K7U C;  1XTD A;  4AYB E;  5GAG C;  3UDI A;  4XTC S;  3D31 A;  1TXY A;  1XPU A;  3GTQ H;  5E7N A;  3S2H H;  2EQS A;  4A3D G;  1PH9 A;  5EU0 A;  1QZH A;  1S3O A;  4DR7 L;  2F52 A;  4GNX A;  5FLM H;  4POG A;  2UXB Q;  1H95 A;  1Y1V H;  3I55 A;  2VQF L;  4IO9 A;  2HHH Q;  2JA5 H;  4JI4 L;  2B63 H;  2JA8 G;  5IYD H;  1X56 A;  4YWL A;  1JMC A;  1YBY A;  4WJ3 M;  4GOP B;  1VQL A;  4NPS A;  4A76 A;  2VQE L;  4X2E A;  1NMG A;  4MNO A;  4DK6 C;  1VQK A;  4A3C H;  2QEX A;  1NTG A;  1L0W A;  3I4O A;  5IE8 A;  3M85 A;  1JJ2 A;  1B7Y B;  1IBK L;  4LFB L;  5FJ8 H;  1SFO H;  4X65 L;  2BA1 A;  5H1S E;  2B3G A;  1Y14 B;  2OQK A;  3OTO L;  1YHB A;  1HZA A;  1WYD A;  3AFQ A;  1GM5 A;  1KXL A;  2IX0 A;  1EUJ A;  4GKK Q;  4DR3 L;  2K5V A;  4X62 L;  2F4V Q;  3HKS A;  1U5K A;  1IXR A;  1IYJ B;  1IZ6 A;  5GQO A;  4PMW A;  1E7Z A;  4DR5 L;  1XJV A;  2ZM6 L;  1W2B A;  1IBL Q;  2WP8 J;  1HZ9 A;  1WJJ A;  3HOW G;  1PH5 A;  3STB D;  5BR8 Q;  4A3C G;  4A3J H;  4DV7 L;  4YY3 Q;  1T9H A;  3S24 A;  2AWN A;  5IYB H;  2ALY B;  3CCJ A;  3I2Z A;  2YV5 A;  4JI7 Q;  1PYB A;  5HGQ A;  1LTL A;  3I7F A;  3CP0 A;  4YHH Q;  1N33 Q;  4X2C A;  2K50 A;  4GLV B;  1XPR A;  2WAQ E;  5C0X J;  2VS1 A;  1R9T H;  1N34 L;  1JB7 A;  3CCE A;  3M3Y H;  1VQA A;  1FJG Q;  5GAE C;  1OXX K;  5M3F H;  1YNX A;  4LF7 Q;  1HNW L;  2JA7 H;  1WFQ A;  1LM0 A;  1KL9 A;  3OYY A;  4OWT B;  4DR4 Q;  1YIJ A;  2UXD L;  4HIK A;  4DR2 L;  3CXC A;  5C3E H;  4AQY Q;  3J81 c;  4YWK A;  3PSI A;  4LFA Q;  2C35 B;  3U4V A;  2OQ0 A;  5JJL A;  4OON A;  4GLX A;  1TWC H;  3D0F A;  1HNX L;  2E5L L;  4JV5 Q;  2BH8 A;  2WB1 G;  2Y0S E;  1RL2 A;  4A3F H;  1K3R A;  5M5W H;  1VQF A;  2UUC Q;  1AH9 A;  1P8L A;  1EOV A;  2PQA A;  4LF5 Q;  5IP9 H;  1N9W A;  5JEA G;  5M3F G;  3WWV A;  4GN4 B;  2IHE A;  4GNX C;  4R4O A;  4A3M G;  2JA7 G;  4DV3 Q;  1MJE A;  1UWV A;  4L5R C;  1YJW A;  1ASY A;  2QA4 A;  4HIO A;  3GTK H;  4DV5 Q;  3G48 A;  4JI2 Q;  3ULP A;  3KJO A;  1OXU A;  4ME3 A;  3T1H L;  3F2C A;  3M4Q A;  3J81 i;  4A93 G;  2I5H A;  2Q2T A;  2JA9 A;  1HR0 Q;  1N32 L;  1PVO A;  4R4T A;  1D8L A;  5IP9 G;  3ERS X;  3PUW A;  3M7N A;  1P16 A;  4K0K L;  1KRS A;  2KCT A;  3I4M G;  5C4J H;  4JI5 Q;  4KI0 A;  5IYC H;  4DV2 Q;  1X6O A;  1XMQ Q;  3PGZ A;  1Q7Y C;  1XNQ Q;  1UE5 A;  4OX9 Q;  4OO1 G;  5HY6 A;  1TWH H;  1KQS A;  3FHW A;  4DV0 L;  1QVF A;  4X6A H;  1EIF A;  2OCE A;  2YTY A;  1G6P A;  2MNA A;  3EIV A;  1I50 H;  3FKI H;  4B3T Q;  1N36 L;  1GO3 E;  3U50 C;  4LF6 L;  2I5L X;  1SR3 A;  3CCQ A;  4U07 A;  1I94 L;  4LF4 L;  1FVI A;  2ZJP A;  1CKN A;  1UE7 A;  3L7Z C;  3MXN B;  3SHG A;  4JI3 L;  3SE5 A;  3G6E A;  3HOV G;  5JJ7 A;  4RG1 A;  4R4C A;  4C3H H;  1IL2 A;  1K73 C;  1XMO L;  1MIU A;  3CCM A;  5LMU L;  3CMA A;  4DV4 Q;  2R92 H;  2D0O A;  1C0A A;  2JQO A;  1X3F A;  2VQF Q;  3U58 A;  4JI4 Q;  3FKI G;  4U0S A;  3M4P A;  2KCM A;  1HJP A;  2K52 A;  2CCZ A;  3TRZ A;  2K75 A;  1HH2 P;  2K14 A;  4U04 A;  5ELN A;  3AFP A;  4C3J H;  3HOX H;  2VQE Q;  4A3D H;  2N49 A;  4NB3 A;  4DV6 Q;  1Z47 A;  4GS3 A;  1JT8 A;  1E3P A;  2L15 A;  1PH2 A;  2QGQ A;  2JA6 G;  5EAY A;  4LFB Q;  1VQJ A;  1IBK Q;  3FP9 A;  2YYZ A;  1VQO A;  4X65 Q;  2JA8 H;  2R92 G;  3UDX A;  4JI0 L;  3W1G A;  2BH2 A;  2CKZ B;  2ES2 A;  5GAH C;  1X65 A;  4C2M H;  4DR3 Q;  4KHP Q;  4X62 Q;  1K83 H;  2DGY A;  2UUA L;  1UE1 A;  4DR5 Q;  3HOU H;  4IPD A;  2AMC B;  3HOX G;  4P75 A;  3N3U A;  2KHJ A;  1VQ8 A;  3BZC A;  2E2J H;  1Q12 A;  4DK3 C;  1VQG A;  2VZA A;  5LMN W;  4DV7 Q;  4JYA L;  4L5Q A;  3DM3 A;  3M9B A;  3JAM c;  4X64 L;  2EIF A;  5C0X G;  1G51 A;  4DUZ L;  5K36 G;  4N67 A;  4FDB A;  4PY3 A;  1A0I A;  5JJI A;  3GO5 A;  3SGI A;  3CCL A;  2WAQ G;  2Q2H A;  1UE6 A;  4O0A A;  3HOW H;  4JI8 Q;  1KAW A;  5GAD C;  4GKJ L;  1FL0 A;  1B8A A;  2E2I H;  1HNW Q;  5JFF A;  3KLW A;  2GVB A;  4DR6 L;  1PH7 A;  4DR2 Q;  2NN6 I;  4QIW E;  2E8G A;  1OXV A;  3A5Z B;  2NVX H;  2VY3 A;  1YVC A;  2ZTE A;  4POF A;  3CPW A;  1YJ9 A;  3I4N G;  3W5O A;  4TVA B;  4HIM A;  3JAM i;  1QVG A;  1HNX Q;  3PCO B;  2E5L Q;  4B3R Q;  4IOC A;  4BA2 I;  1YI2 A;  2JK8 A;  3A74 A;  3KF8 B;  3RLF A;  1WOC A;  5FLX c;  4ALP A;  4U0U A;  3E0E A;  2N78 A;  4HID A;  3HOY G;  1M1K C;  2IT1 A;  2B29 A;  3HOZ G;  3S1M H;  3BJU A;  1BBU A;  4Y52 H;  1PH8 A;  2Q2I A;  5IY0 A;  1VQH A;  2ZJR A;  1QZG A;  4LU4 A;  5DLQ E;  1PV4 A;  1A8V A;  3PV0 A;  4B3M L;  3ZC7 A;  4JI1 Q;  1VCI A;  2GN5 A;  1G29 1;  1PH3 A;  4BY7 G;  4QGU A;  2UXC L;  1Y1W G;  4NXN L;  2LSS A;  3KDF B;  4LUO A;  3T1H Q;  1V9P A;  4BXX G;  1O7I A;  4A3M H;  1HR0 W;  2UUB L;  3H15 A;  1Z9F A;  1N32 Q;  1L1O A;  3PO2 G;  4K0K Q;  3JC6 6;  4A3B G;  1SRO A;  4IPH A;  4OXP A;  2PI2 A;  3DLL A;  1AE3 A;  1WCM H;  3STB C;  3KF6 B;  3BZK A;  4DV0 Q;  3IRB A;  4P73 A;  2ATW A;  4GLA C;  4EX5 A;  2HQL A;  4GN3 B;  2ID0 A;  3AEV A;  3E9H A;  4A93 H;  2AKW B;  1N36 Q;  1PYS B;  2KBN A;  2CWA A;  4R1J A;  3K8A A;  1KRT A;  3CCV A;  4LF6 Q;  2RF4 A;  3TS0 A;  1I6H H;  1X3G A;  4LF4 Q;  1JJC B;  3CW2 C;  1X9N A;  4UP7 A;  1I94 Q;  3I4M H;  4HJ9 A;  4GNX B;  2XGT A;  4RMF A;  1K8A C;  2R7D A;  2G03 A;  4IJH A;  3I56 A;  1WCM G;  4XI8 A;  3S14 H;  4BY1 G;  3L2P A;  3PF4 A;  1A63 A;  1NBW A;  2D0P A;  2ZTD A;  1MJC A;  1OTC A;  2A8V A;  5LMU Q;  3CCS A;  1HZC A;  4LF8 L;  4DV1 Q;  1HZB A;  1W3S A;  3PF5 A;  4ITR A;  3G71 A;  2GVA A;  2VL6 A;  3A5U A;  2OWO A;  1FGU A;  2YU9 H;  2R7Z H;  4LWC A;  5IP7 G;  4P71 A;  3PIP A;  3H3V H;  4YCV A;  3HOV H;  2YTV A;  4MZ9 A;  2ASB A;  2MO0 A;  2Z0S A;  1QUQ A;  4DKA C;  4C3I H;  4OWX B;  3PUZ A;  1BBW A;  3UDG A;  3M4O H;  4IFD G;  2PNH A;  3T1Y L;  4A3L G;  3PUV A;  3CF5 A;  5LMN L;  4EQ5 A;  4YY3 L;  2Q2U A;  3S2D H;  5CGL A;  1CSQ A;  4KLK A;  2N3S A;  4JI0 Q;  4WJ4 A;  3AYH B;  5M3M H;  1M90 C;  2V1C C;  3NEL A;  3RN2 A;  3KFU A;  4AYB G;  3S1Q H;  2R7Z G;  3UDF A;  2UUA Q;  3MEF A;  1SN8 A;  5JFZ A;  4KHP L;  3ULJ A;  4DAY B;  4GOP A;  2JA6 H;  2AWO A;  2HIV A;  1VQP A;  1K9M C;  4DUY L;  3J81 j;  1XNR L;  4DR7 Q;  4JYA Q;  4X64 Q;  3KOJ A;  2R93 H;  5C4X G;  4DUZ Q;  2CFM A;  2K5H A;  3RR5 A;  1L1O C;  1OXS C;  1RIP A;  4LW1 A;  4A4I A;  1NMF A;  4HJ8 A;  3S17 H;  4JV5 L;  4IJL A;  5M3M G;  1I5F A;  2R93 G;  3RZD H;  4TQU S;  5JJ6 A;  3F2D A;  4A3I H;  1JJG A;  4GKJ Q;  4A3G G;  1Q1E A;  3W1B A;  4BBR H;  1TWF H;  2K5N A;  5C44 G;  4B3S L;  2NZH A;  4DR6 Q;  1NE3 A;  3SN9 A;  4L5S A;  1VQB A;  4JBK A;  1GVP A;  1AE2 A;  4DPG A;  3OTO Q;  1VQM A;  1X55 A;  2PI2 E;  4PZ8 A;  4M16 A;  5JEA J;  2PQA B;  2WFW A;  4LFC L;  1L2F A;  4JOI A;  3B6Y A;  1N8R C;  3CUC A;  4J15 A;  1VQ6 A;  3OW2 A;  2HIX A;  1A62 A;  5ELO A;  2ZM6 Q;  3KJP A;  1TWA H;  4A3I G;  3PIO A;  3S16 H;  1KIX A;  4IPG A;  3S1N H;  1CUK A;  3NEM A;  1QVC A;  1BVS A;  3UE1 A;  2H5X A;  4YCW A;  4BBR G;  3CD6 A;  4HJ7 A;  4GN5 A;  1K0R A;  2IX1 A;  1SRU A;  1TWG H;  4JI6 L;  1NY4 A;  1PHJ A;  1Q8K A;  3TQY A;  1C7Y A;  3I4N H;  2I5M X;  4B3M Q;  4OWW B;  4JBW A;  4JC0 A;  1IBM L;  2UXC Q;  4H02 A;  1CKO A;  1EYG A;  1EIY B;  1U0L A;  4NXN Q;  4NXM L;  5AJ3 L;  1N34 Q;  1LYL A;  3PUY A;  1PA6 A;  3HOY H;  2F6S A;  3HOZ H;  2UUB Q;  3NEN A;  4PG3 A;  1E1O A;  1EWI A;  4X2D A;  1LUZ A;  3AQQ A;  3UE0 A;  3ICE A;  4IFD I;  2PMZ E;  4LF9 L;  4OO1 I;  2UXD Q;  2NZO A;  4XIG S;  1XPO A;  2ZJQ A;  1DGS A;  3EN2 A;  1VQ4 A;  4UPA A;  4DR1 L;  3CPF A;  5IWA L;  1VQD A;  1HNZ L;  5J3B A;  1VQ7 A;  2LXK A;  4BY7 H;  4DV4 L;  1Y1W H;  1CKN B;  1VQE A;  1X54 A;  2R6G A;  2Y0S G;  3HKZ E;  3K81 C;  4IPC A;  3PUX A;  4QY7 A;  4X66 L;  4GOP C;  2I0Q A;  2UU9 L;  1J5E L;  3H3V I;  4BXX H;  4L5T A;  1WI5 A;  1EQQ A;  3E9I A;  2Z6K A;  1JE5 A;  1B70 B;  2RHQ B;  1X3E A;  1S40 A;  2RHS B;  1VQ9 A;  3PO2 H;  4A3B H;  1PFS A;  4U0Z A;  3CCU A;  3TRE A;  4JCV E;  2ZTC A;  4A3E H;  4APV A;  3GTO H;  1E24 A;  4DV6 L;  3RLN A;  1VS0 A;  4MTN A;  1PH1 A;  3F2B A;  4JBM A;  4BBS H;  1GKH A;  3RN5 A;  3ZCB A;  2NVY H;  2KHI A;  5FLM G;  4LF8 Q;  1Y1V G;  3KYH C;  4HJA A;  1Q82 C;  2B63 G;  2JA5 G;  5IYD G;  4P72 A;  4AH6 A;  2OTL A;  3LET A;  4Y7N H;  2CQO A;  3S1R H;  4UP9 A;  1SLJ A;  1YZ6 A;  1VQN A;  5CKL A;  1YIT A;  4JOI C;  4A3E G;  4A3K H;  2VUM H;  2OTJ A;  3T1Y Q;  4BY1 H;  2K4K A;  5LMN Q;  2RCN A;  4BBS G;  3RLO A;  3GD7 A;  2UXB L;  5FJ8 G;  5M5X H;  3PO3 H;  3S6A A;  2JJQ A;  2HHH L;  4BA1 I;  3CME A;  4HJ5 A;  3TS2 A;  4YWM A;  5IP7 H;  4R4Q A;  3H0G H;  3CCR A;  3HOU G;  1D7Q A;  4PZ6 A;  4JI3 Q;  4JI8 L;  3ULL A;  4LUV A;  4YCU A;  4AIM A;  4QL5 A;  1OXT A;  5C0X I;  4A3K G;  2VUM G;  2A19 A;  3J7Z C;  1FJG L;  3RNU A;  4A3J G;  2MFI A;  1E1T A;  1KHI A;  2VW9 A;  4DUY Q;  1XMO Q;  1XNR Q;  3RZO H;  5IYB G;  1PH6 A;  1CKM A;  1MKH A;  3A0J A;  2JE6 I;  3PO3 G;  4GKK L;  4DNI A;  2F4V L;  2IHF A;  2R7F A;  1K8G A;  4B3R L;  2JEB I;  3GTL H;  3H0G G;  1IBL L;  2N8N A;  3EBE A;  1Q1B A;  1V43 A;  3TEH B;  2IY5 B;  4PZ7 A;  5BR8 L;  4KHZ A;  4B3S Q;  1KC8 C;  2VNU D;  5C4X H;  4JI7 L;  2YTX A;  5C3E G;  2Z6K C;  2F3I A;  2DUD A;  1N33 L;  4JI1 L;  2BA0 A;  4YHH L;  4LFC Q;  3ZJY C;  1V1Q A;  2CWP A;  2MO1 A;  4QQB X;  4O2D A;  1S72 A;  3GTM H;  2LXJ A;  3CQZ H;  4R4I A;  4A3F G;  3ER0 A;  1ASZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...