4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
molecule tags Cell adhesion
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
3ERSX 4U0SA 2IY5B 4P74A 2K4KA 3TQYA 3U4ZA 1B8AA 1PH6A 2JA7H 5IYDH 3FHWA 3EN2A 4DV5Q 1WCMH 2JEBI 3S1RH 1YJWA 3ZLMA 1RL2A 3G48A 5C3EG 1VQLA 2Q2UA 5LMNQ 5LMNW 3UDIA 2OWOA 1PH1A 2Q2HA 5GAHC 1VQKA 1N33L 4C3IH 1X6OA 4NXMQ 2IT1A 1Q1BA 3ULJA 3CC4A 4QGUA 4IFDJ 4PG3A 4DV2Q 1XMOQ 2G03A 2DGYA 3H0GG 2MO1A 5EAYA 5M5YH 4A3KH 1XJVA 2OTJA 3J81c 3D31A 3PIPA 1QZGA 4DAMA 3CCJA 1L2FA 4DV5L 1AH9A 3CMAA 1C9OA 4DK6C 2WAQG 3A5ZB 1VQGA 3NBHB 4JBWA 2E5LQ 2Z6KC 5C44G 2HIVA 4LNQA 5C3EH 2GVAA 3BZCA 1N34Q 3HOWG 5LMNL 4LF6L 4GS3A 3JAMc 2E2JH 3HOYG 4DR3Q 4OO1I 1Q46A 3PIOA 4NXML 3W5OA 3W1GA 2JJQA 4UPAA 2JE6I 1SR3A 1IBKQ 3I56A 4LF4Q 3M4QA 4DV7Q 1V9PA 3MEFA 3H0GH 4ITRA 3JC66 4XTCS 5H1SE 2UUAQ 4R4CA 3I4OA 3M4PA 5FLXc 4OX9Q 1HZ9A 4APVA 1VCIA 4PZ7A 4YCUA 3TRZA 4IPCA 1S40A 2Z6KA 1UWVA 3LGJA 2NVXH 2YYZA 2E2HH 1W3SA 4AYBG 1M1KC 5IYCG 1PHJA 5IT9c 2E5LL 3KLWA 2WAQE 1OXUA 5C44H 2VW9A 1X3GA 1N34L 4DV3Q 4UP8A 1XNQQ 3HOWH 3S14H 5CKLA 3S17H 2K14A 3K81C 3SE5A 2YTVA 4RG1A 4DV0Q 4XIGS 1MJEA 1TWHH 4DR3L 4AQYQ 4JI7L 5M3MG 1GM5A 3TS0A 3S2HH 4LF4L 2GVBA 3KF6A 1BBUA 2F6SA 1TWCH 3KOJA 4DV7L 4JI0Q 4QIWE 3S1MH 3FKIG 4JI2Q 1VS0A 3CC7A 2UUAL 1FJGQ 2NN6I 3BZKA 4U0UA 1EYGA 4U07A 4HJAA 4A3CG 3U4VA 4IOCA 1OXVA 1HJPA 1B7YB 5GAEC 3J7ZC 5IYCH 1I6HH 4A3EG 1VQJA 4HIKA 1LTLA 4R4QA 4TQUS 1PV4A 4DV3L 2HIXA 5IP9G 1PYSB 1G6PA 3PF4A 1CUKA 1VQMA 3CC2A 4IJLA 4L5SA 1VQHA 5JJIA 4A3DG 3I55A 5M3MH 2HHHL 5HY6A 1EQQA 2OQ0A 4B3SQ 5JEAJ 3KJPA 1V1QA 5AJ3Q 3AEVA 4A76A 3S2DH 1A62A 4X2DA 1FL0A 3T1YQ 1OTCA 3FKIH 4MZ9A 3K0XA 4OWTB 5GADC 4JI2L 2ALYB 1KD1C 2KENA 4DV6Q 4A3CH 3CXCA 4R4TA 5FJ8G 1Y1VG 4AH6A 1AE3A 2CQOA 2E8GA 1R9TH 4A3EH 1SRUA 1X56A 1YITA 3RZDH 5BR8Q 5IE8A 2AHOB 4YHHQ 3L7ZC 2AMCB 1I94L 4OONA 1Q82C 5IP9H 3GD7A 2I5HA 3PO3G 3J81i 1KAWA 2I5LX 1E1OA 1VQPA 2BA0A 1UE1A 4A3DH 2ES2A 3ICEA 4DUYQ 5JJ7A 4AIMA 5AJ3L 1HZAA 3T1YL 1XTDA 3CCEA 4PZ8A 1JJGA 1RIPA 1C7YA 5JFFA 3JAMi 2RF4A 2UUBL 3PO2G 4IPDA 1D7QA 5FJ8H 1Y1VH 4IOAA 4A3GG 2N49A 2R92G 3GTQH 3PUWA 3HOUG 4QY7A 3TREA 2K50A 4OWWB 2ASBA 1XPOA 4BBRG 3PO3H 4OO1G 3CAMA 1N32Q 3PF5A 4WGJA 1VQ5A 4ALPA 2NZHA 4B3MQ 4DV1Q 4PMWA 3RZOH 2E2IH 3CPWA 3DM3A 4LF7L 3HOZG 1MJCA 5C0XJ 1ASZA 3KDFB 3KFUA 2IHEA 1VQNA 1UE5A 1NY4A 4JC0A 1W2BA 4LW1A 2K52A 5JFZA 2CWAA 5CGLA 2HT1A 3L0OA 4DV4Q 2H5XA 3U50C 3PO2H 1IBMQ 4GOPB 4A3GH 4DAYB 1T9HA 4KHZA 4DUZQ 2R92H 2EXDA 1XPRA 3Q8DA 4L5RC 3HOUH 5JJ6A 1Q7YC 3PV0A 1PYBA 3NENA 4BBRH 1Z9FA 1I50H 2B29A 4FDBA 4P73A 3NEMA 1A0IA 2Q2TA 4X2CA 4EX5A 2ZTEA 1UE6A 1E3PA 1CKOA 1CKNA 2B3GA 3HKZE 4JG2A 1XNRQ 3HOZH 4L5QA 4LFBQ 4A4IA 5EU0A 1XPUA 1NE3A 1WI5A 2CFMA 1EUJA 2A19A 1BVSA 4DR1Q 1X3EA 1KRSA 4UP9A 4C3HH 4GLXA 1SLJA 1YHBA 2RHQB 4DUZL 4YCWA 3KYHC 4JI5Q 1JE5A 5E7NA 2ATWA 4KI0A 3TS2A 5ELNA 4IFDI 1XMOL 4DV2L 4YWMA 1O7IA 3E9HA 1YHQA 1HNXQ 1PH5A 4B3RQ 1SROA 2VS1A 4K0KQ 1XNRL 3D0FA 3G4SA 1P8LA 4P75A 4NB3A 4YWLA 2JEAI 4LFBL 3M85A 4R4IA 1PH7A 1S72A 1K8AC 4NPSA 1Y14B 2RHSB 2BA1A 3J7A5 2R7DA 1N9WA 3GTKH 1HZCA 2YU9H 1Q86C 4YWKA 4A3BG 3S24A 2ZJQA 2V1CC 3F1ZA 3H3VI 4MTNA 3S1QH 2UXCQ 3N3UA 3EIVA 1EFWA 2N3SA 4H02A 4JI3Q 1J6QA 2NVTH 3CF5A 1N36Q 4BXXG 1IBKL 2IHFA 3ER0A 1PH4A 4YCVA 1G51A 3UDXA 1HNXL 4JI4Q 3F2BA 4B3RL 4A75A 3CD6A 4JCVE 4K0KL 1OXSC 1Q12A 2K5VA 4OX9L 4WJ3M 3RLOA 1VQ7A 1VQIA 1WJJA 2VQEQ 4JBMA 1U5KA 3CUCA 1Q8KA 3STBD 1SN8A 1SFOH 1PA6A 3GTLH 3J80c 5M5WH 2QGQA 4LWCA 2UUCQ 4DR6Q 2CKZB 4LU4A 3RN2A 4OXPA 2I5MX 2VZAA 3GTMH 4A3BH 2MNAA 1XNQL 1JMCA 1PH9A 4U04A 3G71A 2UXCL 4X66Q 4DV0L 4DR5Q 3GTPH 1PFSA 4AQYL 2EIFA 1L0WA 4JI3L 1VQEA 1HZBA 4KLKA 1IL2A 1N36L 4BXXH 4DR7L 2MO0A 4JI4L 2R7ZG 1X65A 1E7ZA 2R7FA 4LF9Q 4JI0L 1YEZA 2PQAB 1JB7A 3ZC7A 4JI1Q 4C2MH 1FJGL 4HIDA 3CCUA 1EWIA 4BBSG 2LXKA 2OTLA 1QUQB 2VQEL 3OYYA 3K80C 2JA9A 1NJIC 1VQFA 2WP8J 4LFCQ 2K5NA 3I4MG 2JA8G 4ME3A 3S1NH 4DR6L 4KHPQ 4X65Q 1TXYA 3SGIA 3UDFA 3B6YA 4JI8Q 2VY3A 2KCTA 3G6EA 2UXDQ 4GKKL 1OXXK 4QL5A 2K75A 1K9MC 3A0JA 3STBC 4L5TA 4X66L 2BH2A 3HOVG 4GKJQ 3CMEA 1KHIA 3DLLA 3CCLA 4B3SL 1LYLA 2XGTA 3AFPA 1WOCA 2R7ZH 3I4NG 2EQSA 3AYHB 1NMGA 3PUVA 1I3QH 4PY3A 3OW2A 4Y7NH 1H95A 4XI8A 4N67A 1VQ4A 2OCEA 4BBSH 1X9NA 2KBNA 3H15A 4DV6L 2JK8A 5HGQA 2VQFQ 1BBWA 4GN5A 4LFCL 1A8VA 2F3IA 1VQ9A 2JA8H 1S3OA 3I4MH 4JBJA 5BR8L 2YV5A 4YHHL 1OXTA 2ZTDA 2LXJA 3PGZA 3ULLA 4A3MG 1Q1EA 2UXDL 2VNUD 1KIXA 1CSPA 1AE2A 2XTIA 2YTYA 3WWVA 2A8VA 3PCOB 1FGUA 1YVCA 3AQQA 1Q81C 3HOVH 3S16H 2BH8A 4GKJL 3K7UC 4IFDG 2PI2E 3HKZG 4C3JH 4DUYL 3I4NH 2NVYH 1L1OB 1YI2A 1QVGA 1E1TA 1X55A 4HIMA 4GLAC 4TVAB 4R1JA 3ZJYC 3I2ZA 1A63A 5GQOA 1LM0A 2WFWA 4X6AH 1MIUA 1IBLQ 4DR7Q 1IXRA 1L1OC 1U0LA 2AWNA 1K0RA 2N8NA 1JJCB 2JQOA 3F8TA 4JOIC 4DK3C 5JJKA 3RN5A 2Z0SA 4A3MH 1XMQQ 2D0OA 1PH2A 1TWFH 4EQ5A 4A3IG 4GOPC 3S15H 1IZ6A 1N32L 3A5UA 2RCNA 3FP9A 4B3ML 4DV1L 3SHGA 1CKMA 1KL9A 3PUXA 3UE0A 3J80i 2I0QA 1IYJB 4A3LG 5C0XI 1NMFA 1KRTA 1EIYB 4LF5Q 2NN6G 2MFIA 4DR2Q 2KHJA 4IJHA 1L1OA 3KDFA 4DV4L 4HIOA 3PUZA 4RMFA 4JOIA 1MKHA 4LFAQ 2PNHA 2Y0SE 3K8AA 3ZCBA 3HOXG 4DKAC 1IBLL 1IBML 4LF6Q 1C0AA 3CCVA 3I7FA 5M5XH 1E22A 2CWPA 2AKWB 5FLMG 4GOPA 3HFZB 3H3VH 2YTXA 4MNOA 3BU2A 1XMQL 4JI6Q 2B63G 3GTGH 4LUVA 4A3IH 3T1HQ 1EQRA 1GKHA 4M16A 4JV5Q 1Y1WG 1K8GA 3OTOQ 2R6GA 4GN3B 4X2EA 1QZHA 2DUDA 3CCRA 4A3LH 4A3JG 2WB1G 1HH2P 5GROA 2R93G 4LF5L 1VQDA 1B70B 4DR2L 2MQHA 4QQBX 4IPHA 2K5HA 2L15A 4OWXB 2ZJPA 4LFAL 3K7AH 3PSIA 2ZTCA 3HOXH 1J5EQ 5CMTA 4DR1L 3RNUA 2F4VQ 3S6AA 2GN5A 3KF6B 4O2DA 5FLMH 1VQOA 4JI5L 4JI7Q 4JI6L 5K36G 2KHIA 3CP0A 1I5FA 2B63H 1LUZA 3T1HL 5IWAQ 1YJ9A 4JBKA 4JV5L 1Y1WH 4POGA 1BKBA 3OTOL 1NTGA 5JEAG 3BJUA 4WJ4A 1KQSA 2JA6G 1YHAA 3J81j 4A3JH 4HJ8A 4LF8Q 1K73C 4LUZA 1N8RC 2R93H 4NXNQ 1HNWQ 2WB1E 4Y52H 1VQAA 2KCMA 3W1BA 4YY3Q 1FVIA 3M3YH 2NZOA 1EOVA 1WYDA 5IYBG 1P16A 1UE7A 1Z47A 4P71A 1J5EL 1K83H 1M90C 2F4VL 1SMXA 4P72A 4GLVB 3GO5A 5M3FG 3HOYH 2VL6A 3EBEA 3AFQA 4BY7G 2HHHQ 3CPFA 1VQBA 5IWAL 1ASYA 4LUOA 1E24A 1K3RA 4A93G 2IX1A 2ID0A 1CSQA 2ZJRA 2HQLA 4O0AA 3GTJH 2N78A 2JA6H 4GN4B 4LF8L 2PMZE 4NXNL 1HNWL 2UU9Q 2VUMG 5GAGC 4YY3L 4A3FG 2UUCL 5ELOA 1UEBA 4QJFA 3CQZH 4AYBE 2LSSA 5IYBH 3RR5A 4X64Q 2A1AA 3UDGA 1I94Q 3RLNA 5IP7G 1V43A 4HJ5A 1QVFA 1NBWA 3E0EA 4BY1G 1X54A 3F2DA 3CCQA 2Q2IA 2ZM6Q 5M3FH 4DR5L 4BY7H 2JA5G 3A74A 3GDEA 5C4XG 1KXLA 5J3BA 1JT8A 3CCSA 1TWAH 4HJ9A 4A93H 4LF9L 3HKSA 4B3TQ 4JYAQ 3LETA 4JI1L 1SE8A 5C0XG 1HNZQ 4DR4Q 5JJLA 4UP7A 4X62Q 4GNXB 2UUBQ 1GO3E 2PQAA 1JJ2A 2UU9L 2VUMH 4A3FH 1GVPA 1D8LA 2QEXA 4KHPL 1QUQA 1KC8C 1WFQA 4X65L 3VDYA 2IX0A 4R4OA 1TWGH 4X64L 4GNXC 2UXBQ 1QVCA 4JI8L 1YBYA 1VQCA 5IP7H 1GD7A 1YJNA 3MXNB 1PH3A 4DPGA 1YIJA 1PH8A 1X3FA 5DLQE 4BY1H 2ZM6L 1HR0Q 1HR0W 3ULPA 2JA5H 5C4XH 3UE1A 3CCMA 4PZ6A 3GTOH 5LMUQ 4UY8C 3M4OH 2PI2A 4LF7Q 1EIFA 4GKKQ 2D62A 5IYDG 3E9IA 4HJ7A 3IRBA 2JA7G 2FXQA 4B3TL 1VQ6A 2AWOA 4JYAL 1WCMG 5IY0A 1DGSA 1HNZL 5C4JH 3F2CA 3CW2C 3NELA 4X62L 2NVQH 4DR4L 2Y0SG 4IO9A 1YZ6A 2OQKA 3KF8B 2VQFL 3PUYA 3SN9A 4GNXA 4U0ZA 3RLFA 2D0PA 4DNIA 2C35B 1N33Q 3KJOA 2UXBL 3M9BA 4BA2I 2QA4A 4POFA 1PVOA 3TEHB 4BA1I 1CKNB 2CCZA 1HR0L 3L2PA 1G291 3U58A 4A3KG 4IPGA 1YNXA 1VQ8A 5LMUL 3M7NA 2F52A 4J15A
chains in the Genus database with same CATH superfamily
2IY5B 4U0SA 2XWBB 3BG3A 4P74A 3TQYA 3U4ZA 1PH6A 4TKOB 3FHWA 2F0OA 1S5DD 1WCMH 2JEBI 3S1RH 3HGBA 5C3EB 3IAYA 3BYYB 2SNSA 3UDIA 2E2JB 1X6OA 4ABNA 2KCNA 2LKVA 4IFDJ 4PG3A 1XMOQ 3SK8A 2G03A 3H0GG 1BQQT 1XJVA 1BXTA 1ONLA 2OTJA 4FP5D 4DAMA 4DV5L 1AH9A 3CMAA 3A5ZB 2OEOA 5C44B 1A3TA 4ILWA 2GVAA 1N34Q 4C1NK 4IUNA 4L6TB 1TWHB 5I2YA 1B9NA 4DR3Q 4NXML 3J81L 4QIWB 3VR4A 3M4QA 2FJ2A 3A54A 5H1SE 2UUAQ 2EJMA 2PMZB 1WTRA 1HZ9A 3C46A 4APVA 1A2TA 1VCIA 4ME5A 4CDFC 1D6EC 2F0PA 5KNBA 2F0DA 1I6HB 2YYZA 1M1KC 3BDLA 2B2TA 2OF1A 5E4WC 3HOWH 1G8ZD 2L12A 5CKLA 1A3VA 1H9KA 3S17H 2K14A 3K81C 3LX0A 2R61A 1MJEA 4JI7L 1HTPA 3GV3A 5FLXL 5CV5A 5KRUA 1TWCH 2F6SA 3FKIB 1H9MA 3CC7A 4QCLA 4U0UA 2CQAA 3H94A 4HJAA 1GJXA 4IOCA 1B7YB 2EY1A 1R9TB 1LTAD 5IYCH 3RZDB 1VQJA 1KNAA 4HIKA 1EWCA 1LTLA 1ENAA 4DV3L 2K7VA 1F2ZA 1CUKA 1EIHA 3CC2A 5JJIA 5M3MH 2QW7A 1HPCA 1B53A 2K28A 5AJ3Q 3S2DH 1FL0A 3MXUA 4IUTA 1MSGA 4FNFA 1AN8A 4KV6A 4RA8A 2KENA 1CZGA 3CXCA 4R4TA 2CQOA 2E8GA 1SRUA 5CORA 5BR8Q 2EZVA 1H9SA 2AHOB 1E2VA 4OIKA 2KEDA 1I94L 2D2CC 2B8GA 4A3DH 2ES2A 5ELCA 2PZTA 1PRTB 3BDCA 1DOMA 1HTLD 3CCEA 4HCEA 2B2WA 3D4RA 1RIPA 1ZYRD 2HD3A 1C7YA 5JFFA 3QO2A 3JAMi 4RGTA 3PO2G 4C1NI 5FJ8H 2M00A 1Y1VH 3HOUG 4IN3A 4OWWB 2ASBA 1RTNA 4FO2A 4BBRG 3CAMA 1VQ5A 4ALPA 2NZHA 4PMWA 1DZ1A 1SNMA 1STHA 3KDFB 2QDBA 3VR6A 1UE5A 1W2BA 4LW1A 1STGA 1G91A 4M8AA 1IBMQ 4GOPB 5JJZA 1Q7YC 1OO9B 3BYTB 3PV0A 1Z9FA 2B29A 4FDBA 3NEMA 2Q2TA 4EX5A 4X3SA 2EY2A 3HKZE 2ZXOA 5I4DA 1SYCA 4IQZA 4FVMA 1B4OA 1LTRD 2AQ2B 1BVSA 1X3EA 1KRSA 1LT4D 4NMZA 2I07B 4FXKC 3CKIB 4YCWA 1JE5A 4EQOA 2BOSA 3TS2A 3NK9A 5ELNA 1WD0A 1HNXQ 2JP1A 1PFBA 1XNRL 4IURA 2RCFA 2KQ3A 1D5ZC 3WDNA 4P75A 4NB3A 4YWLA 1I4GA 4LFBL 5CV9A 3M85A 4J6HA 4NPSA 1Y14B 5M9OA 3J7A5 3GTMB 3TZDA 1HZCA 2YU9H 1Q86C 4A3BG 2ZJQA 1R4QB 4DAVA 3S1QH 3EIVA 1EFWA 2N3SA 2NUNA 3K59A 1CQVA 4JI4Q 1G51A 3F2BA 4B3RL 3HP3A 2VB2X 1LTID 4KKUA 1PTOB 1JOOA 2J0TD 1VQIA 2VQEQ 3GTLH 3CUCA 5BN5A 1SFOH 1PA6A 3SR1A 1GOZA 2L4NA 2RSNA 2I5MX 4X3KA 3MFGA 1XNQL 4CJ0B 1PH9A 4XQQA 4BY7B 3NHHA 4DV0L 2EIFA 2C9OA 4JI3L 3Q24A 4KLKA 1N36L 1ENCA 4KKTA 4V190 2R7ZG 1AW7A 4JI0L 1YEZA 4J8QA 3W2DA 2PQAB 1V1OA 2OTLA 1SDFA 3I4MB 2A69C 3T4AC 3X3MA 5D3IB 1NCVA 1SNDA 1SJHD 3UDFA 3B6YA 5KEEA 4JI8Q 5IGGA 2VY3A 2N88A 3NWSA 1BCPC 1SMYC 2SDFA 2K75A 1F2MA 3A0JA 1NR4A 5E4XA 1KHIA 3CCLA 4B3SL 1LYLA 2EQSA 3AYHB 3PUVA 1I3QH 4PY3A 2F4IA 3OW2A 3VYRA 1VQ4A 3WOFA 1VDZA 4BBSH 2KBNA 3H15A 4WORA 5CGKA 1BBWA 4LFCL 2JA8H 1S3OA 1WD1A 4JBJA 2YV5A 2ZTDA 3ULLA 3U9OA 2H4OA 2UXDL 2VNUD 4DXFA 1KIXA 3MTSA 1LT3D 2XTIA 1AE2A 2IL8A 4O42A 4GKJL 3GV6A 3NWTA 3K7UC 3MHBA 4C3JH 3L3OC 3I4NH 2G5DA 1QVGA 1E1TA 1JWSD 5E3FA 4TVAB 3M7GA 5DNFA 4MTKA 1A63A 1XWEA 3FDTA 4JK1C 5M5XB 1JJCB 1VF5C 2BE5C 3Q6SA 5JJKA 1IHZA 1STBA 4XT3B 4A3IG 4P2CB 4XQJA 3U9SA 2RCNA 5FO7B 4B3ML 4IUVA 3SHLA 1V1PA 1FYCA 2KHSA 2I0QA 1IYJB 1CFMA 4HIOA 3PUZA 4RMFA 4JOIA 1IBLL 4DU9A 5CBAE 4LF6Q 5C4HA 3NXWA 5CR3A 1GHJA 3SK6A 3H3VH 2YTXA 2E2DC 1IKLA 3BU2A 2B63G 1I4PA 3GTGH 1HA6A 1EQRA 3VYSA 2G9DA 4GN3B 4X2EA 1PTOD 2CH4W 2WB1B 4K6DA 3SXHA 4B9WA 1HH2P 4LF5L 5KGUA 1VQDA 3NTHA 3CRKC 1JOQA 2B2UC 3PQIA 2O4XA 4IUQA 4IPHA 2EVBA 2EJFC 1L0XB 1K83B 2ZTCA 4ZLTF 2Z6BA 4DR1L 3RNUA 4FF2A 3CU7A 4O2DA 2GN5A 5FLMH 2F0GA 4JI6L 2F0MA 1LUZA 5CV6A 3T1HL 4JBKA 1BKBA 3GTJB 2JA6B 3WOEA 1YHAA 3C1EA 4XDXA 4A3JH 4LUZA 1N8RC 2R93H 1KNEA 2KCMA 2DNCA 4YY3Q 1PFNA 3FRPB 1FVIA 2IJ0A 2F0KA 3M3YH 4RHRA 4RWSC 5IYBG 4ZUJA 3P20A 1Z47A 4P71A 1J5EL 2F4VL 1SMXA 5M3FB 4P72A 4GLVB 4BY7G 2VL6A 1SE2A 5K36H 1GUGA 1Z6HA 5IWAL 1ASYA 1E24A 3DHQA 2IX1A 1CSQA 2ZJRA 5JEAH 1M8AA 4O0AA 4EVOA 3QIAA 2F0JA 3E0JA 5EBCA 2V4DA 2VUMB 1NSNS 2RDGA 2UU9Q 1HNWL 5GAGC 2Q8RE 1UEBA 4AYBE 2F03A 1BO0A 3RR5A 4X64Q 2A1AA 5CMDA 4HJ5A 1X54A 5JPNC 4K2KA 2BDOA 2Q2IA 1K8OA 2NZ1D 2A73B 3GDEA 4XYQA 5J3BA 4B3TQ 2J4XA 3FPPA 4JI1L 1SE8A 1L0YB 5C0XG 4DR4Q 5JJLA 4UP7A 2AUJD 4KHVA 5IIFA 1GO3E 5LL6S 2UUBQ 1JJ2A 3GTQB 1LT6D 4QUFA 2IX0A 1TWGH 3LWEA 4GNXC 2UXBQ 2ICEC 1VQCA 5IP7H 2XN9C 3MXNB 4BY1H 2EPBA 1EOTA 1ET6A 5C4XH 1AFPA 3M4OH 2PI2A 3T51B 1KDAA 3KLRA 4OELB 4GKKQ 1HUNA 2D62A 2IX3A 2JA7G 4JYAL 1EFID 2XSCA 5C4JH 3CW2C 3NELA 4EQNA 4IO9A 2OQKA 2B2VA 3SN9A 4U0ZA 2D0PA 3TMEA 2C35B 3MVVA 4C3IG 1BDOA 4BA2I 2LS01 4BA1I 1HR0L 2VXWA 1G291 3L2PA 3U58A 1YNXA 1SSOA 1VQ8A 4CJ1B 2KJXA 5IYDH 2K4KA 1GUTA 1EYCA 1YJWA 3OMGA 2OXPA 2Q2UA 5LMNQ 5LMNW 2WACA 2OWOA 2Q2HA 5GAHC 1N33L 2MP1A 1IW7C 4LK1C 4WRDA 4DV2Q 3H0GB 5A2QE 5M5YH 5J1ZA 4ULLA 4A3KH 3J81c 2NVXB 3EROA 5I9PA 4OHJA 3TSSA 3GTKB 4DXGA 1DCZA 5K5PA 4LNQA 5C3EH 1CA6A 2RQXA 2WKCA 2E2JH 3T56B 3PIOA 3W5OA 2J7ZA 1IBKQ 1QB5D 3I56A 4DV7Q 1V9PA 3MEFA 4R4CA 5FLXc 3TRZA 4K5WA 2Z6KA 5COYA 5I2XA 5M5WB 2E2HH 2JYOA 3SVMA 1VF7A 3FPUB 1PHJA 3KLWA 4KD4A 3JAML 5C44H 3NPPA 2VW9A 1N34L 5EGTA 5EBDA 2Q8TA 2OT2A 1TWHH 4DR3L 1GM5A 2Z1CA 3KF6A 4DK0A 3KOJA 5BN3A 4B08A 5IT9E 1GXDC 2XRQD 1VS0A 3QJYA 4JI2Q 2UUAL 2NN6I 4XQNA 4A3CG 1EY4A 5D14A 1HJPA 3S1NB 2I46A 3J7ZC 1I6HH 1GUOA 4CGYB 4TQUS 5IP9G 1PYSB 1EWHA 1PDQA 1VQMA 2WINB 3NQTA 3I55A 5HY6A 4OL7A 3KJPA 4A76A 1A62A 2FHTA 3T1YQ 3FKIH 4OWTB 5GADC 4DV6Q 5DEHA 4N8FA 3G6JB 1R9TH 4A3EH 1YITA 3RZDH 4RKLA 4YHHQ 4MIUA 1SE4A 1ZXTA 5IGBA 4FF1A 1D1KA 4CBVA 3PO3G 1KAWA 3ICEA 4ZK9B 2E2IB 2F0WA 2NVYB 4DUYQ 1A2UA 4AIMA 5AJ3L 3D8GA 2A68C 5KNCA 3I90A 4PZ8A 3PO2B 4R8NA 3ITPA 4FF4A 4IZ8A 4IPDA 5G3LF 1I4RA 1U4PA 4IOAA 1BR9A 3HOUB 5J22A 5IGDA 1IYUA 3PUWA 1J9OA 2R92G 3D3RA 4BBRB 4HSPA 1I50B 2ZT9C 5I6WA 3PF5A 3J7YW 3HKZB 2PO4A 3RZOH 2JSOA 3DM3A 4LF7L 3HOZG 5C0XJ 1Q90A 2A6HC 2K01A 5CV4A 2K52A 3A7AB 1D1IA 4DV4Q 2H5XA 3U50C 3T13A 1I4QA 3FEWX 4C3HG 4A3GH 4DAYB 4KHZA 4DUZQ 1MD2D 5J39A 2EXDA 5EJWA 3Q8DA 1XPRA 1YNNC 1PYBA 2RBMA 4OO1H 1S4ZA 4P73A 4ZAIA 1A0IA 2HDMA 3V2TA 2Q8IB 4DK1A 1TS3A 5LHY1 1UE6A 1E3PA 4HSVA 4N9TA 4K14A 2EYLA 3DWAA 1WTWA 3K7AB 1EUJA 3HOXB 3VA7A 4GLXA 3W3AA 1YHBA 3R3OA 1EY0A 3H09A 4JI5Q 1RF2D 2ATWA 4PQXA 1PXUA 3E9HA 4BWGB 1ML0D 1SROA 1EY6A 4K0KQ 2QF7A 3D0FA 3G4SA 1S5ED 4CHTB 1CI3M 2PNRC 3OHXC 1CM9A 4R4IA 1UEAB 1K8AC 2RHSB 1YNJC 4A3BB 3OWEB 3S24A 2V1CC 3H3VI 3GTPB 2UXCQ 2DJFC 2NVTH 2G9HD 2KUMA 3BZDB 4H02A 1J6QA 3VA5A 2A69D 4YCVA 3UDXA 1HNXL 1WTHA 4A75A 4C2MB 1E2WA 3HZXA 4JCVE 2NYZD 4OX9L 2K5VA 3RLOA 1F9PA 2EDGA 1VQ7A 1WJJA 1O7LA 1DM0B 3VR5A 1U5KA 2QGQA 4LWCA 2CKZB 4LU4A 3J7AF 3GTMH 1SBBB 1SEBD 1LABA 1RCVD 2EYHA 4X66Q 4DR5Q 1PFSA 4AQYL 2R7ZB 2L1BA 1STNA 4BXXH 4JI4L 3EA6A 1QNKA 3N6RA 1TS2A 2XVSA 3J80E 4Y7NB 3BDOA 5EPKA 3ZC7A 1MBYA 2ZXPA 1FJGL 3CCUA 2NTSA 2LXKA 1PTOH 2VQEL 1NJIC 4HR7B 3SK5A 1RHPA 4KHPQ 2K5NA 2AUKA 5KIXA 5I6YA 3K5OA 1TXYA 3SGIA 1BCPF 5AFWA 1I4XA 5EPJA 1K9MC 3STBC 4L5TA 3H91A 4K5VA 5F2DA 2RSOA 3AFPA 1EY7A 5ISRA 2BCOA 1H95A 2OCEA 2DY8A 2JK8A 3HEJA 1SYBA 1VQ9A 3I4MH 1E0BA 1FNVA 1M4VA 1U9RA 1E2ZA 1Q3LA 3MAQA 3PGZA 1TWFB 2CW0C 4A3MG 1Q1EA 2VB3X 4ZKBB 1PZID 2H1EA 1CSPA 4BS9A 3S16H 3HOVH 3AQQA 1Q81C 3LWUA 1IYVA 3CRLC 3HKZG 4K8JA 1SNCA 1L1OB 2M2LA 2EYPA 1YI2A 1HFNA 5BN4A 3I2ZA 4H7BA 5GQOA 1LM0A 5C3XA 1MIUA 3G7LA 4CKCA 1K0RA 1TT2A 1CA5A 4DK3C 3RN5A 2L9HA 1F2YA 4CDEC 2F0QA 2WKDA 4A3IB 1XMQQ 1PH2A 2D0OA 2HQEA 4EQ5A 1N32L 1EYAA 4DV1L 4IFDH 3SHGA 1MGSA 1T5EA 3UE0A 3J80i 3TBIB 4A3LG 1KRTA 4DR2Q 2RKSA 3O13A 4IJHA 1L1OA 3KDFA 4DNTB 1MKHA 4LFAQ 2PNHA 2Y0SE 3HOXG 1B9MA 3QB3A 3CCVA 5M5XH 1E22A 4OIJA 1DOKA 4GOPA 2B63B 2QKIC 4K2LA 2K04A 4JV5Q 5TSSA 3OTOQ 2R6GA 1FR3A 3TP8A 2F0HA 2FMCA 2NN6H 2EE1A 2A74C 2F0FA 4UHVA 3PIO3 1C8CA 4N8X1 3HOYB 3S6AA 4JI7Q 2KHIA 3CP0A 1I5FA 3CHBD 4RHSA 2CH4A 1Y1WH 4POGA 1TU2B 3M4YA 1QILA 2N55A 4XT1B 1KQSA 5CV7A 4CDCC 3NTKA 3AMUA 3CQZB 3OIPA 4RGOS 5C4ZA 5IOCA 1EIGA 2EYMA 1SYGA 1K83H 3X3NA 4HCSA 2NTTA 4MHEA 3S9WA 1PRTD 5T1GA 3HS0C 3CPFA 3Q22A 4A93G 1K3RA 1H9RA 5LL6X 4G7HC 2DJGC 3GTJH 2N78A 2JA6H 2PMZE 1JE4A 4L63B 3NE5B 4YY3L 4Q5VA 2UUCL 3I73A 4QJFA 1RD9D 1I94Q 1X3PA 1DJRD 4G57A 3RLNA 1V43A 5JPMC 4YIJA 1GUSA 1QVFA 2ENBA 1I4HA 3MXPA 1FD7D 2JN4A 3F2DA 5M3FH 1Y8NB 3AU7A 1JT8A 3CCSA 1TWAH 4HJ9A 2E76C 1B2TA 4LF9L 3HKSA 2F3WA 2NVQB 2F0TA 1Y1VB 2PQAA 2UU9L 2VUMH 1HFGA 1GVPA 2QEXA 4A3FH 1KC8C 2HCIA 3K6OA 1AZPA 4X65L 2F1MA 4X64L 1QOHA 3TP7A 3DWPA 2JA5H 3NP8A 5LMUQ 3OMCA 2JA7B 4HJ7A 3GP7A 2FXQA 4B3TL 1VQ6A 1WCMG 1EZ8A 4U68A 4DR4L 3RD4A 3F2CA 3KF8B 2VQFL 1QWYA 3PUYA 2D9UA 2B2YA 4C3IB 2PQEA 4PNYA 2Z4IA 2UXBL 2MHVA 4IALA 3KLSA 2QA4A 1O7ZA 1STEA 1PVOA 1CKNB 3L9AX 2TSSA 4KJOA 2F52A 5KYLA 4H0LC 1ZKOA 1S72A 4GKKL 3EN2A 4PMBA 1GHKA 4H13C 5IODA 3ZLMA 1RL2A 3G48A 5EQ0A 3MEHA 3QWNA 4G7ZC 1PH1A 3NTIA 1VQKA 1FNUA 1KABA 4FF3A 4HMIA 4QGUA 5EAYA 2MO1A 3D31A 4ZQ3A 3CCJA 4QB4A 1L2FA 1D5XC 4FYDA 2FFKB 4DK6C 2WAQG 3NBHB 2E5LQ 3S14B 2Z9HA 3HOWG 5LMNL 3S1QB 2B2TC 4GS3A 3JAMc 3N52A 2A6EC 3HOYG 4OO1I 5I9OA 1Q46A 3S2HB 2KCCA 3A8JE 2JE6I 4XYOA 3V05A 1SR3A 4LF4Q 1BUVT 4MN3A 2HDLA 3H0GH 3JC66 4M1UB 1F77A 4YCUA 4PZ7A 1SFOB 3GTLB 4IPCA 1LTSD 3LGJA 2NVXH 4AYBG 2AQ3B 5IYCG 2WAQE 4RCNA 1F9SA 5DAUA 1XNQQ 4KMUC 3OIQA 1EY5A 1PLFA 4DV0Q 4NKLA 5IGEA 5M3MG 1QNUA 4C56C 2GVBA 1SNQA 2PZUA 1KLGD 2F3VA 4DV7L 3D4DA 4JI0Q 3S1MH 1KAAA 3U4VA 1OXVA 5GAEC 1QJOA 2MPMA 5D65A 2O5JC 1PV4A 1S5BD 3EJIA 1B3QA 2A68D 3I72A 1G6PA 3PF4A 5HURA 4A3DG 2HHHL 2HCCA 3VYUA 1EQQA 2FMMA 2OQ0A 4B3SQ 1V1QA 3AEVA 3K5LA 4MZ9A 4JI2L 5JAVA 2EXZA 2B2WC 2PPBC 5FJ8G 1Y1VG 1AE3A 3PMFA 3RUZA 1K0SA 2AMCB 4OONA 5FO9B 2DN8A 3GD7A 3PO3B 2I5LX 1U4RA 1E1OA 1ET9A 2BA0A 1UE1A 4X3UA 2K03A 5JJ7A 4DAPA 1B44D 2MUYA 4F88A 1LLRD 3T1YL 1XTDA 1JJGA 3MXGA 1NUCA 1YNND 3VR3A 2KEEA 5C3WA 1HA5A 2RF4A 1D7QA 1DOLA 2EY5A 4ODGA 2R92B 3DM1A 4QY7A 4DFAA 3LNNA 2EYJA 5CYUA 4HEDA 4WGJA 4FXDA 3MXNA 4B3MQ 3HOZB 2E2IH 2AQ1B 3KFUA 4KN7C 5JFZA 1RTOA 5CGLA 3L0OA 3PO2H 4C3HB 4F7XA 2PYKA 4ZUIA 1MSHA 3HOUH 5JJ6A 4CKEA 3GTGB 3NQIA 3FVQA 1QE6A 1RODA 3NENA 4BBRH 2DNEA 1I50H 1YNJD 4X2CA 1UAPA 4G4KA 2ZTEA 1CKOA 2B3GA 4JG2A 1K3BC 5EU0A 1K8MA 1XPUA 1SXTA 2PZWA 1STYA 1IKMA 4DR1Q 3C3LA 4UP9A 1K28A 3ERQA 4DUZL 3KYHC 3A7LA 1JOKA 1CZWA 4IFDI 1XMOL 1JWMD 3I4LA 4YWMA 1O7IA 1PYWD 3I3CA 3HRZC 4A3JB 1TIID 5FKAC 2K33A 4IUUA 2R93B 1P8LA 5A35A 5ELDA 1PH7A 2BA1A 1I6VC 2R7DA 4YWKA 1PMRA 1EEID 4IUPA 4MTNA 3N3UA 2E75C 3CF5A 4DR7Q 2IHFA 3T16A 2P5ZX 1HCZA 5KYIA 4K0KL 1Q12A 1CK1A 3STBD 1SN8A 3NUCA 1NH1A 3KUPA 4DR6Q 3RN2A 3A55A 4OXPA 2L55A 2VZAA 4A3BH 2MNAA 1C4QA 1JMCA 3G71A 2UXCL 2EYOA 3GTPH 3BVGA 3FMCA 1O7YA 2MO0A 1X65A 5G3LD 3ZYYX 1X3QA 4JI1Q 4C2MH 1JORA 1EWIA 4BBSG 2KVMA 1QUQB 2JA9A 1BCPB 1UUPA 2JA8G 4ME3A 1ZEQX 1CHPD 1LO5D 1AP0A 1TR5A 1EQTA 4QL5A 4X66L 2BH2A 4ZYSA 3M4OB 2GA4B 3I4NG 2XGTA 4NP5A 2R7ZH 3ND9A 2LFNA 5IGFA 4Y7NH 4XI8A 3A8IE 1V8QA 5HGQA 1R4PB 1Z7TA 2L0CA 2F3IA 1CHQD 2O5IC 5BR8L 4QUCA 1OXTA 4A3MB 3ONAB 3P1HA 2K1BA 3DUZA 3S15B 2YTYA 4RCOA 3WWVA 2A8VA 3PCOB 1D2BA 2K32A 1HQRD 1BBXC 3QOLA 2PI2E 4HMJA 3VYTA 3ND8A 4GLAC 4HIMA 2Y0SB 4R1JA 3ZJYC 1LT5D 2WFWA 4X6AH 1IXRA 1U0LA 2AWNA 2N8NA 2JQOA 1CQFA 4JOIC 2Z0SA 5D3DA 4HN7A 1EY8A 1TWFH 1TY0A 4A3KB 3FP9A 2R3ZA 3PUXA 2Z8LA 3TN2A 3TZUA 4ID6A 1ESRA 1EZ6A 3ZCBA 1IBML 4DKAC 1IL8A 1C0AA 2CWPA 2CVRA 2AKWB 5FLMG 4NDXA 2KECA 1XMQL 4DAYA 4LUVA 4A3IH 3NBIA 1GKHA 4M16A 1K8GA 1QZHA 3A8KE 1II3A 4X3TA 4A3JG 5GROA 2E2HB 2R93G 4GZYC 1B70B 4DR2L 1SYEA 4RAUC 2K5HA 2ZJPA 2CHBD 4H44C 4LFAL 1TY2A 4CJ2C 1S5FD 1SE3A 1F9QA 1RKNA 3D6CA 1VQOA 5K36G 2B63H 1B50A 2O2LD 1JC7A 3MZ5A 4JV5L 2WIIB 3OTOL 1NTGA 5JEAG 4WJ4A 1PFMA 1RDPD 1BCPD 4HJ8A 2B2UA 1SMYD 1K73C 4LF8Q 3JAME 4NXNQ 1WTXA 4Y52H 1VQAA 3W1BA 3UI2A 5FK9C 3EVQA 1EOVA 5IGCA 1UE7A 3E6ZX 2MGSA 3DMUA 2RVLA 3DXJC 3HOYH 1WTVA 3EBEA 3AFQA 3SE0A 3K5NA 4PV1C 1VQBA 4A93B 4EQPA 4LUOA 1Q8IA 1WTOA 4K5XA 4ZKCB 4G7OC 1H9SB 4PMCA 4A3EB 3CQZH 5IYBH 2F0SA 3I91A 5IP7G 3E0EA 4BY1G 4BY7H 2ZM6Q 2TMPA 3GTOB 5C4XG 4V0BA 1ENFA 2BE5D 4L8JA 1KTKA 1HNZQ 4U673 4GNXB 4X62Q 1CTMA 4KY5A 3VDYA 2B2VC 5L37A 1QVCA 1S5CD 4KK7A 1YBYA 4JI8L 1WVLA 1PH3A 3OW7A 1X3FA 5ELEA 3E5SA 3RZOB 1G2TA 3CCMA 3BS1A 4UY8C 4LF7Q 1EIFA 5IYDG 3E9IA 5ELFA 1WCMB 2IW3A 5JVH3 3R93A 5C0XH 5IY0A 5EKKA 3S1RB 4KY7A 2NVQH 1HHVA 3OPOA 2Y0SG 1HUMA 4A3GB 2FINB 4GNXA 3QR8A 3RLFA 3KJOA 1MI2A 3M9BA 4POFA 3TEHB 1A3UA 4A3KG 3H3VC 1SYFA 5LMUL 3M7NA 4J15A 3ERSX 4UDUC 1B8AA 2JA7H 5EKLA 2A6ED 4N9PA 4DV5Q 5C3EG 2NWGA 1VQLA 1KLUD 4C3IH 4NXMQ 2IT1A 1Q1BA 3ULJA 1JWUD 3CC4A 4JW0A 2DGYA 3PIPA 1QZGA 3E3XA 3J7AV 2SOBA 2XIWA 2WAQB 1C9OA 4JBWA 1VQGA 3TP5A 1TKWB 2Z6KC 5C44G 2F0EA 3HOWB 2HIVA 4FXGC 1C48A 3BZCA 3S17B 4LF6L 2NVTB 3J81E 3W1GA 2JJQA 4UPAA 3SK4A 1TWCB 2K05A 1TQOA 1ESFA 3QG1A 4XTCS 4ITRA 3I4OA 3M4PA 4OX9Q 1HXYD 1S40A 1UWVA 4AYBB 1W3SA 2E5LL 5IT9c 3TDQA 1OXUA 1X3GA 4DV3Q 4UP8A 3S14H 3SE5A 2LMCB 2YTVA 4RG1A 5FLXE 2F0VA 1DXMA 4XIGS 5M3MB 4AQYQ 2A5HA 1EEFD 2D5DA 1A15A 2K5DA 3TS0A 3S2HH 4LF4L 2PW5A 3S2DB 1BBUA 4WFN3 5E1FA 5NUCA 4QIWE 4DGZA 3FKIG 1FJGQ 1G6ZA 3BZKA 4R8IA 1EYGA 4U07A 4LJZC 2HUGA 4A3EG 2BDNA 4R4QA 4CDDC 1LV9A 2HIXA 4NW2A 1KDBA 4IJLA 4L5SA 4A3DB 1VQHA 1GUNA 4CKBA 1RJTA 5JEAJ 2MJ8A 4X2DA 1OTCA 3K0XA 2ALYB 1KD1C 3KK7A 4O1NA 2XRSD 4A3CH 1JICA 4KTAA 4AH6A 1X56A 1SNOA 5IE8A 4DF7A 3L7ZC 4OEMB 1Q82C 5IP9H 2B39A 2I5HA 3S16B 3HOVB 1J8IA 3J81i 3I8ZA 1VQPA 2XNAC 3V96A 1TVXA 1HZAA 1PRTF 1H9JA 1IW7D 2F0NA 2UUBL 3I70A 1JQYD 4EGVA 4A3GG 2EY6A 2N49A 3IFDA 3GTQH 3TREA 2K50A 1V1PB 1XPOA 3PO3H 4OO1G 2RDHA 1N32Q 1F2LA 4DV1Q 2B8FA 3CPWA 4K8IA 1MJCA 1ASZA 2SEBD 1AEXA 2IHEA 1VQNA 4JC0A 1NY4A 3C2PA 2WV6D 1D5MC 1UNSA 2CWAA 2HT1A 3R8BA 2E74C 4XXEA 5C6AA 3EFXD 1DYQA 1T9HA 3KF8A 2R92H 2M9VA 4L5RC 5EKIA 1ZYRC 4LMQD 1Y8OB 5C5LA 3KBXA 2EJGC 3R2TA 1W6KA 1BOSA 3URYA 1XNRQ 5JOBA 1CKNA 5A2QL 3HOZH 3H6MA 4L5QA 4LFBQ 4A4IA 1XX8A 4LAAA 1NE3A 1WI5A 2YU9B 2CFMA 2A19A 1AZQA 1LTBD 2X69A 4C3HH 3R2IA 1KDCA 1SLJA 2RHQB 1TS4A 4JVZA 4I7ZC 5E7NA 4KI0A 1U4MA 2JXMB 1Y1WB 4DV2L 1YHQA 3Q23A 4RGMA 1PH5A 4B3RQ 2VS1A 2XWJB 3KBGA 3IFTA 1EY9A 2JEAI 1SYDA 2PCFB 1ICFB 1QG7A 5HGTA 2L11A 2C5CA 1N9WA 3GTKH 5EPLA 3NBHA 2QCPX 2KOLA 3F1ZA 1JR0D 2K6AA 1PZKD 1SAPA 3MA2B 1SNPA 4JI3Q 4F87A 1N36Q 4BXXG 1IBKL 3ER0A 1PH4A 4KY6A 3P7JA 1FGBD 3CD6A 1X32A 1NAPA 1OXSC 4WJ3M 5IT9L 4JBMA 1Q8KA 1SJED 1PZJD 3J80c 5M5WH 1PTOF 4QF4A 2UUCQ 3SEBA 3DEOA 1EU4A 3MFYA 4U04A 4Z9CB 1ILPA 1T5XD 2QEJC 1L0WA 1VQEA 2PW7A 1TWAB 1HZBA 1IL2A 4DR7L 1I3QB 1E7ZA 2R7FA 2RA4A 3TP6A 4LF9Q 2ICIA 1JB7A 4BBSB 4HIDA 3BVMA 3OYYA 3K80C 4A3FB 4KD3A 3VR2A 2JA8B 1VQFA 2WP8J 4LFCQ 3I4MG 4DR6L 3S1NH 4X65Q 4DA2A 2KCTA 4RGNA 3K58A 2A6HD 3HG9A 3G6EA 2UXDQ 1OXXK 2JA5B 4GKJQ 2QDLA 3HOVG 4JPBW 3CMEA 4C3JB 1DD2A 3DLLA 3I4NB 2F0LA 1WOCA 2NUDA 3DWQA 1NMGA 4TSSA 4F8MA 1JB3A 3OOCA 2K5WA 4N67A 1PRTC 1X9NA 4DV6L 2VQFQ 4GN5A 1A8VA 2NB0A 4YHHL 2LXJA 5ELBA 2RDFA 1ICWA 1NNXA 1FGUA 1YVCA 2BH8A 4IFDG 3OWFA 4DUYL 2NVYH 1WTPA 1X55A 1IBLQ 3EQLC 1L1OC 3F8TA 3BVZA 1BF4A 2NBFA 1LACA 4HTHA 5C5MA 4A3MH 4GOPC 2LY7A 3S15H 1IZ6A 3KLSX 1FNWA 3A5UA 1CKMA 2ZXRA 1KL9A 5C0XI 1NMFA 1EIYB 3K0YA 2NUCA 2NN6G 2MFIA 4LF5Q 1JCKB 2KHJA 4DV4L 4ZRZA 3K8AA 4WJWA 5T1IA 3I7FA 3HFZB 4MNOA 4DNRB 3PIP3 4S3SA 4JI6Q 2IPKD 5DM73 3C1FA 3T1HQ 4Q0FA 1Y1WG 1BNZA 1B3AA 2DUDA 3CCRA 4A3LH 2WB1G 2EOTA 2MQHA 3M3YB 5CC4A 4QQBX 1O78A 4OWXB 2L15A 3GQBA 3K7AH 3MWYW 3PSIA 2Z4HA 3HOXH 1J5EQ 5CMTA 4QMGA 1HRJA 2L5TA 2F4VQ 3D4WA 3IKJA 1XYIA 3KF6B 4HAEA 4JI5L 1LTGD 5IWAQ 1YJ9A 3S1MB 4I7AA 4KN4C 3BJUA 3MC0B 2JA6G 3J81j 1HNWQ 2WB1E 4UAIA 1A6XA 1VMPA 2NZOA 1WYDA 4OGQC 1P16A 1PTOC 3OSOA 3QOJA 5DM63 1NR2A 1M90C 3GO5A 2SNMA 2X6LA 4B9XA 5M3FG 2K5QA 2HHHQ 4K6LA 3SDZA 2X6GA 1QCBD 3D6WA 1LTTD 2ID0A 2HQLA 3T53B 4KKSA 3J80L 2CW0D 3IL8A 4GN4B 4E6IA 4LF8L 2EYFA 4NXNL 4R9WA 1WTQA 2VUMG 4A3FG 1DONA 5ELOA 1TWGB 2LSSA 1Y69U 3DEPA 3UDGA 3K5MA 1B1ZA 4BY1B 1XXGA 1NBWA 3CCQA 4DR5L 5C4XB 2JA5G 3A74A 1KXLA 4C3JG 2QILA 4A93H 3RMHA 3Q0AA 1STAA 5C4JB 4JYAQ 3LETA 5CV8A 3K57A 3P75A 1D8LA 4KHPL 1QUQA 1MHWC 1WFQA 4KJNA 1HQMC 3A56A 2IWHA 4R4OA 1ILQA 2B2YC 2F0UA 1GD7A 1G2SA 1VMCA 1YJNA 5JVG3 4DPGA 1YIJA 1Y8PB 4J1MA 1PH8A 5DLQE 1CT1D 2ZM6L 4DN4M 1HR0Q 1W6JA 1HR0W 3ULPA 1GUWA 1EU3A 3UE1A 4PZ6A 5KNDA 3GTOH 1EYDA 2KA7A 5CBEE 5FO8B 3NSWA 1O80A 3IRBA 4RH6A 2AWOA 1HNZL 1DGSA 4X62L 4ZCKA 4I65A 1YZ6A 4DNIA 1N33Q 3AB9A 1U4LA 2F0IA 2DY7A 4RFBA 1EQVA 2CCZA 1F9RA 4RKBA 4TRDA 1XTCD 5M5YB 4IPGA 1EL0A 3F2UA 5FOBB 1TS5A
chains in the Genus database with same CATH topology
3ERSX 4U0SA 2IY5B 4P74A 2K4KA 3TQYA 3U4ZA 1B8AA 1PH6A 2JA7H 5IYDH 3FHWA 3EN2A 4DV5Q 1WCMH 2JEBI 3S1RH 1YJWA 3ZLMA 1RL2A 3G48A 5C3EG 1VQLA 2Q2UA 5LMNQ 5LMNW 3UDIA 2OWOA 1PH1A 2Q2HA 5GAHC 1VQKA 1N33L 4C3IH 1X6OA 4NXMQ 2IT1A 1Q1BA 3ULJA 3CC4A 4QGUA 4IFDJ 4PG3A 4DV2Q 1XMOQ 2G03A 2DGYA 3H0GG 2MO1A 5EAYA 5M5YH 4A3KH 1XJVA 2OTJA 3J81c 3D31A 3PIPA 1QZGA 4DAMA 3CCJA 1L2FA 4DV5L 1AH9A 3CMAA 1C9OA 4DK6C 2WAQG 3A5ZB 1VQGA 3NBHB 4JBWA 2E5LQ 2Z6KC 5C44G 2HIVA 4LNQA 5C3EH 2GVAA 3BZCA 1N34Q 3HOWG 5LMNL 4LF6L 4GS3A 3JAMc 2E2JH 3HOYG 4DR3Q 4OO1I 1Q46A 3PIOA 4NXML 3W5OA 3W1GA 2JJQA 4UPAA 2JE6I 1SR3A 1IBKQ 3I56A 4LF4Q 3M4QA 4DV7Q 1V9PA 3MEFA 3H0GH 4ITRA 3JC66 4XTCS 5H1SE 2UUAQ 4R4CA 3I4OA 3M4PA 5FLXc 4OX9Q 1HZ9A 4APVA 1VCIA 4PZ7A 4YCUA 3TRZA 4IPCA 1S40A 2Z6KA 1UWVA 3LGJA 2NVXH 2YYZA 2E2HH 1W3SA 4AYBG 1M1KC 5IYCG 1PHJA 5IT9c 2E5LL 3KLWA 2WAQE 1OXUA 5C44H 2VW9A 1X3GA 1N34L 4DV3Q 4UP8A 1XNQQ 3HOWH 3S14H 5CKLA 3S17H 2K14A 3K81C 3SE5A 2YTVA 4RG1A 4DV0Q 4XIGS 1MJEA 1TWHH 4DR3L 4AQYQ 4JI7L 5M3MG 1GM5A 3TS0A 3S2HH 4LF4L 2GVBA 3KF6A 1BBUA 2F6SA 1TWCH 3KOJA 4DV7L 4JI0Q 4QIWE 3S1MH 3FKIG 4JI2Q 1VS0A 3CC7A 2UUAL 1FJGQ 2NN6I 3BZKA 4U0UA 1EYGA 4U07A 4HJAA 4A3CG 3U4VA 4IOCA 1OXVA 1HJPA 1B7YB 5GAEC 3J7ZC 5IYCH 1I6HH 4A3EG 1VQJA 4HIKA 1LTLA 4R4QA 4TQUS 1PV4A 4DV3L 2HIXA 5IP9G 1PYSB 1G6PA 3PF4A 1CUKA 1VQMA 3CC2A 4IJLA 4L5SA 1VQHA 5JJIA 4A3DG 3I55A 5M3MH 2HHHL 5HY6A 1EQQA 2OQ0A 4B3SQ 5JEAJ 3KJPA 1V1QA 5AJ3Q 3AEVA 4A76A 3S2DH 1A62A 4X2DA 1FL0A 3T1YQ 1OTCA 3FKIH 4MZ9A 3K0XA 4OWTB 5GADC 4JI2L 2ALYB 1KD1C 2KENA 4DV6Q 4A3CH 3CXCA 4R4TA 5FJ8G 1Y1VG 4AH6A 1AE3A 2CQOA 2E8GA 1R9TH 4A3EH 1SRUA 1X56A 1YITA 3RZDH 5BR8Q 5IE8A 2AHOB 4YHHQ 3L7ZC 2AMCB 1I94L 4OONA 1Q82C 5IP9H 3GD7A 2I5HA 3PO3G 3J81i 1KAWA 2I5LX 1E1OA 1VQPA 2BA0A 1UE1A 4A3DH 2ES2A 3ICEA 4DUYQ 5JJ7A 4AIMA 5AJ3L 1HZAA 3T1YL 1XTDA 3CCEA 4PZ8A 1JJGA 1RIPA 1C7YA 5JFFA 3JAMi 2RF4A 2UUBL 3PO2G 4IPDA 1D7QA 5FJ8H 1Y1VH 4IOAA 4A3GG 2N49A 2R92G 3GTQH 3PUWA 3HOUG 4QY7A 3TREA 2K50A 4OWWB 2ASBA 1XPOA 4BBRG 3PO3H 4OO1G 3CAMA 1N32Q 3PF5A 4WGJA 1VQ5A 4ALPA 2NZHA 4B3MQ 4DV1Q 4PMWA 3RZOH 2E2IH 3CPWA 3DM3A 4LF7L 3HOZG 1MJCA 5C0XJ 1ASZA 3KDFB 3KFUA 2IHEA 1VQNA 1UE5A 1NY4A 4JC0A 1W2BA 4LW1A 2K52A 5JFZA 2CWAA 5CGLA 2HT1A 3L0OA 4DV4Q 2H5XA 3U50C 3PO2H 1IBMQ 4GOPB 4A3GH 4DAYB 1T9HA 4KHZA 4DUZQ 2R92H 2EXDA 1XPRA 3Q8DA 4L5RC 3HOUH 5JJ6A 1Q7YC 3PV0A 1PYBA 3NENA 4BBRH 1Z9FA 1I50H 2B29A 4FDBA 4P73A 3NEMA 1A0IA 2Q2TA 4X2CA 4EX5A 2ZTEA 1UE6A 1E3PA 1CKOA 1CKNA 2B3GA 3HKZE 4JG2A 1XNRQ 3HOZH 4L5QA 4LFBQ 4A4IA 5EU0A 1XPUA 1NE3A 1WI5A 2CFMA 1EUJA 2A19A 1BVSA 4DR1Q 1X3EA 1KRSA 4UP9A 4C3HH 4GLXA 1SLJA 1YHBA 2RHQB 4DUZL 4YCWA 3KYHC 4JI5Q 1JE5A 5E7NA 2ATWA 4KI0A 3TS2A 5ELNA 4IFDI 1XMOL 4DV2L 4YWMA 1O7IA 3E9HA 1YHQA 1HNXQ 1PH5A 4B3RQ 1SROA 2VS1A 4K0KQ 1XNRL 3D0FA 3G4SA 1P8LA 4P75A 4NB3A 4YWLA 2JEAI 4LFBL 3M85A 4R4IA 1PH7A 1S72A 1K8AC 4NPSA 1Y14B 2RHSB 2BA1A 3J7A5 2R7DA 1N9WA 3GTKH 1HZCA 2YU9H 1Q86C 4YWKA 4A3BG 3S24A 2ZJQA 2V1CC 3F1ZA 3H3VI 4MTNA 3S1QH 2UXCQ 3N3UA 3EIVA 1EFWA 2N3SA 4H02A 4JI3Q 1J6QA 2NVTH 3CF5A 1N36Q 4BXXG 1IBKL 2IHFA 3ER0A 1PH4A 4YCVA 1G51A 3UDXA 1HNXL 4JI4Q 3F2BA 4B3RL 4A75A 3CD6A 4JCVE 4K0KL 1OXSC 1Q12A 2K5VA 4OX9L 4WJ3M 3RLOA 1VQ7A 1VQIA 1WJJA 2VQEQ 4JBMA 1U5KA 3CUCA 1Q8KA 3STBD 1SN8A 1SFOH 1PA6A 3GTLH 3J80c 5M5WH 2QGQA 4LWCA 2UUCQ 4DR6Q 2CKZB 4LU4A 3RN2A 4OXPA 2I5MX 2VZAA 3GTMH 4A3BH 2MNAA 1XNQL 1JMCA 1PH9A 4U04A 3G71A 2UXCL 4X66Q 4DV0L 4DR5Q 3GTPH 1PFSA 4AQYL 2EIFA 1L0WA 4JI3L 1VQEA 1HZBA 4KLKA 1IL2A 1N36L 4BXXH 4DR7L 2MO0A 4JI4L 2R7ZG 1X65A 1E7ZA 2R7FA 4LF9Q 4JI0L 1YEZA 2PQAB 1JB7A 3ZC7A 4JI1Q 4C2MH 1FJGL 4HIDA 3CCUA 1EWIA 4BBSG 2LXKA 2OTLA 1QUQB 2VQEL 3OYYA 3K80C 2JA9A 1NJIC 1VQFA 2WP8J 4LFCQ 2K5NA 3I4MG 2JA8G 4ME3A 3S1NH 4DR6L 4KHPQ 4X65Q 1TXYA 3SGIA 3UDFA 3B6YA 4JI8Q 2VY3A 2KCTA 3G6EA 2UXDQ 4GKKL 1OXXK 4QL5A 2K75A 1K9MC 3A0JA 3STBC 4L5TA 4X66L 2BH2A 3HOVG 4GKJQ 3CMEA 1KHIA 3DLLA 3CCLA 4B3SL 1LYLA 2XGTA 3AFPA 1WOCA 2R7ZH 3I4NG 2EQSA 3AYHB 1NMGA 3PUVA 1I3QH 4PY3A 3OW2A 4Y7NH 1H95A 4XI8A 4N67A 1VQ4A 2OCEA 4BBSH 1X9NA 2KBNA 3H15A 4DV6L 2JK8A 5HGQA 2VQFQ 1BBWA 4GN5A 4LFCL 1A8VA 2F3IA 1VQ9A 2JA8H 1S3OA 3I4MH 4JBJA 5BR8L 2YV5A 4YHHL 1OXTA 2ZTDA 2LXJA 3PGZA 3ULLA 4A3MG 1Q1EA 2UXDL 2VNUD 1KIXA 1CSPA 1AE2A 2XTIA 2YTYA 3WWVA 2A8VA 3PCOB 1FGUA 1YVCA 3AQQA 1Q81C 3HOVH 3S16H 2BH8A 4GKJL 3K7UC 4IFDG 2PI2E 3HKZG 4C3JH 4DUYL 3I4NH 2NVYH 1L1OB 1YI2A 1QVGA 1E1TA 1X55A 4HIMA 4GLAC 4TVAB 4R1JA 3ZJYC 3I2ZA 1A63A 5GQOA 1LM0A 2WFWA 4X6AH 1MIUA 1IBLQ 4DR7Q 1IXRA 1L1OC 1U0LA 2AWNA 1K0RA 2N8NA 1JJCB 2JQOA 3F8TA 4JOIC 4DK3C 5JJKA 3RN5A 2Z0SA 4A3MH 1XMQQ 2D0OA 1PH2A 1TWFH 4EQ5A 4A3IG 4GOPC 3S15H 1IZ6A 1N32L 3A5UA 2RCNA 3FP9A 4B3ML 4DV1L 3SHGA 1CKMA 1KL9A 3PUXA 3UE0A 3J80i 2I0QA 1IYJB 4A3LG 5C0XI 1NMFA 1KRTA 1EIYB 4LF5Q 2NN6G 2MFIA 4DR2Q 2KHJA 4IJHA 1L1OA 3KDFA 4DV4L 4HIOA 3PUZA 4RMFA 4JOIA 1MKHA 4LFAQ 2PNHA 2Y0SE 3K8AA 3ZCBA 3HOXG 4DKAC 1IBLL 1IBML 4LF6Q 1C0AA 3CCVA 3I7FA 5M5XH 1E22A 2CWPA 2AKWB 5FLMG 4GOPA 3HFZB 3H3VH 2YTXA 4MNOA 3BU2A 1XMQL 4JI6Q 2B63G 3GTGH 4LUVA 4A3IH 3T1HQ 1EQRA 1GKHA 4M16A 4JV5Q 1Y1WG 1K8GA 3OTOQ 2R6GA 4GN3B 4X2EA 1QZHA 2DUDA 3CCRA 4A3LH 4A3JG 2WB1G 1HH2P 5GROA 2R93G 4LF5L 1VQDA 1B70B 4DR2L 2MQHA 4QQBX 4IPHA 2K5HA 2L15A 4OWXB 2ZJPA 4LFAL 3K7AH 3PSIA 2ZTCA 3HOXH 1J5EQ 5CMTA 4DR1L 3RNUA 2F4VQ 3S6AA 2GN5A 3KF6B 4O2DA 5FLMH 1VQOA 4JI5L 4JI7Q 4JI6L 5K36G 2KHIA 3CP0A 1I5FA 2B63H 1LUZA 3T1HL 5IWAQ 1YJ9A 4JBKA 4JV5L 1Y1WH 4POGA 1BKBA 3OTOL 1NTGA 5JEAG 3BJUA 4WJ4A 1KQSA 2JA6G 1YHAA 3J81j 4A3JH 4HJ8A 4LF8Q 1K73C 4LUZA 1N8RC 2R93H 4NXNQ 1HNWQ 2WB1E 4Y52H 1VQAA 2KCMA 3W1BA 4YY3Q 1FVIA 3M3YH 2NZOA 1EOVA 1WYDA 5IYBG 1P16A 1UE7A 1Z47A 4P71A 1J5EL 1K83H 1M90C 2F4VL 1SMXA 4P72A 4GLVB 3GO5A 5M3FG 3HOYH 2VL6A 3EBEA 3AFQA 4BY7G 2HHHQ 3CPFA 1VQBA 5IWAL 1ASYA 4LUOA 1E24A 1K3RA 4A93G 2IX1A 2ID0A 1CSQA 2ZJRA 2HQLA 4O0AA 3GTJH 2N78A 2JA6H 4GN4B 4LF8L 2PMZE 4NXNL 1HNWL 2UU9Q 2VUMG 5GAGC 4YY3L 4A3FG 2UUCL 5ELOA 1UEBA 4QJFA 3CQZH 4AYBE 2LSSA 5IYBH 3RR5A 4X64Q 2A1AA 3UDGA 1I94Q 3RLNA 5IP7G 1V43A 4HJ5A 1QVFA 1NBWA 3E0EA 4BY1G 1X54A 3F2DA 3CCQA 2Q2IA 2ZM6Q 5M3FH 4DR5L 4BY7H 2JA5G 3A74A 3GDEA 5C4XG 1KXLA 5J3BA 1JT8A 3CCSA 1TWAH 4HJ9A 4A93H 4LF9L 3HKSA 4B3TQ 4JYAQ 3LETA 4JI1L 1SE8A 5C0XG 1HNZQ 4DR4Q 5JJLA 4UP7A 4X62Q 4GNXB 2UUBQ 1GO3E 2PQAA 1JJ2A 2UU9L 2VUMH 4A3FH 1GVPA 1D8LA 2QEXA 4KHPL 1QUQA 1KC8C 1WFQA 4X65L 3VDYA 2IX0A 4R4OA 1TWGH 4X64L 4GNXC 2UXBQ 1QVCA 4JI8L 1YBYA 1VQCA 5IP7H 1GD7A 1YJNA 3MXNB 1PH3A 4DPGA 1YIJA 1PH8A 1X3FA 5DLQE 4BY1H 2ZM6L 1HR0Q 1HR0W 3ULPA 2JA5H 5C4XH 3UE1A 3CCMA 4PZ6A 3GTOH 5LMUQ 4UY8C 3M4OH 2PI2A 4LF7Q 1EIFA 4GKKQ 2D62A 5IYDG 3E9IA 4HJ7A 3IRBA 2JA7G 2FXQA 4B3TL 1VQ6A 2AWOA 4JYAL 1WCMG 5IY0A 1DGSA 1HNZL 5C4JH 3F2CA 3CW2C 3NELA 4X62L 2NVQH 4DR4L 2Y0SG 4IO9A 1YZ6A 2OQKA 3KF8B 2VQFL 3PUYA 3SN9A 4GNXA 4U0ZA 3RLFA 2D0PA 4DNIA 2C35B 1N33Q 3KJOA 2UXBL 3M9BA 4BA2I 2QA4A 4POFA 1PVOA 3TEHB 4BA1I 1CKNB 2CCZA 1HR0L 3L2PA 1G291 3U58A 4A3KG 4IPGA 1YNXA 1VQ8A 5LMUL 3M7NA 2F52A 4J15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERS X;  4U0S A;  2IY5 B;  4P74 A;  2K4K A;  3TQY A;  3U4Z A;  1B8A A;  1PH6 A;  2JA7 H;  5IYD H;  3FHW A;  3EN2 A;  4DV5 Q;  1WCM H;  2JEB I;  3S1R H;  1YJW A;  3ZLM A;  1RL2 A;  3G48 A;  5C3E G;  1VQL A;  2Q2U A;  5LMN Q;  5LMN W;  3UDI A;  2OWO A;  1PH1 A;  2Q2H A;  5GAH C;  1VQK A;  1N33 L;  4C3I H;  1X6O A;  4NXM Q;  2IT1 A;  1Q1B A;  3ULJ A;  3CC4 A;  4QGU A;  4IFD J;  4PG3 A;  4DV2 Q;  1XMO Q;  2G03 A;  2DGY A;  3H0G G;  2MO1 A;  5EAY A;  5M5Y H;  4A3K H;  1XJV A;  2OTJ A;  3J81 c;  3D31 A;  3PIP A;  1QZG A;  4DAM A;  3CCJ A;  1L2F A;  4DV5 L;  1AH9 A;  3CMA A;  1C9O A;  4DK6 C;  2WAQ G;  3A5Z B;  1VQG A;  3NBH B;  4JBW A;  2E5L Q;  2Z6K C;  5C44 G;  2HIV A;  4LNQ A;  5C3E H;  2GVA A;  3BZC A;  1N34 Q;  3HOW G;  5LMN L;  4LF6 L;  4GS3 A;  3JAM c;  2E2J H;  3HOY G;  4DR3 Q;  4OO1 I;  1Q46 A;  3PIO A;  4NXM L;  3W5O A;  3W1G A;  2JJQ A;  4UPA A;  2JE6 I;  1SR3 A;  1IBK Q;  3I56 A;  4LF4 Q;  3M4Q A;  4DV7 Q;  1V9P A;  3MEF A;  3H0G H;  4ITR A;  3JC6 6;  4XTC S;  5H1S E;  2UUA Q;  4R4C A;  3I4O A;  3M4P A;  5FLX c;  4OX9 Q;  1HZ9 A;  4APV A;  1VCI A;  4PZ7 A;  4YCU A;  3TRZ A;  4IPC A;  1S40 A;  2Z6K A;  1UWV A;  3LGJ A;  2NVX H;  2YYZ A;  2E2H H;  1W3S A;  4AYB G;  1M1K C;  5IYC G;  1PHJ A;  5IT9 c;  2E5L L;  3KLW A;  2WAQ E;  1OXU A;  5C44 H;  2VW9 A;  1X3G A;  1N34 L;  4DV3 Q;  4UP8 A;  1XNQ Q;  3HOW H;  3S14 H;  5CKL A;  3S17 H;  2K14 A;  3K81 C;  3SE5 A;  2YTV A;  4RG1 A;  4DV0 Q;  4XIG S;  1MJE A;  1TWH H;  4DR3 L;  4AQY Q;  4JI7 L;  5M3M G;  1GM5 A;  3TS0 A;  3S2H H;  4LF4 L;  2GVB A;  3KF6 A;  1BBU A;  2F6S A;  1TWC H;  3KOJ A;  4DV7 L;  4JI0 Q;  4QIW E;  3S1M H;  3FKI G;  4JI2 Q;  1VS0 A;  3CC7 A;  2UUA L;  1FJG Q;  2NN6 I;  3BZK A;  4U0U A;  1EYG A;  4U07 A;  4HJA A;  4A3C G;  3U4V A;  4IOC A;  1OXV A;  1HJP A;  1B7Y B;  5GAE C;  3J7Z C;  5IYC H;  1I6H H;  4A3E G;  1VQJ A;  4HIK A;  1LTL A;  4R4Q A;  4TQU S;  1PV4 A;  4DV3 L;  2HIX A;  5IP9 G;  1PYS B;  1G6P A;  3PF4 A;  1CUK A;  1VQM A;  3CC2 A;  4IJL A;  4L5S A;  1VQH A;  5JJI A;  4A3D G;  3I55 A;  5M3M H;  2HHH L;  5HY6 A;  1EQQ A;  2OQ0 A;  4B3S Q;  5JEA J;  3KJP A;  1V1Q A;  5AJ3 Q;  3AEV A;  4A76 A;  3S2D H;  1A62 A;  4X2D A;  1FL0 A;  3T1Y Q;  1OTC A;  3FKI H;  4MZ9 A;  3K0X A;  4OWT B;  5GAD C;  4JI2 L;  2ALY B;  1KD1 C;  2KEN A;  4DV6 Q;  4A3C H;  3CXC A;  4R4T A;  5FJ8 G;  1Y1V G;  4AH6 A;  1AE3 A;  2CQO A;  2E8G A;  1R9T H;  4A3E H;  1SRU A;  1X56 A;  1YIT A;  3RZD H;  5BR8 Q;  5IE8 A;  2AHO B;  4YHH Q;  3L7Z C;  2AMC B;  1I94 L;  4OON A;  1Q82 C;  5IP9 H;  3GD7 A;  2I5H A;  3PO3 G;  3J81 i;  1KAW A;  2I5L X;  1E1O A;  1VQP A;  2BA0 A;  1UE1 A;  4A3D H;  2ES2 A;  3ICE A;  4DUY Q;  5JJ7 A;  4AIM A;  5AJ3 L;  1HZA A;  3T1Y L;  1XTD A;  3CCE A;  4PZ8 A;  1JJG A;  1RIP A;  1C7Y A;  5JFF A;  3JAM i;  2RF4 A;  2UUB L;  3PO2 G;  4IPD A;  1D7Q A;  5FJ8 H;  1Y1V H;  4IOA A;  4A3G G;  2N49 A;  2R92 G;  3GTQ H;  3PUW A;  3HOU G;  4QY7 A;  3TRE A;  2K50 A;  4OWW B;  2ASB A;  1XPO A;  4BBR G;  3PO3 H;  4OO1 G;  3CAM A;  1N32 Q;  3PF5 A;  4WGJ A;  1VQ5 A;  4ALP A;  2NZH A;  4B3M Q;  4DV1 Q;  4PMW A;  3RZO H;  2E2I H;  3CPW A;  3DM3 A;  4LF7 L;  3HOZ G;  1MJC A;  5C0X J;  1ASZ A;  3KDF B;  3KFU A;  2IHE A;  1VQN A;  1UE5 A;  1NY4 A;  4JC0 A;  1W2B A;  4LW1 A;  2K52 A;  5JFZ A;  2CWA A;  5CGL A;  2HT1 A;  3L0O A;  4DV4 Q;  2H5X A;  3U50 C;  3PO2 H;  1IBM Q;  4GOP B;  4A3G H;  4DAY B;  1T9H A;  4KHZ A;  4DUZ Q;  2R92 H;  2EXD A;  1XPR A;  3Q8D A;  4L5R C;  3HOU H;  5JJ6 A;  1Q7Y C;  3PV0 A;  1PYB A;  3NEN A;  4BBR H;  1Z9F A;  1I50 H;  2B29 A;  4FDB A;  4P73 A;  3NEM A;  1A0I A;  2Q2T A;  4X2C A;  4EX5 A;  2ZTE A;  1UE6 A;  1E3P A;  1CKO A;  1CKN A;  2B3G A;  3HKZ E;  4JG2 A;  1XNR Q;  3HOZ H;  4L5Q A;  4LFB Q;  4A4I A;  5EU0 A;  1XPU A;  1NE3 A;  1WI5 A;  2CFM A;  1EUJ A;  2A19 A;  1BVS A;  4DR1 Q;  1X3E A;  1KRS A;  4UP9 A;  4C3H H;  4GLX A;  1SLJ A;  1YHB A;  2RHQ B;  4DUZ L;  4YCW A;  3KYH C;  4JI5 Q;  1JE5 A;  5E7N A;  2ATW A;  4KI0 A;  3TS2 A;  5ELN A;  4IFD I;  1XMO L;  4DV2 L;  4YWM A;  1O7I A;  3E9H A;  1YHQ A;  1HNX Q;  1PH5 A;  4B3R Q;  1SRO A;  2VS1 A;  4K0K Q;  1XNR L;  3D0F A;  3G4S A;  1P8L A;  4P75 A;  4NB3 A;  4YWL A;  2JEA I;  4LFB L;  3M85 A;  4R4I A;  1PH7 A;  1S72 A;  1K8A C;  4NPS A;  1Y14 B;  2RHS B;  2BA1 A;  3J7A 5;  2R7D A;  1N9W A;  3GTK H;  1HZC A;  2YU9 H;  1Q86 C;  4YWK A;  4A3B G;  3S24 A;  2ZJQ A;  2V1C C;  3F1Z A;  3H3V I;  4MTN A;  3S1Q H;  2UXC Q;  3N3U A;  3EIV A;  1EFW A;  2N3S A;  4H02 A;  4JI3 Q;  1J6Q A;  2NVT H;  3CF5 A;  1N36 Q;  4BXX G;  1IBK L;  2IHF A;  3ER0 A;  1PH4 A;  4YCV A;  1G51 A;  3UDX A;  1HNX L;  4JI4 Q;  3F2B A;  4B3R L;  4A75 A;  3CD6 A;  4JCV E;  4K0K L;  1OXS C;  1Q12 A;  2K5V A;  4OX9 L;  4WJ3 M;  3RLO A;  1VQ7 A;  1VQI A;  1WJJ A;  2VQE Q;  4JBM A;  1U5K A;  3CUC A;  1Q8K A;  3STB D;  1SN8 A;  1SFO H;  1PA6 A;  3GTL H;  3J80 c;  5M5W H;  2QGQ A;  4LWC A;  2UUC Q;  4DR6 Q;  2CKZ B;  4LU4 A;  3RN2 A;  4OXP A;  2I5M X;  2VZA A;  3GTM H;  4A3B H;  2MNA A;  1XNQ L;  1JMC A;  1PH9 A;  4U04 A;  3G71 A;  2UXC L;  4X66 Q;  4DV0 L;  4DR5 Q;  3GTP H;  1PFS A;  4AQY L;  2EIF A;  1L0W A;  4JI3 L;  1VQE A;  1HZB A;  4KLK A;  1IL2 A;  1N36 L;  4BXX H;  4DR7 L;  2MO0 A;  4JI4 L;  2R7Z G;  1X65 A;  1E7Z A;  2R7F A;  4LF9 Q;  4JI0 L;  1YEZ A;  2PQA B;  1JB7 A;  3ZC7 A;  4JI1 Q;  4C2M H;  1FJG L;  4HID A;  3CCU A;  1EWI A;  4BBS G;  2LXK A;  2OTL A;  1QUQ B;  2VQE L;  3OYY A;  3K80 C;  2JA9 A;  1NJI C;  1VQF A;  2WP8 J;  4LFC Q;  2K5N A;  3I4M G;  2JA8 G;  4ME3 A;  3S1N H;  4DR6 L;  4KHP Q;  4X65 Q;  1TXY A;  3SGI A;  3UDF A;  3B6Y A;  4JI8 Q;  2VY3 A;  2KCT A;  3G6E A;  2UXD Q;  4GKK L;  1OXX K;  4QL5 A;  2K75 A;  1K9M C;  3A0J A;  3STB C;  4L5T A;  4X66 L;  2BH2 A;  3HOV G;  4GKJ Q;  3CME A;  1KHI A;  3DLL A;  3CCL A;  4B3S L;  1LYL A;  2XGT A;  3AFP A;  1WOC A;  2R7Z H;  3I4N G;  2EQS A;  3AYH B;  1NMG A;  3PUV A;  1I3Q H;  4PY3 A;  3OW2 A;  4Y7N H;  1H95 A;  4XI8 A;  4N67 A;  1VQ4 A;  2OCE A;  4BBS H;  1X9N A;  2KBN A;  3H15 A;  4DV6 L;  2JK8 A;  5HGQ A;  2VQF Q;  1BBW A;  4GN5 A;  4LFC L;  1A8V A;  2F3I A;  1VQ9 A;  2JA8 H;  1S3O A;  3I4M H;  4JBJ A;  5BR8 L;  2YV5 A;  4YHH L;  1OXT A;  2ZTD A;  2LXJ A;  3PGZ A;  3ULL A;  4A3M G;  1Q1E A;  2UXD L;  2VNU D;  1KIX A;  1CSP A;  1AE2 A;  2XTI A;  2YTY A;  3WWV A;  2A8V A;  3PCO B;  1FGU A;  1YVC A;  3AQQ A;  1Q81 C;  3HOV H;  3S16 H;  2BH8 A;  4GKJ L;  3K7U C;  4IFD G;  2PI2 E;  3HKZ G;  4C3J H;  4DUY L;  3I4N H;  2NVY H;  1L1O B;  1YI2 A;  1QVG A;  1E1T A;  1X55 A;  4HIM A;  4GLA C;  4TVA B;  4R1J A;  3ZJY C;  3I2Z A;  1A63 A;  5GQO A;  1LM0 A;  2WFW A;  4X6A H;  1MIU A;  1IBL Q;  4DR7 Q;  1IXR A;  1L1O C;  1U0L A;  2AWN A;  1K0R A;  2N8N A;  1JJC B;  2JQO A;  3F8T A;  4JOI C;  4DK3 C;  5JJK A;  3RN5 A;  2Z0S A;  4A3M H;  1XMQ Q;  2D0O A;  1PH2 A;  1TWF H;  4EQ5 A;  4A3I G;  4GOP C;  3S15 H;  1IZ6 A;  1N32 L;  3A5U A;  2RCN A;  3FP9 A;  4B3M L;  4DV1 L;  3SHG A;  1CKM A;  1KL9 A;  3PUX A;  3UE0 A;  3J80 i;  2I0Q A;  1IYJ B;  4A3L G;  5C0X I;  1NMF A;  1KRT A;  1EIY B;  4LF5 Q;  2NN6 G;  2MFI A;  4DR2 Q;  2KHJ A;  4IJH A;  1L1O A;  3KDF A;  4DV4 L;  4HIO A;  3PUZ A;  4RMF A;  4JOI A;  1MKH A;  4LFA Q;  2PNH A;  2Y0S E;  3K8A A;  3ZCB A;  3HOX G;  4DKA C;  1IBL L;  1IBM L;  4LF6 Q;  1C0A A;  3CCV A;  3I7F A;  5M5X H;  1E22 A;  2CWP A;  2AKW B;  5FLM G;  4GOP A;  3HFZ B;  3H3V H;  2YTX A;  4MNO A;  3BU2 A;  1XMQ L;  4JI6 Q;  2B63 G;  3GTG H;  4LUV A;  4A3I H;  3T1H Q;  1EQR A;  1GKH A;  4M16 A;  4JV5 Q;  1Y1W G;  1K8G A;  3OTO Q;  2R6G A;  4GN3 B;  4X2E A;  1QZH A;  2DUD A;  3CCR A;  4A3L H;  4A3J G;  2WB1 G;  1HH2 P;  5GRO A;  2R93 G;  4LF5 L;  1VQD A;  1B70 B;  4DR2 L;  2MQH A;  4QQB X;  4IPH A;  2K5H A;  2L15 A;  4OWX B;  2ZJP A;  4LFA L;  3K7A H;  3PSI A;  2ZTC A;  3HOX H;  1J5E Q;  5CMT A;  4DR1 L;  3RNU A;  2F4V Q;  3S6A A;  2GN5 A;  3KF6 B;  4O2D A;  5FLM H;  1VQO A;  4JI5 L;  4JI7 Q;  4JI6 L;  5K36 G;  2KHI A;  3CP0 A;  1I5F A;  2B63 H;  1LUZ A;  3T1H L;  5IWA Q;  1YJ9 A;  4JBK A;  4JV5 L;  1Y1W H;  4POG A;  1BKB A;  3OTO L;  1NTG A;  5JEA G;  3BJU A;  4WJ4 A;  1KQS A;  2JA6 G;  1YHA A;  3J81 j;  4A3J H;  4HJ8 A;  4LF8 Q;  1K73 C;  4LUZ A;  1N8R C;  2R93 H;  4NXN Q;  1HNW Q;  2WB1 E;  4Y52 H;  1VQA A;  2KCM A;  3W1B A;  4YY3 Q;  1FVI A;  3M3Y H;  2NZO A;  1EOV A;  1WYD A;  5IYB G;  1P16 A;  1UE7 A;  1Z47 A;  4P71 A;  1J5E L;  1K83 H;  1M90 C;  2F4V L;  1SMX A;  4P72 A;  4GLV B;  3GO5 A;  5M3F G;  3HOY H;  2VL6 A;  3EBE A;  3AFQ A;  4BY7 G;  2HHH Q;  3CPF A;  1VQB A;  5IWA L;  1ASY A;  4LUO A;  1E24 A;  1K3R A;  4A93 G;  2IX1 A;  2ID0 A;  1CSQ A;  2ZJR A;  2HQL A;  4O0A A;  3GTJ H;  2N78 A;  2JA6 H;  4GN4 B;  4LF8 L;  2PMZ E;  4NXN L;  1HNW L;  2UU9 Q;  2VUM G;  5GAG C;  4YY3 L;  4A3F G;  2UUC L;  5ELO A;  1UEB A;  4QJF A;  3CQZ H;  4AYB E;  2LSS A;  5IYB H;  3RR5 A;  4X64 Q;  2A1A A;  3UDG A;  1I94 Q;  3RLN A;  5IP7 G;  1V43 A;  4HJ5 A;  1QVF A;  1NBW A;  3E0E A;  4BY1 G;  1X54 A;  3F2D A;  3CCQ A;  2Q2I A;  2ZM6 Q;  5M3F H;  4DR5 L;  4BY7 H;  2JA5 G;  3A74 A;  3GDE A;  5C4X G;  1KXL A;  5J3B A;  1JT8 A;  3CCS A;  1TWA H;  4HJ9 A;  4A93 H;  4LF9 L;  3HKS A;  4B3T Q;  4JYA Q;  3LET A;  4JI1 L;  1SE8 A;  5C0X G;  1HNZ Q;  4DR4 Q;  5JJL A;  4UP7 A;  4X62 Q;  4GNX B;  2UUB Q;  1GO3 E;  2PQA A;  1JJ2 A;  2UU9 L;  2VUM H;  4A3F H;  1GVP A;  1D8L A;  2QEX A;  4KHP L;  1QUQ A;  1KC8 C;  1WFQ A;  4X65 L;  3VDY A;  2IX0 A;  4R4O A;  1TWG H;  4X64 L;  4GNX C;  2UXB Q;  1QVC A;  4JI8 L;  1YBY A;  1VQC A;  5IP7 H;  1GD7 A;  1YJN A;  3MXN B;  1PH3 A;  4DPG A;  1YIJ A;  1PH8 A;  1X3F A;  5DLQ E;  4BY1 H;  2ZM6 L;  1HR0 Q;  1HR0 W;  3ULP A;  2JA5 H;  5C4X H;  3UE1 A;  3CCM A;  4PZ6 A;  3GTO H;  5LMU Q;  4UY8 C;  3M4O H;  2PI2 A;  4LF7 Q;  1EIF A;  4GKK Q;  2D62 A;  5IYD G;  3E9I A;  4HJ7 A;  3IRB A;  2JA7 G;  2FXQ A;  4B3T L;  1VQ6 A;  2AWO A;  4JYA L;  1WCM G;  5IY0 A;  1DGS A;  1HNZ L;  5C4J H;  3F2C A;  3CW2 C;  3NEL A;  4X62 L;  2NVQ H;  4DR4 L;  2Y0S G;  4IO9 A;  1YZ6 A;  2OQK A;  3KF8 B;  2VQF L;  3PUY A;  3SN9 A;  4GNX A;  4U0Z A;  3RLF A;  2D0P A;  4DNI A;  2C35 B;  1N33 Q;  3KJO A;  2UXB L;  3M9B A;  4BA2 I;  2QA4 A;  4POF A;  1PVO A;  3TEH B;  4BA1 I;  1CKN B;  2CCZ A;  1HR0 L;  3L2P A;  1G29 1;  3U58 A;  4A3K G;  4IPG A;  1YNX A;  1VQ8 A;  5LMU L;  3M7N A;  2F52 A;  4J15 A; 
#chains in the Genus database with same CATH topology
 2IY5 B;  4U0S A;  2XWB B;  3BG3 A;  4P74 A;  3TQY A;  3U4Z A;  1PH6 A;  4TKO B;  3FHW A;  2F0O A;  1S5D D;  1WCM H;  2JEB I;  3S1R H;  3HGB A;  5C3E B;  3IAY A;  3BYY B;  2SNS A;  3UDI A;  2E2J B;  1X6O A;  4ABN A;  2KCN A;  2LKV A;  4IFD J;  4PG3 A;  1XMO Q;  3SK8 A;  2G03 A;  3H0G G;  1BQQ T;  1XJV A;  1BXT A;  1ONL A;  2OTJ A;  4FP5 D;  4DAM A;  4DV5 L;  1AH9 A;  3CMA A;  3A5Z B;  2OEO A;  5C44 B;  1A3T A;  4ILW A;  2GVA A;  1N34 Q;  4C1N K;  4IUN A;  4L6T B;  1TWH B;  5I2Y A;  1B9N A;  4DR3 Q;  4NXM L;  3J81 L;  4QIW B;  3VR4 A;  3M4Q A;  2FJ2 A;  3A54 A;  5H1S E;  2UUA Q;  2EJM A;  2PMZ B;  1WTR A;  1HZ9 A;  3C46 A;  4APV A;  1A2T A;  1VCI A;  4ME5 A;  4CDF C;  1D6E C;  2F0P A;  5KNB A;  2F0D A;  1I6H B;  2YYZ A;  1M1K C;  3BDL A;  2B2T A;  2OF1 A;  5E4W C;  3HOW H;  1G8Z D;  2L12 A;  5CKL A;  1A3V A;  1H9K A;  3S17 H;  2K14 A;  3K81 C;  3LX0 A;  2R61 A;  1MJE A;  4JI7 L;  1HTP A;  3GV3 A;  5FLX L;  5CV5 A;  5KRU A;  1TWC H;  2F6S A;  3FKI B;  1H9M A;  3CC7 A;  4QCL A;  4U0U A;  2CQA A;  3H94 A;  4HJA A;  1GJX A;  4IOC A;  1B7Y B;  2EY1 A;  1R9T B;  1LTA D;  5IYC H;  3RZD B;  1VQJ A;  1KNA A;  4HIK A;  1EWC A;  1LTL A;  1ENA A;  4DV3 L;  2K7V A;  1F2Z A;  1CUK A;  1EIH A;  3CC2 A;  5JJI A;  5M3M H;  2QW7 A;  1HPC A;  1B53 A;  2K28 A;  5AJ3 Q;  3S2D H;  1FL0 A;  3MXU A;  4IUT A;  1MSG A;  4FNF A;  1AN8 A;  4KV6 A;  4RA8 A;  2KEN A;  1CZG A;  3CXC A;  4R4T A;  2CQO A;  2E8G A;  1SRU A;  5COR A;  5BR8 Q;  2EZV A;  1H9S A;  2AHO B;  1E2V A;  4OIK A;  2KED A;  1I94 L;  2D2C C;  2B8G A;  4A3D H;  2ES2 A;  5ELC A;  2PZT A;  1PRT B;  3BDC A;  1DOM A;  1HTL D;  3CCE A;  4HCE A;  2B2W A;  3D4R A;  1RIP A;  1ZYR D;  2HD3 A;  1C7Y A;  5JFF A;  3QO2 A;  3JAM i;  4RGT A;  3PO2 G;  4C1N I;  5FJ8 H;  2M00 A;  1Y1V H;  3HOU G;  4IN3 A;  4OWW B;  2ASB A;  1RTN A;  4FO2 A;  4BBR G;  3CAM A;  1VQ5 A;  4ALP A;  2NZH A;  4PMW A;  1DZ1 A;  1SNM A;  1STH A;  3KDF B;  2QDB A;  3VR6 A;  1UE5 A;  1W2B A;  4LW1 A;  1STG A;  1G91 A;  4M8A A;  1IBM Q;  4GOP B;  5JJZ A;  1Q7Y C;  1OO9 B;  3BYT B;  3PV0 A;  1Z9F A;  2B29 A;  4FDB A;  3NEM A;  2Q2T A;  4EX5 A;  4X3S A;  2EY2 A;  3HKZ E;  2ZXO A;  5I4D A;  1SYC A;  4IQZ A;  4FVM A;  1B4O A;  1LTR D;  2AQ2 B;  1BVS A;  1X3E A;  1KRS A;  1LT4 D;  4NMZ A;  2I07 B;  4FXK C;  3CKI B;  4YCW A;  1JE5 A;  4EQO A;  2BOS A;  3TS2 A;  3NK9 A;  5ELN A;  1WD0 A;  1HNX Q;  2JP1 A;  1PFB A;  1XNR L;  4IUR A;  2RCF A;  2KQ3 A;  1D5Z C;  3WDN A;  4P75 A;  4NB3 A;  4YWL A;  1I4G A;  4LFB L;  5CV9 A;  3M85 A;  4J6H A;  4NPS A;  1Y14 B;  5M9O A;  3J7A 5;  3GTM B;  3TZD A;  1HZC A;  2YU9 H;  1Q86 C;  4A3B G;  2ZJQ A;  1R4Q B;  4DAV A;  3S1Q H;  3EIV A;  1EFW A;  2N3S A;  2NUN A;  3K59 A;  1CQV A;  4JI4 Q;  1G51 A;  3F2B A;  4B3R L;  3HP3 A;  2VB2 X;  1LTI D;  4KKU A;  1PTO B;  1JOO A;  2J0T D;  1VQI A;  2VQE Q;  3GTL H;  3CUC A;  5BN5 A;  1SFO H;  1PA6 A;  3SR1 A;  1GOZ A;  2L4N A;  2RSN A;  2I5M X;  4X3K A;  3MFG A;  1XNQ L;  4CJ0 B;  1PH9 A;  4XQQ A;  4BY7 B;  3NHH A;  4DV0 L;  2EIF A;  2C9O A;  4JI3 L;  3Q24 A;  4KLK A;  1N36 L;  1ENC A;  4KKT A;  4V19 0;  2R7Z G;  1AW7 A;  4JI0 L;  1YEZ A;  4J8Q A;  3W2D A;  2PQA B;  1V1O A;  2OTL A;  1SDF A;  3I4M B;  2A69 C;  3T4A C;  3X3M A;  5D3I B;  1NCV A;  1SND A;  1SJH D;  3UDF A;  3B6Y A;  5KEE A;  4JI8 Q;  5IGG A;  2VY3 A;  2N88 A;  3NWS A;  1BCP C;  1SMY C;  2SDF A;  2K75 A;  1F2M A;  3A0J A;  1NR4 A;  5E4X A;  1KHI A;  3CCL A;  4B3S L;  1LYL A;  2EQS A;  3AYH B;  3PUV A;  1I3Q H;  4PY3 A;  2F4I A;  3OW2 A;  3VYR A;  1VQ4 A;  3WOF A;  1VDZ A;  4BBS H;  2KBN A;  3H15 A;  4WOR A;  5CGK A;  1BBW A;  4LFC L;  2JA8 H;  1S3O A;  1WD1 A;  4JBJ A;  2YV5 A;  2ZTD A;  3ULL A;  3U9O A;  2H4O A;  2UXD L;  2VNU D;  4DXF A;  1KIX A;  3MTS A;  1LT3 D;  2XTI A;  1AE2 A;  2IL8 A;  4O42 A;  4GKJ L;  3GV6 A;  3NWT A;  3K7U C;  3MHB A;  4C3J H;  3L3O C;  3I4N H;  2G5D A;  1QVG A;  1E1T A;  1JWS D;  5E3F A;  4TVA B;  3M7G A;  5DNF A;  4MTK A;  1A63 A;  1XWE A;  3FDT A;  4JK1 C;  5M5X B;  1JJC B;  1VF5 C;  2BE5 C;  3Q6S A;  5JJK A;  1IHZ A;  1STB A;  4XT3 B;  4A3I G;  4P2C B;  4XQJ A;  3U9S A;  2RCN A;  5FO7 B;  4B3M L;  4IUV A;  3SHL A;  1V1P A;  1FYC A;  2KHS A;  2I0Q A;  1IYJ B;  1CFM A;  4HIO A;  3PUZ A;  4RMF A;  4JOI A;  1IBL L;  4DU9 A;  5CBA E;  4LF6 Q;  5C4H A;  3NXW A;  5CR3 A;  1GHJ A;  3SK6 A;  3H3V H;  2YTX A;  2E2D C;  1IKL A;  3BU2 A;  2B63 G;  1I4P A;  3GTG H;  1HA6 A;  1EQR A;  3VYS A;  2G9D A;  4GN3 B;  4X2E A;  1PTO D;  2CH4 W;  2WB1 B;  4K6D A;  3SXH A;  4B9W A;  1HH2 P;  4LF5 L;  5KGU A;  1VQD A;  3NTH A;  3CRK C;  1JOQ A;  2B2U C;  3PQI A;  2O4X A;  4IUQ A;  4IPH A;  2EVB A;  2EJF C;  1L0X B;  1K83 B;  2ZTC A;  4ZLT F;  2Z6B A;  4DR1 L;  3RNU A;  4FF2 A;  3CU7 A;  4O2D A;  2GN5 A;  5FLM H;  2F0G A;  4JI6 L;  2F0M A;  1LUZ A;  5CV6 A;  3T1H L;  4JBK A;  1BKB A;  3GTJ B;  2JA6 B;  3WOE A;  1YHA A;  3C1E A;  4XDX A;  4A3J H;  4LUZ A;  1N8R C;  2R93 H;  1KNE A;  2KCM A;  2DNC A;  4YY3 Q;  1PFN A;  3FRP B;  1FVI A;  2IJ0 A;  2F0K A;  3M3Y H;  4RHR A;  4RWS C;  5IYB G;  4ZUJ A;  3P20 A;  1Z47 A;  4P71 A;  1J5E L;  2F4V L;  1SMX A;  5M3F B;  4P72 A;  4GLV B;  4BY7 G;  2VL6 A;  1SE2 A;  5K36 H;  1GUG A;  1Z6H A;  5IWA L;  1ASY A;  1E24 A;  3DHQ A;  2IX1 A;  1CSQ A;  2ZJR A;  5JEA H;  1M8A A;  4O0A A;  4EVO A;  3QIA A;  2F0J A;  3E0J A;  5EBC A;  2V4D A;  2VUM B;  1NSN S;  2RDG A;  2UU9 Q;  1HNW L;  5GAG C;  2Q8R E;  1UEB A;  4AYB E;  2F03 A;  1BO0 A;  3RR5 A;  4X64 Q;  2A1A A;  5CMD A;  4HJ5 A;  1X54 A;  5JPN C;  4K2K A;  2BDO A;  2Q2I A;  1K8O A;  2NZ1 D;  2A73 B;  3GDE A;  4XYQ A;  5J3B A;  4B3T Q;  2J4X A;  3FPP A;  4JI1 L;  1SE8 A;  1L0Y B;  5C0X G;  4DR4 Q;  5JJL A;  4UP7 A;  2AUJ D;  4KHV A;  5IIF A;  1GO3 E;  5LL6 S;  2UUB Q;  1JJ2 A;  3GTQ B;  1LT6 D;  4QUF A;  2IX0 A;  1TWG H;  3LWE A;  4GNX C;  2UXB Q;  2ICE C;  1VQC A;  5IP7 H;  2XN9 C;  3MXN B;  4BY1 H;  2EPB A;  1EOT A;  1ET6 A;  5C4X H;  1AFP A;  3M4O H;  2PI2 A;  3T51 B;  1KDA A;  3KLR A;  4OEL B;  4GKK Q;  1HUN A;  2D62 A;  2IX3 A;  2JA7 G;  4JYA L;  1EFI D;  2XSC A;  5C4J H;  3CW2 C;  3NEL A;  4EQN A;  4IO9 A;  2OQK A;  2B2V A;  3SN9 A;  4U0Z A;  2D0P A;  3TME A;  2C35 B;  3MVV A;  4C3I G;  1BDO A;  4BA2 I;  2LS0 1;  4BA1 I;  1HR0 L;  2VXW A;  1G29 1;  3L2P A;  3U58 A;  1YNX A;  1SSO A;  1VQ8 A;  4CJ1 B;  2KJX A;  5IYD H;  2K4K A;  1GUT A;  1EYC A;  1YJW A;  3OMG A;  2OXP A;  2Q2U A;  5LMN Q;  5LMN W;  2WAC A;  2OWO A;  2Q2H A;  5GAH C;  1N33 L;  2MP1 A;  1IW7 C;  4LK1 C;  4WRD A;  4DV2 Q;  3H0G B;  5A2Q E;  5M5Y H;  5J1Z A;  4ULL A;  4A3K H;  3J81 c;  2NVX B;  3ERO A;  5I9P A;  4OHJ A;  3TSS A;  3GTK B;  4DXG A;  1DCZ A;  5K5P A;  4LNQ A;  5C3E H;  1CA6 A;  2RQX A;  2WKC A;  2E2J H;  3T56 B;  3PIO A;  3W5O A;  2J7Z A;  1IBK Q;  1QB5 D;  3I56 A;  4DV7 Q;  1V9P A;  3MEF A;  4R4C A;  5FLX c;  3TRZ A;  4K5W A;  2Z6K A;  5COY A;  5I2X A;  5M5W B;  2E2H H;  2JYO A;  3SVM A;  1VF7 A;  3FPU B;  1PHJ A;  3KLW A;  4KD4 A;  3JAM L;  5C44 H;  3NPP A;  2VW9 A;  1N34 L;  5EGT A;  5EBD A;  2Q8T A;  2OT2 A;  1TWH H;  4DR3 L;  1GM5 A;  2Z1C A;  3KF6 A;  4DK0 A;  3KOJ A;  5BN3 A;  4B08 A;  5IT9 E;  1GXD C;  2XRQ D;  1VS0 A;  3QJY A;  4JI2 Q;  2UUA L;  2NN6 I;  4XQN A;  4A3C G;  1EY4 A;  5D14 A;  1HJP A;  3S1N B;  2I46 A;  3J7Z C;  1I6H H;  1GUO A;  4CGY B;  4TQU S;  5IP9 G;  1PYS B;  1EWH A;  1PDQ A;  1VQM A;  2WIN B;  3NQT A;  3I55 A;  5HY6 A;  4OL7 A;  3KJP A;  4A76 A;  1A62 A;  2FHT A;  3T1Y Q;  3FKI H;  4OWT B;  5GAD C;  4DV6 Q;  5DEH A;  4N8F A;  3G6J B;  1R9T H;  4A3E H;  1YIT A;  3RZD H;  4RKL A;  4YHH Q;  4MIU A;  1SE4 A;  1ZXT A;  5IGB A;  4FF1 A;  1D1K A;  4CBV A;  3PO3 G;  1KAW A;  3ICE A;  4ZK9 B;  2E2I B;  2F0W A;  2NVY B;  4DUY Q;  1A2U A;  4AIM A;  5AJ3 L;  3D8G A;  2A68 C;  5KNC A;  3I90 A;  4PZ8 A;  3PO2 B;  4R8N A;  3ITP A;  4FF4 A;  4IZ8 A;  4IPD A;  5G3L F;  1I4R A;  1U4P A;  4IOA A;  1BR9 A;  3HOU B;  5J22 A;  5IGD A;  1IYU A;  3PUW A;  1J9O A;  2R92 G;  3D3R A;  4BBR B;  4HSP A;  1I50 B;  2ZT9 C;  5I6W A;  3PF5 A;  3J7Y W;  3HKZ B;  2PO4 A;  3RZO H;  2JSO A;  3DM3 A;  4LF7 L;  3HOZ G;  5C0X J;  1Q90 A;  2A6H C;  2K01 A;  5CV4 A;  2K52 A;  3A7A B;  1D1I A;  4DV4 Q;  2H5X A;  3U50 C;  3T13 A;  1I4Q A;  3FEW X;  4C3H G;  4A3G H;  4DAY B;  4KHZ A;  4DUZ Q;  1MD2 D;  5J39 A;  2EXD A;  5EJW A;  3Q8D A;  1XPR A;  1YNN C;  1PYB A;  2RBM A;  4OO1 H;  1S4Z A;  4P73 A;  4ZAI A;  1A0I A;  2HDM A;  3V2T A;  2Q8I B;  4DK1 A;  1TS3 A;  5LHY 1;  1UE6 A;  1E3P A;  4HSV A;  4N9T A;  4K14 A;  2EYL A;  3DWA A;  1WTW A;  3K7A B;  1EUJ A;  3HOX B;  3VA7 A;  4GLX A;  3W3A A;  1YHB A;  3R3O A;  1EY0 A;  3H09 A;  4JI5 Q;  1RF2 D;  2ATW A;  4PQX A;  1PXU A;  3E9H A;  4BWG B;  1ML0 D;  1SRO A;  1EY6 A;  4K0K Q;  2QF7 A;  3D0F A;  3G4S A;  1S5E D;  4CHT B;  1CI3 M;  2PNR C;  3OHX C;  1CM9 A;  4R4I A;  1UEA B;  1K8A C;  2RHS B;  1YNJ C;  4A3B B;  3OWE B;  3S24 A;  2V1C C;  3H3V I;  3GTP B;  2UXC Q;  2DJF C;  2NVT H;  2G9H D;  2KUM A;  3BZD B;  4H02 A;  1J6Q A;  3VA5 A;  2A69 D;  4YCV A;  3UDX A;  1HNX L;  1WTH A;  4A75 A;  4C2M B;  1E2W A;  3HZX A;  4JCV E;  2NYZ D;  4OX9 L;  2K5V A;  3RLO A;  1F9P A;  2EDG A;  1VQ7 A;  1WJJ A;  1O7L A;  1DM0 B;  3VR5 A;  1U5K A;  2QGQ A;  4LWC A;  2CKZ B;  4LU4 A;  3J7A F;  3GTM H;  1SBB B;  1SEB D;  1LAB A;  1RCV D;  2EYH A;  4X66 Q;  4DR5 Q;  1PFS A;  4AQY L;  2R7Z B;  2L1B A;  1STN A;  4BXX H;  4JI4 L;  3EA6 A;  1QNK A;  3N6R A;  1TS2 A;  2XVS A;  3J80 E;  4Y7N B;  3BDO A;  5EPK A;  3ZC7 A;  1MBY A;  2ZXP A;  1FJG L;  3CCU A;  2NTS A;  2LXK A;  1PTO H;  2VQE L;  1NJI C;  4HR7 B;  3SK5 A;  1RHP A;  4KHP Q;  2K5N A;  2AUK A;  5KIX A;  5I6Y A;  3K5O A;  1TXY A;  3SGI A;  1BCP F;  5AFW A;  1I4X A;  5EPJ A;  1K9M C;  3STB C;  4L5T A;  3H91 A;  4K5V A;  5F2D A;  2RSO A;  3AFP A;  1EY7 A;  5ISR A;  2BCO A;  1H95 A;  2OCE A;  2DY8 A;  2JK8 A;  3HEJ A;  1SYB A;  1VQ9 A;  3I4M H;  1E0B A;  1FNV A;  1M4V A;  1U9R A;  1E2Z A;  1Q3L A;  3MAQ A;  3PGZ A;  1TWF B;  2CW0 C;  4A3M G;  1Q1E A;  2VB3 X;  4ZKB B;  1PZI D;  2H1E A;  1CSP A;  4BS9 A;  3S16 H;  3HOV H;  3AQQ A;  1Q81 C;  3LWU A;  1IYV A;  3CRL C;  3HKZ G;  4K8J A;  1SNC A;  1L1O B;  2M2L A;  2EYP A;  1YI2 A;  1HFN A;  5BN4 A;  3I2Z A;  4H7B A;  5GQO A;  1LM0 A;  5C3X A;  1MIU A;  3G7L A;  4CKC A;  1K0R A;  1TT2 A;  1CA5 A;  4DK3 C;  3RN5 A;  2L9H A;  1F2Y A;  4CDE C;  2F0Q A;  2WKD A;  4A3I B;  1XMQ Q;  1PH2 A;  2D0O A;  2HQE A;  4EQ5 A;  1N32 L;  1EYA A;  4DV1 L;  4IFD H;  3SHG A;  1MGS A;  1T5E A;  3UE0 A;  3J80 i;  3TBI B;  4A3L G;  1KRT A;  4DR2 Q;  2RKS A;  3O13 A;  4IJH A;  1L1O A;  3KDF A;  4DNT B;  1MKH A;  4LFA Q;  2PNH A;  2Y0S E;  3HOX G;  1B9M A;  3QB3 A;  3CCV A;  5M5X H;  1E22 A;  4OIJ A;  1DOK A;  4GOP A;  2B63 B;  2QKI C;  4K2L A;  2K04 A;  4JV5 Q;  5TSS A;  3OTO Q;  2R6G A;  1FR3 A;  3TP8 A;  2F0H A;  2FMC A;  2NN6 H;  2EE1 A;  2A74 C;  2F0F A;  4UHV A;  3PIO 3;  1C8C A;  4N8X 1;  3HOY B;  3S6A A;  4JI7 Q;  2KHI A;  3CP0 A;  1I5F A;  3CHB D;  4RHS A;  2CH4 A;  1Y1W H;  4POG A;  1TU2 B;  3M4Y A;  1QIL A;  2N55 A;  4XT1 B;  1KQS A;  5CV7 A;  4CDC C;  3NTK A;  3AMU A;  3CQZ B;  3OIP A;  4RGO S;  5C4Z A;  5IOC A;  1EIG A;  2EYM A;  1SYG A;  1K83 H;  3X3N A;  4HCS A;  2NTT A;  4MHE A;  3S9W A;  1PRT D;  5T1G A;  3HS0 C;  3CPF A;  3Q22 A;  4A93 G;  1K3R A;  1H9R A;  5LL6 X;  4G7H C;  2DJG C;  3GTJ H;  2N78 A;  2JA6 H;  2PMZ E;  1JE4 A;  4L63 B;  3NE5 B;  4YY3 L;  4Q5V A;  2UUC L;  3I73 A;  4QJF A;  1RD9 D;  1I94 Q;  1X3P A;  1DJR D;  4G57 A;  3RLN A;  1V43 A;  5JPM C;  4YIJ A;  1GUS A;  1QVF A;  2ENB A;  1I4H A;  3MXP A;  1FD7 D;  2JN4 A;  3F2D A;  5M3F H;  1Y8N B;  3AU7 A;  1JT8 A;  3CCS A;  1TWA H;  4HJ9 A;  2E76 C;  1B2T A;  4LF9 L;  3HKS A;  2F3W A;  2NVQ B;  2F0T A;  1Y1V B;  2PQA A;  2UU9 L;  2VUM H;  1HFG A;  1GVP A;  2QEX A;  4A3F H;  1KC8 C;  2HCI A;  3K6O A;  1AZP A;  4X65 L;  2F1M A;  4X64 L;  1QOH A;  3TP7 A;  3DWP A;  2JA5 H;  3NP8 A;  5LMU Q;  3OMC A;  2JA7 B;  4HJ7 A;  3GP7 A;  2FXQ A;  4B3T L;  1VQ6 A;  1WCM G;  1EZ8 A;  4U68 A;  4DR4 L;  3RD4 A;  3F2C A;  3KF8 B;  2VQF L;  1QWY A;  3PUY A;  2D9U A;  2B2Y A;  4C3I B;  2PQE A;  4PNY A;  2Z4I A;  2UXB L;  2MHV A;  4IAL A;  3KLS A;  2QA4 A;  1O7Z A;  1STE A;  1PVO A;  1CKN B;  3L9A X;  2TSS A;  4KJO A;  2F52 A;  5KYL A;  4H0L C;  1ZKO A;  1S72 A;  4GKK L;  3EN2 A;  4PMB A;  1GHK A;  4H13 C;  5IOD A;  3ZLM A;  1RL2 A;  3G48 A;  5EQ0 A;  3MEH A;  3QWN A;  4G7Z C;  1PH1 A;  3NTI A;  1VQK A;  1FNU A;  1KAB A;  4FF3 A;  4HMI A;  4QGU A;  5EAY A;  2MO1 A;  3D31 A;  4ZQ3 A;  3CCJ A;  4QB4 A;  1L2F A;  1D5X C;  4FYD A;  2FFK B;  4DK6 C;  2WAQ G;  3NBH B;  2E5L Q;  3S14 B;  2Z9H A;  3HOW G;  5LMN L;  3S1Q B;  2B2T C;  4GS3 A;  3JAM c;  3N52 A;  2A6E C;  3HOY G;  4OO1 I;  5I9O A;  1Q46 A;  3S2H B;  2KCC A;  3A8J E;  2JE6 I;  4XYO A;  3V05 A;  1SR3 A;  4LF4 Q;  1BUV T;  4MN3 A;  2HDL A;  3H0G H;  3JC6 6;  4M1U B;  1F77 A;  4YCU A;  4PZ7 A;  1SFO B;  3GTL B;  4IPC A;  1LTS D;  3LGJ A;  2NVX H;  4AYB G;  2AQ3 B;  5IYC G;  2WAQ E;  4RCN A;  1F9S A;  5DAU A;  1XNQ Q;  4KMU C;  3OIQ A;  1EY5 A;  1PLF A;  4DV0 Q;  4NKL A;  5IGE A;  5M3M G;  1QNU A;  4C56 C;  2GVB A;  1SNQ A;  2PZU A;  1KLG D;  2F3V A;  4DV7 L;  3D4D A;  4JI0 Q;  3S1M H;  1KAA A;  3U4V A;  1OXV A;  5GAE C;  1QJO A;  2MPM A;  5D65 A;  2O5J C;  1PV4 A;  1S5B D;  3EJI A;  1B3Q A;  2A68 D;  3I72 A;  1G6P A;  3PF4 A;  5HUR A;  4A3D G;  2HHH L;  2HCC A;  3VYU A;  1EQQ A;  2FMM A;  2OQ0 A;  4B3S Q;  1V1Q A;  3AEV A;  3K5L A;  4MZ9 A;  4JI2 L;  5JAV A;  2EXZ A;  2B2W C;  2PPB C;  5FJ8 G;  1Y1V G;  1AE3 A;  3PMF A;  3RUZ A;  1K0S A;  2AMC B;  4OON A;  5FO9 B;  2DN8 A;  3GD7 A;  3PO3 B;  2I5L X;  1U4R A;  1E1O A;  1ET9 A;  2BA0 A;  1UE1 A;  4X3U A;  2K03 A;  5JJ7 A;  4DAP A;  1B44 D;  2MUY A;  4F88 A;  1LLR D;  3T1Y L;  1XTD A;  1JJG A;  3MXG A;  1NUC A;  1YNN D;  3VR3 A;  2KEE A;  5C3W A;  1HA5 A;  2RF4 A;  1D7Q A;  1DOL A;  2EY5 A;  4ODG A;  2R92 B;  3DM1 A;  4QY7 A;  4DFA A;  3LNN A;  2EYJ A;  5CYU A;  4HED A;  4WGJ A;  4FXD A;  3MXN A;  4B3M Q;  3HOZ B;  2E2I H;  2AQ1 B;  3KFU A;  4KN7 C;  5JFZ A;  1RTO A;  5CGL A;  3L0O A;  3PO2 H;  4C3H B;  4F7X A;  2PYK A;  4ZUI A;  1MSH A;  3HOU H;  5JJ6 A;  4CKE A;  3GTG B;  3NQI A;  3FVQ A;  1QE6 A;  1ROD A;  3NEN A;  4BBR H;  2DNE A;  1I50 H;  1YNJ D;  4X2C A;  1UAP A;  4G4K A;  2ZTE A;  1CKO A;  2B3G A;  4JG2 A;  1K3B C;  5EU0 A;  1K8M A;  1XPU A;  1SXT A;  2PZW A;  1STY A;  1IKM A;  4DR1 Q;  3C3L A;  4UP9 A;  1K28 A;  3ERQ A;  4DUZ L;  3KYH C;  3A7L A;  1JOK A;  1CZW A;  4IFD I;  1XMO L;  1JWM D;  3I4L A;  4YWM A;  1O7I A;  1PYW D;  3I3C A;  3HRZ C;  4A3J B;  1TII D;  5FKA C;  2K33 A;  4IUU A;  2R93 B;  1P8L A;  5A35 A;  5ELD A;  1PH7 A;  2BA1 A;  1I6V C;  2R7D A;  4YWK A;  1PMR A;  1EEI D;  4IUP A;  4MTN A;  3N3U A;  2E75 C;  3CF5 A;  4DR7 Q;  2IHF A;  3T16 A;  2P5Z X;  1HCZ A;  5KYI A;  4K0K L;  1Q12 A;  1CK1 A;  3STB D;  1SN8 A;  3NUC A;  1NH1 A;  3KUP A;  4DR6 Q;  3RN2 A;  3A55 A;  4OXP A;  2L55 A;  2VZA A;  4A3B H;  2MNA A;  1C4Q A;  1JMC A;  3G71 A;  2UXC L;  2EYO A;  3GTP H;  3BVG A;  3FMC A;  1O7Y A;  2MO0 A;  1X65 A;  5G3L D;  3ZYY X;  1X3Q A;  4JI1 Q;  4C2M H;  1JOR A;  1EWI A;  4BBS G;  2KVM A;  1QUQ B;  2JA9 A;  1BCP B;  1UUP A;  2JA8 G;  4ME3 A;  1ZEQ X;  1CHP D;  1LO5 D;  1AP0 A;  1TR5 A;  1EQT A;  4QL5 A;  4X66 L;  2BH2 A;  4ZYS A;  3M4O B;  2GA4 B;  3I4N G;  2XGT A;  4NP5 A;  2R7Z H;  3ND9 A;  2LFN A;  5IGF A;  4Y7N H;  4XI8 A;  3A8I E;  1V8Q A;  5HGQ A;  1R4P B;  1Z7T A;  2L0C A;  2F3I A;  1CHQ D;  2O5I C;  5BR8 L;  4QUC A;  1OXT A;  4A3M B;  3ONA B;  3P1H A;  2K1B A;  3DUZ A;  3S15 B;  2YTY A;  4RCO A;  3WWV A;  2A8V A;  3PCO B;  1D2B A;  2K32 A;  1HQR D;  1BBX C;  3QOL A;  2PI2 E;  4HMJ A;  3VYT A;  3ND8 A;  4GLA C;  4HIM A;  2Y0S B;  4R1J A;  3ZJY C;  1LT5 D;  2WFW A;  4X6A H;  1IXR A;  1U0L A;  2AWN A;  2N8N A;  2JQO A;  1CQF A;  4JOI C;  2Z0S A;  5D3D A;  4HN7 A;  1EY8 A;  1TWF H;  1TY0 A;  4A3K B;  3FP9 A;  2R3Z A;  3PUX A;  2Z8L A;  3TN2 A;  3TZU A;  4ID6 A;  1ESR A;  1EZ6 A;  3ZCB A;  1IBM L;  4DKA C;  1IL8 A;  1C0A A;  2CWP A;  2CVR A;  2AKW B;  5FLM G;  4NDX A;  2KEC A;  1XMQ L;  4DAY A;  4LUV A;  4A3I H;  3NBI A;  1GKH A;  4M16 A;  1K8G A;  1QZH A;  3A8K E;  1II3 A;  4X3T A;  4A3J G;  5GRO A;  2E2H B;  2R93 G;  4GZY C;  1B70 B;  4DR2 L;  1SYE A;  4RAU C;  2K5H A;  2ZJP A;  2CHB D;  4H44 C;  4LFA L;  1TY2 A;  4CJ2 C;  1S5F D;  1SE3 A;  1F9Q A;  1RKN A;  3D6C A;  1VQO A;  5K36 G;  2B63 H;  1B50 A;  2O2L D;  1JC7 A;  3MZ5 A;  4JV5 L;  2WII B;  3OTO L;  1NTG A;  5JEA G;  4WJ4 A;  1PFM A;  1RDP D;  1BCP D;  4HJ8 A;  2B2U A;  1SMY D;  1K73 C;  4LF8 Q;  3JAM E;  4NXN Q;  1WTX A;  4Y52 H;  1VQA A;  3W1B A;  3UI2 A;  5FK9 C;  3EVQ A;  1EOV A;  5IGC A;  1UE7 A;  3E6Z X;  2MGS A;  3DMU A;  2RVL A;  3DXJ C;  3HOY H;  1WTV A;  3EBE A;  3AFQ A;  3SE0 A;  3K5N A;  4PV1 C;  1VQB A;  4A93 B;  4EQP A;  4LUO A;  1Q8I A;  1WTO A;  4K5X A;  4ZKC B;  4G7O C;  1H9S B;  4PMC A;  4A3E B;  3CQZ H;  5IYB H;  2F0S A;  3I91 A;  5IP7 G;  3E0E A;  4BY1 G;  4BY7 H;  2ZM6 Q;  2TMP A;  3GTO B;  5C4X G;  4V0B A;  1ENF A;  2BE5 D;  4L8J A;  1KTK A;  1HNZ Q;  4U67 3;  4GNX B;  4X62 Q;  1CTM A;  4KY5 A;  3VDY A;  2B2V C;  5L37 A;  1QVC A;  1S5C D;  4KK7 A;  1YBY A;  4JI8 L;  1WVL A;  1PH3 A;  3OW7 A;  1X3F A;  5ELE A;  3E5S A;  3RZO B;  1G2T A;  3CCM A;  3BS1 A;  4UY8 C;  4LF7 Q;  1EIF A;  5IYD G;  3E9I A;  5ELF A;  1WCM B;  2IW3 A;  5JVH 3;  3R93 A;  5C0X H;  5IY0 A;  5EKK A;  3S1R B;  4KY7 A;  2NVQ H;  1HHV A;  3OPO A;  2Y0S G;  1HUM A;  4A3G B;  2FIN B;  4GNX A;  3QR8 A;  3RLF A;  3KJO A;  1MI2 A;  3M9B A;  4POF A;  3TEH B;  1A3U A;  4A3K G;  3H3V C;  1SYF A;  5LMU L;  3M7N A;  4J15 A;  3ERS X;  4UDU C;  1B8A A;  2JA7 H;  5EKL A;  2A6E D;  4N9P A;  4DV5 Q;  5C3E G;  2NWG A;  1VQL A;  1KLU D;  4C3I H;  4NXM Q;  2IT1 A;  1Q1B A;  3ULJ A;  1JWU D;  3CC4 A;  4JW0 A;  2DGY A;  3PIP A;  1QZG A;  3E3X A;  3J7A V;  2SOB A;  2XIW A;  2WAQ B;  1C9O A;  4JBW A;  1VQG A;  3TP5 A;  1TKW B;  2Z6K C;  5C44 G;  2F0E A;  3HOW B;  2HIV A;  4FXG C;  1C48 A;  3BZC A;  3S17 B;  4LF6 L;  2NVT B;  3J81 E;  3W1G A;  2JJQ A;  4UPA A;  3SK4 A;  1TWC B;  2K05 A;  1TQO A;  1ESF A;  3QG1 A;  4XTC S;  4ITR A;  3I4O A;  3M4P A;  4OX9 Q;  1HXY D;  1S40 A;  1UWV A;  4AYB B;  1W3S A;  2E5L L;  5IT9 c;  3TDQ A;  1OXU A;  1X3G A;  4DV3 Q;  4UP8 A;  3S14 H;  3SE5 A;  2LMC B;  2YTV A;  4RG1 A;  5FLX E;  2F0V A;  1DXM A;  4XIG S;  5M3M B;  4AQY Q;  2A5H A;  1EEF D;  2D5D A;  1A15 A;  2K5D A;  3TS0 A;  3S2H H;  4LF4 L;  2PW5 A;  3S2D B;  1BBU A;  4WFN 3;  5E1F A;  5NUC A;  4QIW E;  4DGZ A;  3FKI G;  1FJG Q;  1G6Z A;  3BZK A;  4R8I A;  1EYG A;  4U07 A;  4LJZ C;  2HUG A;  4A3E G;  2BDN A;  4R4Q A;  4CDD C;  1LV9 A;  2HIX A;  4NW2 A;  1KDB A;  4IJL A;  4L5S A;  4A3D B;  1VQH A;  1GUN A;  4CKB A;  1RJT A;  5JEA J;  2MJ8 A;  4X2D A;  1OTC A;  3K0X A;  2ALY B;  1KD1 C;  3KK7 A;  4O1N A;  2XRS D;  4A3C H;  1JIC A;  4KTA A;  4AH6 A;  1X56 A;  1SNO A;  5IE8 A;  4DF7 A;  3L7Z C;  4OEM B;  1Q82 C;  5IP9 H;  2B39 A;  2I5H A;  3S16 B;  3HOV B;  1J8I A;  3J81 i;  3I8Z A;  1VQP A;  2XNA C;  3V96 A;  1TVX A;  1HZA A;  1PRT F;  1H9J A;  1IW7 D;  2F0N A;  2UUB L;  3I70 A;  1JQY D;  4EGV A;  4A3G G;  2EY6 A;  2N49 A;  3IFD A;  3GTQ H;  3TRE A;  2K50 A;  1V1P B;  1XPO A;  3PO3 H;  4OO1 G;  2RDH A;  1N32 Q;  1F2L A;  4DV1 Q;  2B8F A;  3CPW A;  4K8I A;  1MJC A;  1ASZ A;  2SEB D;  1AEX A;  2IHE A;  1VQN A;  4JC0 A;  1NY4 A;  3C2P A;  2WV6 D;  1D5M C;  1UNS A;  2CWA A;  2HT1 A;  3R8B A;  2E74 C;  4XXE A;  5C6A A;  3EFX D;  1DYQ A;  1T9H A;  3KF8 A;  2R92 H;  2M9V A;  4L5R C;  5EKI A;  1ZYR C;  4LMQ D;  1Y8O B;  5C5L A;  3KBX A;  2EJG C;  3R2T A;  1W6K A;  1BOS A;  3URY A;  1XNR Q;  5JOB A;  1CKN A;  5A2Q L;  3HOZ H;  3H6M A;  4L5Q A;  4LFB Q;  4A4I A;  1XX8 A;  4LAA A;  1NE3 A;  1WI5 A;  2YU9 B;  2CFM A;  2A19 A;  1AZQ A;  1LTB D;  2X69 A;  4C3H H;  3R2I A;  1KDC A;  1SLJ A;  2RHQ B;  1TS4 A;  4JVZ A;  4I7Z C;  5E7N A;  4KI0 A;  1U4M A;  2JXM B;  1Y1W B;  4DV2 L;  1YHQ A;  3Q23 A;  4RGM A;  1PH5 A;  4B3R Q;  2VS1 A;  2XWJ B;  3KBG A;  3IFT A;  1EY9 A;  2JEA I;  1SYD A;  2PCF B;  1ICF B;  1QG7 A;  5HGT A;  2L11 A;  2C5C A;  1N9W A;  3GTK H;  5EPL A;  3NBH A;  2QCP X;  2KOL A;  3F1Z A;  1JR0 D;  2K6A A;  1PZK D;  1SAP A;  3MA2 B;  1SNP A;  4JI3 Q;  4F87 A;  1N36 Q;  4BXX G;  1IBK L;  3ER0 A;  1PH4 A;  4KY6 A;  3P7J A;  1FGB D;  3CD6 A;  1X32 A;  1NAP A;  1OXS C;  4WJ3 M;  5IT9 L;  4JBM A;  1Q8K A;  1SJE D;  1PZJ D;  3J80 c;  5M5W H;  1PTO F;  4QF4 A;  2UUC Q;  3SEB A;  3DEO A;  1EU4 A;  3MFY A;  4U04 A;  4Z9C B;  1ILP A;  1T5X D;  2QEJ C;  1L0W A;  1VQE A;  2PW7 A;  1TWA B;  1HZB A;  1IL2 A;  4DR7 L;  1I3Q B;  1E7Z A;  2R7F A;  2RA4 A;  3TP6 A;  4LF9 Q;  2ICI A;  1JB7 A;  4BBS B;  4HID A;  3BVM A;  3OYY A;  3K80 C;  4A3F B;  4KD3 A;  3VR2 A;  2JA8 B;  1VQF A;  2WP8 J;  4LFC Q;  3I4M G;  4DR6 L;  3S1N H;  4X65 Q;  4DA2 A;  2KCT A;  4RGN A;  3K58 A;  2A6H D;  3HG9 A;  3G6E A;  2UXD Q;  1OXX K;  2JA5 B;  4GKJ Q;  2QDL A;  3HOV G;  4JPB W;  3CME A;  4C3J B;  1DD2 A;  3DLL A;  3I4N B;  2F0L A;  1WOC A;  2NUD A;  3DWQ A;  1NMG A;  4TSS A;  4F8M A;  1JB3 A;  3OOC A;  2K5W A;  4N67 A;  1PRT C;  1X9N A;  4DV6 L;  2VQF Q;  4GN5 A;  1A8V A;  2NB0 A;  4YHH L;  2LXJ A;  5ELB A;  2RDF A;  1ICW A;  1NNX A;  1FGU A;  1YVC A;  2BH8 A;  4IFD G;  3OWF A;  4DUY L;  2NVY H;  1WTP A;  1X55 A;  1IBL Q;  3EQL C;  1L1O C;  3F8T A;  3BVZ A;  1BF4 A;  2NBF A;  1LAC A;  4HTH A;  5C5M A;  4A3M H;  4GOP C;  2LY7 A;  3S15 H;  1IZ6 A;  3KLS X;  1FNW A;  3A5U A;  1CKM A;  2ZXR A;  1KL9 A;  5C0X I;  1NMF A;  1EIY B;  3K0Y A;  2NUC A;  2NN6 G;  2MFI A;  4LF5 Q;  1JCK B;  2KHJ A;  4DV4 L;  4ZRZ A;  3K8A A;  4WJW A;  5T1I A;  3I7F A;  3HFZ B;  4MNO A;  4DNR B;  3PIP 3;  4S3S A;  4JI6 Q;  2IPK D;  5DM7 3;  3C1F A;  3T1H Q;  4Q0F A;  1Y1W G;  1BNZ A;  1B3A A;  2DUD A;  3CCR A;  4A3L H;  2WB1 G;  2EOT A;  2MQH A;  3M3Y B;  5CC4 A;  4QQB X;  1O78 A;  4OWX B;  2L15 A;  3GQB A;  3K7A H;  3MWY W;  3PSI A;  2Z4H A;  3HOX H;  1J5E Q;  5CMT A;  4QMG A;  1HRJ A;  2L5T A;  2F4V Q;  3D4W A;  3IKJ A;  1XYI A;  3KF6 B;  4HAE A;  4JI5 L;  1LTG D;  5IWA Q;  1YJ9 A;  3S1M B;  4I7A A;  4KN4 C;  3BJU A;  3MC0 B;  2JA6 G;  3J81 j;  1HNW Q;  2WB1 E;  4UAI A;  1A6X A;  1VMP A;  2NZO A;  1WYD A;  4OGQ C;  1P16 A;  1PTO C;  3OSO A;  3QOJ A;  5DM6 3;  1NR2 A;  1M90 C;  3GO5 A;  2SNM A;  2X6L A;  4B9X A;  5M3F G;  2K5Q A;  2HHH Q;  4K6L A;  3SDZ A;  2X6G A;  1QCB D;  3D6W A;  1LTT D;  2ID0 A;  2HQL A;  3T53 B;  4KKS A;  3J80 L;  2CW0 D;  3IL8 A;  4GN4 B;  4E6I A;  4LF8 L;  2EYF A;  4NXN L;  4R9W A;  1WTQ A;  2VUM G;  4A3F G;  1DON A;  5ELO A;  1TWG B;  2LSS A;  1Y69 U;  3DEP A;  3UDG A;  3K5M A;  1B1Z A;  4BY1 B;  1XXG A;  1NBW A;  3CCQ A;  4DR5 L;  5C4X B;  2JA5 G;  3A74 A;  1KXL A;  4C3J G;  2QIL A;  4A93 H;  3RMH A;  3Q0A A;  1STA A;  5C4J B;  4JYA Q;  3LET A;  5CV8 A;  3K57 A;  3P75 A;  1D8L A;  4KHP L;  1QUQ A;  1MHW C;  1WFQ A;  4KJN A;  1HQM C;  3A56 A;  2IWH A;  4R4O A;  1ILQ A;  2B2Y C;  2F0U A;  1GD7 A;  1G2S A;  1VMC A;  1YJN A;  5JVG 3;  4DPG A;  1YIJ A;  1Y8P B;  4J1M A;  1PH8 A;  5DLQ E;  1CT1 D;  2ZM6 L;  4DN4 M;  1HR0 Q;  1W6J A;  1HR0 W;  3ULP A;  1GUW A;  1EU3 A;  3UE1 A;  4PZ6 A;  5KND A;  3GTO H;  1EYD A;  2KA7 A;  5CBE E;  5FO8 B;  3NSW A;  1O80 A;  3IRB A;  4RH6 A;  2AWO A;  1HNZ L;  1DGS A;  4X62 L;  4ZCK A;  4I65 A;  1YZ6 A;  4DNI A;  1N33 Q;  3AB9 A;  1U4L A;  2F0I A;  2DY7 A;  4RFB A;  1EQV A;  2CCZ A;  1F9R A;  4RKB A;  4TRD A;  1XTC D;  5M5Y B;  4IPG A;  1EL0 A;  3F2U A;  5FOB B;  1TS5 A; 
#chains in the Genus database with same CATH homology
 3ERS X;  4U0S A;  2IY5 B;  4P74 A;  2K4K A;  3TQY A;  3U4Z A;  1B8A A;  1PH6 A;  2JA7 H;  5IYD H;  3FHW A;  3EN2 A;  4DV5 Q;  1WCM H;  2JEB I;  3S1R H;  1YJW A;  3ZLM A;  1RL2 A;  3G48 A;  5C3E G;  1VQL A;  2Q2U A;  5LMN Q;  5LMN W;  3UDI A;  2OWO A;  1PH1 A;  2Q2H A;  5GAH C;  1VQK A;  1N33 L;  4C3I H;  1X6O A;  4NXM Q;  2IT1 A;  1Q1B A;  3ULJ A;  3CC4 A;  4QGU A;  4IFD J;  4PG3 A;  4DV2 Q;  1XMO Q;  2G03 A;  2DGY A;  3H0G G;  2MO1 A;  5EAY A;  5M5Y H;  4A3K H;  1XJV A;  2OTJ A;  3J81 c;  3D31 A;  3PIP A;  1QZG A;  4DAM A;  3CCJ A;  1L2F A;  4DV5 L;  1AH9 A;  3CMA A;  1C9O A;  4DK6 C;  2WAQ G;  3A5Z B;  1VQG A;  3NBH B;  4JBW A;  2E5L Q;  2Z6K C;  5C44 G;  2HIV A;  4LNQ A;  5C3E H;  2GVA A;  3BZC A;  1N34 Q;  3HOW G;  5LMN L;  4LF6 L;  4GS3 A;  3JAM c;  2E2J H;  3HOY G;  4DR3 Q;  4OO1 I;  1Q46 A;  3PIO A;  4NXM L;  3W5O A;  3W1G A;  2JJQ A;  4UPA A;  2JE6 I;  1SR3 A;  1IBK Q;  3I56 A;  4LF4 Q;  3M4Q A;  4DV7 Q;  1V9P A;  3MEF A;  3H0G H;  4ITR A;  3JC6 6;  4XTC S;  5H1S E;  2UUA Q;  4R4C A;  3I4O A;  3M4P A;  5FLX c;  4OX9 Q;  1HZ9 A;  4APV A;  1VCI A;  4PZ7 A;  4YCU A;  3TRZ A;  4IPC A;  1S40 A;  2Z6K A;  1UWV A;  3LGJ A;  2NVX H;  2YYZ A;  2E2H H;  1W3S A;  4AYB G;  1M1K C;  5IYC G;  1PHJ A;  5IT9 c;  2E5L L;  3KLW A;  2WAQ E;  1OXU A;  5C44 H;  2VW9 A;  1X3G A;  1N34 L;  4DV3 Q;  4UP8 A;  1XNQ Q;  3HOW H;  3S14 H;  5CKL A;  3S17 H;  2K14 A;  3K81 C;  3SE5 A;  2YTV A;  4RG1 A;  4DV0 Q;  4XIG S;  1MJE A;  1TWH H;  4DR3 L;  4AQY Q;  4JI7 L;  5M3M G;  1GM5 A;  3TS0 A;  3S2H H;  4LF4 L;  2GVB A;  3KF6 A;  1BBU A;  2F6S A;  1TWC H;  3KOJ A;  4DV7 L;  4JI0 Q;  4QIW E;  3S1M H;  3FKI G;  4JI2 Q;  1VS0 A;  3CC7 A;  2UUA L;  1FJG Q;  2NN6 I;  3BZK A;  4U0U A;  1EYG A;  4U07 A;  4HJA A;  4A3C G;  3U4V A;  4IOC A;  1OXV A;  1HJP A;  1B7Y B;  5GAE C;  3J7Z C;  5IYC H;  1I6H H;  4A3E G;  1VQJ A;  4HIK A;  1LTL A;  4R4Q A;  4TQU S;  1PV4 A;  4DV3 L;  2HIX A;  5IP9 G;  1PYS B;  1G6P A;  3PF4 A;  1CUK A;  1VQM A;  3CC2 A;  4IJL A;  4L5S A;  1VQH A;  5JJI A;  4A3D G;  3I55 A;  5M3M H;  2HHH L;  5HY6 A;  1EQQ A;  2OQ0 A;  4B3S Q;  5JEA J;  3KJP A;  1V1Q A;  5AJ3 Q;  3AEV A;  4A76 A;  3S2D H;  1A62 A;  4X2D A;  1FL0 A;  3T1Y Q;  1OTC A;  3FKI H;  4MZ9 A;  3K0X A;  4OWT B;  5GAD C;  4JI2 L;  2ALY B;  1KD1 C;  2KEN A;  4DV6 Q;  4A3C H;  3CXC A;  4R4T A;  5FJ8 G;  1Y1V G;  4AH6 A;  1AE3 A;  2CQO A;  2E8G A;  1R9T H;  4A3E H;  1SRU A;  1X56 A;  1YIT A;  3RZD H;  5BR8 Q;  5IE8 A;  2AHO B;  4YHH Q;  3L7Z C;  2AMC B;  1I94 L;  4OON A;  1Q82 C;  5IP9 H;  3GD7 A;  2I5H A;  3PO3 G;  3J81 i;  1KAW A;  2I5L X;  1E1O A;  1VQP A;  2BA0 A;  1UE1 A;  4A3D H;  2ES2 A;  3ICE A;  4DUY Q;  5JJ7 A;  4AIM A;  5AJ3 L;  1HZA A;  3T1Y L;  1XTD A;  3CCE A;  4PZ8 A;  1JJG A;  1RIP A;  1C7Y A;  5JFF A;  3JAM i;  2RF4 A;  2UUB L;  3PO2 G;  4IPD A;  1D7Q A;  5FJ8 H;  1Y1V H;  4IOA A;  4A3G G;  2N49 A;  2R92 G;  3GTQ H;  3PUW A;  3HOU G;  4QY7 A;  3TRE A;  2K50 A;  4OWW B;  2ASB A;  1XPO A;  4BBR G;  3PO3 H;  4OO1 G;  3CAM A;  1N32 Q;  3PF5 A;  4WGJ A;  1VQ5 A;  4ALP A;  2NZH A;  4B3M Q;  4DV1 Q;  4PMW A;  3RZO H;  2E2I H;  3CPW A;  3DM3 A;  4LF7 L;  3HOZ G;  1MJC A;  5C0X J;  1ASZ A;  3KDF B;  3KFU A;  2IHE A;  1VQN A;  1UE5 A;  1NY4 A;  4JC0 A;  1W2B A;  4LW1 A;  2K52 A;  5JFZ A;  2CWA A;  5CGL A;  2HT1 A;  3L0O A;  4DV4 Q;  2H5X A;  3U50 C;  3PO2 H;  1IBM Q;  4GOP B;  4A3G H;  4DAY B;  1T9H A;  4KHZ A;  4DUZ Q;  2R92 H;  2EXD A;  1XPR A;  3Q8D A;  4L5R C;  3HOU H;  5JJ6 A;  1Q7Y C;  3PV0 A;  1PYB A;  3NEN A;  4BBR H;  1Z9F A;  1I50 H;  2B29 A;  4FDB A;  4P73 A;  3NEM A;  1A0I A;  2Q2T A;  4X2C A;  4EX5 A;  2ZTE A;  1UE6 A;  1E3P A;  1CKO A;  1CKN A;  2B3G A;  3HKZ E;  4JG2 A;  1XNR Q;  3HOZ H;  4L5Q A;  4LFB Q;  4A4I A;  5EU0 A;  1XPU A;  1NE3 A;  1WI5 A;  2CFM A;  1EUJ A;  2A19 A;  1BVS A;  4DR1 Q;  1X3E A;  1KRS A;  4UP9 A;  4C3H H;  4GLX A;  1SLJ A;  1YHB A;  2RHQ B;  4DUZ L;  4YCW A;  3KYH C;  4JI5 Q;  1JE5 A;  5E7N A;  2ATW A;  4KI0 A;  3TS2 A;  5ELN A;  4IFD I;  1XMO L;  4DV2 L;  4YWM A;  1O7I A;  3E9H A;  1YHQ A;  1HNX Q;  1PH5 A;  4B3R Q;  1SRO A;  2VS1 A;  4K0K Q;  1XNR L;  3D0F A;  3G4S A;  1P8L A;  4P75 A;  4NB3 A;  4YWL A;  2JEA I;  4LFB L;  3M85 A;  4R4I A;  1PH7 A;  1S72 A;  1K8A C;  4NPS A;  1Y14 B;  2RHS B;  2BA1 A;  3J7A 5;  2R7D A;  1N9W A;  3GTK H;  1HZC A;  2YU9 H;  1Q86 C;  4YWK A;  4A3B G;  3S24 A;  2ZJQ A;  2V1C C;  3F1Z A;  3H3V I;  4MTN A;  3S1Q H;  2UXC Q;  3N3U A;  3EIV A;  1EFW A;  2N3S A;  4H02 A;  4JI3 Q;  1J6Q A;  2NVT H;  3CF5 A;  1N36 Q;  4BXX G;  1IBK L;  2IHF A;  3ER0 A;  1PH4 A;  4YCV A;  1G51 A;  3UDX A;  1HNX L;  4JI4 Q;  3F2B A;  4B3R L;  4A75 A;  3CD6 A;  4JCV E;  4K0K L;  1OXS C;  1Q12 A;  2K5V A;  4OX9 L;  4WJ3 M;  3RLO A;  1VQ7 A;  1VQI A;  1WJJ A;  2VQE Q;  4JBM A;  1U5K A;  3CUC A;  1Q8K A;  3STB D;  1SN8 A;  1SFO H;  1PA6 A;  3GTL H;  3J80 c;  5M5W H;  2QGQ A;  4LWC A;  2UUC Q;  4DR6 Q;  2CKZ B;  4LU4 A;  3RN2 A;  4OXP A;  2I5M X;  2VZA A;  3GTM H;  4A3B H;  2MNA A;  1XNQ L;  1JMC A;  1PH9 A;  4U04 A;  3G71 A;  2UXC L;  4X66 Q;  4DV0 L;  4DR5 Q;  3GTP H;  1PFS A;  4AQY L;  2EIF A;  1L0W A;  4JI3 L;  1VQE A;  1HZB A;  4KLK A;  1IL2 A;  1N36 L;  4BXX H;  4DR7 L;  2MO0 A;  4JI4 L;  2R7Z G;  1X65 A;  1E7Z A;  2R7F A;  4LF9 Q;  4JI0 L;  1YEZ A;  2PQA B;  1JB7 A;  3ZC7 A;  4JI1 Q;  4C2M H;  1FJG L;  4HID A;  3CCU A;  1EWI A;  4BBS G;  2LXK A;  2OTL A;  1QUQ B;  2VQE L;  3OYY A;  3K80 C;  2JA9 A;  1NJI C;  1VQF A;  2WP8 J;  4LFC Q;  2K5N A;  3I4M G;  2JA8 G;  4ME3 A;  3S1N H;  4DR6 L;  4KHP Q;  4X65 Q;  1TXY A;  3SGI A;  3UDF A;  3B6Y A;  4JI8 Q;  2VY3 A;  2KCT A;  3G6E A;  2UXD Q;  4GKK L;  1OXX K;  4QL5 A;  2K75 A;  1K9M C;  3A0J A;  3STB C;  4L5T A;  4X66 L;  2BH2 A;  3HOV G;  4GKJ Q;  3CME A;  1KHI A;  3DLL A;  3CCL A;  4B3S L;  1LYL A;  2XGT A;  3AFP A;  1WOC A;  2R7Z H;  3I4N G;  2EQS A;  3AYH B;  1NMG A;  3PUV A;  1I3Q H;  4PY3 A;  3OW2 A;  4Y7N H;  1H95 A;  4XI8 A;  4N67 A;  1VQ4 A;  2OCE A;  4BBS H;  1X9N A;  2KBN A;  3H15 A;  4DV6 L;  2JK8 A;  5HGQ A;  2VQF Q;  1BBW A;  4GN5 A;  4LFC L;  1A8V A;  2F3I A;  1VQ9 A;  2JA8 H;  1S3O A;  3I4M H;  4JBJ A;  5BR8 L;  2YV5 A;  4YHH L;  1OXT A;  2ZTD A;  2LXJ A;  3PGZ A;  3ULL A;  4A3M G;  1Q1E A;  2UXD L;  2VNU D;  1KIX A;  1CSP A;  1AE2 A;  2XTI A;  2YTY A;  3WWV A;  2A8V A;  3PCO B;  1FGU A;  1YVC A;  3AQQ A;  1Q81 C;  3HOV H;  3S16 H;  2BH8 A;  4GKJ L;  3K7U C;  4IFD G;  2PI2 E;  3HKZ G;  4C3J H;  4DUY L;  3I4N H;  2NVY H;  1L1O B;  1YI2 A;  1QVG A;  1E1T A;  1X55 A;  4HIM A;  4GLA C;  4TVA B;  4R1J A;  3ZJY C;  3I2Z A;  1A63 A;  5GQO A;  1LM0 A;  2WFW A;  4X6A H;  1MIU A;  1IBL Q;  4DR7 Q;  1IXR A;  1L1O C;  1U0L A;  2AWN A;  1K0R A;  2N8N A;  1JJC B;  2JQO A;  3F8T A;  4JOI C;  4DK3 C;  5JJK A;  3RN5 A;  2Z0S A;  4A3M H;  1XMQ Q;  2D0O A;  1PH2 A;  1TWF H;  4EQ5 A;  4A3I G;  4GOP C;  3S15 H;  1IZ6 A;  1N32 L;  3A5U A;  2RCN A;  3FP9 A;  4B3M L;  4DV1 L;  3SHG A;  1CKM A;  1KL9 A;  3PUX A;  3UE0 A;  3J80 i;  2I0Q A;  1IYJ B;  4A3L G;  5C0X I;  1NMF A;  1KRT A;  1EIY B;  4LF5 Q;  2NN6 G;  2MFI A;  4DR2 Q;  2KHJ A;  4IJH A;  1L1O A;  3KDF A;  4DV4 L;  4HIO A;  3PUZ A;  4RMF A;  4JOI A;  1MKH A;  4LFA Q;  2PNH A;  2Y0S E;  3K8A A;  3ZCB A;  3HOX G;  4DKA C;  1IBL L;  1IBM L;  4LF6 Q;  1C0A A;  3CCV A;  3I7F A;  5M5X H;  1E22 A;  2CWP A;  2AKW B;  5FLM G;  4GOP A;  3HFZ B;  3H3V H;  2YTX A;  4MNO A;  3BU2 A;  1XMQ L;  4JI6 Q;  2B63 G;  3GTG H;  4LUV A;  4A3I H;  3T1H Q;  1EQR A;  1GKH A;  4M16 A;  4JV5 Q;  1Y1W G;  1K8G A;  3OTO Q;  2R6G A;  4GN3 B;  4X2E A;  1QZH A;  2DUD A;  3CCR A;  4A3L H;  4A3J G;  2WB1 G;  1HH2 P;  5GRO A;  2R93 G;  4LF5 L;  1VQD A;  1B70 B;  4DR2 L;  2MQH A;  4QQB X;  4IPH A;  2K5H A;  2L15 A;  4OWX B;  2ZJP A;  4LFA L;  3K7A H;  3PSI A;  2ZTC A;  3HOX H;  1J5E Q;  5CMT A;  4DR1 L;  3RNU A;  2F4V Q;  3S6A A;  2GN5 A;  3KF6 B;  4O2D A;  5FLM H;  1VQO A;  4JI5 L;  4JI7 Q;  4JI6 L;  5K36 G;  2KHI A;  3CP0 A;  1I5F A;  2B63 H;  1LUZ A;  3T1H L;  5IWA Q;  1YJ9 A;  4JBK A;  4JV5 L;  1Y1W H;  4POG A;  1BKB A;  3OTO L;  1NTG A;  5JEA G;  3BJU A;  4WJ4 A;  1KQS A;  2JA6 G;  1YHA A;  3J81 j;  4A3J H;  4HJ8 A;  4LF8 Q;  1K73 C;  4LUZ A;  1N8R C;  2R93 H;  4NXN Q;  1HNW Q;  2WB1 E;  4Y52 H;  1VQA A;  2KCM A;  3W1B A;  4YY3 Q;  1FVI A;  3M3Y H;  2NZO A;  1EOV A;  1WYD A;  5IYB G;  1P16 A;  1UE7 A;  1Z47 A;  4P71 A;  1J5E L;  1K83 H;  1M90 C;  2F4V L;  1SMX A;  4P72 A;  4GLV B;  3GO5 A;  5M3F G;  3HOY H;  2VL6 A;  3EBE A;  3AFQ A;  4BY7 G;  2HHH Q;  3CPF A;  1VQB A;  5IWA L;  1ASY A;  4LUO A;  1E24 A;  1K3R A;  4A93 G;  2IX1 A;  2ID0 A;  1CSQ A;  2ZJR A;  2HQL A;  4O0A A;  3GTJ H;  2N78 A;  2JA6 H;  4GN4 B;  4LF8 L;  2PMZ E;  4NXN L;  1HNW L;  2UU9 Q;  2VUM G;  5GAG C;  4YY3 L;  4A3F G;  2UUC L;  5ELO A;  1UEB A;  4QJF A;  3CQZ H;  4AYB E;  2LSS A;  5IYB H;  3RR5 A;  4X64 Q;  2A1A A;  3UDG A;  1I94 Q;  3RLN A;  5IP7 G;  1V43 A;  4HJ5 A;  1QVF A;  1NBW A;  3E0E A;  4BY1 G;  1X54 A;  3F2D A;  3CCQ A;  2Q2I A;  2ZM6 Q;  5M3F H;  4DR5 L;  4BY7 H;  2JA5 G;  3A74 A;  3GDE A;  5C4X G;  1KXL A;  5J3B A;  1JT8 A;  3CCS A;  1TWA H;  4HJ9 A;  4A93 H;  4LF9 L;  3HKS A;  4B3T Q;  4JYA Q;  3LET A;  4JI1 L;  1SE8 A;  5C0X G;  1HNZ Q;  4DR4 Q;  5JJL A;  4UP7 A;  4X62 Q;  4GNX B;  2UUB Q;  1GO3 E;  2PQA A;  1JJ2 A;  2UU9 L;  2VUM H;  4A3F H;  1GVP A;  1D8L A;  2QEX A;  4KHP L;  1QUQ A;  1KC8 C;  1WFQ A;  4X65 L;  3VDY A;  2IX0 A;  4R4O A;  1TWG H;  4X64 L;  4GNX C;  2UXB Q;  1QVC A;  4JI8 L;  1YBY A;  1VQC A;  5IP7 H;  1GD7 A;  1YJN A;  3MXN B;  1PH3 A;  4DPG A;  1YIJ A;  1PH8 A;  1X3F A;  5DLQ E;  4BY1 H;  2ZM6 L;  1HR0 Q;  1HR0 W;  3ULP A;  2JA5 H;  5C4X H;  3UE1 A;  3CCM A;  4PZ6 A;  3GTO H;  5LMU Q;  4UY8 C;  3M4O H;  2PI2 A;  4LF7 Q;  1EIF A;  4GKK Q;  2D62 A;  5IYD G;  3E9I A;  4HJ7 A;  3IRB A;  2JA7 G;  2FXQ A;  4B3T L;  1VQ6 A;  2AWO A;  4JYA L;  1WCM G;  5IY0 A;  1DGS A;  1HNZ L;  5C4J H;  3F2C A;  3CW2 C;  3NEL A;  4X62 L;  2NVQ H;  4DR4 L;  2Y0S G;  4IO9 A;  1YZ6 A;  2OQK A;  3KF8 B;  2VQF L;  3PUY A;  3SN9 A;  4GNX A;  4U0Z A;  3RLF A;  2D0P A;  4DNI A;  2C35 B;  1N33 Q;  3KJO A;  2UXB L;  3M9B A;  4BA2 I;  2QA4 A;  4POF A;  1PVO A;  3TEH B;  4BA1 I;  1CKN B;  2CCZ A;  1HR0 L;  3L2P A;  1G29 1;  3U58 A;  4A3K G;  4IPG A;  1YNX A;  1VQ8 A;  5LMU L;  3M7N A;  2F52 A;  4J15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...