4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
molecule tags Cell adhesion
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
2JA8H 4BA2I 1EIFA 5JJIA 3J81j 4YHHL 1BVSA 4DV7L 3HOZH 2E2IH 1Q81C 4B3SL 4JI7L 4DAYB 3CC4A 2JA6H 3PO3G 4R4OA 3CCRA 1OXUA 1YJNA 3K8AA 1G51A 5JJKA 4IFDG 2NVYH 1QZGA 2F52A 1D7QA 4LFCL 4NXMQ 1VQDA 2UU9Q 4A3EH 4B3TL 1VQFA 4HJAA 2VY3A 2PQAB 1WOCA 3HOVG 1EOVA 2RHQB 1G291 3KDFB 4IFDJ 3NENA 3CCLA 3CCSA 4A75A 4M16A 1I94Q 1IBML 1VQLA 4LFBL 2UUAQ 1X3EA 5LMNW 4OX9Q 2AHOB 1IBLL 2YTVA 2AMCB 5EU0A 2RHSB 4A3LG 1X54A 1XPUA 2Q2TA 2L15A 2WP8J 3FP9A 2JA7G 3GTOH 2KHJA 2Y0SE 1Y1VH 4DV0L 3A5UA 3S17H 1UE5A 2N49A 4GN3B 2MO1A 4PY3A 4DR1Q 3PO2H 4GKJQ 4P74A 1VQMA 2ASBA 4OO1I 3HOWG 5GROA 3TQYA 3PUZA 5FJ8H 4DV4L 5CMTA 3D0FA 4X66Q 1MIUA 2MNAA 2Q2IA 4LNQA 4LF7L 5GADC 4QY7A 4A3JH 1CKOA 4IPCA 3GDEA 2NN6I 2KCTA 2CKZB 3KF8B 4DR6Q 4UP7A 1TXYA 3F2CA 4JBJA 1N34L 2OQ0A 3A5ZB 1HJPA 2IX1A 2E8GA 5IP7H 5M5YH 4GNXB 1CKNA 1Z9FA 1K0RA 1Y1WG 1IBKQ 4A3KH 3STBC 2JEBI 4LFAL 2BH8A 3E0EA 4X62Q 4DUZQ 3U58A 1JJ2A 1PA6A 3GO5A 5M3FG 2QEXA 1XMQQ 3E9IA 3IRBA 3PUYA 4YCVA 3CCMA 1L1OC 4A3EG 1N32L 1G6PA 3HKZE 1B70B 1RIPA 2WB1E 4JC0A 1SLJA 1BBUA 1VQOA 1Y1WH 4A76A 2LXJA 3PUVA 4WJ3M 3K80C 1KHIA 1Q1BA 1NMFA 3MEFA 3NBHB 1YHBA 4GLAC 3M4QA 1FGUA 2EQSA 4U07A 1KRSA 3U4ZA 4A3CH 4DKAC 3L7ZC 4AIMA 2ALYB 5FLMH 2JA8G 2PNHA 3CXCA 2ZJRA 4DV1Q 2KENA 4JYAL 4OONA 1IBMQ 1B8AA 1J6QA 1WJJA 2CWPA 4JI2Q 3U4VA 3CPFA 4BBRG 3PIPA 3PV0A 4YWKA 4OWXB 3S1RH 4A3GH 4BBSG 4PZ8A 3F2BA 2UU9L 4JI4Q 1SMXA 3CQZH 4A3BG 3K7UC 2Z6KA 4A3GG 3I4MH 1HNZL 4LF4Q 1P8LA 1L2FA 1X65A 4AYBG 4JYAQ 2VZAA 1A63A 4U04A 4AH6A 4JI8L 1EQQA 4P72A 1PHJA 2YTXA 2VUMH 1NJIC 3I4MG 1N36Q 5BR8L 1YNXA 4PG3A 4JI1Q 3J81i 3CF5A 4GKKL 1E24A 1BBWA 5JFZA 2K5NA 1VCIA 1V9PA 2AKWB 1VQ8A 1N32Q 5IYDG 3N3UA 1RL2A 1QUQB 5FJ8G 1FJGL 4YY3Q 3OTOQ 2ID0A 4DR7Q 1FVIA 1L0WA 4BY7G 2ZM6Q 5IE8A 1OXTA 1GM5A 2R6GA 1SE8A 4A3DG 1B7YB 4BXXH 3CCJA 3SN9A 3JAMi 2CCZA 4JCVE 1PH3A 3CCQA 4DV6Q 3H3VI 4DR4L 3JC66 1WCMG 5H1SE 4IJHA 1NTGA 3EN2A 3TREA 3W1GA 1Q46A 4DR2Q 3HFZB 1SFOH 4LF5L 1XNQL 2K5VA 4A3DH 3OW2A 4QQBX 2B3GA 3WWVA 1D8LA 1YBYA 1X3GA 4WGJA 4RG1A 3OTOL 2NVQH 4JI5Q 2RCNA 1SN8A 2JJQA 4GKJL 4GNXC 2YTYA 1HR0L 2B63H 3S1QH 3PO3H 4B3ML 1PH5A 2K5HA 4DV2Q 1TWFH 3UE1A 5C44G 2JA7H 1W3SA 1JE5A 4APVA 2UUBQ 4IPHA 4GOPC 2ZTEA 4H02A 2IT1A 4GOPB 1I94L 2UXBQ 3E9HA 1X9NA 3T1HL 4LF9Q 2QA4A 4HJ9A 4HJ7A 3HOUG 2YYZA 2I5HA 2QGQA 4NXML 2H5XA 4UPAA 3CMEA 2F3IA 3AYHB 1Y14B 3HOYH 3H15A 2N3SA 3ICEA 1EUJA 2YU9H 2UUBL 2ZJQA 3CCEA 5C3EG 4JI7Q 2NN6G 3LETA 2JA6G 4K0KL 2PI2E 5C0XG 3UDGA 3FHWA 1VQEA 4YWMA 1FL0A 4GOPA 4X65L 3CCUA 2JEAI 1KXLA 1K8AC 1HR0Q 2VQEL 3CP0A 4JOIC 2BA0A 4UP8A 2RF4A 4JI3Q 3RZOH 2VNUD 1WYDA 4BBSH 1UE6A 5LMNL 1KC8C 1VQAA 3KOJA 1S40A 1VQ5A 4GNXA 3TS2A 2I5MX 4BBRH 4A93H 5HGQA 3TS0A 4JV5L 5JJ6A 1J5EL 3I55A 5GAHC 4LFAQ 3M85A 1UWVA 4YWLA 5IP7G 3G71A 3CMAA 3ZC7A 1VQNA 1Q7YC 3PO2G 3H0GG 3SE5A 4B3RQ 3GTGH 5LMUQ 4AQYQ 2MFIA 2WFWA 1GO3E 4FDBA 4DV6L 4AQYL 1EFWA 5IWAL 4QGUA 1EIYB 3HOYG 3S14H 5M5XH 1SR3A 4IO9A 3RLNA 4A93G 1PFSA 4PZ6A 1J5EQ 4KHPQ 4DR7L 4U0ZA 1OXVA 2VL6A 4YY3L 2JE6I 3S1NH 2R7DA 4LF7Q 1AH9A 2XGTA 5J3BA 1UE1A 1HH2P 1FJGQ 5LMNQ 1UEBA 1OXSC 1PVOA 4Y52H 1YJWA 1XNRL 4C3JH 4DV4Q 1JJCB 2GN5A 4GLXA 1KAWA 2OQKA 4JI1L 5JEAJ 4AYBE 4X65Q 3S24A 4HIKA 4OO1G 4DV0Q 2Z6KC 2A8VA 1S3OA 4IPGA 4JOIA 4A3MH 4IJLA 2N8NA 4DAMA 2EIFA 2BH2A 5C3EH 2KBNA 4LF4L 4JBMA 1HNXL 2PI2A 1E1OA 2R7FA 3S1MH 2JA5G 4LF9L 2NVTH 4LUZA 5K36G 5IP9H 1TWCH 1HNXQ 1ASZA 3ZCBA 1Q8KA 4POFA 3J80i 1VQBA 3I4NG 2UUCL 1X3FA 4A3KG 4A3CG 2VUMG 4BXXG 3GD7A 1PH4A 2R92G 1ASYA 4B3SQ 2OCEA 4HIOA 5IYCH 4B3MQ 2B63G 1X55A 1L1OA 2CQOA 3I4OA 5AJ3Q 3HOXG 4DV5L 1DGSA 2Z0SA 1VQ4A 2Q2HA 4DR5Q 4DK6C 4DV3L 3CW2C 3NELA 3ULLA 2K14A 2IY5B 4JI5L 1JB7A 1XNRQ 1H95A 1CUKA 1XMQL 4IOCA 4DUYQ 1XMOQ 2UXBL 1LUZA 1U5KA 1I6HH 2MO0A 1Q86C 4LF5Q 3GTQH 2UXCL 4KHPL 3KJOA 4DR2L 4DUZL 4POGA 1LTLA 4DK3C 3UDFA 1IBKL 2DUDA 4NB3A 1JT8A 4DR3L 4JI6Q 1TWHH 1S72A 3T1YL 3OYYA 3T1YQ 4JBKA 2D62A 2JA9A 4DR6L 3FKIH 1HNWL 1U0LA 1N34Q 2HHHL 4MNOA 2R92H 1K3RA 4LUVA 2LSSA 3BZKA 3HKZG 1N33L 2ATWA 2K50A 2UXCQ 5IYDH 2FXQA 2C35B 2G03A 4JI0L 3TRZA 1GKHA 1A8VA 1T9HA 3NEMA 4PZ7A 4NXNL 3HOUH 2JA5H 5CGLA 1OXXK 2GVBA 4R4QA 3BU2A 5BR8Q 1VQCA 4DR1L 1PH1A 1WCMH 4EX5A 1I3QH 1KRTA 5AJ3L 2KCMA 4X6AH 3CUCA 4GLVB 2OTJA 4A3IG 4UY8C 2K4KA 4X2CA 1PV4A 4K0KQ 3KDFA 1XPRA 4XI8A 3AFQA 4GN5A 3M7NA 4OX9L 3H0GH 3S6AA 3PF4A 1K73C 2KHIA 4KHZA 1PH8A 3ULJA 3TEHB 2UUAL 1PH9A 3PIOA 1IL2A 4A3BH 4JI4L 3I7FA 1A0IA 5GAEC 1HR0W 1PYBA 1N8RC 3KJPA 4LFCQ 2UXDL 3G6EA 3T1HQ 1CKMA 4MZ9A 3PUWA 3CPWA 1E1TA 5M3FH 1SROA 2K75A 4WJ4A 3J80c 5CKLA 3F2DA 3W1BA 4DR3Q 4JI6L 5DLQE 4QIWE 2I5LX 4YHHQ 4DV7Q 1YI2A 1HZAA 3AEVA 4RMFA 4DV2L 3CD6A 3I4NH 4X2EA 1YEZA 3UDXA 4LF8L 3ER0A 3ZJYC 2GVAA 1NE3A 1HZCA 4JBWA 4DUYL 3VDYA 1XMOL 1OTCA 4L5SA 1IZ6A 3RN5A 2Q2UA 2YV5A 2ES2A 4C3HH 4HIDA 1KL9A 4KI0A 3HOWH 1E3PA 3RZDH 2D0PA 4R4TA 1R9TH 5C4JH 1CSQA 1SRUA 4R1JA 2OWOA 3RN2A 2DGYA 5E7NA 4X62L 4X64L 2AWNA 4R4CA 1YIJA 1Q1EA 4L5QA 4LF8Q 1GVPA 3M3YH 5FLXc 3K7AH 5ELNA 4DR4Q 5C0XJ 1PH7A 4A4IA 1KD1C 5M5WH 5IY0A 1VQHA 3KFUA 3U50C 3KLWA 2UUCQ 1VQKA 2LXKA 1Y1VG 4L5RC 3F8TA 3AFPA 2HT1A 1M90C 3B6YA 1BKBA 4B3RL 4A3LH 1VQ6A 1JMCA 1Z47A 3KYHC 4JG2A 2ZM6L 1EYGA 2E2HH 2UXDQ 3L2PA 4J15A 3RNUA 2MQHA 1YITA 1IYJB 3S2DH 4P75A 3K0XA 4PMWA 4ALPA 2WAQE 2F4VL 1Q12A 2IHFA 4GKKQ 3AQQA 2HIXA 4A3FH 2E5LL 4JI3L 4BY1H 4BA1I 1PH2A 5C44H 1XJVA 3HOZG 5JFFA 2ZJPA 3L0OA 4BY7H 4OWTB 4HJ8A 3HKSA 1VS0A 4O0AA 4P71A 4ME3A 1EQRA 4A3FG 1M1KC 4NXNQ 1JJGA 1HNZQ 4JI0Q 5C0XI 2A1AA 5IP9G 2XTIA 1HZ9A 2JK8A 2ZTCA 3SGIA 4Y7NH 3LGJA 1V1QA 2HHHQ 4LW1A 3S2HH 1HNWQ 1C9OA 5EAYA 5M3MG 4JI2L 4MTNA 4LU4A 1MKHA 1P16A 2N78A 3M9BA 5LMUL 1WFQA 3M4PA 4EQ5A 3GTPH 2OTLA 1HZBA 2NZOA 1AE2A 3Q8DA 1VQ9A 3S16H 4XTCS 2VS1A 3A74A 2ZTDA 1MJEA 4UP9A 2HQLA 1I5FA 3S15H 1L1OB 4GN4B 1EWIA 4IPDA 3KF6B 3PGZA 2A19A 5IT9c 4LF6Q 4LFBQ 4LF6L 2V1CC 4DPGA 1NBWA 2IHEA 1QZHA 4OXPA 1XPOA 3HOVH 2VQEQ 4DV3Q 3MXNB 1LYLA 1VQPA 4TQUS 1KIXA 1E7ZA 3CC2A 2CWAA 4C3IH 4DV5Q 3GTLH 1O7IA 5ELOA 1K9MC 1WI5A 1LM0A 1K8GA 3M4OH 1PH6A 2NVXH 4LUOA 3UDIA 4NPSA 2E2JH 4U0UA 2D0OA 3KF6A 1E22A 3FKIG 3PSIA 3RR5A 3DLLA 4GS3A 1VQ7A 4B3TQ 4IFDI 3JAMc 1Q82C 2EXDA 1YJ9A 4BY1G 3GTJH 1I50H 3D31A 2R7ZH 3EIVA 5GAGC 5C4XG 1TWGH 3J7ZC 2WB1G 1CKNB 1GD7A 3CCVA 3ERSX 3ULPA 1A62A 1W2BA 3GTMH 3PUXA 3PF5A 4X66L 4TVAB 5JJLA 1PYSB 1YVCA 2NZHA 1YZ6A 1N9WA 1VQJA 1CSPA 1UE7A 5JEAG 2CFMA 4OWWB 1IXRA 2R7ZG 2HIVA 3PCOB 5FLMG 4A3MG 3W5OA 3H3VH 5HY6A 4X2DA 4YCUA 2R93H 4QL5A 3UE0A 3G48A 4YCWA 2IX0A 4O2DA 4ITRA 1XTDA 2R93G 1C0AA 2AWOA 4JI8Q 1IBLQ 2E5LQ 1NY4A 1X6OA 2Y0SG 1QVGA 4C2MH 4LWCA 2F4VQ 3DM3A 2BA1A 4A3JG 4P73A 2PMZE 4R4IA 4XIGS 1XNQQ 5C4XH 3STBD 4L5TA 1N33Q 3CAMA 3HOXH 3EBEA 3GTKH 3J7A5 5IYBG 1VQIA 3F1ZA 1QUQA 5IWAQ 1C7YA 3K81C 4A3IH 1V43A 3BZCA 5M3MH 4QJFA 3G4SA 1TWAH 4N67A 3RLOA 4DV1L 4IOAA 2K52A 2PQAA 1YHQA 4DNIA 1VQGA 5GQOA 4HJ5A 4U0SA 3BJUA 4X64Q 5IYBH 1QVCA 1AE3A 1K83H 2VQFQ 2F6SA 1MJCA 2JQOA 1KQSA 2I0QA 3A0JA 3ZLMA 2B29A 2VW9A 5JJ7A 1YHAA 3RLFA 1QVFA 1NMGA 4JV5Q 4KLKA 3J81c 2VQFL 4HIMA 3I56A 1N36L 1X56A 5IYCG 3CC7A 2WAQG 4DR5L 3SHGA 3I2ZA
chains in the Genus database with same CATH superfamily
5JJIA 1U4MA 2O4XA 4A3IB 1Z7TA 4IUUA 2JA6H 2I46A 1D7QA 3BS1A 2BDNA 3SXHA 2NYZD 2VY3A 1FYCA 4U68A 1SYFA 1PTOC 2PZUA 4FXGC 4HN7A 1SSOA 2AMCB 3P7JA 1X54A 2WP8J 3FP9A 1D5XC 2JA7G 2Y0SE 4H0LC 4DV0L 1UE5A 1LT4D 2K5QA 1STHA 1EWHA 2JXMB 4MN3A 1PZID 4RAUC 3AU7A 4ZQ3A 3WOFA 2E2HB 4X66Q 1MIUA 1Y8OB 2HUGA 1QE6A 3T53B 4LNQA 3K5LA 4LF7L 4KMUC 1XXGA 4QY7A 3TP5A 1CKOA 1WTOA 4A3GB 1TQOA 1EY5A 3M4YA 4UP7A 1TXYA 1N34L 4JBJA 4RGMA 5M5YH 3NPPA 2O5IC 2LKVA 4A3KH 2ZT9C 2BH8A 3SK8A 4DUZQ 2IL8A 1JJ2A 1PA6A 4TKOB 2MHVA 2QEXA 3RZOB 4ZKCB 4JC0A 4RGTA 1SLJA 4U673 4PMBA 4C3HB 3PUVA 5D3IB 3NBHB 2CW0D 1GUTA 5CV9A 1B3QA 5DM73 4AIMA 1B53A 5FLMH 4K8IA 3H09A 2ZJRA 3H3VC 3KLRA 2L12A 4DV1Q 4FF1A 4JYAL 2ICEC 1J6QA 4JI2Q 4A3JB 4GZYC 2B2WC 4A3GG 4LF4Q 1L0XB 4JYAQ 1D1KA 2KUMA 4JI8L 1JOQA 2YTXA 2VUMH 1NJIC 3OIPA 3I4MG 1GUSA 3TZUA 5BR8L 4PG3A 1KLUD 1BBWA 1V9PA 3N3UA 3TBIB 1TU2B 1FJGL 2ID0A 1F9QA 4C3HG 1NCVA 2JYOA 3I4NB 4FF2A 1TY0A 4BXXH 1RF2D 2CCZA 3K5OA 1JOKA 4NMZA 3E6ZX 2NB0A 2IX3A 1NTGA 3EN2A 3MXGA 4JV5Q 1XNQL 4LF5L 5FLXE 3OTOL 2Z4IA 3A55A 4GNXC 5FO9B 4CHTB 2EY6A 1PLFA 2RDHA 3QOLA 4B3ML 2N88A 2K5HA 2L1BA 3P20A 3UE1A 1JE5A 2CH4W 2UUBQ 4GOPC 4H02A 2IT1A 3I91A 1X9NA 1HQMC 4HJ9A 1H9KA 4FO2A 3BVGA 3TDQA 4N9PA 1IKLA 3CMEA 2F3IA 1G2SA 1KABA 2N3SA 5LL6S 2YU9H 3R93A 1V1PA 2NN6G 1GXDC 2JEAI 3S17B 1SYBA 1HR0Q 2VQEL 3URYA 4UP8A 5IT9E 3RZOH 4JI3Q 1SYCA 4CJ2C 1V8QA 2MUYA 1O78A 3BYTB 5HGQA 1D2BA 5JJ6A 3I55A 4LFAQ 3CMAA 1CT1D 5EBCA 5BN5A 3H0GG 3SE5A 2B2VC 1GUGA 4O42A 4AQYQ 1EFWA 3S14H 3HOYG 4QGUA 4K2KA 3SK5A 3IL8A 4XYOA 1ONLA 4IO9A 4Q0FA 4Q5VA 3RLNA 3VA5A 5K36H 1J5EQ 4DR7L 2KHSA 4KJOA 3MEHA 1ENFA 2L0CA 1AH9A 2XGTA 4BBSB 5IIFA 1XNRL 5JVH3 4DV4Q 4DA2A 3S24A 4HIKA 1BBXC 1KLGD 1RD9D 1C48A 4IJLA 4DAMA 2EIFA 2BH2A 3HKZB 2JA5G 2NVTH 1EFID 1HNXQ 1KDCA 2LFNA 3HEJA 3X3NA 2FMCA 1IW7D 1ASYA 2EYMA 2OCEA 2KVMA 2F0NA 2E2IB 1U4RA 5AJ3Q 4DV5L 4M8AA 2Z0SA 1VQ4A 1K3BC 4DK6C 5IGGA 1RDPD 4DXGA 5JJZA 1QCBD 4MTKA 2NBFA 3HGBA 2UXBL 1U5KA 3IFTA 1IW7C 4KHPL 4X3KA 4DR2L 1LTLA 1DONA 3MVVA 4ZLTF 1TS5A 4DNTB 1S72A 2PNRC 5T1IA 4DR6L 2A5HA 1HNWL 3I4LA 2HHHL 4MNOA 3HKZG 1N33L 2FXQA 4H13C 1A8VA 5EKIA 4NXNL 1ESFA 3KF8A 2JA5H 3SVMA 2PQEA 3BU2A 1PH1A 3OWEB 1K28A 4KV6A 5AJ3L 2KCMA 4GLVB 2WIIB 3MZ5A 3VYSA 1XPRA 4OX9L 3H0GH 2WAQB 4KHZA 2E75C 3ULJA 2UUAL 3NQIA 3TSSA 4X3SA 4JI4L 5CR3A 1A0IA 1N8RC 4LFCQ 4HR7B 3QWNA 4S3SA 1I4PA 5M3FH 3GTGB 4K6DA 4WJ4A 2F0KA 3HOZB 2BDOA 2Z8LA 5J1ZA 4QIWE 4YHHQ 4DV7Q 4RMFA 3A8KE 1UUPA 4ODGA 4RH6A 3ER0A 4LF8L 3QJYA 3SDZA 1LTRD 4DUYL 1NE3A 3VDYA 1IZ6A 1EOTA 4IUTA 3HOWH 3RZDH 3AMUA 3NBIA 1SRUA 1K0SA 2DGYA 3VR3A 1YIJA 4L5QA 5M3MB 1GVPA 4LF8Q 1KD1C 5M5WH 5IY0A 1E2ZA 1EYAA 1VQKA 4HEDA 2X6GA 1BCPF 3AFPA 3H94A 3MAQA 4A3LH 1JMCA 1SDFA 4CDDC 1SE4A 3RNUA 4PNYA 1RODA 5C4HA 3K0XA 2F4VL 2EJGC 2TMPA 1Y1WB 4A93B 2K5DA 1CI3M 1H9SA 2IHFA 4GKKQ 4G7OC 1AN8A 4A3FH 4JI3L 4BY1H 5C44H 1XJVA 3C46A 2JA8B 2ZJPA 1VS0A 4P71A 5JVG3 1LT3D 4ABNA 1DOKA 4NXNQ 1EY6A 4PV1C 4JI0Q 4KY6A 5IP9G 5C0XI 2XTIA 1HZ9A 2FINB 1Q90A 3LGJA 1V1QA 4LW1A 3S2HH 4QCLA 4ME5A 1XWEA 4BBRB 2N78A 1LT6D 1GJXA 1S5DD 4EQ5A 4NP5A 3BDCA 3GTPH 4IQZA 3SK4A 2NZOA 1AE2A 4V190 1VQ9A 1DOLA 2ZTDA 2HQLA 1PRTB 4GN4B 5IT9c 3KF6B 3PGZA 4DPGA 2IHEA 1VQPA 3MXNB 1E7ZA 1STAA 2CWAA 4C3IH 3K0YA 4DV5Q 1WI5A 3M4OH 3QIAA 1PH6A 2NVXH 3UDIA 4KKUA 4CBVA 4CJ0B 4GS3A 3D6CA 3G6JB 1ZEQX 2XVSA 5E4XA 1X3QA 1I50H 2R7ZH 3EIVA 2PO4A 1HXYD 3H0GB 2R92B 4A3EB 1ICWA 1YNJD 1CKNB 3BG3A 3ERSX 3CCVA 3I72A 2B2UA 1B2TA 5JPMC 2F0VA 5IGCA 1CSPA 5C4XB 1IXRA 3S1QB 2HIVA 3PCOB 5FLMG 4LAAA 4QB4A 3G48A 4YCWA 3J81E 5D14A 2RDFA 2AWOA 4JI8Q 4FF3A 4HAEA 1X6OA 2Y0SG 2XNAC 1PFBA 2PZTA 4LWCA 3MHBA 2X6LA 2KEEA 4XIGS 2Z1CA 3J7A5 1VQIA 4BWGB 3PQIA 1EEFD 3BZCA 4TSSA 3RLOA 2K52A 5LL6X 2EYOA 3OIQA 3EVQA 2HD3A 1SE3A 1AE3A 1X3PA 3W3AA 2I0QA 4DAYA 2K01A 4B3TQ 3I56A 1JC7A 4DR5L 1WTQA 2CQAA 1MD2D 1NR2A 3HG9A 4YHHL 3KUPA 4DV7L 2D2CC 4B3SL 1EYCA 4DAYB 3CC4A 3PO3G 2DNCA 4KKSA 5JJKA 4IFDG 3OPOA 2F52A 4NXMQ 2UU9Q 1VQFA 4HJAA 1HPCA 1SE2A 1EOVA 1G291 4V0BA 3NENA 4DN4M 4A75A 4M16A 2IJ0A 5EJWA 3NQTA 1NH1A 4OX9Q 1PFNA 1IBLL 2YTVA 3I8ZA 1AZPA 2ICIA 2RHSB 2RA4A 5EKLA 5E1FA 1EYDA 2F0WA 1Y1VH 1KTKA 3A5UA 2N49A 1EU3A 4DR1Q 4JVZA 4P74A 4AYBB 1VQMA 5GROA 3TQYA 4DV4L 5CMTA 4HMJA 1A3VA 4QUCA 4KD4A 3K5MA 3I4MB 4IPCA 2NN6I 1B44D 4R8IA 4DR6Q 2MGSA 3F2CA 5LHY1 5M5WB 1EZ8A 1Z9FA 2JA6B 1Y1WG 1IBKQ 4ULLA 3MC0B 3A8JE 4LFAL 3T51B 3U58A 2C5CA 3GO5A 3R2TA 5M3FG 5CV4A 2KCNA 3IRBA 2WB1B 3PUYA 4YCVA 1PRTC 2RVLA 5KYIA 1B70B 1RIPA 3S9WA 5ISRA 4A76A 3K80C 1KHIA 4IUPA 3MEFA 1MSGA 3M4QA 1SEBD 1FGUA 4B08A 5HURA 4K14A 3L7ZC 4QIWB 3SEBA 2PNHA 3CXCA 1ZYRD 1IBMQ 2VB2X 4BBRG 3CPFA 3FMCA 3PV0A 3IFDA 3S1RH 2SDFA 3CQZH 4A3BG 1HNZL 1L2FA 1X65A 3A7LA 2WINB 5C44B 1B3AA 4ILWA 1EQTA 1SMYD 2QCPX 1N36Q 1EY0A 2O2LD 4A3DB 2DJFC 3SE0A 1E24A 5JFZA 2B2YA 1LACA 1LTBD 1RL2A 5KIXA 5G3LF 3D8GA 4YY3Q 3OTOQ 1FVIA 3LNNA 4EQOA 2ZM6Q 1OXTA 4A3DG 2EYLA 4JCVE 3OMCA 1JOOA 1PH3A 1HCZA 4UAIA 1CQFA 1LTTD 1KC8C 1WCMG 1EL0A 1A2UA 1I50B 3HFZB 2R7ZB 3WWVA 1YBYA 2KEDA 4WGJA 1E2WA 1OO9B 4KY7A 4JI5Q 4F88A 1V1PB 4OGQC 1WCMB 2OT2A 1SN8A 2JJQA 5C0XH 3S1QH 1RTNA 2P5ZX 4DV2Q 1TWFH 1EQVA 3TP7A 1QILA 1W3SA 5I6WA 4APVA 1AP0A 4IPHA 1S5CD 1WD1A 5C3EB 3T1HL 4LF9Q 1F2LA 2OXPA 4UPAA 4C2MB 5JPNC 3AYHB 3VR6A 1PFMA 1Y14B 5CMDA 1EY4A 3ICEA 1EUJA 4DNRB 3CCEA 5C3EG 2F0PA 3U9SA 4B9WA 4K0KL 2PI2E 4GOPA 4YWMA 1KXLA 1S5ED 2A68C 2BA0A 2RF4A 4NDXA 3MFYA 3S1NB 1JB3A 2A6HD 3KOJA 4IALA 3T13A 1HQRD 4GNXA 2I5MX 4BBRH 1GUNA 1FNVA 2L5TA 4JV5L 1WTWA 4BY1B 5GAHC 4YWLA 5IP7G 1VQNA 1HHVA 5LMUQ 1JQYD 2WFWA 4DV6L 1EIYB 2F3WA 5M5XH 1PFSA 4PZ6A 1TKWB 5FO8B 4ZUIA 4YY3L 3S1NH 1LLRD 5J22A 1HH2P 2XWBB 2OQKA 4JI1L 5JEAJ 3A54A 4OO1G 1PZKD 1Y1VB 2Z6KC 1JWUD 3W2DA 4A3MH 4CKBA 4O1NA 2N8NA 2F0TA 4C3JG 2XWJB 3N6RA 1O7LA 2BCOA 2KQ3A 1WD0A 1CZWA 2KBNA 4JBMA 3SR1A 4XQNA 1E1OA 4DU9A 3HRZC 3JAML 4LF9L 4LUZA 5K36G 3V2TA 3ZCBA 4POFA 5M3FB 3I4NG 1Q3LA 2HQEA 1X3FA 4EQPA 4A3KG 1SBBB 4A3CG 2NWGA 3GD7A 3C1EA 4NKLA 4B3SQ 2F0JA 4FYDA 1KAAA 2A73B 4R8NA 1BQQT 4RKLA 5CORA 2AUKA 3C1FA 1ILQA 3N52A 2Q2HA 5D65A 1TS3A 4DR5Q 4DV3L 1C4QA 1EZ6A 2Q8IB 3ULLA 1ZXTA 2IY5B 3NE5B 2HCCA 1H95A 1PTOH 1XMOQ 3HOYB 1LT5D 3HZXA 2MO0A 2LY7A 3UDFA 4OO1H 4DR3L 4L6TB 4JI6Q 1EWCA 1KNEA 1H9JA 2O5JC 3OYYA 4RKBA 3DWPA 1U0LA 4KTAA 4LUVA 5IYDH 2PMZB 2H1EA 2NUDA 1GKHA 4A3BB 1T9HA 1J9OA 1II3A 4PZ7A 2EYPA 2BE5D 2E2JB 4DR1L 3HOWB 4EX5A 1I3QH 5DEHA 1KRTA 4UY8C 4FVMA 2K4KA 4ZCKA 2B2YC 4XI8A 3AFQA 3DWAA 4FXKC 1PMRA 1MGSA 3PF4A 3S1RB 3TEHB 3O13A 4HMIA 5ELEA 1EY8A 1CKMA 1I4GA 3PUWA 1ILPA 1SNOA 2K75A 5CKLA 1EEID 3F2DA 3W1BA 2FHTA 1F9PA 1B50A 3I4NH 2JN4A 3AEVA 1HZAA 3CD6A 2EDGA 4F7XA 1ET6A 3J7AV 2HDMA 2R3ZA 1FD7D 5KRUA 1XMOL 3S15B 1SNDA 1OTCA 4KD3A 1B1ZA 2ES2A 3P1HA 4C3HH 2OF1A 2E76C 2D0PA 4R4TA 1R9TH 3RN2A 3DXJC 4X62L 4R4CA 3M3YH 3IAYA 1HUNA 2ENBA 3K7AH 4DR4Q 4DAVA 1PH7A 5M5YB 3KFUA 1BOSA 3TN2A 3KLWA 2LXKA 2IW3A 3F8TA 3TZDA 2HT1A 1NSNS 3P75A 3OWFA 4B3RL 3K59A 3KLSA 2UXDQ 3L2PA 1PTOB 2NTTA 3S2DH 1VF7A 3NTHA 1V1OA 1TVXA 4OIJA 3AQQA 4BA1I 1PH2A 2VUMB 2AUJD 2XSCA 2H4OA 3L0OA 3VR2A 4BY7H 3PO3B 3HKSA 4O0AA 4DXFA 1EQRA 1M1KC 5JAVA 1JJGA 1HFGA 2G9DA 2EE1A 2A1AA 2A6ED 3SGIA 4ZRZA 2NVTB 4XT1B 2F0SA 1C9OA 3FPPA 3KLSX 4LU4A 5I9PA 5LMUL 1CHQD 1WFQA 2Q8RE 3CKIB 3NK9A 1HTLD 2OTLA 1DD2A 1VDZA 2EXZA 2VS1A 2EPBA 5ELCA 1MJEA 1DXMA 1H9RA 1EWIA 5C6AA 2RCFA 3TMEA 4LF6L 2V1CC 3RZDB 1XPOA 3R2IA 3CC2A 3V96A 1KIXA 3GTLH 1WVLA 1K9MC 1RJTA 1IL8A 4CDEC 1LM0A 1RCVD 2JP1A 1DYQA 2D0OA 3PSIA 3K6OA 3FKIG 3DLLA 1VQ7A 1E2VA 1U4PA 2V4DA 3JAMc 2WKDA 4BY1G 5J39A 1YNND 1X32A 5GAGC 1MBYA 3Q0AA 1TWGH 3J7ZC 1W2BA 3PUXA 4TVAB 5JJLA 1PYSB 5E4WC 1BNZA 4OWWB 3QG1A 1HRJA 3H3VH 4QUFA 2WV6D 4YCUA 2R93H 2F0HA 2NTSA 4RHSA 2IX0A 4ITRA 2F0LA 1C0AA 1JWSD 1SYDA 1PRTD 4C2MH 1D5MC 2PMZE 1UAPA 2DJGC 3STBD 3GTMB 1N33Q 2E74C 3SHLA 4IUQA 5IYBG 1TWCB 3BDOA 3F1ZA 4HCSA 5M9OA 1QUQA 5IWAQ 2NVXB 1I6HB 4A3IH 3DUZA 4DV1L 2QW7A 1IYVA 4WJWA 3EFXD 3QO2A 2LMCB 2VQFQ 2F6SA 1CK1A 1MJCA 3A0JA 3ZLMA 1NR4A 3Q22A 3J81c 1UNSA 4HIMA 1N36L 2L55A 3C3LA 1JT8A 3I2ZA 1EIFA 4CGYB 3HOZH 2E2IH 1F9RA 4JI7L 3Q23A 4R4OA 1VF5C 1OXUA 5D3DA 2NVYH 5IOCA 2ZXPA 1QZGA 4LFCL 4A3EH 1F2MA 1WOCA 4XYQA 3CCSA 3BVMA 3NBHA 1VQLA 2UUAQ 2PPBC 1X3EA 3GQBA 2F0OA 5FO7B 5EU0A 1QNUA 1A2TA 4A3LG 1ENCA 2Q2TA 2L15A 3NXWA 3GTOH 2KHJA 3PO2H 1KDAA 1QWYA 4RHRA 4GKJQ 4OO1I 2ASBA 3HOWG 1M4VA 4FXDA 1UEAB 5FJ8H 2EYHA 4WRDA 2A69C 2Q2IA 2JA5B 1MI2A 2KCTA 1F2YA 2F3VA 3K7AB 1BCPC 2OQ0A 3A5ZB 2E8GA 4GNXB 1CKNA 2A74C 4DK0A 1K0RA 1A3UA 2FMMA 3RMHA 3STBC 2JEBI 1E0BA 4ZK9B 1K8MA 3E0EA 4X62Q 2J4XA 4K6LA 1XMQQ 3ERQA 4A3EG 1L1OC 5TSSA 1N32L 1G6PA 3HKZE 4IURA 2WKCA 1BBUA 2LXJA 2F0DA 3CHBD 4WJ3M 1Q1BA 4GLAC 4XXEA 3H6MA 4EQNA 1R9TB 5JOBA 3VYTA 1SYEA 4DKAC 2ALYB 2M9VA 1NAPA 2CWPA 5I6YA 5COYA 1QG7A 4PZ8A 5BN4A 2B2TC 1JE4A 4JI4Q 1SMXA 2K03A 1ZYRC 3K7UC 1B9MA 3I4MH 1P8LA 4AYBG 1A63A 4AH6A 2A69D 3DEOA 1EQQA 4P72A 1TS4A 1PHJA 1TWFB 4RWSC 1O7YA 1YNXA 2JSOA 4JI1Q 3CF5A 4NW2A 2K5NA 3NTIA 5FJ8G 4Z9CB 4DR7Q 5NUCA 4BY7G 1JWMD 2B2VA 3GV6A 3NP8A 1GUWA 1GM5A 1JCKB 1SE8A 2R6GA 3E0JA 2RSOA 3JAMi 4RCOA 1WTVA 3FKIB 3G7LA 5I4DA 3CCQA 4DV6Q 1W6KA 1G8ZD 2F1MA 4DR4L 3JC66 4XQJA 4A93G 4IJHA 3ONAB 4DK1A 1Q46A 3J7AF 2L11A 2K5VA 4QQBX 4Y7NB 1X3GA 4RG1A 1GHKA 2NVQH 2RCNA 3CRKC 3A7AB 2YTYA 2B63H 5EBDA 5CV8A 1SNPA 2HCIA 2G5DA 4YIJA 1EY9A 2QDLA 5EPJA 1CHPD 4X3TA 2ZTEA 4GOPB 1I94L 3E9HA 2E2DC 1TWGB 2QA4A 1FR3A 2PCFB 5I2XA 2QGQA 3MWYW 2K1BA 4XT3B 1PZJD 1D1IA 1U4LA 2XN9C 4IFDH 2UUBL 4UHVA 3T56B 4JI7Q 2PZWA 2JA6G 5C0XG 3FHWA 1FL0A 2PW7A 3FEWX 3CP0A 2EYFA 1WYDA 4N8X1 4BBSH 1HFNA 1S40A 5IODA 2KOLA 5BN3A 1DOMA 3LWEA 3A56A 2LS01 1J5EL 3S2HB 4KN7C 1UWVA 3M85A 3G71A 3ZC7A 2NUCA 3GTGH 3D4RA 2MFIA 1QOHA 4AQYL 5IWAL 2QILA 2EJMA 1SR3A 3HS0C 4XQQA 1OXVA 4JW0A 2DN8A 2JE6I 5FK9C 1I6VC 2R7DA 4LF7Q 5C4JB 1UE1A 5C3WA 2RBMA 2SEBD 5E3FA 3I73A 1YJWA 4QF4A 2GN5A 4GLXA 4AYBE 2EVBA 3MA2B 4DV0Q 2VB3X 1LTAD 2B2WA 2A8VA 1S3OA 4IPGA 5ELFA 3FDTA 2Z4HA 2TSSA 1K83B 5KEEA 5C3EH 2PI2A 4JPBW 3WDNA 1T5EA 5IP9H 4LJZC 1Q8KA 1VQBA 1JORA 1RTOA 2VUMG 1TWHB 1PH4A 1IHZA 4C1NK 2R92G 5JEAH 4B3MQ 2B63G 1X55A 1L1OA 4CDFC 3EQLC 5DM63 3CW2C 2XRSD 4JI5L 4DUYQ 2XIWA 2B63B 1I6HH 3RUZA 4LF5Q 3D3RA 2UXCL 1B4OA 2K6AA 4DUZL 5F2DA 1NNXA 2Y0SB 1STYA 3DHQA 2DUDA 1IBKL 1TWHH 5ELDA 3T1YL 3T1YQ 4OHJA 3ND9A 4J1MA 2A6EC 3BZKA 2K50A 2UXCQ 2CH4A 2G03A 3NSWA 4MHEA 3NEMA 3HOUH 3DMUA 5CGLA 4KY5A 1OXXK 5BR8Q 1VQCA 1BCPB 1WCMH 3E5SA 3PIP3 4X6AH 1ESRA 2XRQD 1LTID 3KDFA 4K0KQ 1K73C 2X69A 2KHIA 4A3BH 4L8JA 1R4QB 3PIOA 3PMFA 1PH9A 3NWSA 3NUCA 3OSOA 1IL2A 5GAEC 3HP3A 3KBXA 4I65A 4MZ9A 3G6EA 1E1TA 1IYUA 2F0EA 4J8QA 4DR3Q 5FLXL 3MXNA 4JI6L 1R4PB 2I5LX 3K58A 2F0FA 4DV2L 1BF4A 4X2EA 2R61A 1TY2A 2NUNA 3LWUA 3UDXA 4DFAA 2RSNA 2GVAA 4JBWA 1A15A 2UXBQ 1MSHA 2AQ2B 2YV5A 2NVQB 3BDLA 4HIDA 1KL9A 4KI0A 1E3PA 4E6IA 4RCNA 5C4JH 3K57A 4ID6A 4R9WA 5ELNA 3QB3A 3OOCA 4A4IA 2EY1A 2RDGA 2F03A 1VQHA 3U50C 1LABA 1Y1VG 4L5RC 1QB5D 1TWAB 1SAPA 1Z47A 2M2LA 3KYHC 3QR8A 4JG2A 1EYGA 2E2HH 4J15A 2MQHA 3E3XA 1IYJB 4P75A 4FF4A 4ALPA 2WAQE 1ML0D 5C4ZA 2HIXA 1O80A 3HOZG 2QKIC 5T1GA 4WFN3 5JFFA 4G57A 2BE5C 4OWTB 5CV5A 2F0UA 1B9NA 5KNDA 4ME3A 1ET9A 4A3FG 1M8AA 4IZ8A 5EQ0A 3VYUA 1RHPA 5EPKA 2JK8A 4Y7NH 1LTGD 4F87A 5EAYA 5CBAE 5M3MG 1D5ZC 4MTNA 1MKHA 1P16A 2OEOA 3NWTA 3VYRA 5A2QL 2RQXA 4ZKBB 4C3IG 3S16H 4J6HA 4UP9A 3S15H 1I5FA 4OEMB 3Q6SA 4IPDA 5KGUA 2A19A 3ND8A 1QZHA 1S5BD 4OXPA 3T16A 1ENAA 4LFBL 4TQUS 4PMCA 1IKMA 4RGOS 4LUOA 5HGTA 3VR4A 4U0UA 3KF6A 3RR5A 4IFDI 1Q82C 2K05A 1EY7A 1SFOB 3D31A 1VMPA 1SYGA 5C4XG 1I4QA 1SJED 2K28A 3ZYYX 1EU4A 1GD7A 4F8MA 3R8BA 2NZHA 1N9WA 1UE7A 2CFMA 4KHVA 4RGNA 2R7ZG 5IT9L 4A3MG 5HY6A 2CW0C 2EJFC 4QL5A 4O2DA 1XTDA 2R93G 3X3MA 2E5LQ 1L0YB 1NY4A 1QVGA 2F4VQ 3DM3A 2BA1A 5L37A 5IGEA 4A3JG 1XNQQ 3MXPA 5DAUA 2MPMA 1C7YA 1CQVA 5CBEE 1V43A 5M3MH 4QJFA 3G4SA 1TWAH 4N67A 1FGBD 4IOAA 1VQGA 5GQOA 3D6WA 1K8OA 4U0SA 4X64Q 1QJOA 1K83H 1KQSA 1S4ZA 2B29A 1QVFA 4RA8A 3RLFA 4TRDA 1SMYC 3R3OA 1TIID 4KLKA 2VQFL 4C1NI 3CC7A 2WAQG 1WTHA 2F4IA 3SHGA 3GV3A 2JA8H 4BA2I 4N8FA 3J81j 1BVSA 3KK7A 4K8JA 1Q81C 1EIHA 3CCRA 1YJNA 3K8AA 3JAME 4G4KA 1G51A 3DM1A 1XTCD 1VQDA 4A3KB 2FFKB 2PQAB 3HOVG 2RHQB 3KDFB 4IFDJ 2KECA 4N9TA 3CCLA 1I94Q 1IBML 5C3XA 3M4OB 5LMNW 2AHOB 4BS9A 1I4RA 1XPUA 3S17H 4CDCC 4H44C 4GN3B 2MO1A 4PY3A 1WTPA 2KJXA 3PUZA 3D0FA 1AW7A 1GOZA 2MNAA 4RFBA 5GADC 3S2DB 4A3JH 3GDEA 3KF8B 2CKZB 2AQ1B 1SNMA 1HJPA 2IX1A 5IP7H 1FNWA 4DAPA 2D9UA 3E9IA 3CCMA 2WB1E 1TT2A 1BUVT 1VQOA 2C9OA 1Y1WH 2K32A 1I3QB 1WTRA 3GTOB 1NMFA 2Q8TA 4A3FB 1YHBA 1ICFB 2EQSA 2EZVA 4U07A 1AEXA 1KRSA 3QOJA 1LV9A 3U4ZA 4A3CH 2JA8G 4L63B 2CVRA 1VMCA 2KENA 4OONA 1B8AA 1WJJA 3PIPA 1CA6A 3U4VA 2QEJC 5M5XB 4YWKA 1KDBA 4OWXB 4A3GH 4BBSG 4DGZA 3F2BA 2UU9L 1EIGA 2Z6KA 1MHWC 4ZYSA 2VZAA 4I7ZC 4U04A 1DCZA 3K5NA 2L4NA 4FP5D 2RKSA 1STBA 3Q24A 3M7GA 3J81i 4GKKL 3EA6A 1VCIA 4KJNA 1N32Q 2AKWB 1VQ8A 5IYDG 3CU7A 1QUQB 3HOUB 1O7ZA 1L0WA 2PW5A 1KNAA 5IE8A 1B7YB 3CCJA 2EYJA 3SN9A 1QNKA 3J80E 5EGTA 2B8GA 3H3VI 5H1SE 4DR2Q 3TREA 3W1GA 1STNA 1SFOH 4A3DH 2N55A 3OW2A 2B3GA 5ELBA 1D8LA 2L9HA 1DJRD 1HA6A 4C3IB 1J8IA 3F2UA 4WORA 3FRPB 4GKJL 4JK1C 4IUVA 1HR0L 3PO3H 4FNFA 1PH5A 1BO0A 2KCCA 5C44G 2JA7H 5FOBB 3GTPB 3FPUB 5IGDA 1CTMA 4HJ7A 3HOUG 2YYZA 2I5HA 4NXML 2H5XA 5A35A 3V05A 3HOYH 1DZ1A 3H15A 4K2LA 3VA7A 3GTQB 2ZJQA 5G3LD 3LETA 2HDLA 1GHJA 3UDGA 1VQEA 3D4DA 5K5PA 4X65L 3CCUA 1NUCA 1K8AC 3L9AX 3PO2B 4JOIC 2F0QA 2VNUD 1UE6A 5LMNL 1VQAA 5IGFA 2GA4B 1F9SA 2QF7A 1VQ5A 3TS2A 4A93H 3TS0A 1XX8A 3PO2G 2KA7A 1Q7YC 4B3RQ 1GO3E 4FDBA 2ZXOA 1TS2A 1SJHD 4CJ1B 3VR5A 1HA5A 1F77A 4KHPQ 4U0ZA 2VL6A 1SNQA 2WACA 3OHXC 5J3BA 1FJGQ 2B8FA 1UEBA 1OXSC 5LMNQ 3HOVB 1PVOA 4Y52H 3FVQA 4C3JH 1JJCB 1KAWA 3CRLC 1F2ZA 4X65Q 2YU9B 1PYWD 2K5WA 3GP7A 2DY7A 4LK1C 3NTKA 4JOIA 5AFWA 1D6EC 2B2TA 1PTOD 2SNMA 5KNCA 4EVOA 2F0GA 3KBGA 4OL7A 4LF4L 1CM9A 2VXWA 1G6ZA 1HNXL 1AFPA 2R7FA 3S1MH 3MXUA 4CKEA 2EY2A 1TWCH 1ASZA 2CHBD 3J80i 1AZQA 2UUCL 2EOTA 4BXXG 4HIOA 2NVYB 5IYCH 2CQOA 3I4OA 3HOXG 1DGSA 1CFMA 3NELA 2K14A 1DM0B 3AB9A 1JB7A 1XNRQ 1CUKA 4K5XA 4IOCA 1XMQL 1LUZA 3MFGA 3GTQH 1Q86C 3KJOA 4POGA 4DK3C 4NB3A 2Z9HA 2F0MA 3I70A 5CGKA 4JBKA 2D62A 2JA9A 1Y8PB 3FKIH 1N34Q 4P2CB 2R92H 1K3RA 2ATWA 2LSSA 3DWQA 3IKJA 2C35B 4JI0L 3SK6A 3TRZA 4KKTA 2GVBA 4R4QA 5CV7A 3GTLB 3I90A 3CUCA 2OTJA 2B2UC 4A3IG 5KYLA 1JR0D 4X2CA 2NN6H 1PV4A 5IGBA 2B39A 4GN5A 1BXTA 3M7NA 2IPKD 1SXTA 3S6AA 3ITPA 4XDXA 1PH8A 3WOEA 1LTSD 2FJ2A 3I7FA 4PQXA 1HR0W 1PYBA 3OW7A 3KJPA 2UXDL 3T1HQ 3CPWA 1SROA 3J80c 1BR9A 2BOSA 2PYKA 5DLQE 4A3MB 1STEA 4QMGA 5CC4A 1YI2A 1A6XA 1YEZA 1RKNA 2SOBA 3U9OA 2R93B 4HTHA 1HUMA 3ZJYC 4HSPA 1HZCA 1I4HA 2A68D 4L5SA 3TP6A 3RN5A 2Q2UA 3T4AC 5EKKA 5CYUA 1CSQA 4R1JA 2OWOA 5E7NA 4X64L 2AWNA 4EGVA 1Q1EA 2G9HD 4H7BA 5FLXc 4K5VA 5C0XJ 1PDQA 2UUCQ 1ZKOA 1YNJC 3S16B 1M90C 3B6YA 1BKBA 1VQ6A 1Y8NB 2ZM6L 1YNNC 2ZXRA 3TP8A 1YITA 5I9OA 4PMWA 3H91A 1PRTF 1Q12A 5EPLA 2E5LL 2A6HC 3J7YW 3NHHA 4G7HC 2MP1A 4UDUC 4HJ8A 4KK7A 4X3UA 4BY7B 2DY8A 1Z6HA 3D4WA 4ZUJA 3LX0A 1HNZQ 1G91A 1FNUA 1TR5A 2ZTCA 2MJ8A 5C5LA 5A2QE 2HHHQ 5DNFA 3C2PA 3BVZA 1HNWQ 4JI2L 2K7VA 3M9BA 3M4PA 4C56C 2F0IA 2J7ZA 1STGA 4IN3A 1HZBA 3Q8DA 1JICA 2DNEA 4XTCS 2SNSA 3A74A 2AQ3B 5I2YA 2M00A 1L1OB 2I07B 2IWHA 2QDBA 4LFBQ 2K33A 4LF6Q 1NBWA 1Y69U 3HOVH 3PIO3 2VQEQ 4DV3Q 1LYLA 4ZAIA 4C3JB 1O7IA 4K5WA 5ELOA 2J0TD 2Z6BA 3EROA 1K8GA 3BZDB 1W6JA 4NPSA 1I4XA 1XYIA 2E2JH 3MTSA 1E22A 3UI2A 1T5XD 2EXDA 4DF7A 1YJ9A 5C5MA 3GTJH 1BCPD 3GTJB 3CQZB 2K04A 2D5DA 2WB1G 4KN4C 3ULPA 3GTMH 1A62A 3PF5A 4X66L 1SNCA 3M3YB 1YZ6A 1YVCA 3HOXB 3GTKB 1VQJA 4HCEA 5JEAG 5FKAC 3RD4A 3DEPA 1U9RA 1PTOF 4G7ZC 1GUOA 1A3TA 1C8CA 4I7AA 1CA5A 3W5OA 4X2DA 4OIKA 4CKCA 4IUNA 1H9MA 3UE0A 2NZ1D 1IBLQ 1WTXA 5CV6A 1G2TA 2EY5A 3L3OC 4P73A 4B9XA 1BDOA 4MIUA 4R4IA 5C4XH 4L5TA 1H9SB 3CAMA 3S1MB 3HOXH 3EBEA 3GTKH 1CZGA 1Q8IA 3EJIA 3K81C 3A8IE 3J80L 3BYYB 4M1UB 2JA7B 3S14B 2PQAA 4HSVA 4LMQD 1YHQA 3OMGA 4DNIA 4HJ5A 3BJUA 5IYBH 1QVCA 4B3TL 2JQOA 2VW9A 4OELB 5JJ7A 1HTPA 1YHAA 1NMGA 5KNBA 3J81L 3I3CA 1X56A 5IYCG 1S5FD 1LO5D 1PXUA
chains in the Genus database with same CATH topology
2JA8H 4BA2I 1EIFA 5JJIA 3J81j 4YHHL 1BVSA 4DV7L 3HOZH 2E2IH 1Q81C 4B3SL 4JI7L 4DAYB 3CC4A 2JA6H 3PO3G 4R4OA 3CCRA 1OXUA 1YJNA 3K8AA 1G51A 5JJKA 4IFDG 2NVYH 1QZGA 2F52A 1D7QA 4LFCL 4NXMQ 1VQDA 2UU9Q 4A3EH 4B3TL 1VQFA 4HJAA 2VY3A 2PQAB 1WOCA 3HOVG 1EOVA 2RHQB 1G291 3KDFB 4IFDJ 3NENA 3CCLA 3CCSA 4A75A 4M16A 1I94Q 1IBML 1VQLA 4LFBL 2UUAQ 1X3EA 5LMNW 4OX9Q 2AHOB 1IBLL 2YTVA 2AMCB 5EU0A 2RHSB 4A3LG 1X54A 1XPUA 2Q2TA 2L15A 2WP8J 3FP9A 2JA7G 3GTOH 2KHJA 2Y0SE 1Y1VH 4DV0L 3A5UA 3S17H 1UE5A 2N49A 4GN3B 2MO1A 4PY3A 4DR1Q 3PO2H 4GKJQ 4P74A 1VQMA 2ASBA 4OO1I 3HOWG 5GROA 3TQYA 3PUZA 5FJ8H 4DV4L 5CMTA 3D0FA 4X66Q 1MIUA 2MNAA 2Q2IA 4LNQA 4LF7L 5GADC 4QY7A 4A3JH 1CKOA 4IPCA 3GDEA 2NN6I 2KCTA 2CKZB 3KF8B 4DR6Q 4UP7A 1TXYA 3F2CA 4JBJA 1N34L 2OQ0A 3A5ZB 1HJPA 2IX1A 2E8GA 5IP7H 5M5YH 4GNXB 1CKNA 1Z9FA 1K0RA 1Y1WG 1IBKQ 4A3KH 3STBC 2JEBI 4LFAL 2BH8A 3E0EA 4X62Q 4DUZQ 3U58A 1JJ2A 1PA6A 3GO5A 5M3FG 2QEXA 1XMQQ 3E9IA 3IRBA 3PUYA 4YCVA 3CCMA 1L1OC 4A3EG 1N32L 1G6PA 3HKZE 1B70B 1RIPA 2WB1E 4JC0A 1SLJA 1BBUA 1VQOA 1Y1WH 4A76A 2LXJA 3PUVA 4WJ3M 3K80C 1KHIA 1Q1BA 1NMFA 3MEFA 3NBHB 1YHBA 4GLAC 3M4QA 1FGUA 2EQSA 4U07A 1KRSA 3U4ZA 4A3CH 4DKAC 3L7ZC 4AIMA 2ALYB 5FLMH 2JA8G 2PNHA 3CXCA 2ZJRA 4DV1Q 2KENA 4JYAL 4OONA 1IBMQ 1B8AA 1J6QA 1WJJA 2CWPA 4JI2Q 3U4VA 3CPFA 4BBRG 3PIPA 3PV0A 4YWKA 4OWXB 3S1RH 4A3GH 4BBSG 4PZ8A 3F2BA 2UU9L 4JI4Q 1SMXA 3CQZH 4A3BG 3K7UC 2Z6KA 4A3GG 3I4MH 1HNZL 4LF4Q 1P8LA 1L2FA 1X65A 4AYBG 4JYAQ 2VZAA 1A63A 4U04A 4AH6A 4JI8L 1EQQA 4P72A 1PHJA 2YTXA 2VUMH 1NJIC 3I4MG 1N36Q 5BR8L 1YNXA 4PG3A 4JI1Q 3J81i 3CF5A 4GKKL 1E24A 1BBWA 5JFZA 2K5NA 1VCIA 1V9PA 2AKWB 1VQ8A 1N32Q 5IYDG 3N3UA 1RL2A 1QUQB 5FJ8G 1FJGL 4YY3Q 3OTOQ 2ID0A 4DR7Q 1FVIA 1L0WA 4BY7G 2ZM6Q 5IE8A 1OXTA 1GM5A 2R6GA 1SE8A 4A3DG 1B7YB 4BXXH 3CCJA 3SN9A 3JAMi 2CCZA 4JCVE 1PH3A 3CCQA 4DV6Q 3H3VI 4DR4L 3JC66 1WCMG 5H1SE 4IJHA 1NTGA 3EN2A 3TREA 3W1GA 1Q46A 4DR2Q 3HFZB 1SFOH 4LF5L 1XNQL 2K5VA 4A3DH 3OW2A 4QQBX 2B3GA 3WWVA 1D8LA 1YBYA 1X3GA 4WGJA 4RG1A 3OTOL 2NVQH 4JI5Q 2RCNA 1SN8A 2JJQA 4GKJL 4GNXC 2YTYA 1HR0L 2B63H 3S1QH 3PO3H 4B3ML 1PH5A 2K5HA 4DV2Q 1TWFH 3UE1A 5C44G 2JA7H 1W3SA 1JE5A 4APVA 2UUBQ 4IPHA 4GOPC 2ZTEA 4H02A 2IT1A 4GOPB 1I94L 2UXBQ 3E9HA 1X9NA 3T1HL 4LF9Q 2QA4A 4HJ9A 4HJ7A 3HOUG 2YYZA 2I5HA 2QGQA 4NXML 2H5XA 4UPAA 3CMEA 2F3IA 3AYHB 1Y14B 3HOYH 3H15A 2N3SA 3ICEA 1EUJA 2YU9H 2UUBL 2ZJQA 3CCEA 5C3EG 4JI7Q 2NN6G 3LETA 2JA6G 4K0KL 2PI2E 5C0XG 3UDGA 3FHWA 1VQEA 4YWMA 1FL0A 4GOPA 4X65L 3CCUA 2JEAI 1KXLA 1K8AC 1HR0Q 2VQEL 3CP0A 4JOIC 2BA0A 4UP8A 2RF4A 4JI3Q 3RZOH 2VNUD 1WYDA 4BBSH 1UE6A 5LMNL 1KC8C 1VQAA 3KOJA 1S40A 1VQ5A 4GNXA 3TS2A 2I5MX 4BBRH 4A93H 5HGQA 3TS0A 4JV5L 5JJ6A 1J5EL 3I55A 5GAHC 4LFAQ 3M85A 1UWVA 4YWLA 5IP7G 3G71A 3CMAA 3ZC7A 1VQNA 1Q7YC 3PO2G 3H0GG 3SE5A 4B3RQ 3GTGH 5LMUQ 4AQYQ 2MFIA 2WFWA 1GO3E 4FDBA 4DV6L 4AQYL 1EFWA 5IWAL 4QGUA 1EIYB 3HOYG 3S14H 5M5XH 1SR3A 4IO9A 3RLNA 4A93G 1PFSA 4PZ6A 1J5EQ 4KHPQ 4DR7L 4U0ZA 1OXVA 2VL6A 4YY3L 2JE6I 3S1NH 2R7DA 4LF7Q 1AH9A 2XGTA 5J3BA 1UE1A 1HH2P 1FJGQ 5LMNQ 1UEBA 1OXSC 1PVOA 4Y52H 1YJWA 1XNRL 4C3JH 4DV4Q 1JJCB 2GN5A 4GLXA 1KAWA 2OQKA 4JI1L 5JEAJ 4AYBE 4X65Q 3S24A 4HIKA 4OO1G 4DV0Q 2Z6KC 2A8VA 1S3OA 4IPGA 4JOIA 4A3MH 4IJLA 2N8NA 4DAMA 2EIFA 2BH2A 5C3EH 2KBNA 4LF4L 4JBMA 1HNXL 2PI2A 1E1OA 2R7FA 3S1MH 2JA5G 4LF9L 2NVTH 4LUZA 5K36G 5IP9H 1TWCH 1HNXQ 1ASZA 3ZCBA 1Q8KA 4POFA 3J80i 1VQBA 3I4NG 2UUCL 1X3FA 4A3KG 4A3CG 2VUMG 4BXXG 3GD7A 1PH4A 2R92G 1ASYA 4B3SQ 2OCEA 4HIOA 5IYCH 4B3MQ 2B63G 1X55A 1L1OA 2CQOA 3I4OA 5AJ3Q 3HOXG 4DV5L 1DGSA 2Z0SA 1VQ4A 2Q2HA 4DR5Q 4DK6C 4DV3L 3CW2C 3NELA 3ULLA 2K14A 2IY5B 4JI5L 1JB7A 1XNRQ 1H95A 1CUKA 1XMQL 4IOCA 4DUYQ 1XMOQ 2UXBL 1LUZA 1U5KA 1I6HH 2MO0A 1Q86C 4LF5Q 3GTQH 2UXCL 4KHPL 3KJOA 4DR2L 4DUZL 4POGA 1LTLA 4DK3C 3UDFA 1IBKL 2DUDA 4NB3A 1JT8A 4DR3L 4JI6Q 1TWHH 1S72A 3T1YL 3OYYA 3T1YQ 4JBKA 2D62A 2JA9A 4DR6L 3FKIH 1HNWL 1U0LA 1N34Q 2HHHL 4MNOA 2R92H 1K3RA 4LUVA 2LSSA 3BZKA 3HKZG 1N33L 2ATWA 2K50A 2UXCQ 5IYDH 2FXQA 2C35B 2G03A 4JI0L 3TRZA 1GKHA 1A8VA 1T9HA 3NEMA 4PZ7A 4NXNL 3HOUH 2JA5H 5CGLA 1OXXK 2GVBA 4R4QA 3BU2A 5BR8Q 1VQCA 4DR1L 1PH1A 1WCMH 4EX5A 1I3QH 1KRTA 5AJ3L 2KCMA 4X6AH 3CUCA 4GLVB 2OTJA 4A3IG 4UY8C 2K4KA 4X2CA 1PV4A 4K0KQ 3KDFA 1XPRA 4XI8A 3AFQA 4GN5A 3M7NA 4OX9L 3H0GH 3S6AA 3PF4A 1K73C 2KHIA 4KHZA 1PH8A 3ULJA 3TEHB 2UUAL 1PH9A 3PIOA 1IL2A 4A3BH 4JI4L 3I7FA 1A0IA 5GAEC 1HR0W 1PYBA 1N8RC 3KJPA 4LFCQ 2UXDL 3G6EA 3T1HQ 1CKMA 4MZ9A 3PUWA 3CPWA 1E1TA 5M3FH 1SROA 2K75A 4WJ4A 3J80c 5CKLA 3F2DA 3W1BA 4DR3Q 4JI6L 5DLQE 4QIWE 2I5LX 4YHHQ 4DV7Q 1YI2A 1HZAA 3AEVA 4RMFA 4DV2L 3CD6A 3I4NH 4X2EA 1YEZA 3UDXA 4LF8L 3ER0A 3ZJYC 2GVAA 1NE3A 1HZCA 4JBWA 4DUYL 3VDYA 1XMOL 1OTCA 4L5SA 1IZ6A 3RN5A 2Q2UA 2YV5A 2ES2A 4C3HH 4HIDA 1KL9A 4KI0A 3HOWH 1E3PA 3RZDH 2D0PA 4R4TA 1R9TH 5C4JH 1CSQA 1SRUA 4R1JA 2OWOA 3RN2A 2DGYA 5E7NA 4X62L 4X64L 2AWNA 4R4CA 1YIJA 1Q1EA 4L5QA 4LF8Q 1GVPA 3M3YH 5FLXc 3K7AH 5ELNA 4DR4Q 5C0XJ 1PH7A 4A4IA 1KD1C 5M5WH 5IY0A 1VQHA 3KFUA 3U50C 3KLWA 2UUCQ 1VQKA 2LXKA 1Y1VG 4L5RC 3F8TA 3AFPA 2HT1A 1M90C 3B6YA 1BKBA 4B3RL 4A3LH 1VQ6A 1JMCA 1Z47A 3KYHC 4JG2A 2ZM6L 1EYGA 2E2HH 2UXDQ 3L2PA 4J15A 3RNUA 2MQHA 1YITA 1IYJB 3S2DH 4P75A 3K0XA 4PMWA 4ALPA 2WAQE 2F4VL 1Q12A 2IHFA 4GKKQ 3AQQA 2HIXA 4A3FH 2E5LL 4JI3L 4BY1H 4BA1I 1PH2A 5C44H 1XJVA 3HOZG 5JFFA 2ZJPA 3L0OA 4BY7H 4OWTB 4HJ8A 3HKSA 1VS0A 4O0AA 4P71A 4ME3A 1EQRA 4A3FG 1M1KC 4NXNQ 1JJGA 1HNZQ 4JI0Q 5C0XI 2A1AA 5IP9G 2XTIA 1HZ9A 2JK8A 2ZTCA 3SGIA 4Y7NH 3LGJA 1V1QA 2HHHQ 4LW1A 3S2HH 1HNWQ 1C9OA 5EAYA 5M3MG 4JI2L 4MTNA 4LU4A 1MKHA 1P16A 2N78A 3M9BA 5LMUL 1WFQA 3M4PA 4EQ5A 3GTPH 2OTLA 1HZBA 2NZOA 1AE2A 3Q8DA 1VQ9A 3S16H 4XTCS 2VS1A 3A74A 2ZTDA 1MJEA 4UP9A 2HQLA 1I5FA 3S15H 1L1OB 4GN4B 1EWIA 4IPDA 3KF6B 3PGZA 2A19A 5IT9c 4LF6Q 4LFBQ 4LF6L 2V1CC 4DPGA 1NBWA 2IHEA 1QZHA 4OXPA 1XPOA 3HOVH 2VQEQ 4DV3Q 3MXNB 1LYLA 1VQPA 4TQUS 1KIXA 1E7ZA 3CC2A 2CWAA 4C3IH 4DV5Q 3GTLH 1O7IA 5ELOA 1K9MC 1WI5A 1LM0A 1K8GA 3M4OH 1PH6A 2NVXH 4LUOA 3UDIA 4NPSA 2E2JH 4U0UA 2D0OA 3KF6A 1E22A 3FKIG 3PSIA 3RR5A 3DLLA 4GS3A 1VQ7A 4B3TQ 4IFDI 3JAMc 1Q82C 2EXDA 1YJ9A 4BY1G 3GTJH 1I50H 3D31A 2R7ZH 3EIVA 5GAGC 5C4XG 1TWGH 3J7ZC 2WB1G 1CKNB 1GD7A 3CCVA 3ERSX 3ULPA 1A62A 1W2BA 3GTMH 3PUXA 3PF5A 4X66L 4TVAB 5JJLA 1PYSB 1YVCA 2NZHA 1YZ6A 1N9WA 1VQJA 1CSPA 1UE7A 5JEAG 2CFMA 4OWWB 1IXRA 2R7ZG 2HIVA 3PCOB 5FLMG 4A3MG 3W5OA 3H3VH 5HY6A 4X2DA 4YCUA 2R93H 4QL5A 3UE0A 3G48A 4YCWA 2IX0A 4O2DA 4ITRA 1XTDA 2R93G 1C0AA 2AWOA 4JI8Q 1IBLQ 2E5LQ 1NY4A 1X6OA 2Y0SG 1QVGA 4C2MH 4LWCA 2F4VQ 3DM3A 2BA1A 4A3JG 4P73A 2PMZE 4R4IA 4XIGS 1XNQQ 5C4XH 3STBD 4L5TA 1N33Q 3CAMA 3HOXH 3EBEA 3GTKH 3J7A5 5IYBG 1VQIA 3F1ZA 1QUQA 5IWAQ 1C7YA 3K81C 4A3IH 1V43A 3BZCA 5M3MH 4QJFA 3G4SA 1TWAH 4N67A 3RLOA 4DV1L 4IOAA 2K52A 2PQAA 1YHQA 4DNIA 1VQGA 5GQOA 4HJ5A 4U0SA 3BJUA 4X64Q 5IYBH 1QVCA 1AE3A 1K83H 2VQFQ 2F6SA 1MJCA 2JQOA 1KQSA 2I0QA 3A0JA 3ZLMA 2B29A 2VW9A 5JJ7A 1YHAA 3RLFA 1QVFA 1NMGA 4JV5Q 4KLKA 3J81c 2VQFL 4HIMA 3I56A 1N36L 1X56A 5IYCG 3CC7A 2WAQG 4DR5L 3SHGA 3I2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 H;  4BA2 I;  1EIF A;  5JJI A;  3J81 j;  4YHH L;  1BVS A;  4DV7 L;  3HOZ H;  2E2I H;  1Q81 C;  4B3S L;  4JI7 L;  4DAY B;  3CC4 A;  2JA6 H;  3PO3 G;  4R4O A;  3CCR A;  1OXU A;  1YJN A;  3K8A A;  1G51 A;  5JJK A;  4IFD G;  2NVY H;  1QZG A;  2F52 A;  1D7Q A;  4LFC L;  4NXM Q;  1VQD A;  2UU9 Q;  4A3E H;  4B3T L;  1VQF A;  4HJA A;  2VY3 A;  2PQA B;  1WOC A;  3HOV G;  1EOV A;  2RHQ B;  1G29 1;  3KDF B;  4IFD J;  3NEN A;  3CCL A;  3CCS A;  4A75 A;  4M16 A;  1I94 Q;  1IBM L;  1VQL A;  4LFB L;  2UUA Q;  1X3E A;  5LMN W;  4OX9 Q;  2AHO B;  1IBL L;  2YTV A;  2AMC B;  5EU0 A;  2RHS B;  4A3L G;  1X54 A;  1XPU A;  2Q2T A;  2L15 A;  2WP8 J;  3FP9 A;  2JA7 G;  3GTO H;  2KHJ A;  2Y0S E;  1Y1V H;  4DV0 L;  3A5U A;  3S17 H;  1UE5 A;  2N49 A;  4GN3 B;  2MO1 A;  4PY3 A;  4DR1 Q;  3PO2 H;  4GKJ Q;  4P74 A;  1VQM A;  2ASB A;  4OO1 I;  3HOW G;  5GRO A;  3TQY A;  3PUZ A;  5FJ8 H;  4DV4 L;  5CMT A;  3D0F A;  4X66 Q;  1MIU A;  2MNA A;  2Q2I A;  4LNQ A;  4LF7 L;  5GAD C;  4QY7 A;  4A3J H;  1CKO A;  4IPC A;  3GDE A;  2NN6 I;  2KCT A;  2CKZ B;  3KF8 B;  4DR6 Q;  4UP7 A;  1TXY A;  3F2C A;  4JBJ A;  1N34 L;  2OQ0 A;  3A5Z B;  1HJP A;  2IX1 A;  2E8G A;  5IP7 H;  5M5Y H;  4GNX B;  1CKN A;  1Z9F A;  1K0R A;  1Y1W G;  1IBK Q;  4A3K H;  3STB C;  2JEB I;  4LFA L;  2BH8 A;  3E0E A;  4X62 Q;  4DUZ Q;  3U58 A;  1JJ2 A;  1PA6 A;  3GO5 A;  5M3F G;  2QEX A;  1XMQ Q;  3E9I A;  3IRB A;  3PUY A;  4YCV A;  3CCM A;  1L1O C;  4A3E G;  1N32 L;  1G6P A;  3HKZ E;  1B70 B;  1RIP A;  2WB1 E;  4JC0 A;  1SLJ A;  1BBU A;  1VQO A;  1Y1W H;  4A76 A;  2LXJ A;  3PUV A;  4WJ3 M;  3K80 C;  1KHI A;  1Q1B A;  1NMF A;  3MEF A;  3NBH B;  1YHB A;  4GLA C;  3M4Q A;  1FGU A;  2EQS A;  4U07 A;  1KRS A;  3U4Z A;  4A3C H;  4DKA C;  3L7Z C;  4AIM A;  2ALY B;  5FLM H;  2JA8 G;  2PNH A;  3CXC A;  2ZJR A;  4DV1 Q;  2KEN A;  4JYA L;  4OON A;  1IBM Q;  1B8A A;  1J6Q A;  1WJJ A;  2CWP A;  4JI2 Q;  3U4V A;  3CPF A;  4BBR G;  3PIP A;  3PV0 A;  4YWK A;  4OWX B;  3S1R H;  4A3G H;  4BBS G;  4PZ8 A;  3F2B A;  2UU9 L;  4JI4 Q;  1SMX A;  3CQZ H;  4A3B G;  3K7U C;  2Z6K A;  4A3G G;  3I4M H;  1HNZ L;  4LF4 Q;  1P8L A;  1L2F A;  1X65 A;  4AYB G;  4JYA Q;  2VZA A;  1A63 A;  4U04 A;  4AH6 A;  4JI8 L;  1EQQ A;  4P72 A;  1PHJ A;  2YTX A;  2VUM H;  1NJI C;  3I4M G;  1N36 Q;  5BR8 L;  1YNX A;  4PG3 A;  4JI1 Q;  3J81 i;  3CF5 A;  4GKK L;  1E24 A;  1BBW A;  5JFZ A;  2K5N A;  1VCI A;  1V9P A;  2AKW B;  1VQ8 A;  1N32 Q;  5IYD G;  3N3U A;  1RL2 A;  1QUQ B;  5FJ8 G;  1FJG L;  4YY3 Q;  3OTO Q;  2ID0 A;  4DR7 Q;  1FVI A;  1L0W A;  4BY7 G;  2ZM6 Q;  5IE8 A;  1OXT A;  1GM5 A;  2R6G A;  1SE8 A;  4A3D G;  1B7Y B;  4BXX H;  3CCJ A;  3SN9 A;  3JAM i;  2CCZ A;  4JCV E;  1PH3 A;  3CCQ A;  4DV6 Q;  3H3V I;  4DR4 L;  3JC6 6;  1WCM G;  5H1S E;  4IJH A;  1NTG A;  3EN2 A;  3TRE A;  3W1G A;  1Q46 A;  4DR2 Q;  3HFZ B;  1SFO H;  4LF5 L;  1XNQ L;  2K5V A;  4A3D H;  3OW2 A;  4QQB X;  2B3G A;  3WWV A;  1D8L A;  1YBY A;  1X3G A;  4WGJ A;  4RG1 A;  3OTO L;  2NVQ H;  4JI5 Q;  2RCN A;  1SN8 A;  2JJQ A;  4GKJ L;  4GNX C;  2YTY A;  1HR0 L;  2B63 H;  3S1Q H;  3PO3 H;  4B3M L;  1PH5 A;  2K5H A;  4DV2 Q;  1TWF H;  3UE1 A;  5C44 G;  2JA7 H;  1W3S A;  1JE5 A;  4APV A;  2UUB Q;  4IPH A;  4GOP C;  2ZTE A;  4H02 A;  2IT1 A;  4GOP B;  1I94 L;  2UXB Q;  3E9H A;  1X9N A;  3T1H L;  4LF9 Q;  2QA4 A;  4HJ9 A;  4HJ7 A;  3HOU G;  2YYZ A;  2I5H A;  2QGQ A;  4NXM L;  2H5X A;  4UPA A;  3CME A;  2F3I A;  3AYH B;  1Y14 B;  3HOY H;  3H15 A;  2N3S A;  3ICE A;  1EUJ A;  2YU9 H;  2UUB L;  2ZJQ A;  3CCE A;  5C3E G;  4JI7 Q;  2NN6 G;  3LET A;  2JA6 G;  4K0K L;  2PI2 E;  5C0X G;  3UDG A;  3FHW A;  1VQE A;  4YWM A;  1FL0 A;  4GOP A;  4X65 L;  3CCU A;  2JEA I;  1KXL A;  1K8A C;  1HR0 Q;  2VQE L;  3CP0 A;  4JOI C;  2BA0 A;  4UP8 A;  2RF4 A;  4JI3 Q;  3RZO H;  2VNU D;  1WYD A;  4BBS H;  1UE6 A;  5LMN L;  1KC8 C;  1VQA A;  3KOJ A;  1S40 A;  1VQ5 A;  4GNX A;  3TS2 A;  2I5M X;  4BBR H;  4A93 H;  5HGQ A;  3TS0 A;  4JV5 L;  5JJ6 A;  1J5E L;  3I55 A;  5GAH C;  4LFA Q;  3M85 A;  1UWV A;  4YWL A;  5IP7 G;  3G71 A;  3CMA A;  3ZC7 A;  1VQN A;  1Q7Y C;  3PO2 G;  3H0G G;  3SE5 A;  4B3R Q;  3GTG H;  5LMU Q;  4AQY Q;  2MFI A;  2WFW A;  1GO3 E;  4FDB A;  4DV6 L;  4AQY L;  1EFW A;  5IWA L;  4QGU A;  1EIY B;  3HOY G;  3S14 H;  5M5X H;  1SR3 A;  4IO9 A;  3RLN A;  4A93 G;  1PFS A;  4PZ6 A;  1J5E Q;  4KHP Q;  4DR7 L;  4U0Z A;  1OXV A;  2VL6 A;  4YY3 L;  2JE6 I;  3S1N H;  2R7D A;  4LF7 Q;  1AH9 A;  2XGT A;  5J3B A;  1UE1 A;  1HH2 P;  1FJG Q;  5LMN Q;  1UEB A;  1OXS C;  1PVO A;  4Y52 H;  1YJW A;  1XNR L;  4C3J H;  4DV4 Q;  1JJC B;  2GN5 A;  4GLX A;  1KAW A;  2OQK A;  4JI1 L;  5JEA J;  4AYB E;  4X65 Q;  3S24 A;  4HIK A;  4OO1 G;  4DV0 Q;  2Z6K C;  2A8V A;  1S3O A;  4IPG A;  4JOI A;  4A3M H;  4IJL A;  2N8N A;  4DAM A;  2EIF A;  2BH2 A;  5C3E H;  2KBN A;  4LF4 L;  4JBM A;  1HNX L;  2PI2 A;  1E1O A;  2R7F A;  3S1M H;  2JA5 G;  4LF9 L;  2NVT H;  4LUZ A;  5K36 G;  5IP9 H;  1TWC H;  1HNX Q;  1ASZ A;  3ZCB A;  1Q8K A;  4POF A;  3J80 i;  1VQB A;  3I4N G;  2UUC L;  1X3F A;  4A3K G;  4A3C G;  2VUM G;  4BXX G;  3GD7 A;  1PH4 A;  2R92 G;  1ASY A;  4B3S Q;  2OCE A;  4HIO A;  5IYC H;  4B3M Q;  2B63 G;  1X55 A;  1L1O A;  2CQO A;  3I4O A;  5AJ3 Q;  3HOX G;  4DV5 L;  1DGS A;  2Z0S A;  1VQ4 A;  2Q2H A;  4DR5 Q;  4DK6 C;  4DV3 L;  3CW2 C;  3NEL A;  3ULL A;  2K14 A;  2IY5 B;  4JI5 L;  1JB7 A;  1XNR Q;  1H95 A;  1CUK A;  1XMQ L;  4IOC A;  4DUY Q;  1XMO Q;  2UXB L;  1LUZ A;  1U5K A;  1I6H H;  2MO0 A;  1Q86 C;  4LF5 Q;  3GTQ H;  2UXC L;  4KHP L;  3KJO A;  4DR2 L;  4DUZ L;  4POG A;  1LTL A;  4DK3 C;  3UDF A;  1IBK L;  2DUD A;  4NB3 A;  1JT8 A;  4DR3 L;  4JI6 Q;  1TWH H;  1S72 A;  3T1Y L;  3OYY A;  3T1Y Q;  4JBK A;  2D62 A;  2JA9 A;  4DR6 L;  3FKI H;  1HNW L;  1U0L A;  1N34 Q;  2HHH L;  4MNO A;  2R92 H;  1K3R A;  4LUV A;  2LSS A;  3BZK A;  3HKZ G;  1N33 L;  2ATW A;  2K50 A;  2UXC Q;  5IYD H;  2FXQ A;  2C35 B;  2G03 A;  4JI0 L;  3TRZ A;  1GKH A;  1A8V A;  1T9H A;  3NEM A;  4PZ7 A;  4NXN L;  3HOU H;  2JA5 H;  5CGL A;  1OXX K;  2GVB A;  4R4Q A;  3BU2 A;  5BR8 Q;  1VQC A;  4DR1 L;  1PH1 A;  1WCM H;  4EX5 A;  1I3Q H;  1KRT A;  5AJ3 L;  2KCM A;  4X6A H;  3CUC A;  4GLV B;  2OTJ A;  4A3I G;  4UY8 C;  2K4K A;  4X2C A;  1PV4 A;  4K0K Q;  3KDF A;  1XPR A;  4XI8 A;  3AFQ A;  4GN5 A;  3M7N A;  4OX9 L;  3H0G H;  3S6A A;  3PF4 A;  1K73 C;  2KHI A;  4KHZ A;  1PH8 A;  3ULJ A;  3TEH B;  2UUA L;  1PH9 A;  3PIO A;  1IL2 A;  4A3B H;  4JI4 L;  3I7F A;  1A0I A;  5GAE C;  1HR0 W;  1PYB A;  1N8R C;  3KJP A;  4LFC Q;  2UXD L;  3G6E A;  3T1H Q;  1CKM A;  4MZ9 A;  3PUW A;  3CPW A;  1E1T A;  5M3F H;  1SRO A;  2K75 A;  4WJ4 A;  3J80 c;  5CKL A;  3F2D A;  3W1B A;  4DR3 Q;  4JI6 L;  5DLQ E;  4QIW E;  2I5L X;  4YHH Q;  4DV7 Q;  1YI2 A;  1HZA A;  3AEV A;  4RMF A;  4DV2 L;  3CD6 A;  3I4N H;  4X2E A;  1YEZ A;  3UDX A;  4LF8 L;  3ER0 A;  3ZJY C;  2GVA A;  1NE3 A;  1HZC A;  4JBW A;  4DUY L;  3VDY A;  1XMO L;  1OTC A;  4L5S A;  1IZ6 A;  3RN5 A;  2Q2U A;  2YV5 A;  2ES2 A;  4C3H H;  4HID A;  1KL9 A;  4KI0 A;  3HOW H;  1E3P A;  3RZD H;  2D0P A;  4R4T A;  1R9T H;  5C4J H;  1CSQ A;  1SRU A;  4R1J A;  2OWO A;  3RN2 A;  2DGY A;  5E7N A;  4X62 L;  4X64 L;  2AWN A;  4R4C A;  1YIJ A;  1Q1E A;  4L5Q A;  4LF8 Q;  1GVP A;  3M3Y H;  5FLX c;  3K7A H;  5ELN A;  4DR4 Q;  5C0X J;  1PH7 A;  4A4I A;  1KD1 C;  5M5W H;  5IY0 A;  1VQH A;  3KFU A;  3U50 C;  3KLW A;  2UUC Q;  1VQK A;  2LXK A;  1Y1V G;  4L5R C;  3F8T A;  3AFP A;  2HT1 A;  1M90 C;  3B6Y A;  1BKB A;  4B3R L;  4A3L H;  1VQ6 A;  1JMC A;  1Z47 A;  3KYH C;  4JG2 A;  2ZM6 L;  1EYG A;  2E2H H;  2UXD Q;  3L2P A;  4J15 A;  3RNU A;  2MQH A;  1YIT A;  1IYJ B;  3S2D H;  4P75 A;  3K0X A;  4PMW A;  4ALP A;  2WAQ E;  2F4V L;  1Q12 A;  2IHF A;  4GKK Q;  3AQQ A;  2HIX A;  4A3F H;  2E5L L;  4JI3 L;  4BY1 H;  4BA1 I;  1PH2 A;  5C44 H;  1XJV A;  3HOZ G;  5JFF A;  2ZJP A;  3L0O A;  4BY7 H;  4OWT B;  4HJ8 A;  3HKS A;  1VS0 A;  4O0A A;  4P71 A;  4ME3 A;  1EQR A;  4A3F G;  1M1K C;  4NXN Q;  1JJG A;  1HNZ Q;  4JI0 Q;  5C0X I;  2A1A A;  5IP9 G;  2XTI A;  1HZ9 A;  2JK8 A;  2ZTC A;  3SGI A;  4Y7N H;  3LGJ A;  1V1Q A;  2HHH Q;  4LW1 A;  3S2H H;  1HNW Q;  1C9O A;  5EAY A;  5M3M G;  4JI2 L;  4MTN A;  4LU4 A;  1MKH A;  1P16 A;  2N78 A;  3M9B A;  5LMU L;  1WFQ A;  3M4P A;  4EQ5 A;  3GTP H;  2OTL A;  1HZB A;  2NZO A;  1AE2 A;  3Q8D A;  1VQ9 A;  3S16 H;  4XTC S;  2VS1 A;  3A74 A;  2ZTD A;  1MJE A;  4UP9 A;  2HQL A;  1I5F A;  3S15 H;  1L1O B;  4GN4 B;  1EWI A;  4IPD A;  3KF6 B;  3PGZ A;  2A19 A;  5IT9 c;  4LF6 Q;  4LFB Q;  4LF6 L;  2V1C C;  4DPG A;  1NBW A;  2IHE A;  1QZH A;  4OXP A;  1XPO A;  3HOV H;  2VQE Q;  4DV3 Q;  3MXN B;  1LYL A;  1VQP A;  4TQU S;  1KIX A;  1E7Z A;  3CC2 A;  2CWA A;  4C3I H;  4DV5 Q;  3GTL H;  1O7I A;  5ELO A;  1K9M C;  1WI5 A;  1LM0 A;  1K8G A;  3M4O H;  1PH6 A;  2NVX H;  4LUO A;  3UDI A;  4NPS A;  2E2J H;  4U0U A;  2D0O A;  3KF6 A;  1E22 A;  3FKI G;  3PSI A;  3RR5 A;  3DLL A;  4GS3 A;  1VQ7 A;  4B3T Q;  4IFD I;  3JAM c;  1Q82 C;  2EXD A;  1YJ9 A;  4BY1 G;  3GTJ H;  1I50 H;  3D31 A;  2R7Z H;  3EIV A;  5GAG C;  5C4X G;  1TWG H;  3J7Z C;  2WB1 G;  1CKN B;  1GD7 A;  3CCV A;  3ERS X;  3ULP A;  1A62 A;  1W2B A;  3GTM H;  3PUX A;  3PF5 A;  4X66 L;  4TVA B;  5JJL A;  1PYS B;  1YVC A;  2NZH A;  1YZ6 A;  1N9W A;  1VQJ A;  1CSP A;  1UE7 A;  5JEA G;  2CFM A;  4OWW B;  1IXR A;  2R7Z G;  2HIV A;  3PCO B;  5FLM G;  4A3M G;  3W5O A;  3H3V H;  5HY6 A;  4X2D A;  4YCU A;  2R93 H;  4QL5 A;  3UE0 A;  3G48 A;  4YCW A;  2IX0 A;  4O2D A;  4ITR A;  1XTD A;  2R93 G;  1C0A A;  2AWO A;  4JI8 Q;  1IBL Q;  2E5L Q;  1NY4 A;  1X6O A;  2Y0S G;  1QVG A;  4C2M H;  4LWC A;  2F4V Q;  3DM3 A;  2BA1 A;  4A3J G;  4P73 A;  2PMZ E;  4R4I A;  4XIG S;  1XNQ Q;  5C4X H;  3STB D;  4L5T A;  1N33 Q;  3CAM A;  3HOX H;  3EBE A;  3GTK H;  3J7A 5;  5IYB G;  1VQI A;  3F1Z A;  1QUQ A;  5IWA Q;  1C7Y A;  3K81 C;  4A3I H;  1V43 A;  3BZC A;  5M3M H;  4QJF A;  3G4S A;  1TWA H;  4N67 A;  3RLO A;  4DV1 L;  4IOA A;  2K52 A;  2PQA A;  1YHQ A;  4DNI A;  1VQG A;  5GQO A;  4HJ5 A;  4U0S A;  3BJU A;  4X64 Q;  5IYB H;  1QVC A;  1AE3 A;  1K83 H;  2VQF Q;  2F6S A;  1MJC A;  2JQO A;  1KQS A;  2I0Q A;  3A0J A;  3ZLM A;  2B29 A;  2VW9 A;  5JJ7 A;  1YHA A;  3RLF A;  1QVF A;  1NMG A;  4JV5 Q;  4KLK A;  3J81 c;  2VQF L;  4HIM A;  3I56 A;  1N36 L;  1X56 A;  5IYC G;  3CC7 A;  2WAQ G;  4DR5 L;  3SHG A;  3I2Z A; 
#chains in the Genus database with same CATH topology
 5JJI A;  1U4M A;  2O4X A;  4A3I B;  1Z7T A;  4IUU A;  2JA6 H;  2I46 A;  1D7Q A;  3BS1 A;  2BDN A;  3SXH A;  2NYZ D;  2VY3 A;  1FYC A;  4U68 A;  1SYF A;  1PTO C;  2PZU A;  4FXG C;  4HN7 A;  1SSO A;  2AMC B;  3P7J A;  1X54 A;  2WP8 J;  3FP9 A;  1D5X C;  2JA7 G;  2Y0S E;  4H0L C;  4DV0 L;  1UE5 A;  1LT4 D;  2K5Q A;  1STH A;  1EWH A;  2JXM B;  4MN3 A;  1PZI D;  4RAU C;  3AU7 A;  4ZQ3 A;  3WOF A;  2E2H B;  4X66 Q;  1MIU A;  1Y8O B;  2HUG A;  1QE6 A;  3T53 B;  4LNQ A;  3K5L A;  4LF7 L;  4KMU C;  1XXG A;  4QY7 A;  3TP5 A;  1CKO A;  1WTO A;  4A3G B;  1TQO A;  1EY5 A;  3M4Y A;  4UP7 A;  1TXY A;  1N34 L;  4JBJ A;  4RGM A;  5M5Y H;  3NPP A;  2O5I C;  2LKV A;  4A3K H;  2ZT9 C;  2BH8 A;  3SK8 A;  4DUZ Q;  2IL8 A;  1JJ2 A;  1PA6 A;  4TKO B;  2MHV A;  2QEX A;  3RZO B;  4ZKC B;  4JC0 A;  4RGT A;  1SLJ A;  4U67 3;  4PMB A;  4C3H B;  3PUV A;  5D3I B;  3NBH B;  2CW0 D;  1GUT A;  5CV9 A;  1B3Q A;  5DM7 3;  4AIM A;  1B53 A;  5FLM H;  4K8I A;  3H09 A;  2ZJR A;  3H3V C;  3KLR A;  2L12 A;  4DV1 Q;  4FF1 A;  4JYA L;  2ICE C;  1J6Q A;  4JI2 Q;  4A3J B;  4GZY C;  2B2W C;  4A3G G;  4LF4 Q;  1L0X B;  4JYA Q;  1D1K A;  2KUM A;  4JI8 L;  1JOQ A;  2YTX A;  2VUM H;  1NJI C;  3OIP A;  3I4M G;  1GUS A;  3TZU A;  5BR8 L;  4PG3 A;  1KLU D;  1BBW A;  1V9P A;  3N3U A;  3TBI B;  1TU2 B;  1FJG L;  2ID0 A;  1F9Q A;  4C3H G;  1NCV A;  2JYO A;  3I4N B;  4FF2 A;  1TY0 A;  4BXX H;  1RF2 D;  2CCZ A;  3K5O A;  1JOK A;  4NMZ A;  3E6Z X;  2NB0 A;  2IX3 A;  1NTG A;  3EN2 A;  3MXG A;  4JV5 Q;  1XNQ L;  4LF5 L;  5FLX E;  3OTO L;  2Z4I A;  3A55 A;  4GNX C;  5FO9 B;  4CHT B;  2EY6 A;  1PLF A;  2RDH A;  3QOL A;  4B3M L;  2N88 A;  2K5H A;  2L1B A;  3P20 A;  3UE1 A;  1JE5 A;  2CH4 W;  2UUB Q;  4GOP C;  4H02 A;  2IT1 A;  3I91 A;  1X9N A;  1HQM C;  4HJ9 A;  1H9K A;  4FO2 A;  3BVG A;  3TDQ A;  4N9P A;  1IKL A;  3CME A;  2F3I A;  1G2S A;  1KAB A;  2N3S A;  5LL6 S;  2YU9 H;  3R93 A;  1V1P A;  2NN6 G;  1GXD C;  2JEA I;  3S17 B;  1SYB A;  1HR0 Q;  2VQE L;  3URY A;  4UP8 A;  5IT9 E;  3RZO H;  4JI3 Q;  1SYC A;  4CJ2 C;  1V8Q A;  2MUY A;  1O78 A;  3BYT B;  5HGQ A;  1D2B A;  5JJ6 A;  3I55 A;  4LFA Q;  3CMA A;  1CT1 D;  5EBC A;  5BN5 A;  3H0G G;  3SE5 A;  2B2V C;  1GUG A;  4O42 A;  4AQY Q;  1EFW A;  3S14 H;  3HOY G;  4QGU A;  4K2K A;  3SK5 A;  3IL8 A;  4XYO A;  1ONL A;  4IO9 A;  4Q0F A;  4Q5V A;  3RLN A;  3VA5 A;  5K36 H;  1J5E Q;  4DR7 L;  2KHS A;  4KJO A;  3MEH A;  1ENF A;  2L0C A;  1AH9 A;  2XGT A;  4BBS B;  5IIF A;  1XNR L;  5JVH 3;  4DV4 Q;  4DA2 A;  3S24 A;  4HIK A;  1BBX C;  1KLG D;  1RD9 D;  1C48 A;  4IJL A;  4DAM A;  2EIF A;  2BH2 A;  3HKZ B;  2JA5 G;  2NVT H;  1EFI D;  1HNX Q;  1KDC A;  2LFN A;  3HEJ A;  3X3N A;  2FMC A;  1IW7 D;  1ASY A;  2EYM A;  2OCE A;  2KVM A;  2F0N A;  2E2I B;  1U4R A;  5AJ3 Q;  4DV5 L;  4M8A A;  2Z0S A;  1VQ4 A;  1K3B C;  4DK6 C;  5IGG A;  1RDP D;  4DXG A;  5JJZ A;  1QCB D;  4MTK A;  2NBF A;  3HGB A;  2UXB L;  1U5K A;  3IFT A;  1IW7 C;  4KHP L;  4X3K A;  4DR2 L;  1LTL A;  1DON A;  3MVV A;  4ZLT F;  1TS5 A;  4DNT B;  1S72 A;  2PNR C;  5T1I A;  4DR6 L;  2A5H A;  1HNW L;  3I4L A;  2HHH L;  4MNO A;  3HKZ G;  1N33 L;  2FXQ A;  4H13 C;  1A8V A;  5EKI A;  4NXN L;  1ESF A;  3KF8 A;  2JA5 H;  3SVM A;  2PQE A;  3BU2 A;  1PH1 A;  3OWE B;  1K28 A;  4KV6 A;  5AJ3 L;  2KCM A;  4GLV B;  2WII B;  3MZ5 A;  3VYS A;  1XPR A;  4OX9 L;  3H0G H;  2WAQ B;  4KHZ A;  2E75 C;  3ULJ A;  2UUA L;  3NQI A;  3TSS A;  4X3S A;  4JI4 L;  5CR3 A;  1A0I A;  1N8R C;  4LFC Q;  4HR7 B;  3QWN A;  4S3S A;  1I4P A;  5M3F H;  3GTG B;  4K6D A;  4WJ4 A;  2F0K A;  3HOZ B;  2BDO A;  2Z8L A;  5J1Z A;  4QIW E;  4YHH Q;  4DV7 Q;  4RMF A;  3A8K E;  1UUP A;  4ODG A;  4RH6 A;  3ER0 A;  4LF8 L;  3QJY A;  3SDZ A;  1LTR D;  4DUY L;  1NE3 A;  3VDY A;  1IZ6 A;  1EOT A;  4IUT A;  3HOW H;  3RZD H;  3AMU A;  3NBI A;  1SRU A;  1K0S A;  2DGY A;  3VR3 A;  1YIJ A;  4L5Q A;  5M3M B;  1GVP A;  4LF8 Q;  1KD1 C;  5M5W H;  5IY0 A;  1E2Z A;  1EYA A;  1VQK A;  4HED A;  2X6G A;  1BCP F;  3AFP A;  3H94 A;  3MAQ A;  4A3L H;  1JMC A;  1SDF A;  4CDD C;  1SE4 A;  3RNU A;  4PNY A;  1ROD A;  5C4H A;  3K0X A;  2F4V L;  2EJG C;  2TMP A;  1Y1W B;  4A93 B;  2K5D A;  1CI3 M;  1H9S A;  2IHF A;  4GKK Q;  4G7O C;  1AN8 A;  4A3F H;  4JI3 L;  4BY1 H;  5C44 H;  1XJV A;  3C46 A;  2JA8 B;  2ZJP A;  1VS0 A;  4P71 A;  5JVG 3;  1LT3 D;  4ABN A;  1DOK A;  4NXN Q;  1EY6 A;  4PV1 C;  4JI0 Q;  4KY6 A;  5IP9 G;  5C0X I;  2XTI A;  1HZ9 A;  2FIN B;  1Q90 A;  3LGJ A;  1V1Q A;  4LW1 A;  3S2H H;  4QCL A;  4ME5 A;  1XWE A;  4BBR B;  2N78 A;  1LT6 D;  1GJX A;  1S5D D;  4EQ5 A;  4NP5 A;  3BDC A;  3GTP H;  4IQZ A;  3SK4 A;  2NZO A;  1AE2 A;  4V19 0;  1VQ9 A;  1DOL A;  2ZTD A;  2HQL A;  1PRT B;  4GN4 B;  5IT9 c;  3KF6 B;  3PGZ A;  4DPG A;  2IHE A;  1VQP A;  3MXN B;  1E7Z A;  1STA A;  2CWA A;  4C3I H;  3K0Y A;  4DV5 Q;  1WI5 A;  3M4O H;  3QIA A;  1PH6 A;  2NVX H;  3UDI A;  4KKU A;  4CBV A;  4CJ0 B;  4GS3 A;  3D6C A;  3G6J B;  1ZEQ X;  2XVS A;  5E4X A;  1X3Q A;  1I50 H;  2R7Z H;  3EIV A;  2PO4 A;  1HXY D;  3H0G B;  2R92 B;  4A3E B;  1ICW A;  1YNJ D;  1CKN B;  3BG3 A;  3ERS X;  3CCV A;  3I72 A;  2B2U A;  1B2T A;  5JPM C;  2F0V A;  5IGC A;  1CSP A;  5C4X B;  1IXR A;  3S1Q B;  2HIV A;  3PCO B;  5FLM G;  4LAA A;  4QB4 A;  3G48 A;  4YCW A;  3J81 E;  5D14 A;  2RDF A;  2AWO A;  4JI8 Q;  4FF3 A;  4HAE A;  1X6O A;  2Y0S G;  2XNA C;  1PFB A;  2PZT A;  4LWC A;  3MHB A;  2X6L A;  2KEE A;  4XIG S;  2Z1C A;  3J7A 5;  1VQI A;  4BWG B;  3PQI A;  1EEF D;  3BZC A;  4TSS A;  3RLO A;  2K52 A;  5LL6 X;  2EYO A;  3OIQ A;  3EVQ A;  2HD3 A;  1SE3 A;  1AE3 A;  1X3P A;  3W3A A;  2I0Q A;  4DAY A;  2K01 A;  4B3T Q;  3I56 A;  1JC7 A;  4DR5 L;  1WTQ A;  2CQA A;  1MD2 D;  1NR2 A;  3HG9 A;  4YHH L;  3KUP A;  4DV7 L;  2D2C C;  4B3S L;  1EYC A;  4DAY B;  3CC4 A;  3PO3 G;  2DNC A;  4KKS A;  5JJK A;  4IFD G;  3OPO A;  2F52 A;  4NXM Q;  2UU9 Q;  1VQF A;  4HJA A;  1HPC A;  1SE2 A;  1EOV A;  1G29 1;  4V0B A;  3NEN A;  4DN4 M;  4A75 A;  4M16 A;  2IJ0 A;  5EJW A;  3NQT A;  1NH1 A;  4OX9 Q;  1PFN A;  1IBL L;  2YTV A;  3I8Z A;  1AZP A;  2ICI A;  2RHS B;  2RA4 A;  5EKL A;  5E1F A;  1EYD A;  2F0W A;  1Y1V H;  1KTK A;  3A5U A;  2N49 A;  1EU3 A;  4DR1 Q;  4JVZ A;  4P74 A;  4AYB B;  1VQM A;  5GRO A;  3TQY A;  4DV4 L;  5CMT A;  4HMJ A;  1A3V A;  4QUC A;  4KD4 A;  3K5M A;  3I4M B;  4IPC A;  2NN6 I;  1B44 D;  4R8I A;  4DR6 Q;  2MGS A;  3F2C A;  5LHY 1;  5M5W B;  1EZ8 A;  1Z9F A;  2JA6 B;  1Y1W G;  1IBK Q;  4ULL A;  3MC0 B;  3A8J E;  4LFA L;  3T51 B;  3U58 A;  2C5C A;  3GO5 A;  3R2T A;  5M3F G;  5CV4 A;  2KCN A;  3IRB A;  2WB1 B;  3PUY A;  4YCV A;  1PRT C;  2RVL A;  5KYI A;  1B70 B;  1RIP A;  3S9W A;  5ISR A;  4A76 A;  3K80 C;  1KHI A;  4IUP A;  3MEF A;  1MSG A;  3M4Q A;  1SEB D;  1FGU A;  4B08 A;  5HUR A;  4K14 A;  3L7Z C;  4QIW B;  3SEB A;  2PNH A;  3CXC A;  1ZYR D;  1IBM Q;  2VB2 X;  4BBR G;  3CPF A;  3FMC A;  3PV0 A;  3IFD A;  3S1R H;  2SDF A;  3CQZ H;  4A3B G;  1HNZ L;  1L2F A;  1X65 A;  3A7L A;  2WIN B;  5C44 B;  1B3A A;  4ILW A;  1EQT A;  1SMY D;  2QCP X;  1N36 Q;  1EY0 A;  2O2L D;  4A3D B;  2DJF C;  3SE0 A;  1E24 A;  5JFZ A;  2B2Y A;  1LAC A;  1LTB D;  1RL2 A;  5KIX A;  5G3L F;  3D8G A;  4YY3 Q;  3OTO Q;  1FVI A;  3LNN A;  4EQO A;  2ZM6 Q;  1OXT A;  4A3D G;  2EYL A;  4JCV E;  3OMC A;  1JOO A;  1PH3 A;  1HCZ A;  4UAI A;  1CQF A;  1LTT D;  1KC8 C;  1WCM G;  1EL0 A;  1A2U A;  1I50 B;  3HFZ B;  2R7Z B;  3WWV A;  1YBY A;  2KED A;  4WGJ A;  1E2W A;  1OO9 B;  4KY7 A;  4JI5 Q;  4F88 A;  1V1P B;  4OGQ C;  1WCM B;  2OT2 A;  1SN8 A;  2JJQ A;  5C0X H;  3S1Q H;  1RTN A;  2P5Z X;  4DV2 Q;  1TWF H;  1EQV A;  3TP7 A;  1QIL A;  1W3S A;  5I6W A;  4APV A;  1AP0 A;  4IPH A;  1S5C D;  1WD1 A;  5C3E B;  3T1H L;  4LF9 Q;  1F2L A;  2OXP A;  4UPA A;  4C2M B;  5JPN C;  3AYH B;  3VR6 A;  1PFM A;  1Y14 B;  5CMD A;  1EY4 A;  3ICE A;  1EUJ A;  4DNR B;  3CCE A;  5C3E G;  2F0P A;  3U9S A;  4B9W A;  4K0K L;  2PI2 E;  4GOP A;  4YWM A;  1KXL A;  1S5E D;  2A68 C;  2BA0 A;  2RF4 A;  4NDX A;  3MFY A;  3S1N B;  1JB3 A;  2A6H D;  3KOJ A;  4IAL A;  3T13 A;  1HQR D;  4GNX A;  2I5M X;  4BBR H;  1GUN A;  1FNV A;  2L5T A;  4JV5 L;  1WTW A;  4BY1 B;  5GAH C;  4YWL A;  5IP7 G;  1VQN A;  1HHV A;  5LMU Q;  1JQY D;  2WFW A;  4DV6 L;  1EIY B;  2F3W A;  5M5X H;  1PFS A;  4PZ6 A;  1TKW B;  5FO8 B;  4ZUI A;  4YY3 L;  3S1N H;  1LLR D;  5J22 A;  1HH2 P;  2XWB B;  2OQK A;  4JI1 L;  5JEA J;  3A54 A;  4OO1 G;  1PZK D;  1Y1V B;  2Z6K C;  1JWU D;  3W2D A;  4A3M H;  4CKB A;  4O1N A;  2N8N A;  2F0T A;  4C3J G;  2XWJ B;  3N6R A;  1O7L A;  2BCO A;  2KQ3 A;  1WD0 A;  1CZW A;  2KBN A;  4JBM A;  3SR1 A;  4XQN A;  1E1O A;  4DU9 A;  3HRZ C;  3JAM L;  4LF9 L;  4LUZ A;  5K36 G;  3V2T A;  3ZCB A;  4POF A;  5M3F B;  3I4N G;  1Q3L A;  2HQE A;  1X3F A;  4EQP A;  4A3K G;  1SBB B;  4A3C G;  2NWG A;  3GD7 A;  3C1E A;  4NKL A;  4B3S Q;  2F0J A;  4FYD A;  1KAA A;  2A73 B;  4R8N A;  1BQQ T;  4RKL A;  5COR A;  2AUK A;  3C1F A;  1ILQ A;  3N52 A;  2Q2H A;  5D65 A;  1TS3 A;  4DR5 Q;  4DV3 L;  1C4Q A;  1EZ6 A;  2Q8I B;  3ULL A;  1ZXT A;  2IY5 B;  3NE5 B;  2HCC A;  1H95 A;  1PTO H;  1XMO Q;  3HOY B;  1LT5 D;  3HZX A;  2MO0 A;  2LY7 A;  3UDF A;  4OO1 H;  4DR3 L;  4L6T B;  4JI6 Q;  1EWC A;  1KNE A;  1H9J A;  2O5J C;  3OYY A;  4RKB A;  3DWP A;  1U0L A;  4KTA A;  4LUV A;  5IYD H;  2PMZ B;  2H1E A;  2NUD A;  1GKH A;  4A3B B;  1T9H A;  1J9O A;  1II3 A;  4PZ7 A;  2EYP A;  2BE5 D;  2E2J B;  4DR1 L;  3HOW B;  4EX5 A;  1I3Q H;  5DEH A;  1KRT A;  4UY8 C;  4FVM A;  2K4K A;  4ZCK A;  2B2Y C;  4XI8 A;  3AFQ A;  3DWA A;  4FXK C;  1PMR A;  1MGS A;  3PF4 A;  3S1R B;  3TEH B;  3O13 A;  4HMI A;  5ELE A;  1EY8 A;  1CKM A;  1I4G A;  3PUW A;  1ILP A;  1SNO A;  2K75 A;  5CKL A;  1EEI D;  3F2D A;  3W1B A;  2FHT A;  1F9P A;  1B50 A;  3I4N H;  2JN4 A;  3AEV A;  1HZA A;  3CD6 A;  2EDG A;  4F7X A;  1ET6 A;  3J7A V;  2HDM A;  2R3Z A;  1FD7 D;  5KRU A;  1XMO L;  3S15 B;  1SND A;  1OTC A;  4KD3 A;  1B1Z A;  2ES2 A;  3P1H A;  4C3H H;  2OF1 A;  2E76 C;  2D0P A;  4R4T A;  1R9T H;  3RN2 A;  3DXJ C;  4X62 L;  4R4C A;  3M3Y H;  3IAY A;  1HUN A;  2ENB A;  3K7A H;  4DR4 Q;  4DAV A;  1PH7 A;  5M5Y B;  3KFU A;  1BOS A;  3TN2 A;  3KLW A;  2LXK A;  2IW3 A;  3F8T A;  3TZD A;  2HT1 A;  1NSN S;  3P75 A;  3OWF A;  4B3R L;  3K59 A;  3KLS A;  2UXD Q;  3L2P A;  1PTO B;  2NTT A;  3S2D H;  1VF7 A;  3NTH A;  1V1O A;  1TVX A;  4OIJ A;  3AQQ A;  4BA1 I;  1PH2 A;  2VUM B;  2AUJ D;  2XSC A;  2H4O A;  3L0O A;  3VR2 A;  4BY7 H;  3PO3 B;  3HKS A;  4O0A A;  4DXF A;  1EQR A;  1M1K C;  5JAV A;  1JJG A;  1HFG A;  2G9D A;  2EE1 A;  2A1A A;  2A6E D;  3SGI A;  4ZRZ A;  2NVT B;  4XT1 B;  2F0S A;  1C9O A;  3FPP A;  3KLS X;  4LU4 A;  5I9P A;  5LMU L;  1CHQ D;  1WFQ A;  2Q8R E;  3CKI B;  3NK9 A;  1HTL D;  2OTL A;  1DD2 A;  1VDZ A;  2EXZ A;  2VS1 A;  2EPB A;  5ELC A;  1MJE A;  1DXM A;  1H9R A;  1EWI A;  5C6A A;  2RCF A;  3TME A;  4LF6 L;  2V1C C;  3RZD B;  1XPO A;  3R2I A;  3CC2 A;  3V96 A;  1KIX A;  3GTL H;  1WVL A;  1K9M C;  1RJT A;  1IL8 A;  4CDE C;  1LM0 A;  1RCV D;  2JP1 A;  1DYQ A;  2D0O A;  3PSI A;  3K6O A;  3FKI G;  3DLL A;  1VQ7 A;  1E2V A;  1U4P A;  2V4D A;  3JAM c;  2WKD A;  4BY1 G;  5J39 A;  1YNN D;  1X32 A;  5GAG C;  1MBY A;  3Q0A A;  1TWG H;  3J7Z C;  1W2B A;  3PUX A;  4TVA B;  5JJL A;  1PYS B;  5E4W C;  1BNZ A;  4OWW B;  3QG1 A;  1HRJ A;  3H3V H;  4QUF A;  2WV6 D;  4YCU A;  2R93 H;  2F0H A;  2NTS A;  4RHS A;  2IX0 A;  4ITR A;  2F0L A;  1C0A A;  1JWS D;  1SYD A;  1PRT D;  4C2M H;  1D5M C;  2PMZ E;  1UAP A;  2DJG C;  3STB D;  3GTM B;  1N33 Q;  2E74 C;  3SHL A;  4IUQ A;  5IYB G;  1TWC B;  3BDO A;  3F1Z A;  4HCS A;  5M9O A;  1QUQ A;  5IWA Q;  2NVX B;  1I6H B;  4A3I H;  3DUZ A;  4DV1 L;  2QW7 A;  1IYV A;  4WJW A;  3EFX D;  3QO2 A;  2LMC B;  2VQF Q;  2F6S A;  1CK1 A;  1MJC A;  3A0J A;  3ZLM A;  1NR4 A;  3Q22 A;  3J81 c;  1UNS A;  4HIM A;  1N36 L;  2L55 A;  3C3L A;  1JT8 A;  3I2Z A;  1EIF A;  4CGY B;  3HOZ H;  2E2I H;  1F9R A;  4JI7 L;  3Q23 A;  4R4O A;  1VF5 C;  1OXU A;  5D3D A;  2NVY H;  5IOC A;  2ZXP A;  1QZG A;  4LFC L;  4A3E H;  1F2M A;  1WOC A;  4XYQ A;  3CCS A;  3BVM A;  3NBH A;  1VQL A;  2UUA Q;  2PPB C;  1X3E A;  3GQB A;  2F0O A;  5FO7 B;  5EU0 A;  1QNU A;  1A2T A;  4A3L G;  1ENC A;  2Q2T A;  2L15 A;  3NXW A;  3GTO H;  2KHJ A;  3PO2 H;  1KDA A;  1QWY A;  4RHR A;  4GKJ Q;  4OO1 I;  2ASB A;  3HOW G;  1M4V A;  4FXD A;  1UEA B;  5FJ8 H;  2EYH A;  4WRD A;  2A69 C;  2Q2I A;  2JA5 B;  1MI2 A;  2KCT A;  1F2Y A;  2F3V A;  3K7A B;  1BCP C;  2OQ0 A;  3A5Z B;  2E8G A;  4GNX B;  1CKN A;  2A74 C;  4DK0 A;  1K0R A;  1A3U A;  2FMM A;  3RMH A;  3STB C;  2JEB I;  1E0B A;  4ZK9 B;  1K8M A;  3E0E A;  4X62 Q;  2J4X A;  4K6L A;  1XMQ Q;  3ERQ A;  4A3E G;  1L1O C;  5TSS A;  1N32 L;  1G6P A;  3HKZ E;  4IUR A;  2WKC A;  1BBU A;  2LXJ A;  2F0D A;  3CHB D;  4WJ3 M;  1Q1B A;  4GLA C;  4XXE A;  3H6M A;  4EQN A;  1R9T B;  5JOB A;  3VYT A;  1SYE A;  4DKA C;  2ALY B;  2M9V A;  1NAP A;  2CWP A;  5I6Y A;  5COY A;  1QG7 A;  4PZ8 A;  5BN4 A;  2B2T C;  1JE4 A;  4JI4 Q;  1SMX A;  2K03 A;  1ZYR C;  3K7U C;  1B9M A;  3I4M H;  1P8L A;  4AYB G;  1A63 A;  4AH6 A;  2A69 D;  3DEO A;  1EQQ A;  4P72 A;  1TS4 A;  1PHJ A;  1TWF B;  4RWS C;  1O7Y A;  1YNX A;  2JSO A;  4JI1 Q;  3CF5 A;  4NW2 A;  2K5N A;  3NTI A;  5FJ8 G;  4Z9C B;  4DR7 Q;  5NUC A;  4BY7 G;  1JWM D;  2B2V A;  3GV6 A;  3NP8 A;  1GUW A;  1GM5 A;  1JCK B;  1SE8 A;  2R6G A;  3E0J A;  2RSO A;  3JAM i;  4RCO A;  1WTV A;  3FKI B;  3G7L A;  5I4D A;  3CCQ A;  4DV6 Q;  1W6K A;  1G8Z D;  2F1M A;  4DR4 L;  3JC6 6;  4XQJ A;  4A93 G;  4IJH A;  3ONA B;  4DK1 A;  1Q46 A;  3J7A F;  2L11 A;  2K5V A;  4QQB X;  4Y7N B;  1X3G A;  4RG1 A;  1GHK A;  2NVQ H;  2RCN A;  3CRK C;  3A7A B;  2YTY A;  2B63 H;  5EBD A;  5CV8 A;  1SNP A;  2HCI A;  2G5D A;  4YIJ A;  1EY9 A;  2QDL A;  5EPJ A;  1CHP D;  4X3T A;  2ZTE A;  4GOP B;  1I94 L;  3E9H A;  2E2D C;  1TWG B;  2QA4 A;  1FR3 A;  2PCF B;  5I2X A;  2QGQ A;  3MWY W;  2K1B A;  4XT3 B;  1PZJ D;  1D1I A;  1U4L A;  2XN9 C;  4IFD H;  2UUB L;  4UHV A;  3T56 B;  4JI7 Q;  2PZW A;  2JA6 G;  5C0X G;  3FHW A;  1FL0 A;  2PW7 A;  3FEW X;  3CP0 A;  2EYF A;  1WYD A;  4N8X 1;  4BBS H;  1HFN A;  1S40 A;  5IOD A;  2KOL A;  5BN3 A;  1DOM A;  3LWE A;  3A56 A;  2LS0 1;  1J5E L;  3S2H B;  4KN7 C;  1UWV A;  3M85 A;  3G71 A;  3ZC7 A;  2NUC A;  3GTG H;  3D4R A;  2MFI A;  1QOH A;  4AQY L;  5IWA L;  2QIL A;  2EJM A;  1SR3 A;  3HS0 C;  4XQQ A;  1OXV A;  4JW0 A;  2DN8 A;  2JE6 I;  5FK9 C;  1I6V C;  2R7D A;  4LF7 Q;  5C4J B;  1UE1 A;  5C3W A;  2RBM A;  2SEB D;  5E3F A;  3I73 A;  1YJW A;  4QF4 A;  2GN5 A;  4GLX A;  4AYB E;  2EVB A;  3MA2 B;  4DV0 Q;  2VB3 X;  1LTA D;  2B2W A;  2A8V A;  1S3O A;  4IPG A;  5ELF A;  3FDT A;  2Z4H A;  2TSS A;  1K83 B;  5KEE A;  5C3E H;  2PI2 A;  4JPB W;  3WDN A;  1T5E A;  5IP9 H;  4LJZ C;  1Q8K A;  1VQB A;  1JOR A;  1RTO A;  2VUM G;  1TWH B;  1PH4 A;  1IHZ A;  4C1N K;  2R92 G;  5JEA H;  4B3M Q;  2B63 G;  1X55 A;  1L1O A;  4CDF C;  3EQL C;  5DM6 3;  3CW2 C;  2XRS D;  4JI5 L;  4DUY Q;  2XIW A;  2B63 B;  1I6H H;  3RUZ A;  4LF5 Q;  3D3R A;  2UXC L;  1B4O A;  2K6A A;  4DUZ L;  5F2D A;  1NNX A;  2Y0S B;  1STY A;  3DHQ A;  2DUD A;  1IBK L;  1TWH H;  5ELD A;  3T1Y L;  3T1Y Q;  4OHJ A;  3ND9 A;  4J1M A;  2A6E C;  3BZK A;  2K50 A;  2UXC Q;  2CH4 A;  2G03 A;  3NSW A;  4MHE A;  3NEM A;  3HOU H;  3DMU A;  5CGL A;  4KY5 A;  1OXX K;  5BR8 Q;  1VQC A;  1BCP B;  1WCM H;  3E5S A;  3PIP 3;  4X6A H;  1ESR A;  2XRQ D;  1LTI D;  3KDF A;  4K0K Q;  1K73 C;  2X69 A;  2KHI A;  4A3B H;  4L8J A;  1R4Q B;  3PIO A;  3PMF A;  1PH9 A;  3NWS A;  3NUC A;  3OSO A;  1IL2 A;  5GAE C;  3HP3 A;  3KBX A;  4I65 A;  4MZ9 A;  3G6E A;  1E1T A;  1IYU A;  2F0E A;  4J8Q A;  4DR3 Q;  5FLX L;  3MXN A;  4JI6 L;  1R4P B;  2I5L X;  3K58 A;  2F0F A;  4DV2 L;  1BF4 A;  4X2E A;  2R61 A;  1TY2 A;  2NUN A;  3LWU A;  3UDX A;  4DFA A;  2RSN A;  2GVA A;  4JBW A;  1A15 A;  2UXB Q;  1MSH A;  2AQ2 B;  2YV5 A;  2NVQ B;  3BDL A;  4HID A;  1KL9 A;  4KI0 A;  1E3P A;  4E6I A;  4RCN A;  5C4J H;  3K57 A;  4ID6 A;  4R9W A;  5ELN A;  3QB3 A;  3OOC A;  4A4I A;  2EY1 A;  2RDG A;  2F03 A;  1VQH A;  3U50 C;  1LAB A;  1Y1V G;  4L5R C;  1QB5 D;  1TWA B;  1SAP A;  1Z47 A;  2M2L A;  3KYH C;  3QR8 A;  4JG2 A;  1EYG A;  2E2H H;  4J15 A;  2MQH A;  3E3X A;  1IYJ B;  4P75 A;  4FF4 A;  4ALP A;  2WAQ E;  1ML0 D;  5C4Z A;  2HIX A;  1O80 A;  3HOZ G;  2QKI C;  5T1G A;  4WFN 3;  5JFF A;  4G57 A;  2BE5 C;  4OWT B;  5CV5 A;  2F0U A;  1B9N A;  5KND A;  4ME3 A;  1ET9 A;  4A3F G;  1M8A A;  4IZ8 A;  5EQ0 A;  3VYU A;  1RHP A;  5EPK A;  2JK8 A;  4Y7N H;  1LTG D;  4F87 A;  5EAY A;  5CBA E;  5M3M G;  1D5Z C;  4MTN A;  1MKH A;  1P16 A;  2OEO A;  3NWT A;  3VYR A;  5A2Q L;  2RQX A;  4ZKB B;  4C3I G;  3S16 H;  4J6H A;  4UP9 A;  3S15 H;  1I5F A;  4OEM B;  3Q6S A;  4IPD A;  5KGU A;  2A19 A;  3ND8 A;  1QZH A;  1S5B D;  4OXP A;  3T16 A;  1ENA A;  4LFB L;  4TQU S;  4PMC A;  1IKM A;  4RGO S;  4LUO A;  5HGT A;  3VR4 A;  4U0U A;  3KF6 A;  3RR5 A;  4IFD I;  1Q82 C;  2K05 A;  1EY7 A;  1SFO B;  3D31 A;  1VMP A;  1SYG A;  5C4X G;  1I4Q A;  1SJE D;  2K28 A;  3ZYY X;  1EU4 A;  1GD7 A;  4F8M A;  3R8B A;  2NZH A;  1N9W A;  1UE7 A;  2CFM A;  4KHV A;  4RGN A;  2R7Z G;  5IT9 L;  4A3M G;  5HY6 A;  2CW0 C;  2EJF C;  4QL5 A;  4O2D A;  1XTD A;  2R93 G;  3X3M A;  2E5L Q;  1L0Y B;  1NY4 A;  1QVG A;  2F4V Q;  3DM3 A;  2BA1 A;  5L37 A;  5IGE A;  4A3J G;  1XNQ Q;  3MXP A;  5DAU A;  2MPM A;  1C7Y A;  1CQV A;  5CBE E;  1V43 A;  5M3M H;  4QJF A;  3G4S A;  1TWA H;  4N67 A;  1FGB D;  4IOA A;  1VQG A;  5GQO A;  3D6W A;  1K8O A;  4U0S A;  4X64 Q;  1QJO A;  1K83 H;  1KQS A;  1S4Z A;  2B29 A;  1QVF A;  4RA8 A;  3RLF A;  4TRD A;  1SMY C;  3R3O A;  1TII D;  4KLK A;  2VQF L;  4C1N I;  3CC7 A;  2WAQ G;  1WTH A;  2F4I A;  3SHG A;  3GV3 A;  2JA8 H;  4BA2 I;  4N8F A;  3J81 j;  1BVS A;  3KK7 A;  4K8J A;  1Q81 C;  1EIH A;  3CCR A;  1YJN A;  3K8A A;  3JAM E;  4G4K A;  1G51 A;  3DM1 A;  1XTC D;  1VQD A;  4A3K B;  2FFK B;  2PQA B;  3HOV G;  2RHQ B;  3KDF B;  4IFD J;  2KEC A;  4N9T A;  3CCL A;  1I94 Q;  1IBM L;  5C3X A;  3M4O B;  5LMN W;  2AHO B;  4BS9 A;  1I4R A;  1XPU A;  3S17 H;  4CDC C;  4H44 C;  4GN3 B;  2MO1 A;  4PY3 A;  1WTP A;  2KJX A;  3PUZ A;  3D0F A;  1AW7 A;  1GOZ A;  2MNA A;  4RFB A;  5GAD C;  3S2D B;  4A3J H;  3GDE A;  3KF8 B;  2CKZ B;  2AQ1 B;  1SNM A;  1HJP A;  2IX1 A;  5IP7 H;  1FNW A;  4DAP A;  2D9U A;  3E9I A;  3CCM A;  2WB1 E;  1TT2 A;  1BUV T;  1VQO A;  2C9O A;  1Y1W H;  2K32 A;  1I3Q B;  1WTR A;  3GTO B;  1NMF A;  2Q8T A;  4A3F B;  1YHB A;  1ICF B;  2EQS A;  2EZV A;  4U07 A;  1AEX A;  1KRS A;  3QOJ A;  1LV9 A;  3U4Z A;  4A3C H;  2JA8 G;  4L63 B;  2CVR A;  1VMC A;  2KEN A;  4OON A;  1B8A A;  1WJJ A;  3PIP A;  1CA6 A;  3U4V A;  2QEJ C;  5M5X B;  4YWK A;  1KDB A;  4OWX B;  4A3G H;  4BBS G;  4DGZ A;  3F2B A;  2UU9 L;  1EIG A;  2Z6K A;  1MHW C;  4ZYS A;  2VZA A;  4I7Z C;  4U04 A;  1DCZ A;  3K5N A;  2L4N A;  4FP5 D;  2RKS A;  1STB A;  3Q24 A;  3M7G A;  3J81 i;  4GKK L;  3EA6 A;  1VCI A;  4KJN A;  1N32 Q;  2AKW B;  1VQ8 A;  5IYD G;  3CU7 A;  1QUQ B;  3HOU B;  1O7Z A;  1L0W A;  2PW5 A;  1KNA A;  5IE8 A;  1B7Y B;  3CCJ A;  2EYJ A;  3SN9 A;  1QNK A;  3J80 E;  5EGT A;  2B8G A;  3H3V I;  5H1S E;  4DR2 Q;  3TRE A;  3W1G A;  1STN A;  1SFO H;  4A3D H;  2N55 A;  3OW2 A;  2B3G A;  5ELB A;  1D8L A;  2L9H A;  1DJR D;  1HA6 A;  4C3I B;  1J8I A;  3F2U A;  4WOR A;  3FRP B;  4GKJ L;  4JK1 C;  4IUV A;  1HR0 L;  3PO3 H;  4FNF A;  1PH5 A;  1BO0 A;  2KCC A;  5C44 G;  2JA7 H;  5FOB B;  3GTP B;  3FPU B;  5IGD A;  1CTM A;  4HJ7 A;  3HOU G;  2YYZ A;  2I5H A;  4NXM L;  2H5X A;  5A35 A;  3V05 A;  3HOY H;  1DZ1 A;  3H15 A;  4K2L A;  3VA7 A;  3GTQ B;  2ZJQ A;  5G3L D;  3LET A;  2HDL A;  1GHJ A;  3UDG A;  1VQE A;  3D4D A;  5K5P A;  4X65 L;  3CCU A;  1NUC A;  1K8A C;  3L9A X;  3PO2 B;  4JOI C;  2F0Q A;  2VNU D;  1UE6 A;  5LMN L;  1VQA A;  5IGF A;  2GA4 B;  1F9S A;  2QF7 A;  1VQ5 A;  3TS2 A;  4A93 H;  3TS0 A;  1XX8 A;  3PO2 G;  2KA7 A;  1Q7Y C;  4B3R Q;  1GO3 E;  4FDB A;  2ZXO A;  1TS2 A;  1SJH D;  4CJ1 B;  3VR5 A;  1HA5 A;  1F77 A;  4KHP Q;  4U0Z A;  2VL6 A;  1SNQ A;  2WAC A;  3OHX C;  5J3B A;  1FJG Q;  2B8F A;  1UEB A;  1OXS C;  5LMN Q;  3HOV B;  1PVO A;  4Y52 H;  3FVQ A;  4C3J H;  1JJC B;  1KAW A;  3CRL C;  1F2Z A;  4X65 Q;  2YU9 B;  1PYW D;  2K5W A;  3GP7 A;  2DY7 A;  4LK1 C;  3NTK A;  4JOI A;  5AFW A;  1D6E C;  2B2T A;  1PTO D;  2SNM A;  5KNC A;  4EVO A;  2F0G A;  3KBG A;  4OL7 A;  4LF4 L;  1CM9 A;  2VXW A;  1G6Z A;  1HNX L;  1AFP A;  2R7F A;  3S1M H;  3MXU A;  4CKE A;  2EY2 A;  1TWC H;  1ASZ A;  2CHB D;  3J80 i;  1AZQ A;  2UUC L;  2EOT A;  4BXX G;  4HIO A;  2NVY B;  5IYC H;  2CQO A;  3I4O A;  3HOX G;  1DGS A;  1CFM A;  3NEL A;  2K14 A;  1DM0 B;  3AB9 A;  1JB7 A;  1XNR Q;  1CUK A;  4K5X A;  4IOC A;  1XMQ L;  1LUZ A;  3MFG A;  3GTQ H;  1Q86 C;  3KJO A;  4POG A;  4DK3 C;  4NB3 A;  2Z9H A;  2F0M A;  3I70 A;  5CGK A;  4JBK A;  2D62 A;  2JA9 A;  1Y8P B;  3FKI H;  1N34 Q;  4P2C B;  2R92 H;  1K3R A;  2ATW A;  2LSS A;  3DWQ A;  3IKJ A;  2C35 B;  4JI0 L;  3SK6 A;  3TRZ A;  4KKT A;  2GVB A;  4R4Q A;  5CV7 A;  3GTL B;  3I90 A;  3CUC A;  2OTJ A;  2B2U C;  4A3I G;  5KYL A;  1JR0 D;  4X2C A;  2NN6 H;  1PV4 A;  5IGB A;  2B39 A;  4GN5 A;  1BXT A;  3M7N A;  2IPK D;  1SXT A;  3S6A A;  3ITP A;  4XDX A;  1PH8 A;  3WOE A;  1LTS D;  2FJ2 A;  3I7F A;  4PQX A;  1HR0 W;  1PYB A;  3OW7 A;  3KJP A;  2UXD L;  3T1H Q;  3CPW A;  1SRO A;  3J80 c;  1BR9 A;  2BOS A;  2PYK A;  5DLQ E;  4A3M B;  1STE A;  4QMG A;  5CC4 A;  1YI2 A;  1A6X A;  1YEZ A;  1RKN A;  2SOB A;  3U9O A;  2R93 B;  4HTH A;  1HUM A;  3ZJY C;  4HSP A;  1HZC A;  1I4H A;  2A68 D;  4L5S A;  3TP6 A;  3RN5 A;  2Q2U A;  3T4A C;  5EKK A;  5CYU A;  1CSQ A;  4R1J A;  2OWO A;  5E7N A;  4X64 L;  2AWN A;  4EGV A;  1Q1E A;  2G9H D;  4H7B A;  5FLX c;  4K5V A;  5C0X J;  1PDQ A;  2UUC Q;  1ZKO A;  1YNJ C;  3S16 B;  1M90 C;  3B6Y A;  1BKB A;  1VQ6 A;  1Y8N B;  2ZM6 L;  1YNN C;  2ZXR A;  3TP8 A;  1YIT A;  5I9O A;  4PMW A;  3H91 A;  1PRT F;  1Q12 A;  5EPL A;  2E5L L;  2A6H C;  3J7Y W;  3NHH A;  4G7H C;  2MP1 A;  4UDU C;  4HJ8 A;  4KK7 A;  4X3U A;  4BY7 B;  2DY8 A;  1Z6H A;  3D4W A;  4ZUJ A;  3LX0 A;  1HNZ Q;  1G91 A;  1FNU A;  1TR5 A;  2ZTC A;  2MJ8 A;  5C5L A;  5A2Q E;  2HHH Q;  5DNF A;  3C2P A;  3BVZ A;  1HNW Q;  4JI2 L;  2K7V A;  3M9B A;  3M4P A;  4C56 C;  2F0I A;  2J7Z A;  1STG A;  4IN3 A;  1HZB A;  3Q8D A;  1JIC A;  2DNE A;  4XTC S;  2SNS A;  3A74 A;  2AQ3 B;  5I2Y A;  2M00 A;  1L1O B;  2I07 B;  2IWH A;  2QDB A;  4LFB Q;  2K33 A;  4LF6 Q;  1NBW A;  1Y69 U;  3HOV H;  3PIO 3;  2VQE Q;  4DV3 Q;  1LYL A;  4ZAI A;  4C3J B;  1O7I A;  4K5W A;  5ELO A;  2J0T D;  2Z6B A;  3ERO A;  1K8G A;  3BZD B;  1W6J A;  4NPS A;  1I4X A;  1XYI A;  2E2J H;  3MTS A;  1E22 A;  3UI2 A;  1T5X D;  2EXD A;  4DF7 A;  1YJ9 A;  5C5M A;  3GTJ H;  1BCP D;  3GTJ B;  3CQZ B;  2K04 A;  2D5D A;  2WB1 G;  4KN4 C;  3ULP A;  3GTM H;  1A62 A;  3PF5 A;  4X66 L;  1SNC A;  3M3Y B;  1YZ6 A;  1YVC A;  3HOX B;  3GTK B;  1VQJ A;  4HCE A;  5JEA G;  5FKA C;  3RD4 A;  3DEP A;  1U9R A;  1PTO F;  4G7Z C;  1GUO A;  1A3T A;  1C8C A;  4I7A A;  1CA5 A;  3W5O A;  4X2D A;  4OIK A;  4CKC A;  4IUN A;  1H9M A;  3UE0 A;  2NZ1 D;  1IBL Q;  1WTX A;  5CV6 A;  1G2T A;  2EY5 A;  3L3O C;  4P73 A;  4B9X A;  1BDO A;  4MIU A;  4R4I A;  5C4X H;  4L5T A;  1H9S B;  3CAM A;  3S1M B;  3HOX H;  3EBE A;  3GTK H;  1CZG A;  1Q8I A;  3EJI A;  3K81 C;  3A8I E;  3J80 L;  3BYY B;  4M1U B;  2JA7 B;  3S14 B;  2PQA A;  4HSV A;  4LMQ D;  1YHQ A;  3OMG A;  4DNI A;  4HJ5 A;  3BJU A;  5IYB H;  1QVC A;  4B3T L;  2JQO A;  2VW9 A;  4OEL B;  5JJ7 A;  1HTP A;  1YHA A;  1NMG A;  5KNB A;  3J81 L;  3I3C A;  1X56 A;  5IYC G;  1S5F D;  1LO5 D;  1PXU A; 
#chains in the Genus database with same CATH homology
 2JA8 H;  4BA2 I;  1EIF A;  5JJI A;  3J81 j;  4YHH L;  1BVS A;  4DV7 L;  3HOZ H;  2E2I H;  1Q81 C;  4B3S L;  4JI7 L;  4DAY B;  3CC4 A;  2JA6 H;  3PO3 G;  4R4O A;  3CCR A;  1OXU A;  1YJN A;  3K8A A;  1G51 A;  5JJK A;  4IFD G;  2NVY H;  1QZG A;  2F52 A;  1D7Q A;  4LFC L;  4NXM Q;  1VQD A;  2UU9 Q;  4A3E H;  4B3T L;  1VQF A;  4HJA A;  2VY3 A;  2PQA B;  1WOC A;  3HOV G;  1EOV A;  2RHQ B;  1G29 1;  3KDF B;  4IFD J;  3NEN A;  3CCL A;  3CCS A;  4A75 A;  4M16 A;  1I94 Q;  1IBM L;  1VQL A;  4LFB L;  2UUA Q;  1X3E A;  5LMN W;  4OX9 Q;  2AHO B;  1IBL L;  2YTV A;  2AMC B;  5EU0 A;  2RHS B;  4A3L G;  1X54 A;  1XPU A;  2Q2T A;  2L15 A;  2WP8 J;  3FP9 A;  2JA7 G;  3GTO H;  2KHJ A;  2Y0S E;  1Y1V H;  4DV0 L;  3A5U A;  3S17 H;  1UE5 A;  2N49 A;  4GN3 B;  2MO1 A;  4PY3 A;  4DR1 Q;  3PO2 H;  4GKJ Q;  4P74 A;  1VQM A;  2ASB A;  4OO1 I;  3HOW G;  5GRO A;  3TQY A;  3PUZ A;  5FJ8 H;  4DV4 L;  5CMT A;  3D0F A;  4X66 Q;  1MIU A;  2MNA A;  2Q2I A;  4LNQ A;  4LF7 L;  5GAD C;  4QY7 A;  4A3J H;  1CKO A;  4IPC A;  3GDE A;  2NN6 I;  2KCT A;  2CKZ B;  3KF8 B;  4DR6 Q;  4UP7 A;  1TXY A;  3F2C A;  4JBJ A;  1N34 L;  2OQ0 A;  3A5Z B;  1HJP A;  2IX1 A;  2E8G A;  5IP7 H;  5M5Y H;  4GNX B;  1CKN A;  1Z9F A;  1K0R A;  1Y1W G;  1IBK Q;  4A3K H;  3STB C;  2JEB I;  4LFA L;  2BH8 A;  3E0E A;  4X62 Q;  4DUZ Q;  3U58 A;  1JJ2 A;  1PA6 A;  3GO5 A;  5M3F G;  2QEX A;  1XMQ Q;  3E9I A;  3IRB A;  3PUY A;  4YCV A;  3CCM A;  1L1O C;  4A3E G;  1N32 L;  1G6P A;  3HKZ E;  1B70 B;  1RIP A;  2WB1 E;  4JC0 A;  1SLJ A;  1BBU A;  1VQO A;  1Y1W H;  4A76 A;  2LXJ A;  3PUV A;  4WJ3 M;  3K80 C;  1KHI A;  1Q1B A;  1NMF A;  3MEF A;  3NBH B;  1YHB A;  4GLA C;  3M4Q A;  1FGU A;  2EQS A;  4U07 A;  1KRS A;  3U4Z A;  4A3C H;  4DKA C;  3L7Z C;  4AIM A;  2ALY B;  5FLM H;  2JA8 G;  2PNH A;  3CXC A;  2ZJR A;  4DV1 Q;  2KEN A;  4JYA L;  4OON A;  1IBM Q;  1B8A A;  1J6Q A;  1WJJ A;  2CWP A;  4JI2 Q;  3U4V A;  3CPF A;  4BBR G;  3PIP A;  3PV0 A;  4YWK A;  4OWX B;  3S1R H;  4A3G H;  4BBS G;  4PZ8 A;  3F2B A;  2UU9 L;  4JI4 Q;  1SMX A;  3CQZ H;  4A3B G;  3K7U C;  2Z6K A;  4A3G G;  3I4M H;  1HNZ L;  4LF4 Q;  1P8L A;  1L2F A;  1X65 A;  4AYB G;  4JYA Q;  2VZA A;  1A63 A;  4U04 A;  4AH6 A;  4JI8 L;  1EQQ A;  4P72 A;  1PHJ A;  2YTX A;  2VUM H;  1NJI C;  3I4M G;  1N36 Q;  5BR8 L;  1YNX A;  4PG3 A;  4JI1 Q;  3J81 i;  3CF5 A;  4GKK L;  1E24 A;  1BBW A;  5JFZ A;  2K5N A;  1VCI A;  1V9P A;  2AKW B;  1VQ8 A;  1N32 Q;  5IYD G;  3N3U A;  1RL2 A;  1QUQ B;  5FJ8 G;  1FJG L;  4YY3 Q;  3OTO Q;  2ID0 A;  4DR7 Q;  1FVI A;  1L0W A;  4BY7 G;  2ZM6 Q;  5IE8 A;  1OXT A;  1GM5 A;  2R6G A;  1SE8 A;  4A3D G;  1B7Y B;  4BXX H;  3CCJ A;  3SN9 A;  3JAM i;  2CCZ A;  4JCV E;  1PH3 A;  3CCQ A;  4DV6 Q;  3H3V I;  4DR4 L;  3JC6 6;  1WCM G;  5H1S E;  4IJH A;  1NTG A;  3EN2 A;  3TRE A;  3W1G A;  1Q46 A;  4DR2 Q;  3HFZ B;  1SFO H;  4LF5 L;  1XNQ L;  2K5V A;  4A3D H;  3OW2 A;  4QQB X;  2B3G A;  3WWV A;  1D8L A;  1YBY A;  1X3G A;  4WGJ A;  4RG1 A;  3OTO L;  2NVQ H;  4JI5 Q;  2RCN A;  1SN8 A;  2JJQ A;  4GKJ L;  4GNX C;  2YTY A;  1HR0 L;  2B63 H;  3S1Q H;  3PO3 H;  4B3M L;  1PH5 A;  2K5H A;  4DV2 Q;  1TWF H;  3UE1 A;  5C44 G;  2JA7 H;  1W3S A;  1JE5 A;  4APV A;  2UUB Q;  4IPH A;  4GOP C;  2ZTE A;  4H02 A;  2IT1 A;  4GOP B;  1I94 L;  2UXB Q;  3E9H A;  1X9N A;  3T1H L;  4LF9 Q;  2QA4 A;  4HJ9 A;  4HJ7 A;  3HOU G;  2YYZ A;  2I5H A;  2QGQ A;  4NXM L;  2H5X A;  4UPA A;  3CME A;  2F3I A;  3AYH B;  1Y14 B;  3HOY H;  3H15 A;  2N3S A;  3ICE A;  1EUJ A;  2YU9 H;  2UUB L;  2ZJQ A;  3CCE A;  5C3E G;  4JI7 Q;  2NN6 G;  3LET A;  2JA6 G;  4K0K L;  2PI2 E;  5C0X G;  3UDG A;  3FHW A;  1VQE A;  4YWM A;  1FL0 A;  4GOP A;  4X65 L;  3CCU A;  2JEA I;  1KXL A;  1K8A C;  1HR0 Q;  2VQE L;  3CP0 A;  4JOI C;  2BA0 A;  4UP8 A;  2RF4 A;  4JI3 Q;  3RZO H;  2VNU D;  1WYD A;  4BBS H;  1UE6 A;  5LMN L;  1KC8 C;  1VQA A;  3KOJ A;  1S40 A;  1VQ5 A;  4GNX A;  3TS2 A;  2I5M X;  4BBR H;  4A93 H;  5HGQ A;  3TS0 A;  4JV5 L;  5JJ6 A;  1J5E L;  3I55 A;  5GAH C;  4LFA Q;  3M85 A;  1UWV A;  4YWL A;  5IP7 G;  3G71 A;  3CMA A;  3ZC7 A;  1VQN A;  1Q7Y C;  3PO2 G;  3H0G G;  3SE5 A;  4B3R Q;  3GTG H;  5LMU Q;  4AQY Q;  2MFI A;  2WFW A;  1GO3 E;  4FDB A;  4DV6 L;  4AQY L;  1EFW A;  5IWA L;  4QGU A;  1EIY B;  3HOY G;  3S14 H;  5M5X H;  1SR3 A;  4IO9 A;  3RLN A;  4A93 G;  1PFS A;  4PZ6 A;  1J5E Q;  4KHP Q;  4DR7 L;  4U0Z A;  1OXV A;  2VL6 A;  4YY3 L;  2JE6 I;  3S1N H;  2R7D A;  4LF7 Q;  1AH9 A;  2XGT A;  5J3B A;  1UE1 A;  1HH2 P;  1FJG Q;  5LMN Q;  1UEB A;  1OXS C;  1PVO A;  4Y52 H;  1YJW A;  1XNR L;  4C3J H;  4DV4 Q;  1JJC B;  2GN5 A;  4GLX A;  1KAW A;  2OQK A;  4JI1 L;  5JEA J;  4AYB E;  4X65 Q;  3S24 A;  4HIK A;  4OO1 G;  4DV0 Q;  2Z6K C;  2A8V A;  1S3O A;  4IPG A;  4JOI A;  4A3M H;  4IJL A;  2N8N A;  4DAM A;  2EIF A;  2BH2 A;  5C3E H;  2KBN A;  4LF4 L;  4JBM A;  1HNX L;  2PI2 A;  1E1O A;  2R7F A;  3S1M H;  2JA5 G;  4LF9 L;  2NVT H;  4LUZ A;  5K36 G;  5IP9 H;  1TWC H;  1HNX Q;  1ASZ A;  3ZCB A;  1Q8K A;  4POF A;  3J80 i;  1VQB A;  3I4N G;  2UUC L;  1X3F A;  4A3K G;  4A3C G;  2VUM G;  4BXX G;  3GD7 A;  1PH4 A;  2R92 G;  1ASY A;  4B3S Q;  2OCE A;  4HIO A;  5IYC H;  4B3M Q;  2B63 G;  1X55 A;  1L1O A;  2CQO A;  3I4O A;  5AJ3 Q;  3HOX G;  4DV5 L;  1DGS A;  2Z0S A;  1VQ4 A;  2Q2H A;  4DR5 Q;  4DK6 C;  4DV3 L;  3CW2 C;  3NEL A;  3ULL A;  2K14 A;  2IY5 B;  4JI5 L;  1JB7 A;  1XNR Q;  1H95 A;  1CUK A;  1XMQ L;  4IOC A;  4DUY Q;  1XMO Q;  2UXB L;  1LUZ A;  1U5K A;  1I6H H;  2MO0 A;  1Q86 C;  4LF5 Q;  3GTQ H;  2UXC L;  4KHP L;  3KJO A;  4DR2 L;  4DUZ L;  4POG A;  1LTL A;  4DK3 C;  3UDF A;  1IBK L;  2DUD A;  4NB3 A;  1JT8 A;  4DR3 L;  4JI6 Q;  1TWH H;  1S72 A;  3T1Y L;  3OYY A;  3T1Y Q;  4JBK A;  2D62 A;  2JA9 A;  4DR6 L;  3FKI H;  1HNW L;  1U0L A;  1N34 Q;  2HHH L;  4MNO A;  2R92 H;  1K3R A;  4LUV A;  2LSS A;  3BZK A;  3HKZ G;  1N33 L;  2ATW A;  2K50 A;  2UXC Q;  5IYD H;  2FXQ A;  2C35 B;  2G03 A;  4JI0 L;  3TRZ A;  1GKH A;  1A8V A;  1T9H A;  3NEM A;  4PZ7 A;  4NXN L;  3HOU H;  2JA5 H;  5CGL A;  1OXX K;  2GVB A;  4R4Q A;  3BU2 A;  5BR8 Q;  1VQC A;  4DR1 L;  1PH1 A;  1WCM H;  4EX5 A;  1I3Q H;  1KRT A;  5AJ3 L;  2KCM A;  4X6A H;  3CUC A;  4GLV B;  2OTJ A;  4A3I G;  4UY8 C;  2K4K A;  4X2C A;  1PV4 A;  4K0K Q;  3KDF A;  1XPR A;  4XI8 A;  3AFQ A;  4GN5 A;  3M7N A;  4OX9 L;  3H0G H;  3S6A A;  3PF4 A;  1K73 C;  2KHI A;  4KHZ A;  1PH8 A;  3ULJ A;  3TEH B;  2UUA L;  1PH9 A;  3PIO A;  1IL2 A;  4A3B H;  4JI4 L;  3I7F A;  1A0I A;  5GAE C;  1HR0 W;  1PYB A;  1N8R C;  3KJP A;  4LFC Q;  2UXD L;  3G6E A;  3T1H Q;  1CKM A;  4MZ9 A;  3PUW A;  3CPW A;  1E1T A;  5M3F H;  1SRO A;  2K75 A;  4WJ4 A;  3J80 c;  5CKL A;  3F2D A;  3W1B A;  4DR3 Q;  4JI6 L;  5DLQ E;  4QIW E;  2I5L X;  4YHH Q;  4DV7 Q;  1YI2 A;  1HZA A;  3AEV A;  4RMF A;  4DV2 L;  3CD6 A;  3I4N H;  4X2E A;  1YEZ A;  3UDX A;  4LF8 L;  3ER0 A;  3ZJY C;  2GVA A;  1NE3 A;  1HZC A;  4JBW A;  4DUY L;  3VDY A;  1XMO L;  1OTC A;  4L5S A;  1IZ6 A;  3RN5 A;  2Q2U A;  2YV5 A;  2ES2 A;  4C3H H;  4HID A;  1KL9 A;  4KI0 A;  3HOW H;  1E3P A;  3RZD H;  2D0P A;  4R4T A;  1R9T H;  5C4J H;  1CSQ A;  1SRU A;  4R1J A;  2OWO A;  3RN2 A;  2DGY A;  5E7N A;  4X62 L;  4X64 L;  2AWN A;  4R4C A;  1YIJ A;  1Q1E A;  4L5Q A;  4LF8 Q;  1GVP A;  3M3Y H;  5FLX c;  3K7A H;  5ELN A;  4DR4 Q;  5C0X J;  1PH7 A;  4A4I A;  1KD1 C;  5M5W H;  5IY0 A;  1VQH A;  3KFU A;  3U50 C;  3KLW A;  2UUC Q;  1VQK A;  2LXK A;  1Y1V G;  4L5R C;  3F8T A;  3AFP A;  2HT1 A;  1M90 C;  3B6Y A;  1BKB A;  4B3R L;  4A3L H;  1VQ6 A;  1JMC A;  1Z47 A;  3KYH C;  4JG2 A;  2ZM6 L;  1EYG A;  2E2H H;  2UXD Q;  3L2P A;  4J15 A;  3RNU A;  2MQH A;  1YIT A;  1IYJ B;  3S2D H;  4P75 A;  3K0X A;  4PMW A;  4ALP A;  2WAQ E;  2F4V L;  1Q12 A;  2IHF A;  4GKK Q;  3AQQ A;  2HIX A;  4A3F H;  2E5L L;  4JI3 L;  4BY1 H;  4BA1 I;  1PH2 A;  5C44 H;  1XJV A;  3HOZ G;  5JFF A;  2ZJP A;  3L0O A;  4BY7 H;  4OWT B;  4HJ8 A;  3HKS A;  1VS0 A;  4O0A A;  4P71 A;  4ME3 A;  1EQR A;  4A3F G;  1M1K C;  4NXN Q;  1JJG A;  1HNZ Q;  4JI0 Q;  5C0X I;  2A1A A;  5IP9 G;  2XTI A;  1HZ9 A;  2JK8 A;  2ZTC A;  3SGI A;  4Y7N H;  3LGJ A;  1V1Q A;  2HHH Q;  4LW1 A;  3S2H H;  1HNW Q;  1C9O A;  5EAY A;  5M3M G;  4JI2 L;  4MTN A;  4LU4 A;  1MKH A;  1P16 A;  2N78 A;  3M9B A;  5LMU L;  1WFQ A;  3M4P A;  4EQ5 A;  3GTP H;  2OTL A;  1HZB A;  2NZO A;  1AE2 A;  3Q8D A;  1VQ9 A;  3S16 H;  4XTC S;  2VS1 A;  3A74 A;  2ZTD A;  1MJE A;  4UP9 A;  2HQL A;  1I5F A;  3S15 H;  1L1O B;  4GN4 B;  1EWI A;  4IPD A;  3KF6 B;  3PGZ A;  2A19 A;  5IT9 c;  4LF6 Q;  4LFB Q;  4LF6 L;  2V1C C;  4DPG A;  1NBW A;  2IHE A;  1QZH A;  4OXP A;  1XPO A;  3HOV H;  2VQE Q;  4DV3 Q;  3MXN B;  1LYL A;  1VQP A;  4TQU S;  1KIX A;  1E7Z A;  3CC2 A;  2CWA A;  4C3I H;  4DV5 Q;  3GTL H;  1O7I A;  5ELO A;  1K9M C;  1WI5 A;  1LM0 A;  1K8G A;  3M4O H;  1PH6 A;  2NVX H;  4LUO A;  3UDI A;  4NPS A;  2E2J H;  4U0U A;  2D0O A;  3KF6 A;  1E22 A;  3FKI G;  3PSI A;  3RR5 A;  3DLL A;  4GS3 A;  1VQ7 A;  4B3T Q;  4IFD I;  3JAM c;  1Q82 C;  2EXD A;  1YJ9 A;  4BY1 G;  3GTJ H;  1I50 H;  3D31 A;  2R7Z H;  3EIV A;  5GAG C;  5C4X G;  1TWG H;  3J7Z C;  2WB1 G;  1CKN B;  1GD7 A;  3CCV A;  3ERS X;  3ULP A;  1A62 A;  1W2B A;  3GTM H;  3PUX A;  3PF5 A;  4X66 L;  4TVA B;  5JJL A;  1PYS B;  1YVC A;  2NZH A;  1YZ6 A;  1N9W A;  1VQJ A;  1CSP A;  1UE7 A;  5JEA G;  2CFM A;  4OWW B;  1IXR A;  2R7Z G;  2HIV A;  3PCO B;  5FLM G;  4A3M G;  3W5O A;  3H3V H;  5HY6 A;  4X2D A;  4YCU A;  2R93 H;  4QL5 A;  3UE0 A;  3G48 A;  4YCW A;  2IX0 A;  4O2D A;  4ITR A;  1XTD A;  2R93 G;  1C0A A;  2AWO A;  4JI8 Q;  1IBL Q;  2E5L Q;  1NY4 A;  1X6O A;  2Y0S G;  1QVG A;  4C2M H;  4LWC A;  2F4V Q;  3DM3 A;  2BA1 A;  4A3J G;  4P73 A;  2PMZ E;  4R4I A;  4XIG S;  1XNQ Q;  5C4X H;  3STB D;  4L5T A;  1N33 Q;  3CAM A;  3HOX H;  3EBE A;  3GTK H;  3J7A 5;  5IYB G;  1VQI A;  3F1Z A;  1QUQ A;  5IWA Q;  1C7Y A;  3K81 C;  4A3I H;  1V43 A;  3BZC A;  5M3M H;  4QJF A;  3G4S A;  1TWA H;  4N67 A;  3RLO A;  4DV1 L;  4IOA A;  2K52 A;  2PQA A;  1YHQ A;  4DNI A;  1VQG A;  5GQO A;  4HJ5 A;  4U0S A;  3BJU A;  4X64 Q;  5IYB H;  1QVC A;  1AE3 A;  1K83 H;  2VQF Q;  2F6S A;  1MJC A;  2JQO A;  1KQS A;  2I0Q A;  3A0J A;  3ZLM A;  2B29 A;  2VW9 A;  5JJ7 A;  1YHA A;  3RLF A;  1QVF A;  1NMG A;  4JV5 Q;  4KLK A;  3J81 c;  2VQF L;  4HIM A;  3I56 A;  1N36 L;  1X56 A;  5IYC G;  3CC7 A;  2WAQ G;  4DR5 L;  3SHG A;  3I2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...