4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
molecule tags Cell adhesion
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
1BBWA 2N3SA 4A3EH 1UEBA 3ZJYC 4C3HH 4A3IH 1EIFA 3U4ZA 1VQ6A 4LF5Q 3KFUA 3PO3G 1EQQA 1AE3A 4IFDJ 2LXKA 1JJGA 1QUQA 2C35B 5HY6A 1B70B 1NMFA 1MIUA 2JA8G 4JI6Q 4B3TQ 3PV0A 4DV3L 1PH7A 1N32Q 2BH2A 3CPWA 1GD7A 4A3FH 2Z6KC 2NVYH 2XTIA 2KENA 2VNUD 1HNZL 3GTQH 2HT1A 2N8NA 3BZKA 2Q2IA 1SFOH 1VQLA 1OXSC 4L5RC 5LMUQ 1YHAA 3KF6B 1YITA 1XMOQ 4GS3A 2K5NA 2UXCL 1A63A 4JI0Q 2NN6I 4X2CA 1X3FA 4DV4Q 5IYCH 3F1ZA 3ZC7A 2AWNA 1RL2A 3Q8DA 4J15A 1D8LA 3STBC 5JEAG 1IBLL 4R4IA 3HOZH 3SN9A 3W1BA 3A74A 4DR5L 2AMCB 3HFZB 4JI5L 3KLWA 1EOVA 4YY3L 3T1HL 3TS0A 5IP9H 3PUWA 4DR3Q 2F52A 4DV3Q 1C0AA 4GNXB 3HKSA 3M3YH 3D0FA 1XTDA 4U04A 2CWPA 2RHSB 2B63G 3PO2H 2JK8A 3UDFA 3TREA 1OXVA 1TXYA 1XPOA 2L15A 1CSQA 2ZM6Q 4C2MH 1RIPA 4LW1A 1FVIA 4JI6L 1N32L 5EU0A 1YEZA 2R92G 2DUDA 4DR6Q 2NZHA 3AYHB 3CPFA 1YNXA 1HNZQ 1I3QH 5FLXc 1B7YB 1IXRA 4MTNA 4A93H 1O7IA 3SGIA 1YZ6A 1Z47A 4A3JG 5M5XH 5IP9G 2UUBQ 2JJQA 3H3VH 1SLJA 3OTOL 4HIMA 4JBKA 2PMZE 2YV5A 3GTGH 3LETA 4DV7L 3HOWH 1OXUA 2B63H 3PO2G 1P8LA 2HQLA 3M85A 2UUCQ 2JEBI 4IFDI 4U0UA 4A3GH 5M3MH 1KD1C 4L5QA 5C4XG 1Q12A 2IX1A 4JC0A 4GOPB 4B3TL 3HOYG 4JCVE 1A0IA 1JJ2A 5E7NA 1SE8A 1HR0Q 4GOPA 1W3SA 5CKLA 4JI1L 1J6QA 2B3GA 4DPGA 5IE8A 3T1HQ 2JA5G 3HOXH 1VQHA 1FJGQ 1X54A 4OWXB 2UXDL 2YTYA 1J5EL 2LXJA 4DV4L 4BY1H 2N78A 4B3SL 1VQ8A 1MJEA 3NELA 1Y14B 2FXQA 3GTLH 4OXPA 1IZ6A 2CWAA 1OXTA 5IWAQ 1IBMQ 2YTVA 1AH9A 2HIVA 2Q2HA 4DV6Q 3TRZA 4A3LG 3S17H 3A5UA 3J7A5 2JA5H 1H95A 5JFZA 4JI2L 1CKNA 4LFCL 1XPRA 1G291 3AQQA 4DV5L 4GKKL 2BA0A 4BBSG 2GVBA 1G51A 1N34L 2E5LL 5GROA 3CMAA 3OTOQ 2ZJRA 4KHPQ 1PHJA 2UUBL 3FKIH 4FDBA 1WFQA 1BVSA 4DAYB 1Y1WG 1DGSA 2JA7H 3I2ZA 4XI8A 4M16A 3BU2A 2R92H 1KL9A 4HIDA 1XNRQ 2RCNA 2VQFQ 2CKZB 4K0KQ 4O0AA 4A3BG 4MNOA 1FJGL 4LUVA 1Q46A 3GD7A 3PSIA 1CUKA 4P74A 2ES2A 3K8AA 4A3LH 2OQ0A 2VUMG 4QJFA 4LUZA 1X55A 4EX5A 5GADC 2VQEL 4GNXC 4DUYL 3T1YQ 3HOUH 5HGQA 2NVXH 2E2IH 1PVOA 4GNXA 1HJPA 4A3MH 3H15A 4DV7Q 2VZAA 1PH6A 2R7ZH 4DR4Q 3G48A 4UP8A 2JA6G 5IYDH 3F8TA 2CCZA 2ZTDA 4YWKA 3S24A 5AJ3Q 3UDGA 4LFBQ 4POFA 1SR3A 2MFIA 2MNAA 3JC66 3BJUA 4JYAL 2I5HA 1M1KC 3CCEA 4P75A 5IWAL 4X2DA 3N3UA 1E1OA 4YCVA 3PF4A 1X56A 3GTJH 3SE5A 4BBRG 1Q1EA 3I56A 3I4OA 2ALYB 4QGUA 4X64L 4KHPL 2G03A 3U50C 2AHOB 1IBLQ 3UDXA 1N34Q 2E5LQ 1VQBA 2UU9Q 4KLKA 4JI3Q 1XNQL 5C3EG 4BXXH 1U0LA 4DR2Q 4DR1L 2HHHQ 3FHWA 4BBSH 2PI2E 1I6HH 4TVAB 3RN5A 3KDFB 5C44H 2JQOA 4IFDG 1L1OA 2F4VL 3K7AH 3CD6A 1UE1A 1YBYA 2HIXA 2MO0A 5C4JH 5JJIA 1QUQB 5ELNA 2KBNA 4BY7G 3AFQA 3JAMc 1OTCA 2NN6G 4C3JH 4RG1A 1NMGA 1X9NA 1VQGA 5CMTA 2WFWA 3I7FA 1HZ9A 4YWMA 2K50A 3ULPA 5C44G 1XMQL 1EQRA 4IPHA 4IOCA 1PH4A 2OTLA 2UXCQ 4LF6L 2K14A 4C3IH 5M5YH 2Q2UA 5AJ3L 1C7YA 4ME3A 2UU9L 5GQOA 1B8AA 3PIPA 1CKMA 1SMXA 5JFFA 2E2HH 4HIKA 1S3OA 3S16H 4WJ4A 3DLLA 4DKAC 5FLMG 5IYBH 4B3MQ 3K81C 4LF9L 4QL5A 3M4QA 3I4NG 3WWVA 1OXXK 4JBMA 4YY3Q 2IY5B 5JEAJ 1X6OA 4A4IA 1Q7YC 2DGYA 2Z6KA 4R4CA 1L2FA 3GTOH 4OO1I 3F2CA 1NTGA 1EWIA 2K4KA 4DUZQ 3HOYH 2PQAB 3OW2A 3W5OA 1VQOA 1I94Q 4GLVB 4KI0A 4A3IG 1TWAH 2HHHL 1E3PA 4A3GG 1GVPA 4OX9Q 2IX0A 4BA1I 4JI7L 1X3GA 4OWTB 3F2BA 4HJ8A 4A76A 4DR6L 3RLFA 5GAEC 4X65Q 2KHJA 4HIOA 4HJ5A 1YIJA 3CP0A 4GLAC 2YYZA 1IBML 4AQYQ 3L0OA 1VQJA 1UE7A 1D7QA 1HR0L 2KCMA 3I4MG 4U0SA 1E24A 2Y0SG 3UDIA 1N33L 2N49A 3E0EA 5JJKA 3CQZH 1VQ5A 4BY7H 3L7ZC 5IT9c 3J80c 3CF5A 3KF8B 2ASBA 2UXBL 3KOJA 5BR8L 3STBD 4GKJL 1C9OA 3PIOA 5ELOA 3G6EA 1W2BA 1JB7A 4B3ML 3ICEA 4DV0Q 3K7UC 1GKHA 3NENA 3RR5A 3M9BA 4YHHL 1Q82C 4OX9L 2YTXA 4R4QA 4LUOA 3J81c 4JBWA 2ZTEA 3I4MH 1LYLA 1FL0A 1HZAA 2ID0A 5H1SE 2UXDQ 1Y1VH 2BH8A 4R4OA 4BY1G 4Y7NH 3G71A 3PF5A 1KC8C 1VQ7A 5C0XJ 1K8GA 3CCMA 4A3FG 4R1JA 1Q8KA 1KHIA 1EIYB 4JI0L 3HOXG 4LF9Q 1YJWA 1CKOA 4L5TA 4PZ8A 3PUYA 4QY7A 1YJNA 2A19A 3PUVA 3CUCA 2K5VA 2I5MX 2RHQB 3CW2C 4DV5Q 4TQUS 2UUAL 2OCEA 4POGA 2VUMH 2IHEA 2MQHA 3CC7A 2ATWA 2D0PA 2A1AA 2IHFA 3H3VI 4DR5Q 4DV0L 4A3DG 3EIVA 1VQMA 1IYJB 2VY3A 1CSPA 1I5FA 1VQAA 4AYBE 3HOUG 4DUYQ 1WCMG 5C4XH 4YHHQ 2ZJQA 3RZOH 2NZOA 2WB1E 1XNRL 3K80C 3W1GA 1LM0A 3M4PA 1QVCA 3HOZG 1XJVA 3HOVG 3ULLA 3L2PA 5LMUL 1XMOL 3HOWG 3M4OH 3CC4A 4GKJQ 3CXCA 1VQNA 1WCMH 1JE5A 2WAQE 1PH2A 3CCRA 3M7NA 3KF6A 5IYBG 2IT1A 3S14H 2QEXA 4IOAA 1K83H 1N33Q 2JA8H 3CCLA 4A3DH 1VQCA 2WAQG 3PGZA 3HOVH 4P73A 4JI4L 2OWOA 2UXBQ 4A3MG 5JJ7A 2GVAA 1HH2P 2AWOA 2MO1A 5LMNL 4HJAA 3S2HH 2WB1G 1QVGA 4UY8C 4WJ3M 3GTMH 2E2JH 1N9WA 1XMQQ 1XPUA 5CGLA 3LGJA 1TWHH 4P71A 3DM3A 4IPCA 3FKIG 4NXML 4X64Q 1L1OB 4O2DA 1NJIC 3S6AA 3HKZE 4YWLA 4JI3L 2F6SA 3PO3H 2R93H 1YVCA 5IYCG 1KQSA 1Y1WH 1K73C 5FLMH 4DR7Q 1UE6A 3RLOA 2ZJPA 4ALPA 1UWVA 5M5WH 1V1QA 4JV5Q 2VW9A 4IPDA 1S40A 1QZHA 3MEFA 2K75A 4DUZL 1J5EQ 4NB3A 4IPGA 2ZTCA 2GN5A 3KJOA 2K52A 2EQSA 3GO5A 1JJCB 1E7ZA 3UE0A 3UE1A 3S2DH 4JBJA 3S1QH 4DNIA 1YJ9A 2OTJA 2JA9A 3CCQA 4JI7Q 4LF8Q 4X2EA 2R7DA 1L0WA 1GO3E 3U58A 4NXMQ 2JE6I 3TQYA 3CC2A 4GLXA 5JJ6A 4L5SA 2EIFA 2PNHA 1NE3A 1A62A 1KRSA 4JI8L 4X62Q 5LMNQ 3RN2A 2KCTA 3PUXA 3ULJA 3EN2A 2CQOA 1JT8A 5IP7H 4XIGS 1MKHA 3J80i 1KIXA 2RF4A 4B3SQ 2VQFL 3BZCA 1PH8A 1L1OC 4X66L 4LF7Q 1TWGH 3ZLMA 1LUZA 4DV2Q 1K3RA 2K5HA 4YCUA 1N8RC 3G4SA 4X65L 1K8AC 4JI2Q 1PYSB 3I4NH 5M3MG 3ERSX 2VQEQ 4APVA 4DV1Q 5IP7G 2E8GA 4EQ5A 1PH3A 4JI5Q 2I5LX 4AH6A 3CCSA 3K0XA 5M3FG 5GAHC 1VQPA 1E1TA 4UP9A 4KHZA 4HJ9A 1Q81C 1VQKA 3EBEA 2BA1A 3PUZA 3S1NH 3GTPH 2PI2A 5BR8Q 4K0KL 4LWCA 4A3JH 1VQIA 1EFWA 2R93G 2R7ZG 4LU4A 1X65A 4U0ZA 1YHBA 3PCOB 4DAMA 3CAMA 1KAWA 1Z9FA 1HR0W 2WP8J 1QVFA 3E9IA 2Q2TA 4Y52H 4GOPC 4A3KH 2VS1A 4JG2A 4X6AH 4DR7L 2QGQA 4A93G 4JI8Q 4DR4L 1XNQQ 1PH1A 3ZCBA 4LFBL 3CCJA 4DR2L 1NBWA 1HZCA 4U07A 3IRBA 4BBRH 4DV1L 2A8VA 3J7ZC 3B6YA 3A5ZB 4GN3B 4X66Q 4JYAQ 5C0XI 2Y0SE 3AEVA 1PA6A 2KHIA 2LSSA 4NPSA 3FP9A 2F4VQ 3A0JA 4A3KG 4H02A 5C3EH 5C0XG 4DV2L 4OONA 4BXXG 2I0QA 4OO1G 3JAMi 1BBUA 3RNUA 4DK3C 4DR3L 1QZGA 5DLQE 3VDYA 2UUAQ 1SRUA 4B3RQ 1GM5A 3RLNA 3CCVA 1E22A 1M90C 2NVQH 3U4VA 2B29A 4PG3A 3H0GH 5FJ8H 4X62L 2AKWB 4LFAL 1TWFH 1MJCA 4PY3A 4NXNL 4UP7A 5K36G 4UPAA 2R6GA 4DR1Q 2VL6A 1R9TH 1HNXL 2UUCL 4LF6Q 1V9PA 2JEAI 2NVTH 4AYBG 4IJHA 1N36Q 5IYDG 5LMNW 2H5XA 2JA6H 1EYGA 1YHQA 3S1MH 2XGTA 1VQDA 1HNWL 4A3EG 2Z0SA 3SHGA 3J81j 3NBHB 4HJ7A 1A8VA 3ER0A 5GAGC 1SN8A 1AE2A 1VQFA 4JI1Q 1P16A 4DV6L 4OWWB 2PQAA 1WI5A 4DK6C 1HZBA 4N67A 5M3FH 4BA2I 3GDEA 5FJ8G 3CCUA 3H0GG 1VQ9A 4LF4L 1V43A 1Q1BA 1WYDA 4PZ7A 4XTCS 4WGJA 1T9HA 3NEMA 1IBKL 4GN4B 1I50H 1I94L 1KRTA 4P72A 3KJPA 4PZ6A 3S15H 4A3BH 4ITRA 4RMFA 4PMWA 1ASZA 4A3CH 4NXNQ 3GTKH 4LF5L 1YI2A 4JV5L 1G6PA 1IL2A 3CMEA 1UE5A 1CKNB 4R4TA 1FGUA 2QA4A 1BKBA 2OQKA 1PYBA 3HKZG 2CFMA 4GN5A 4JOIC 3F2DA 3TEHB 4JI4Q 3TS2A 2D0OA 4JOIA 2D62A 1VQ4A 1Q86C 1LTLA 1VCIA 4LFAQ 1SROA 1PV4A 3AFPA 3D31A 1PFSA 1Y1VG 1NY4A 2V1CC 4A75A 2EXDA 1N36L 1K9MC 2R7FA 5J3BA 1HNXQ 4LNQA 4AIMA 4IJLA 1K0RA 4A3CG 4YCWA 3RZDH 2YU9H 2F3IA 5EAYA 1S72A 1IBKQ 5JJLA 1WJJA 1JMCA 1VS0A 3KYHC 4LFCQ 4GKKQ 1HNWQ 3KDFA 1PH9A 1EUJA 1X3EA 4IO9A 1WOCA 5IY0A 2ZM6L 3S1RH 4B3RL 3MXNB 3I55A 3J81i 4LF7L 4AQYL 1PH5A 1ASYA 1U5KA 4LF8L 1VQEA 3T1YL 2JA7G 4QQBX 1KXLA 3E9HA 1TWCH 4LF4Q 3OYYA 4MZ9A 4QIWE
chains in the Genus database with same CATH superfamily
1ESFA 5DEHA 2MPMA 4PMBA 2J7ZA 3ZJYC 1JOKA 4C3HH 5IGFA 4LF5Q 3G6JB 1EQQA 2F03A 3S14B 4UHVA 3KLSX 5HY6A 1SFOB 1FD7D 1WTPA 3I4NB 1MIUA 2EJGC 3A54A 2V4DA 3IFDA 4FNFA 5IGEA 2JA8G 1N32Q 1RD9D 3FEWX 5IT9E 2B2VA 1HNZL 2VNUD 2HT1A 2KVMA 3V05A 4ZYSA 2PZUA 1Y8PB 5M5YB 1OO9B 5IGDA 1X3PA 3O13A 1YITA 1NNXA 1A63A 4JI0Q 2SOBA 3J7AF 1X3FA 1LABA 2L11A 3J7YW 5KNDA 4J15A 3STBC 3HOZH 3A74A 3HRZC 4G57A 1EOVA 2EOTA 5IP9H 4YIJA 1EEID 4GNXB 3BYTB 2B63G 2JK8A 3VYSA 3UDFA 1E0BA 5LL6X 3BDCA 1PRTC 4C3JG 1TXYA 2O2LD 5COYA 1CSQA 2G5DA 4C2MH 5C3WA 1FVIA 4JI6L 4MTKA 3NTHA 2F3WA 3T16A 1HNZQ 1I3QH 1TWHB 1QOHA 1Z47A 3SGIA 2UUBQ 1U4RA 3OTOL 2VXWA 2Q8RE 3K7AB 1O7LA 3LETA 4KK7A 3PO2G 3IAYA 2HQLA 1LTSD 4A3GH 2JEBI 1SAPA 1IHZA 2X69A 5J39A 3VA7A 2K33A 1B9MA 3ONAB 5CKLA 4UAIA 5IE8A 3IL8A 3NQIA 3SHLA 3EJIA 2DJGC 2HDLA 3EQLC 2JXMB 2L4NA 4H7BA 2LXJA 2PZTA 4DV4L 1K28A 2N78A 1MJEA 1S5CD 5IWAQ 2EVBA 3S16B 1EWCA 4MIUA 3TRZA 2E2HB 2OEOA 2CH4W 1CKNA 4GKKL 2F0EA 1G291 4DV5L 2BA0A 4BBSG 2GVBA 1AN8A 1I4QA 4N8X1 2E5LL 4KHPQ 2F0MA 4C56C 4PNYA 3OMGA 2O4XA 1BVSA 1LLRD 5ELCA 1STBA 1Y1WG 4OL7A 2NVXB 3I2ZA 2K32A 3BU2A 1KL9A 4JK1C 1SNDA 2CKZB 4K0KQ 4ZAIA 3SK6A 3MZ5A 3J81E 3PSIA 4A3LH 2F0WA 3VYTA 2VUMG 4QJFA 4HSPA 4FF2A 4EX5A 2CW0D 1QNUA 1G2TA 3E3XA 3H0GB 3G48A 3J80L 3M3YB 4ME5A 3D4WA 2EE1A 1CZGA 4BY1B 3JC66 3BJUA 4JVZA 4P75A 4X2DA 3SE5A 1Q1EA 4L6TB 1EYCA 2ALYB 3QOLA 5C5LA 2WV6D 5EPJA 1GUTA 4KHPL 2AHOB 2E5LQ 1S5ED 1VQBA 2UU9Q 4RHRA 4H44C 4Q0FA 3CU7A 1U0LA 1UNSA 1C4QA 3FHWA 1EY8A 4BBSH 1IYVA 3KUPA 2O5JC 4TVAB 2AQ3B 3EFXD 5C44H 2JQOA 2F4VL 1O7ZA 2EY5A 5ELNA 3JAMc 4C3JH 3I7FA 5CMTA 1SMYD 4Z9CB 1HZ9A 4K14A 2K50A 2EXZA 3ULPA 5C44G 4IPHA 2K14A 5M5YH 5AJ3L 1C7YA 1V1PB 4ME3A 5GQOA 1B8AA 2A73B 1CKMA 5JFFA 2PNRC 2R7ZB 5M5WB 2C5CA 4KY5A 4LF9L 3WWVA 1HA5A 1X6OA 5C4JB 2Z6KA 4R4CA 3MXNA 2F0QA 2F0NA 3NHHA 2PQAB 2DNCA 4Y7NB 4C3IG 4C3HB 4A3IG 1TWAH 1HTPA 3A8JE 1JR0D 5JPMC 4Q5VA 4OWTB 4KN4C 4DR6L 3MTSA 1PTOF 4KJOA 4K6LA 4GLAC 4AQYQ 3OHXC 1VQJA 3DXJC 3UDIA 2N49A 3E0EA 3V96A 4S3SA 3R3OA 3KF8B 3GV6A 1TKWB 3KOJA 5CC4A 1MHWC 5KRUA 3G6EA 4B3ML 1B53A 3NENA 2A6HD 4YHHL 4OX9L 1KLGD 4R4QA 1EYAA 2ZTEA 3I4MH 5IT9L 4A3JB 1HZAA 4MN3A 1Y1VH 1R9TB 1PFBA 1XWEA 4CKBA 4K6DA 4BY1G 4ZQ3A 3P20A 1KHIA 1JB3A 3HOXG 4RA8A 5CBEE 4DV5Q 2ATWA 1PYWD 4DR5Q 4DV0L 4A3DG 1VQMA 4QUFA 1CSPA 2B2WA 1VQAA 4DUYQ 2R61A 2H4OA 2NZOA 4R8NA 2WB1E 5T1GA 2FHTA 5CR3A 2LKVA 1QE6A 1QVCA 1XJVA 5LMUL 1VQNA 1WCMH 1RHPA 3KF6A 1BF4A 3QB3A 4N9PA 2EY2A 1N33Q 1SNOA 3DWAA 1VQCA 4O42A 3NSWA 4ID6A 4F88A 1HH2P 3S2HH 5LMNL 4HJAA 5I2XA 3GTMH 1XMQQ 1XPUA 2VB2X 5CV8A 4K5WA 4A3BB 1SNPA 2E76C 2JA8B 3DM3A 4IPCA 3NTKA 4NXML 4YWLA 4JI3L 3DM1A 2QF7A 2R93H 3FPUB 1HUNA 3QIAA 1YNND 1KQSA 1HXYD 1UAPA 1UE6A 3TP6A 2L0CA 2ZJPA 3H91A 4JV5Q 2VW9A 1WD1A 3MEFA 1J5EQ 4DUZL 4NB3A 2GN5A 2K52A 3S2DH 1LTRD 2F0HA 2SNSA 2X6GA 2L5TA 4X2EA 2R7DA 1A3UA 1EQVA 4J6HA 4DK1A 4L5SA 1RKNA 2EIFA 2J4XA 2PNHA 1NE3A 1A62A 5LMNQ 3RN2A 5IP7H 2VB3X 5CV4A 1I50B 2VQFL 1QB5D 5DM63 5EGTA 1HQRD 3X3NA 1D1KA 4LK1C 1PYSB 4N9TA 1ENAA 5M3MG 3ERSX 4RGMA 2R92B 1WTVA 5IP7G 1STNA 2PPBC 3TSSA 1PH3A 2XNAC 3TDQA 2KQ3A 2I5LX 1IKMA 1E1TA 1STEA 4HJ9A 1VQKA 4KKTA 3EBEA 3CHBD 2PI2A 1FGBD 3NBHA 4IALA 1GHJA 1EFWA 4LU4A 1X65A 3PIO3 3PCOB 1B4OA 1QILA 1G8ZD 2VS1A 1GOZA 4X6AH 3V2TA 1DD2A 1A2UA 3HOZB 4DR4L 1PH1A 3ZCBA 3QWNA 1HZCA 4U07A 1TY2A 3IRBA 4BBRH 2A8VA 3J7ZC 4A3IB 3E0JA 3A5ZB 5C0XI 3AEVA 1STYA 3I70A 3FP9A 4NPSA 4OEMB 2ZXOA 5C3EH 4BXXG 3S1MB 2I0QA 3VDYA 4RWSC 5EQ0A 3I4MB 4PG3A 4A3MB 5I2YA 4CDEC 3S15B 5K36G 4UPAA 2R6GA 3BZDB 2E2DC 2KEDA 4LF6Q 1CHPD 5IYDG 1JOOA 1YHQA 3S1MH 5JPNC 3FKIB 4L8JA 2M00A 5E1FA 4KV6A 1V8QA 1VQDA 1CT1D 2Z1CA 1ESRA 3ER0A 1SN8A 1AE2A 1EQTA 1TWFB 3UI2A 5L37A 1MBYA 3H0GG 1HFNA 1HQMC 3NEMA 4C2MB 4GZYC 1I50H 2KCCA 2G9HD 3KJPA 4KMUC 3S15H 4ITRA 4PMWA 4A3CH 3R2TA 3J80E 4LF5L 1YI2A 1B50A 3HOXB 3CMEA 1S4ZA 1UE5A 4R4TA 1ML0D 2KOLA 1PYBA 4JI4Q 3TS2A 2DY7A 4A3DB 1DOKA 1VQ4A 2FJ2A 4IUPA 2QEJC 4LNQA 1SXTA 2RDGA 4AIMA 3HOWB 3RZDH 1R4PB 5EAYA 3A8IE 3SK4A 3KYHC 1HNWQ 4GKKQ 1EUJA 1D5MC 1WOCA 4B3RL 2JA7G 1U5KA 1VQEA 3E9HA 5C5MA 3OYYA 2D9UA 2B2YC 2F0DA 1BBWA 4TRDA 1PXUA 1UEBA 3D4RA 2A5HA 2K03A 4K2LA 5CV9A 2LFNA 3SVMA 1VQ6A 1B44D 4TSSA 3T51B 3KFUA 1MGSA 5EBCA 3HEJA 2IW3A 1NMFA 4NKLA 4HTHA 4JI6Q 3PV0A 2BH2A 2Z6KC 5FOBB 2K7VA 2MUYA 3BZKA 1QCBD 1KNEA 5F2DA 1XMOQ 1YHAA 4A3KB 4X2CA 2NN6I 4KHVA 4KTAA 1CQVA 1CA5A 2AWNA 1IBLL 1ZKOA 2EYOA 3W1BA 2AMCB 2YU9B 1YNJC 5CV6A 2F0JA 1O7YA 2F52A 2BE5D 4NMZA 1C0AA 3HKSA 4U04A 4XQNA 2P5ZX 1XPOA 1A15A 3W2DA 4DF7A 1H9KA 2SEBD 4LW1A 4XXEA 5K36H 1N32L 4DR6Q 2WINB 3CPFA 4HSVA 4M1UB 3GTKB 1IXRA 4A93H 1O7IA 4L63B 3MVVA 3BVMA 5ELFA 5IP9G 2JJQA 3H3VH 2YV5A 4DV7L 1F9RA 3HOWH 1OXUA 2B63H 1TWGB 1P8LA 3M85A 2UUCQ 4U0UA 3A56A 2K05A 1A2TA 3HP3A 3MXUA 4F8MA 5EPLA 4L5QA 5M3MH 3Q23A 1KD1C 2JP1A 3H94A 5C4XG 1EY4A 3MEHA 3HKZB 4XYQA 2IX1A 5CMDA 4GOPB 4JCVE 1SE8A 1HR0Q 4QUCA 4GOPA 4JI1L 3HOUB 2B3GA 2B2WC 2QW7A 3T1HQ 3HOXH 4A93B 1BXTA 3TBIB 4MHEA 1BOSA 1J5EL 4BY1H 2QKIC 1Y14B 2A69D 1IZ6A 1AH9A 1OXTA 1SE4A 1E2WA 2Q2HA 1NUCA 3A5UA 3J7A5 3LX0A 3MFGA 1XPRA 2WAQB 3AQQA 1Q8IA 1G51A 2SNMA 1N34L 5E4WC 1PHJA 3FKIH 4FDBA 4DAYB 2BOSA 2JA7H 4XI8A 4HIDA 4AYBB 4A3BG 1FJGL 1GUNA 1Q46A 1II3A 1X3QA 4P74A 3URYA 4U68A 5GADC 3T1YQ 3HOUH 3C3LA 1PVOA 1LTGD 4GNXA 1HJPA 4DV7Q 4IUUA 4DR4Q 3I72A 4F87A 3F8TA 1C8CA 2CCZA 3S24A 5AJ3Q 3I8ZA 4POFA 1XTCD 2F4IA 2MNAA 5IODA 1LT4D 5FKAC 3VA5A 1M1KC 3N3UA 1E1OA 1X56A 1ZYRD 4BBRG 3I56A 1SNMA 2A69C 4O1NA 4X64L 2G03A 1JWMD 1EY9A 2FINB 1KDCA 1XNQL 1GUWA 5C3EG 4BXXH 3K5MA 4DR2Q 4DR1L 4M8AA 2CH4A 2K5QA 3I4LA 5KNBA 5JVG3 2KCNA 1I6HH 3C1EA 3HOVB 3OMCA 1RCVD 3K7AH 5FO7B 2MO0A 5C4JH 5JJIA 1IYUA 1QUQB 1TQOA 1B9NA 1E2ZA 2NN6G 4NDXA 1F9SA 1NMGA 1VQGA 1SNQA 1RDPD 5JOBA 3TP8A 2F0SA 2UXCQ 4G7ZC 4LF6L 1G2SA 2UU9L 3VR6A 3PO3B 5A2QL 4HIKA 1S3OA 4RKBA 4B9WA 1ET9A 2N55A 2TSSA 4PV1C 3F2UA 4B3MQ 3VR3A 1LT5D 4HAEA 1Q7YC 4A4IA 2DGYA 5FLXL 4HMJA 2ZXPA 1MSHA 4OO1I 1H9JA 1EWIA 2K4KA 4DUZQ 5C4ZA 2EYJA 3W5OA 1EOTA 4KI0A 3S1NB 1E3PA 4A3GG 2I07B 4OX9Q 1HPCA 2K04A 1X3GA 4HJ8A 3GP7A 3FDTA 3OWFA 4BBSB 2XSCA 2F0LA 3L0OA 1UE7A 2IWHA 2EY6A 2WKCA 2Y0SG 3KK7A 3TN2A 1Y1WB 5M5XB 1GUOA 5IT9c 2HCIA 3C1FA 5BR8L 3STBD 4GKJL 1C9OA 3PIOA 4DV0Q 3RR5A 1PTOH 3M9BA 1Q82C 2RKSA 1ILPA 5I4DA 4KY6A 4LUOA 3SK8A 1LYLA 1LTBD 5IGBA 2ID0A 2NWGA 1EL0A 1KC8C 5E4XA 3CCMA 1G6ZA 5J1ZA 1Q8KA 2BDNA 5M3FB 1EIYB 1HUMA 4LF9Q 4L5TA 4PZ8A 1YJNA 3PUYA 2NTSA 3PUVA 3CUCA 2K5VA 2I5MX 2RHQB 3CW2C 1B3AA 4TQUS 5C0XH 4POGA 4DGZA 2VUMH 2IHEA 3CC7A 2DN8A 2D0PA 3RD4A 1TWCB 3R8BA 2VY3A 4IUQA 1I5FA 3I3CA 3QJYA 1LTTD 1PRTD 5C4XH 5FLXE 3FRPB 2OF1A 3K80C 1LM0A 4GKJQ 1EEFD 4KY7A 3M4OH 3CXCA 4RKLA 3ITPA 1CM9A 1JE5A 2AUKA 2WAQE 3IFTA 1SDFA 1LV9A 5IYBG 2IT1A 1WD0A 2QEXA 4WRDA 3DEPA 1WTHA 4XT1B 1WTRA 3H09A 2JA8H 1FNVA 1GXDC 2B2YA 2Z4IA 2XN9C 4A3MG 5JJ7A 2GVAA 4CKCA 2EYPA 2WB1G 1PLFA 4ZLTF 1QVGA 4UY8C 2E2JH 3OOCA 5CGLA 4HR7B 3A8KE 1I3QB 1TWHH 4P71A 4H0LC 1XXGA 3FKIG 2WIIB 3S6AA 3HKZE 2F6SA 3VR5A 3H3VC 2B2VC 4KN7C 2J0TD 4C3HG 5A2QE 1F2MA 1UWVA 1V1QA 2CHBD 3NK9A 1S40A 1QZHA 3MA2B 2EYMA 4IPGA 2ZTCA 2EQSA 2KUMA 3GO5A 3UE1A 3UE0A 4RH6A 4JBJA 1IL8A 3HS0C 3S1QH 1ZXTA 2JA9A 1Z6HA 1EU3A 4JI7Q 1CK1A 1L0WA 4LF8Q 2A74C 2JE6I 2NUCA 3TQYA 5JJ6A 5M9OA 1AEXA 2L12A 2KCTA 2F0UA 4LMQD 2B39A 1L0XB 3RUZA 2RF4A 2AQ1B 2RSNA 3W3AA 1PH8A 1LT3D 1EFID 3ZLMA 4IUTA 1TIID 3I4NH 4CHTB 2VQEQ 3BG3A 2JA7B 3KLSA 1VDZA 4EQ5A 5C44B 4FO2A 4C1NK 4UP9A 3S1NH 2BA1A 2EYHA 1DYQA 5BR8Q 4V190 4WORA 2NUDA 2JSOA 3CAMA 5ELBA 4R9WA 4OELB 1KAWA 1Z9FA 3J81L 1WCMB 3E9IA 1UEAB 4A3KH 4JG2A 2ENBA 2PZWA 1VMPA 3JAME 4A93G 3FPPA 4DV1L 1SE3A 3B6YA 4X66Q 4JYAQ 1PA6A 5JAVA 2LSSA 1F2YA 4ZCKA 3A0JA 4A3KG 1PRTB 3S2HB 4OONA 1PRTF 1S5FD 1BBUA 3JAMi 4DK3C 2UUAQ 5DLQE 5EKIA 1SRUA 1GM5A 3CCVA 1E22A 1M90C 2Z9HA 3OIPA 2B29A 4X62L 2AKWB 4NXNL 4PY3A 1D6EC 1R9TH 2JEAI 1V9PA 5C6AA 4AYBG 2H5XA 1QWYA 4G4KA 4RGNA 4C3JB 1RF2D 1HNWL 3QG1A 4HJ7A 1A8VA 1VQFA 4JI1Q 4OWWB 1WI5A 2FMMA 4WFN3 5FJ8G 2RSOA 4XTCS 2JA6B 5T1IA 4DFAA 1IBKL 1EZ6A 1I94L 1KRTA 4P72A 4PZ6A 5KGUA 1I4PA 1SJHD 4DXFA 4ZKCB 1ICFB 1IL2A 1BKBA 2OQKA 2CFMA 3M4OB 4JOIA 2D62A 1KDBA 4QB4A 3Q0AA 1PV4A 2EJMA 3D31A 3U9OA 1PFSA 1Y1VG 1NY4A 2M9VA 2V1CC 1N36L 2PCFB 5J3BA 3D6CA 1HNXQ 1K0RA 3OWEB 5DM73 4YCWA 2F0FA 1BQQT 5K5PA 1WJJA 1PH9A 1X3EA 3I91A 4IO9A 3MXNB 3J81i 2R92G 2L1BA 1PH5A 1KXLA 4J1MA 3T1YL 4QQBX 1TWCH 4XQJA 2A6ED 4QIWE 4RGOS 3GQBA 1EIFA 3HG9A 3U4ZA 1D5ZC 2F0KA 2LXKA 1QUQA 2C35B 3BVGA 2E2IB 1RJTA 2RCFA 4B3TQ 4DV3L 1JC7A 3SDZA 2XTIA 4DNRB 3GTQH 2K6AA 4C3IB 1K3BC 3Q24A 4IZ8A 5JEAH 1VQLA 2FMCA 4L5RC 4K2KA 1ZEQX 4GS3A 2K5NA 3VR2A 2UXCL 1WTXA 3D4DA 4K8IA 5I6WA 2Z6BA 4IFDH 3F1ZA 4PMCA 1WTOA 1FR3A 4EGVA 1SYEA 1HA6A 1RL2A 1GUSA 3Q8DA 1D8LA 4R4IA 3HFZB 2Y0SB 3KLWA 4YY3L 3TS0A 3T1HL 4C1NI 3S9WA 1DJRD 3PUWA 4DR3Q 4RCNA 3GTLB 4DV3Q 3M3YH 3D0FA 5C3EB 1S5BD 5ELEA 3OPOA 2QCPX 4DK0A 5EU0A 1H9MA 1YEZA 3GTJB 2NZHA 4OGQC 1B7YB 4MTNA 2CVRA 1JOQA 5M5XH 3MWYW 1SLJA 4HIMA 4FXGC 4JBKA 2PMZE 4IUVA 4RCOA 3OIQA 2F0TA 3R2IA 2QILA 1JCKB 3I90A 3AMUA 2EDGA 4JC0A 1M4VA 3P1HA 4X3TA 1FNUA 1JQYD 4DA2A 4ULLA 1W6JA 1J6QA 2MGSA 1STHA 3DWQA 2JA5G 1VQHA 2RVLA 1B1ZA 1FJGQ 1X54A 4G7OC 2UXDL 2PW5A 3OSOA 2XIWA 1AFPA 4B3SL 1VQ8A 3T4AC 4CDFC 5JVH3 3GTLH 2CWAA 1IBMQ 2YTVA 4HN7A 3S17H 2JA5H 1H95A 5I9OA 4KD4A 4XT3B 4JI2L 1MSGA 4LFCL 5GROA 3CMAA 2C9OA 3LWUA 2XWJB 1TVXA 2K5WA 3HGBA 2HQEA 2KJXA 2BE5C 3RZDB 2WB1B 3DUZA 2R92H 1U9RA 1XNRQ 4O0AA 2A68C 4MNOA 1BCPC 1CUKA 1TS4A 3MXPA 1X55A 1PMRA 2VQEL 4GNXC 4DUYL 5HGQA 4KKUA 4WJWA 2E2IH 3EROA 3H15A 1CHQD 2VZAA 3K58A 4UP8A 2JA6G 2ZTDA 5IOCA 2OT2A 4JYAL 2I5HA 4FP5D 2F0GA 4B08A 2NYZD 5IWAL 4RFBA 1HFGA 4P2CB 1RTOA 3GTJH 2SDFA 1J9OA 1TY0A 3I4OA 2HUGA 3U50C 1PFNA 1Y1VB 2HHHQ 3RN5A 3KDFB 1SE2A 2MJ8A 5KIXA 1AZPA 1L1OA 3CD6A 3GTGB 1EY6A 2HIXA 1YNNC 2KBNA 5M3MB 3L9AX 1PZJD 2DY8A 3GTMB 3D8GA 1Y8NB 3D6WA 2WFWA 1ICWA 2NTTA 2QDBA 1EQRA 1NSNS 4IOCA 4C3IH 2EY1A 4CDDC 5IIFA 3BDLA 2X6LA 1MI2A 2XRSD 3JAML 3SR1A 4WJ4A 3DLLA 3K81C 1O78A 4QL5A 4YY3Q 1CTMA 4U673 1VQOA 2Z8LA 2HHHL 1GVPA 2NB0A 1AW7A 3A7LA 1LACA 3K5NA 2B2TA 3P75A 3RLFA 5GAEC 4X65Q 2KHJA 4HJ5A 1YIJA 2YYZA 4CBVA 1D7QA 4ZUJA 2GA4B 2OXPA 1HR0L 3I4MG 4U0SA 4RAUC 1N33L 3NWSA 3AB9A 3GV3A 3CQZH 1VQ5A 2K01A 3J80c 2ASBA 2UXBL 2I46A 1DOMA 5ELOA 1W2BA 1EWHA 2L55A 2YTXA 3MAQA 2A68D 4PQXA 3AU7A 1FL0A 4R4OA 3PF5A 5FO8B 1I4HA 1K8GA 3PO2B 4A3FG 2ICIA 1SYFA 5FO9B 1CKOA 4FF3A 2A19A 4UDUC 2UUAL 4CJ2C 3SEBA 3H3VI 3N52A 3EIVA 1IYJB 3HOUG 4KKSA 4YHHQ 3RZOH 1XNRL 3CQZB 3W1GA 3K5LA 3M4PA 3HOVG 3D3RA 3ULLA 3L2PA 1XMOL 3HOWG 2WACA 3L3OC 2IX3A 3GTPB 3CCRA 3M7GA 2NVTB 4DAVA 2K1BA 4IOAA 5KYLA 3CCLA 4A3DH 3HOVH 4I7AA 4OIKA 4P73A 3R93A 5D65A 1BCPB 2AWOA 1ENFA 3ND9A 3NUCA 4RHSA 4WJ3M 4NW2A 1KNAA 3LGJA 4BWGB 5J22A 1EIHA 1NJIC 4O2DA 3MFYA 4OHJA 2M2LA 5IYCG 1Y1WH 1K73C 3E5SA 3RLOA 2E2JB 2PMZB 4ALPA 1T5EA 1XX8A 5M5WH 4F7XA 2PO4A 2F0IA 2K75A 3TZUA 3KJOA 2H1EA 4R8IA 2LS01 1SBBB 1JJCB 1L0YB 5LHY1 5HGTA 3GTOB 5CGKA 3CCQA 4K8JA 1DCZA 1GO3E 3QO2A 3C2PA 4GLXA 3LWEA 3HZXA 1PZKD 2QDLA 1KRSA 1NR2A 3OW7A 4JI8L 4HMIA 3PUXA 3ULJA 3EN2A 2CQOA 3T56B 1JT8A 2ICEC 4B3SQ 1JICA 4X66L 4LF7Q 1WTWA 5A35A 1LUZA 4DV2Q 1K3RA 1MD2D 3G4SA 4X65L 5I6YA 4JI2Q 2IL8A 3S1QB 1SYGA 1FNWA 2RQXA 1GJXA 2FFKB 4AH6A 3CCSA 4A3FB 3KLRA 5GAHC 1Q81C 3I73A 3PUZA 1B3QA 3GTPH 4LWCA 4U0ZA 1YHBA 3TZDA 4CJ0B 4X3SA 1PTOC 2Q2TA 4Y52H 4GOPC 4DR7L 5AFWA 2JA5B 2QGQA 5EKLA 4JI8Q 5G3LD 3VYRA 4LFBL 4ZUIA 1HCZA 2CW0C 3Q22A 4ZKBB 4OO1H 1F9QA 4QF4A 4ZK9B 2B2TC 3VR4A 4H02A 5C0XG 4DV2L 3RNUA 4DR3L 2XWBB 3FMCA 1DM0B 3RLNA 2NVQH 1Q90A 4LFAL 1DONA 2JN4A 4UP7A 1EY5A 1TS5A 1HNXL 2UUCL 1N36Q 5BN4A 1SYCA 2XGTA 5ISRA 3CKIB 3S1RB 4A3EG 2Z0SA 5GAGC 4DV6L 2F0PA 2PQAA 5M3FH 4BA2I 1SYBA 1VQ9A 3DHQA 3CCUA 1WYDA 4PZ7A 4WGJA 1T9HA 3ND8A 1CI3M 3E6ZX 5EKKA 3ZYYX 1KTKA 4A3BH 4RMFA 2CQAA 4NXNQ 2B2UA 3KF8A 4JV5L 1G6PA 5CV7A 1TU2B 2RA4A 1I6HB 1CKNB 4QCLA 1FGUA 2QA4A 1KLUD 4GN5A 2TMPA 3F2DA 3TEHB 4NP5A 1PFMA 1JWUD 1BUVT 1Q86C 1LTLA 1PDQA 1VCIA 1SROA 3AFPA 4A75A 2R7FA 4IJLA 4A3CG 4TKOB 5JJZA 2F3IA 1S72A 4KD3A 1VS0A 4LFCQ 3KDFA 4X3UA 2KHSA 5IY0A 2ZM6L 3PQIA 3I55A 4I65A 4AQYL 4LF7L 1SSOA 3N6RA 4CGYB 3BVZA 4LF4Q 4MZ9A 1JORA 1BR9A 2N3SA 4A3EH 1U4MA 4LJZC 4A3IH 4RGTA 4BS9A 3PO3G 1ZYRC 1H9SA 2B8FA 4IFDJ 1AE3A 1JJGA 2RBMA 1AZQA 3RMHA 2IPKD 1B70B 1Y69U 3MC0B 4LAAA 2AQ2B 1PH7A 3BDOA 1A3VA 3CPWA 1GD7A 4K5VA 4A3FH 2NVYH 2KENA 2A6HC 2N8NA 2NBFA 1NH1A 1EZ8A 2Q2IA 2ZT9C 3K0YA 1SFOH 4A3GB 1OXSC 1E2VA 3MXGA 5LMUQ 3KF6B 4E6IA 2HD3A 4DV4Q 5IYCH 1PTOB 3ZC7A 1ILQA 1U4PA 2NVYB 1BDOA 1KABA 1QJOA 2L9HA 5JEAG 3SN9A 3BYYB 4FVMA 4DR5L 4JI5L 1XYIA 5DAUA 5EPKA 5KYIA 3SXHA 1R4QB 3K59A 1GHKA 1XTDA 5C3XA 2CWPA 2RHSB 3PO2H 3TREA 1B2TA 1OXVA 4XQQA 2L15A 4A3EB 2ZM6Q 3PMFA 1RIPA 1NR4A 2DUDA 3AYHB 1YNXA 4FYDA 5FLXc 1WTQA 4A3JG 1YZ6A 4EQPA 5ELDA 3K6OA 4DU9A 2ZXRA 3NQTA 3GTGH 4N8FA 1TS3A 1I4RA 2E75C 3WOFA 1CA6A 4IFDI 5D3IB 1Q12A 3HOYG 2K5DA 4B3TL 2R93B 5TSSA 1SJED 1A0IA 1JJ2A 5E7NA 1TWAB 1W3SA 4DPGA 4G7HC 5CBAE 2BCOA 1GUGA 4CKEA 1F2LA 4OWXB 4X3KA 1LT6D 2YTYA 5D3DA 2XRQD 1V1PA 1STAA 3NELA 2FXQA 3NPPA 1IKLA 2PQEA 1D1IA 1JWSD 4OXPA 2Q8IB 2HIVA 4DV6Q 4A3LG 2F0VA 1LO5D 5JFZA 1HTLD 1U4LA 3RZOB 2ZJRA 3OTOQ 2UUBL 3NXWA 1WFQA 1DGSA 4M16A 2PYKA 3SK5A 2RCNA 2VQFQ 2EJFC 4LUVA 3GD7A 1NCVA 3TMEA 2ES2A 3K8AA 2NVQB 5IGCA 2OQ0A 4LUZA 4KJNA 2NVXH 4JPBW 4A3MH 1PH6A 2R7ZH 3A55A 5IYDH 2B8GA 2JYOA 4LFBQ 4YWKA 1ONLA 2EPBA 3UDGA 1Q3LA 1BCPD 1SR3A 2MFIA 3CCEA 3PF4A 3NTIA 4YCVA 4EQOA 1X32A 2MHVA 1STGA 2IJ0A 1TR5A 4QGUA 4ZRZA 1IBLQ 3EVQA 3UDXA 1N34Q 4JI3Q 4KLKA 4DAYA 5I9PA 2PI2E 4IFDG 1UE1A 1YBYA 1ET6A 3X3MA 4BY7G 3AFQA 1OTCA 3BS1A 4RG1A 1JE4A 1X9NA 4YWMA 2MP1A 2AUJD 4FXKC 1XMQL 2RDFA 1PH4A 2OTLA 1YNJD 2Q2UA 1EU4A 3K5OA 1K83B 3PIPA 1SMXA 1W6KA 2E2HH 3S16H 1CZWA 4DKAC 5FLMG 5NUCA 5IYBH 5CORA 3M4QA 3I4NG 1OXXK 4IN3A 4JBMA 2IY5B 4DAPA 5JEAJ 1FYCA 3IKJA 1I4GA 1L2FA 5E3FA 1VF5C 3GTOH 3F2CA 1NTGA 3HOYH 3OW2A 4IURA 1I94Q 4GLVB 3NWTA 1Z7TA 2K28A 1IW7C 2Q8TA 2F3VA 4H13C 2IX0A 5EJWA 4BA1I 3FVQA 4JI7L 3F2BA 5EBDA 5BN5A 4A76A 4DN4M 2O5IC 5CV5A 2A6EC 4HIOA 3CP0A 3GTQB 1SNCA 1O80A 1IBML 1NAPA 1K8MA 2KCMA 1E24A 1VMCA 1PZID 4ABNA 4IQZA 4HCSA 5JJKA 4BY7H 3L7ZC 4EVOA 3CF5A 1SEBD 5LL6S 1EIGA 1EY0A 5IGGA 1BNZA 4DXGA 3ICEA 1BBXC 1JB7A 3S17B 3NE5B 2VUMB 3K57A 3K7UC 1GKHA 3DWPA 1I4XA 3J81c 4JBWA 4CJ1B 3CRLC 5H1SE 2UXDQ 2BH8A 1H9RA 4Y7NH 3G71A 1VQ7A 5C0XJ 3CRKC 4R1JA 4JI0L 1T5XD 1YJWA 4QY7A 4DNTB 5HURA 2E74C 1BO0A 2OCEA 2HDMA 2MQHA 2A1AA 2IHFA 4CDCC 4AYBE 1WCMG 3NBIA 2ZJQA 1I6VC 2RDHA 3HOZG 3J7AV 3CC4A 2NZ1D 1G91A 3S2DB 2PW7A 1PH2A 3M7NA 1CQFA 4BY7B 1F77A 3S14H 1PTOD 3A7AB 3TP7A 2NUNA 3NP8A 3WDNA 1K83H 2D5DA 2WAQG 3PGZA 4J8QA 4JW0A 3MHBA 4JI4L 2OWOA 1Y8OB 2UXBQ 1BCPF 1D5XC 4HCEA 2MO1A 3G7LA 4B9XA 1V1OA 1N9WA 5BN3A 5KNCA 2DNEA 1H9SB 1CFMA 4X64Q 1L1OB 3WOEA 1LTAD 4I7ZC 3T53B 1ENCA 3PO3H 1YVCA 5FLMH 4DR7Q 1SYDA 5G3LF 4QIWB 3DMUA 4IPDA 2HCCA 1E7ZA 4V0BA 2DJFC 1A6XA 4DNIA 3ERQA 1YJ9A 2OTJA 1HRJA 4NXMQ 3CC2A 1J8IA 4X62Q 4XIGS 1MKHA 3J80i 3PIP3 3U9SA 1KIXA 2WKDA 3BZCA 2BDOA 1L1OC 1TS2A 5D14A 1TWGH 2K5HA 4YCUA 1N8RC 4OIJA 1K8AC 1K8OA 4IUNA 4FF1A 4APVA 1KAAA 4HEDA 4DV1Q 4FXDA 2E8GA 4JI5Q 2D2CC 3K0XA 1LTID 5M3FG 1VQPA 4KHZA 1RTNA 5C4HA 4K0KL 5CYUA 4XDXA 1A3TA 4A3JH 1VQIA 2XVSA 3HOYB 2R93G 2R7ZG 2NN6H 3LNNA 4DAMA 1QVFA 2WP8J 1D2BA 1UUPA 2EYFA 1XNQQ 2KEEA 1F9PA 1NBWA 3CCJA 3P7JA 4DR2L 1K0SA 4GN3B 1S5DD 2Y0SE 1KDAA 3QR8A 4ODGA 2KHIA 3Q6SA 2LMCB 2F4VQ 5DNFA 4OO1G 1QZGA 3M4YA 4XYOA 4B3RQ 3U4VA 3H0GH 5FJ8H 1TWFH 1MJCA 1AP0A 4DR1Q 2VL6A 4EQNA 1IW7D 2NVTH 2N88A 4IJHA 2JA6H 5LMNW 1DZ1A 3VYUA 1EYGA 1M8AA 3SE0A 2B63B 1EY7A 4QMGA 3H6MA 3DEOA 3SHGA 2F0OA 3J81j 3QOJA 3NBHB 1QNKA 2Z4HA 5FK9C 3U58A 1P16A 4FF4A 3KBGA 1HZBA 4N67A 2F1MA 4DK6C 3GDEA 4LF4L 1V43A 2EZVA 1Q1BA 2KECA 1QG7A 4GN4B 1DXMA 2B2UC 2G9DA 1ASZA 3GTKH 3T13A 1EYDA 1C48A 5C4XB 2LY7A 3TP5A 4BBRB 3HKZG 2EYLA 4JOIC 1RODA 2D0OA 1DOLA 1SMYC 4LFAQ 1K9MC 1HR0W 2EXDA 3KBXA 2R3ZA 2KA7A 1HHVA 3EA6A 4K5XA 1WVLA 2YU9H 1IBKQ 5JJLA 1JMCA 1F2ZA 3S1RH 1VF7A 1ASYA 4LF8L 1TT2A 4ILWA 3C46A 5KEEA
chains in the Genus database with same CATH topology
1BBWA 2N3SA 4A3EH 1UEBA 3ZJYC 4C3HH 4A3IH 1EIFA 3U4ZA 1VQ6A 4LF5Q 3KFUA 3PO3G 1EQQA 1AE3A 4IFDJ 2LXKA 1JJGA 1QUQA 2C35B 5HY6A 1B70B 1NMFA 1MIUA 2JA8G 4JI6Q 4B3TQ 3PV0A 4DV3L 1PH7A 1N32Q 2BH2A 3CPWA 1GD7A 4A3FH 2Z6KC 2NVYH 2XTIA 2KENA 2VNUD 1HNZL 3GTQH 2HT1A 2N8NA 3BZKA 2Q2IA 1SFOH 1VQLA 1OXSC 4L5RC 5LMUQ 1YHAA 3KF6B 1YITA 1XMOQ 4GS3A 2K5NA 2UXCL 1A63A 4JI0Q 2NN6I 4X2CA 1X3FA 4DV4Q 5IYCH 3F1ZA 3ZC7A 2AWNA 1RL2A 3Q8DA 4J15A 1D8LA 3STBC 5JEAG 1IBLL 4R4IA 3HOZH 3SN9A 3W1BA 3A74A 4DR5L 2AMCB 3HFZB 4JI5L 3KLWA 1EOVA 4YY3L 3T1HL 3TS0A 5IP9H 3PUWA 4DR3Q 2F52A 4DV3Q 1C0AA 4GNXB 3HKSA 3M3YH 3D0FA 1XTDA 4U04A 2CWPA 2RHSB 2B63G 3PO2H 2JK8A 3UDFA 3TREA 1OXVA 1TXYA 1XPOA 2L15A 1CSQA 2ZM6Q 4C2MH 1RIPA 4LW1A 1FVIA 4JI6L 1N32L 5EU0A 1YEZA 2R92G 2DUDA 4DR6Q 2NZHA 3AYHB 3CPFA 1YNXA 1HNZQ 1I3QH 5FLXc 1B7YB 1IXRA 4MTNA 4A93H 1O7IA 3SGIA 1YZ6A 1Z47A 4A3JG 5M5XH 5IP9G 2UUBQ 2JJQA 3H3VH 1SLJA 3OTOL 4HIMA 4JBKA 2PMZE 2YV5A 3GTGH 3LETA 4DV7L 3HOWH 1OXUA 2B63H 3PO2G 1P8LA 2HQLA 3M85A 2UUCQ 2JEBI 4IFDI 4U0UA 4A3GH 5M3MH 1KD1C 4L5QA 5C4XG 1Q12A 2IX1A 4JC0A 4GOPB 4B3TL 3HOYG 4JCVE 1A0IA 1JJ2A 5E7NA 1SE8A 1HR0Q 4GOPA 1W3SA 5CKLA 4JI1L 1J6QA 2B3GA 4DPGA 5IE8A 3T1HQ 2JA5G 3HOXH 1VQHA 1FJGQ 1X54A 4OWXB 2UXDL 2YTYA 1J5EL 2LXJA 4DV4L 4BY1H 2N78A 4B3SL 1VQ8A 1MJEA 3NELA 1Y14B 2FXQA 3GTLH 4OXPA 1IZ6A 2CWAA 1OXTA 5IWAQ 1IBMQ 2YTVA 1AH9A 2HIVA 2Q2HA 4DV6Q 3TRZA 4A3LG 3S17H 3A5UA 3J7A5 2JA5H 1H95A 5JFZA 4JI2L 1CKNA 4LFCL 1XPRA 1G291 3AQQA 4DV5L 4GKKL 2BA0A 4BBSG 2GVBA 1G51A 1N34L 2E5LL 5GROA 3CMAA 3OTOQ 2ZJRA 4KHPQ 1PHJA 2UUBL 3FKIH 4FDBA 1WFQA 1BVSA 4DAYB 1Y1WG 1DGSA 2JA7H 3I2ZA 4XI8A 4M16A 3BU2A 2R92H 1KL9A 4HIDA 1XNRQ 2RCNA 2VQFQ 2CKZB 4K0KQ 4O0AA 4A3BG 4MNOA 1FJGL 4LUVA 1Q46A 3GD7A 3PSIA 1CUKA 4P74A 2ES2A 3K8AA 4A3LH 2OQ0A 2VUMG 4QJFA 4LUZA 1X55A 4EX5A 5GADC 2VQEL 4GNXC 4DUYL 3T1YQ 3HOUH 5HGQA 2NVXH 2E2IH 1PVOA 4GNXA 1HJPA 4A3MH 3H15A 4DV7Q 2VZAA 1PH6A 2R7ZH 4DR4Q 3G48A 4UP8A 2JA6G 5IYDH 3F8TA 2CCZA 2ZTDA 4YWKA 3S24A 5AJ3Q 3UDGA 4LFBQ 4POFA 1SR3A 2MFIA 2MNAA 3JC66 3BJUA 4JYAL 2I5HA 1M1KC 3CCEA 4P75A 5IWAL 4X2DA 3N3UA 1E1OA 4YCVA 3PF4A 1X56A 3GTJH 3SE5A 4BBRG 1Q1EA 3I56A 3I4OA 2ALYB 4QGUA 4X64L 4KHPL 2G03A 3U50C 2AHOB 1IBLQ 3UDXA 1N34Q 2E5LQ 1VQBA 2UU9Q 4KLKA 4JI3Q 1XNQL 5C3EG 4BXXH 1U0LA 4DR2Q 4DR1L 2HHHQ 3FHWA 4BBSH 2PI2E 1I6HH 4TVAB 3RN5A 3KDFB 5C44H 2JQOA 4IFDG 1L1OA 2F4VL 3K7AH 3CD6A 1UE1A 1YBYA 2HIXA 2MO0A 5C4JH 5JJIA 1QUQB 5ELNA 2KBNA 4BY7G 3AFQA 3JAMc 1OTCA 2NN6G 4C3JH 4RG1A 1NMGA 1X9NA 1VQGA 5CMTA 2WFWA 3I7FA 1HZ9A 4YWMA 2K50A 3ULPA 5C44G 1XMQL 1EQRA 4IPHA 4IOCA 1PH4A 2OTLA 2UXCQ 4LF6L 2K14A 4C3IH 5M5YH 2Q2UA 5AJ3L 1C7YA 4ME3A 2UU9L 5GQOA 1B8AA 3PIPA 1CKMA 1SMXA 5JFFA 2E2HH 4HIKA 1S3OA 3S16H 4WJ4A 3DLLA 4DKAC 5FLMG 5IYBH 4B3MQ 3K81C 4LF9L 4QL5A 3M4QA 3I4NG 3WWVA 1OXXK 4JBMA 4YY3Q 2IY5B 5JEAJ 1X6OA 4A4IA 1Q7YC 2DGYA 2Z6KA 4R4CA 1L2FA 3GTOH 4OO1I 3F2CA 1NTGA 1EWIA 2K4KA 4DUZQ 3HOYH 2PQAB 3OW2A 3W5OA 1VQOA 1I94Q 4GLVB 4KI0A 4A3IG 1TWAH 2HHHL 1E3PA 4A3GG 1GVPA 4OX9Q 2IX0A 4BA1I 4JI7L 1X3GA 4OWTB 3F2BA 4HJ8A 4A76A 4DR6L 3RLFA 5GAEC 4X65Q 2KHJA 4HIOA 4HJ5A 1YIJA 3CP0A 4GLAC 2YYZA 1IBML 4AQYQ 3L0OA 1VQJA 1UE7A 1D7QA 1HR0L 2KCMA 3I4MG 4U0SA 1E24A 2Y0SG 3UDIA 1N33L 2N49A 3E0EA 5JJKA 3CQZH 1VQ5A 4BY7H 3L7ZC 5IT9c 3J80c 3CF5A 3KF8B 2ASBA 2UXBL 3KOJA 5BR8L 3STBD 4GKJL 1C9OA 3PIOA 5ELOA 3G6EA 1W2BA 1JB7A 4B3ML 3ICEA 4DV0Q 3K7UC 1GKHA 3NENA 3RR5A 3M9BA 4YHHL 1Q82C 4OX9L 2YTXA 4R4QA 4LUOA 3J81c 4JBWA 2ZTEA 3I4MH 1LYLA 1FL0A 1HZAA 2ID0A 5H1SE 2UXDQ 1Y1VH 2BH8A 4R4OA 4BY1G 4Y7NH 3G71A 3PF5A 1KC8C 1VQ7A 5C0XJ 1K8GA 3CCMA 4A3FG 4R1JA 1Q8KA 1KHIA 1EIYB 4JI0L 3HOXG 4LF9Q 1YJWA 1CKOA 4L5TA 4PZ8A 3PUYA 4QY7A 1YJNA 2A19A 3PUVA 3CUCA 2K5VA 2I5MX 2RHQB 3CW2C 4DV5Q 4TQUS 2UUAL 2OCEA 4POGA 2VUMH 2IHEA 2MQHA 3CC7A 2ATWA 2D0PA 2A1AA 2IHFA 3H3VI 4DR5Q 4DV0L 4A3DG 3EIVA 1VQMA 1IYJB 2VY3A 1CSPA 1I5FA 1VQAA 4AYBE 3HOUG 4DUYQ 1WCMG 5C4XH 4YHHQ 2ZJQA 3RZOH 2NZOA 2WB1E 1XNRL 3K80C 3W1GA 1LM0A 3M4PA 1QVCA 3HOZG 1XJVA 3HOVG 3ULLA 3L2PA 5LMUL 1XMOL 3HOWG 3M4OH 3CC4A 4GKJQ 3CXCA 1VQNA 1WCMH 1JE5A 2WAQE 1PH2A 3CCRA 3M7NA 3KF6A 5IYBG 2IT1A 3S14H 2QEXA 4IOAA 1K83H 1N33Q 2JA8H 3CCLA 4A3DH 1VQCA 2WAQG 3PGZA 3HOVH 4P73A 4JI4L 2OWOA 2UXBQ 4A3MG 5JJ7A 2GVAA 1HH2P 2AWOA 2MO1A 5LMNL 4HJAA 3S2HH 2WB1G 1QVGA 4UY8C 4WJ3M 3GTMH 2E2JH 1N9WA 1XMQQ 1XPUA 5CGLA 3LGJA 1TWHH 4P71A 3DM3A 4IPCA 3FKIG 4NXML 4X64Q 1L1OB 4O2DA 1NJIC 3S6AA 3HKZE 4YWLA 4JI3L 2F6SA 3PO3H 2R93H 1YVCA 5IYCG 1KQSA 1Y1WH 1K73C 5FLMH 4DR7Q 1UE6A 3RLOA 2ZJPA 4ALPA 1UWVA 5M5WH 1V1QA 4JV5Q 2VW9A 4IPDA 1S40A 1QZHA 3MEFA 2K75A 4DUZL 1J5EQ 4NB3A 4IPGA 2ZTCA 2GN5A 3KJOA 2K52A 2EQSA 3GO5A 1JJCB 1E7ZA 3UE0A 3UE1A 3S2DH 4JBJA 3S1QH 4DNIA 1YJ9A 2OTJA 2JA9A 3CCQA 4JI7Q 4LF8Q 4X2EA 2R7DA 1L0WA 1GO3E 3U58A 4NXMQ 2JE6I 3TQYA 3CC2A 4GLXA 5JJ6A 4L5SA 2EIFA 2PNHA 1NE3A 1A62A 1KRSA 4JI8L 4X62Q 5LMNQ 3RN2A 2KCTA 3PUXA 3ULJA 3EN2A 2CQOA 1JT8A 5IP7H 4XIGS 1MKHA 3J80i 1KIXA 2RF4A 4B3SQ 2VQFL 3BZCA 1PH8A 1L1OC 4X66L 4LF7Q 1TWGH 3ZLMA 1LUZA 4DV2Q 1K3RA 2K5HA 4YCUA 1N8RC 3G4SA 4X65L 1K8AC 4JI2Q 1PYSB 3I4NH 5M3MG 3ERSX 2VQEQ 4APVA 4DV1Q 5IP7G 2E8GA 4EQ5A 1PH3A 4JI5Q 2I5LX 4AH6A 3CCSA 3K0XA 5M3FG 5GAHC 1VQPA 1E1TA 4UP9A 4KHZA 4HJ9A 1Q81C 1VQKA 3EBEA 2BA1A 3PUZA 3S1NH 3GTPH 2PI2A 5BR8Q 4K0KL 4LWCA 4A3JH 1VQIA 1EFWA 2R93G 2R7ZG 4LU4A 1X65A 4U0ZA 1YHBA 3PCOB 4DAMA 3CAMA 1KAWA 1Z9FA 1HR0W 2WP8J 1QVFA 3E9IA 2Q2TA 4Y52H 4GOPC 4A3KH 2VS1A 4JG2A 4X6AH 4DR7L 2QGQA 4A93G 4JI8Q 4DR4L 1XNQQ 1PH1A 3ZCBA 4LFBL 3CCJA 4DR2L 1NBWA 1HZCA 4U07A 3IRBA 4BBRH 4DV1L 2A8VA 3J7ZC 3B6YA 3A5ZB 4GN3B 4X66Q 4JYAQ 5C0XI 2Y0SE 3AEVA 1PA6A 2KHIA 2LSSA 4NPSA 3FP9A 2F4VQ 3A0JA 4A3KG 4H02A 5C3EH 5C0XG 4DV2L 4OONA 4BXXG 2I0QA 4OO1G 3JAMi 1BBUA 3RNUA 4DK3C 4DR3L 1QZGA 5DLQE 3VDYA 2UUAQ 1SRUA 4B3RQ 1GM5A 3RLNA 3CCVA 1E22A 1M90C 2NVQH 3U4VA 2B29A 4PG3A 3H0GH 5FJ8H 4X62L 2AKWB 4LFAL 1TWFH 1MJCA 4PY3A 4NXNL 4UP7A 5K36G 4UPAA 2R6GA 4DR1Q 2VL6A 1R9TH 1HNXL 2UUCL 4LF6Q 1V9PA 2JEAI 2NVTH 4AYBG 4IJHA 1N36Q 5IYDG 5LMNW 2H5XA 2JA6H 1EYGA 1YHQA 3S1MH 2XGTA 1VQDA 1HNWL 4A3EG 2Z0SA 3SHGA 3J81j 3NBHB 4HJ7A 1A8VA 3ER0A 5GAGC 1SN8A 1AE2A 1VQFA 4JI1Q 1P16A 4DV6L 4OWWB 2PQAA 1WI5A 4DK6C 1HZBA 4N67A 5M3FH 4BA2I 3GDEA 5FJ8G 3CCUA 3H0GG 1VQ9A 4LF4L 1V43A 1Q1BA 1WYDA 4PZ7A 4XTCS 4WGJA 1T9HA 3NEMA 1IBKL 4GN4B 1I50H 1I94L 1KRTA 4P72A 3KJPA 4PZ6A 3S15H 4A3BH 4ITRA 4RMFA 4PMWA 1ASZA 4A3CH 4NXNQ 3GTKH 4LF5L 1YI2A 4JV5L 1G6PA 1IL2A 3CMEA 1UE5A 1CKNB 4R4TA 1FGUA 2QA4A 1BKBA 2OQKA 1PYBA 3HKZG 2CFMA 4GN5A 4JOIC 3F2DA 3TEHB 4JI4Q 3TS2A 2D0OA 4JOIA 2D62A 1VQ4A 1Q86C 1LTLA 1VCIA 4LFAQ 1SROA 1PV4A 3AFPA 3D31A 1PFSA 1Y1VG 1NY4A 2V1CC 4A75A 2EXDA 1N36L 1K9MC 2R7FA 5J3BA 1HNXQ 4LNQA 4AIMA 4IJLA 1K0RA 4A3CG 4YCWA 3RZDH 2YU9H 2F3IA 5EAYA 1S72A 1IBKQ 5JJLA 1WJJA 1JMCA 1VS0A 3KYHC 4LFCQ 4GKKQ 1HNWQ 3KDFA 1PH9A 1EUJA 1X3EA 4IO9A 1WOCA 5IY0A 2ZM6L 3S1RH 4B3RL 3MXNB 3I55A 3J81i 4LF7L 4AQYL 1PH5A 1ASYA 1U5KA 4LF8L 1VQEA 3T1YL 2JA7G 4QQBX 1KXLA 3E9HA 1TWCH 4LF4Q 3OYYA 4MZ9A 4QIWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBW A;  2N3S A;  4A3E H;  1UEB A;  3ZJY C;  4C3H H;  4A3I H;  1EIF A;  3U4Z A;  1VQ6 A;  4LF5 Q;  3KFU A;  3PO3 G;  1EQQ A;  1AE3 A;  4IFD J;  2LXK A;  1JJG A;  1QUQ A;  2C35 B;  5HY6 A;  1B70 B;  1NMF A;  1MIU A;  2JA8 G;  4JI6 Q;  4B3T Q;  3PV0 A;  4DV3 L;  1PH7 A;  1N32 Q;  2BH2 A;  3CPW A;  1GD7 A;  4A3F H;  2Z6K C;  2NVY H;  2XTI A;  2KEN A;  2VNU D;  1HNZ L;  3GTQ H;  2HT1 A;  2N8N A;  3BZK A;  2Q2I A;  1SFO H;  1VQL A;  1OXS C;  4L5R C;  5LMU Q;  1YHA A;  3KF6 B;  1YIT A;  1XMO Q;  4GS3 A;  2K5N A;  2UXC L;  1A63 A;  4JI0 Q;  2NN6 I;  4X2C A;  1X3F A;  4DV4 Q;  5IYC H;  3F1Z A;  3ZC7 A;  2AWN A;  1RL2 A;  3Q8D A;  4J15 A;  1D8L A;  3STB C;  5JEA G;  1IBL L;  4R4I A;  3HOZ H;  3SN9 A;  3W1B A;  3A74 A;  4DR5 L;  2AMC B;  3HFZ B;  4JI5 L;  3KLW A;  1EOV A;  4YY3 L;  3T1H L;  3TS0 A;  5IP9 H;  3PUW A;  4DR3 Q;  2F52 A;  4DV3 Q;  1C0A A;  4GNX B;  3HKS A;  3M3Y H;  3D0F A;  1XTD A;  4U04 A;  2CWP A;  2RHS B;  2B63 G;  3PO2 H;  2JK8 A;  3UDF A;  3TRE A;  1OXV A;  1TXY A;  1XPO A;  2L15 A;  1CSQ A;  2ZM6 Q;  4C2M H;  1RIP A;  4LW1 A;  1FVI A;  4JI6 L;  1N32 L;  5EU0 A;  1YEZ A;  2R92 G;  2DUD A;  4DR6 Q;  2NZH A;  3AYH B;  3CPF A;  1YNX A;  1HNZ Q;  1I3Q H;  5FLX c;  1B7Y B;  1IXR A;  4MTN A;  4A93 H;  1O7I A;  3SGI A;  1YZ6 A;  1Z47 A;  4A3J G;  5M5X H;  5IP9 G;  2UUB Q;  2JJQ A;  3H3V H;  1SLJ A;  3OTO L;  4HIM A;  4JBK A;  2PMZ E;  2YV5 A;  3GTG H;  3LET A;  4DV7 L;  3HOW H;  1OXU A;  2B63 H;  3PO2 G;  1P8L A;  2HQL A;  3M85 A;  2UUC Q;  2JEB I;  4IFD I;  4U0U A;  4A3G H;  5M3M H;  1KD1 C;  4L5Q A;  5C4X G;  1Q12 A;  2IX1 A;  4JC0 A;  4GOP B;  4B3T L;  3HOY G;  4JCV E;  1A0I A;  1JJ2 A;  5E7N A;  1SE8 A;  1HR0 Q;  4GOP A;  1W3S A;  5CKL A;  4JI1 L;  1J6Q A;  2B3G A;  4DPG A;  5IE8 A;  3T1H Q;  2JA5 G;  3HOX H;  1VQH A;  1FJG Q;  1X54 A;  4OWX B;  2UXD L;  2YTY A;  1J5E L;  2LXJ A;  4DV4 L;  4BY1 H;  2N78 A;  4B3S L;  1VQ8 A;  1MJE A;  3NEL A;  1Y14 B;  2FXQ A;  3GTL H;  4OXP A;  1IZ6 A;  2CWA A;  1OXT A;  5IWA Q;  1IBM Q;  2YTV A;  1AH9 A;  2HIV A;  2Q2H A;  4DV6 Q;  3TRZ A;  4A3L G;  3S17 H;  3A5U A;  3J7A 5;  2JA5 H;  1H95 A;  5JFZ A;  4JI2 L;  1CKN A;  4LFC L;  1XPR A;  1G29 1;  3AQQ A;  4DV5 L;  4GKK L;  2BA0 A;  4BBS G;  2GVB A;  1G51 A;  1N34 L;  2E5L L;  5GRO A;  3CMA A;  3OTO Q;  2ZJR A;  4KHP Q;  1PHJ A;  2UUB L;  3FKI H;  4FDB A;  1WFQ A;  1BVS A;  4DAY B;  1Y1W G;  1DGS A;  2JA7 H;  3I2Z A;  4XI8 A;  4M16 A;  3BU2 A;  2R92 H;  1KL9 A;  4HID A;  1XNR Q;  2RCN A;  2VQF Q;  2CKZ B;  4K0K Q;  4O0A A;  4A3B G;  4MNO A;  1FJG L;  4LUV A;  1Q46 A;  3GD7 A;  3PSI A;  1CUK A;  4P74 A;  2ES2 A;  3K8A A;  4A3L H;  2OQ0 A;  2VUM G;  4QJF A;  4LUZ A;  1X55 A;  4EX5 A;  5GAD C;  2VQE L;  4GNX C;  4DUY L;  3T1Y Q;  3HOU H;  5HGQ A;  2NVX H;  2E2I H;  1PVO A;  4GNX A;  1HJP A;  4A3M H;  3H15 A;  4DV7 Q;  2VZA A;  1PH6 A;  2R7Z H;  4DR4 Q;  3G48 A;  4UP8 A;  2JA6 G;  5IYD H;  3F8T A;  2CCZ A;  2ZTD A;  4YWK A;  3S24 A;  5AJ3 Q;  3UDG A;  4LFB Q;  4POF A;  1SR3 A;  2MFI A;  2MNA A;  3JC6 6;  3BJU A;  4JYA L;  2I5H A;  1M1K C;  3CCE A;  4P75 A;  5IWA L;  4X2D A;  3N3U A;  1E1O A;  4YCV A;  3PF4 A;  1X56 A;  3GTJ H;  3SE5 A;  4BBR G;  1Q1E A;  3I56 A;  3I4O A;  2ALY B;  4QGU A;  4X64 L;  4KHP L;  2G03 A;  3U50 C;  2AHO B;  1IBL Q;  3UDX A;  1N34 Q;  2E5L Q;  1VQB A;  2UU9 Q;  4KLK A;  4JI3 Q;  1XNQ L;  5C3E G;  4BXX H;  1U0L A;  4DR2 Q;  4DR1 L;  2HHH Q;  3FHW A;  4BBS H;  2PI2 E;  1I6H H;  4TVA B;  3RN5 A;  3KDF B;  5C44 H;  2JQO A;  4IFD G;  1L1O A;  2F4V L;  3K7A H;  3CD6 A;  1UE1 A;  1YBY A;  2HIX A;  2MO0 A;  5C4J H;  5JJI A;  1QUQ B;  5ELN A;  2KBN A;  4BY7 G;  3AFQ A;  3JAM c;  1OTC A;  2NN6 G;  4C3J H;  4RG1 A;  1NMG A;  1X9N A;  1VQG A;  5CMT A;  2WFW A;  3I7F A;  1HZ9 A;  4YWM A;  2K50 A;  3ULP A;  5C44 G;  1XMQ L;  1EQR A;  4IPH A;  4IOC A;  1PH4 A;  2OTL A;  2UXC Q;  4LF6 L;  2K14 A;  4C3I H;  5M5Y H;  2Q2U A;  5AJ3 L;  1C7Y A;  4ME3 A;  2UU9 L;  5GQO A;  1B8A A;  3PIP A;  1CKM A;  1SMX A;  5JFF A;  2E2H H;  4HIK A;  1S3O A;  3S16 H;  4WJ4 A;  3DLL A;  4DKA C;  5FLM G;  5IYB H;  4B3M Q;  3K81 C;  4LF9 L;  4QL5 A;  3M4Q A;  3I4N G;  3WWV A;  1OXX K;  4JBM A;  4YY3 Q;  2IY5 B;  5JEA J;  1X6O A;  4A4I A;  1Q7Y C;  2DGY A;  2Z6K A;  4R4C A;  1L2F A;  3GTO H;  4OO1 I;  3F2C A;  1NTG A;  1EWI A;  2K4K A;  4DUZ Q;  3HOY H;  2PQA B;  3OW2 A;  3W5O A;  1VQO A;  1I94 Q;  4GLV B;  4KI0 A;  4A3I G;  1TWA H;  2HHH L;  1E3P A;  4A3G G;  1GVP A;  4OX9 Q;  2IX0 A;  4BA1 I;  4JI7 L;  1X3G A;  4OWT B;  3F2B A;  4HJ8 A;  4A76 A;  4DR6 L;  3RLF A;  5GAE C;  4X65 Q;  2KHJ A;  4HIO A;  4HJ5 A;  1YIJ A;  3CP0 A;  4GLA C;  2YYZ A;  1IBM L;  4AQY Q;  3L0O A;  1VQJ A;  1UE7 A;  1D7Q A;  1HR0 L;  2KCM A;  3I4M G;  4U0S A;  1E24 A;  2Y0S G;  3UDI A;  1N33 L;  2N49 A;  3E0E A;  5JJK A;  3CQZ H;  1VQ5 A;  4BY7 H;  3L7Z C;  5IT9 c;  3J80 c;  3CF5 A;  3KF8 B;  2ASB A;  2UXB L;  3KOJ A;  5BR8 L;  3STB D;  4GKJ L;  1C9O A;  3PIO A;  5ELO A;  3G6E A;  1W2B A;  1JB7 A;  4B3M L;  3ICE A;  4DV0 Q;  3K7U C;  1GKH A;  3NEN A;  3RR5 A;  3M9B A;  4YHH L;  1Q82 C;  4OX9 L;  2YTX A;  4R4Q A;  4LUO A;  3J81 c;  4JBW A;  2ZTE A;  3I4M H;  1LYL A;  1FL0 A;  1HZA A;  2ID0 A;  5H1S E;  2UXD Q;  1Y1V H;  2BH8 A;  4R4O A;  4BY1 G;  4Y7N H;  3G71 A;  3PF5 A;  1KC8 C;  1VQ7 A;  5C0X J;  1K8G A;  3CCM A;  4A3F G;  4R1J A;  1Q8K A;  1KHI A;  1EIY B;  4JI0 L;  3HOX G;  4LF9 Q;  1YJW A;  1CKO A;  4L5T A;  4PZ8 A;  3PUY A;  4QY7 A;  1YJN A;  2A19 A;  3PUV A;  3CUC A;  2K5V A;  2I5M X;  2RHQ B;  3CW2 C;  4DV5 Q;  4TQU S;  2UUA L;  2OCE A;  4POG A;  2VUM H;  2IHE A;  2MQH A;  3CC7 A;  2ATW A;  2D0P A;  2A1A A;  2IHF A;  3H3V I;  4DR5 Q;  4DV0 L;  4A3D G;  3EIV A;  1VQM A;  1IYJ B;  2VY3 A;  1CSP A;  1I5F A;  1VQA A;  4AYB E;  3HOU G;  4DUY Q;  1WCM G;  5C4X H;  4YHH Q;  2ZJQ A;  3RZO H;  2NZO A;  2WB1 E;  1XNR L;  3K80 C;  3W1G A;  1LM0 A;  3M4P A;  1QVC A;  3HOZ G;  1XJV A;  3HOV G;  3ULL A;  3L2P A;  5LMU L;  1XMO L;  3HOW G;  3M4O H;  3CC4 A;  4GKJ Q;  3CXC A;  1VQN A;  1WCM H;  1JE5 A;  2WAQ E;  1PH2 A;  3CCR A;  3M7N A;  3KF6 A;  5IYB G;  2IT1 A;  3S14 H;  2QEX A;  4IOA A;  1K83 H;  1N33 Q;  2JA8 H;  3CCL A;  4A3D H;  1VQC A;  2WAQ G;  3PGZ A;  3HOV H;  4P73 A;  4JI4 L;  2OWO A;  2UXB Q;  4A3M G;  5JJ7 A;  2GVA A;  1HH2 P;  2AWO A;  2MO1 A;  5LMN L;  4HJA A;  3S2H H;  2WB1 G;  1QVG A;  4UY8 C;  4WJ3 M;  3GTM H;  2E2J H;  1N9W A;  1XMQ Q;  1XPU A;  5CGL A;  3LGJ A;  1TWH H;  4P71 A;  3DM3 A;  4IPC A;  3FKI G;  4NXM L;  4X64 Q;  1L1O B;  4O2D A;  1NJI C;  3S6A A;  3HKZ E;  4YWL A;  4JI3 L;  2F6S A;  3PO3 H;  2R93 H;  1YVC A;  5IYC G;  1KQS A;  1Y1W H;  1K73 C;  5FLM H;  4DR7 Q;  1UE6 A;  3RLO A;  2ZJP A;  4ALP A;  1UWV A;  5M5W H;  1V1Q A;  4JV5 Q;  2VW9 A;  4IPD A;  1S40 A;  1QZH A;  3MEF A;  2K75 A;  4DUZ L;  1J5E Q;  4NB3 A;  4IPG A;  2ZTC A;  2GN5 A;  3KJO A;  2K52 A;  2EQS A;  3GO5 A;  1JJC B;  1E7Z A;  3UE0 A;  3UE1 A;  3S2D H;  4JBJ A;  3S1Q H;  4DNI A;  1YJ9 A;  2OTJ A;  2JA9 A;  3CCQ A;  4JI7 Q;  4LF8 Q;  4X2E A;  2R7D A;  1L0W A;  1GO3 E;  3U58 A;  4NXM Q;  2JE6 I;  3TQY A;  3CC2 A;  4GLX A;  5JJ6 A;  4L5S A;  2EIF A;  2PNH A;  1NE3 A;  1A62 A;  1KRS A;  4JI8 L;  4X62 Q;  5LMN Q;  3RN2 A;  2KCT A;  3PUX A;  3ULJ A;  3EN2 A;  2CQO A;  1JT8 A;  5IP7 H;  4XIG S;  1MKH A;  3J80 i;  1KIX A;  2RF4 A;  4B3S Q;  2VQF L;  3BZC A;  1PH8 A;  1L1O C;  4X66 L;  4LF7 Q;  1TWG H;  3ZLM A;  1LUZ A;  4DV2 Q;  1K3R A;  2K5H A;  4YCU A;  1N8R C;  3G4S A;  4X65 L;  1K8A C;  4JI2 Q;  1PYS B;  3I4N H;  5M3M G;  3ERS X;  2VQE Q;  4APV A;  4DV1 Q;  5IP7 G;  2E8G A;  4EQ5 A;  1PH3 A;  4JI5 Q;  2I5L X;  4AH6 A;  3CCS A;  3K0X A;  5M3F G;  5GAH C;  1VQP A;  1E1T A;  4UP9 A;  4KHZ A;  4HJ9 A;  1Q81 C;  1VQK A;  3EBE A;  2BA1 A;  3PUZ A;  3S1N H;  3GTP H;  2PI2 A;  5BR8 Q;  4K0K L;  4LWC A;  4A3J H;  1VQI A;  1EFW A;  2R93 G;  2R7Z G;  4LU4 A;  1X65 A;  4U0Z A;  1YHB A;  3PCO B;  4DAM A;  3CAM A;  1KAW A;  1Z9F A;  1HR0 W;  2WP8 J;  1QVF A;  3E9I A;  2Q2T A;  4Y52 H;  4GOP C;  4A3K H;  2VS1 A;  4JG2 A;  4X6A H;  4DR7 L;  2QGQ A;  4A93 G;  4JI8 Q;  4DR4 L;  1XNQ Q;  1PH1 A;  3ZCB A;  4LFB L;  3CCJ A;  4DR2 L;  1NBW A;  1HZC A;  4U07 A;  3IRB A;  4BBR H;  4DV1 L;  2A8V A;  3J7Z C;  3B6Y A;  3A5Z B;  4GN3 B;  4X66 Q;  4JYA Q;  5C0X I;  2Y0S E;  3AEV A;  1PA6 A;  2KHI A;  2LSS A;  4NPS A;  3FP9 A;  2F4V Q;  3A0J A;  4A3K G;  4H02 A;  5C3E H;  5C0X G;  4DV2 L;  4OON A;  4BXX G;  2I0Q A;  4OO1 G;  3JAM i;  1BBU A;  3RNU A;  4DK3 C;  4DR3 L;  1QZG A;  5DLQ E;  3VDY A;  2UUA Q;  1SRU A;  4B3R Q;  1GM5 A;  3RLN A;  3CCV A;  1E22 A;  1M90 C;  2NVQ H;  3U4V A;  2B29 A;  4PG3 A;  3H0G H;  5FJ8 H;  4X62 L;  2AKW B;  4LFA L;  1TWF H;  1MJC A;  4PY3 A;  4NXN L;  4UP7 A;  5K36 G;  4UPA A;  2R6G A;  4DR1 Q;  2VL6 A;  1R9T H;  1HNX L;  2UUC L;  4LF6 Q;  1V9P A;  2JEA I;  2NVT H;  4AYB G;  4IJH A;  1N36 Q;  5IYD G;  5LMN W;  2H5X A;  2JA6 H;  1EYG A;  1YHQ A;  3S1M H;  2XGT A;  1VQD A;  1HNW L;  4A3E G;  2Z0S A;  3SHG A;  3J81 j;  3NBH B;  4HJ7 A;  1A8V A;  3ER0 A;  5GAG C;  1SN8 A;  1AE2 A;  1VQF A;  4JI1 Q;  1P16 A;  4DV6 L;  4OWW B;  2PQA A;  1WI5 A;  4DK6 C;  1HZB A;  4N67 A;  5M3F H;  4BA2 I;  3GDE A;  5FJ8 G;  3CCU A;  3H0G G;  1VQ9 A;  4LF4 L;  1V43 A;  1Q1B A;  1WYD A;  4PZ7 A;  4XTC S;  4WGJ A;  1T9H A;  3NEM A;  1IBK L;  4GN4 B;  1I50 H;  1I94 L;  1KRT A;  4P72 A;  3KJP A;  4PZ6 A;  3S15 H;  4A3B H;  4ITR A;  4RMF A;  4PMW A;  1ASZ A;  4A3C H;  4NXN Q;  3GTK H;  4LF5 L;  1YI2 A;  4JV5 L;  1G6P A;  1IL2 A;  3CME A;  1UE5 A;  1CKN B;  4R4T A;  1FGU A;  2QA4 A;  1BKB A;  2OQK A;  1PYB A;  3HKZ G;  2CFM A;  4GN5 A;  4JOI C;  3F2D A;  3TEH B;  4JI4 Q;  3TS2 A;  2D0O A;  4JOI A;  2D62 A;  1VQ4 A;  1Q86 C;  1LTL A;  1VCI A;  4LFA Q;  1SRO A;  1PV4 A;  3AFP A;  3D31 A;  1PFS A;  1Y1V G;  1NY4 A;  2V1C C;  4A75 A;  2EXD A;  1N36 L;  1K9M C;  2R7F A;  5J3B A;  1HNX Q;  4LNQ A;  4AIM A;  4IJL A;  1K0R A;  4A3C G;  4YCW A;  3RZD H;  2YU9 H;  2F3I A;  5EAY A;  1S72 A;  1IBK Q;  5JJL A;  1WJJ A;  1JMC A;  1VS0 A;  3KYH C;  4LFC Q;  4GKK Q;  1HNW Q;  3KDF A;  1PH9 A;  1EUJ A;  1X3E A;  4IO9 A;  1WOC A;  5IY0 A;  2ZM6 L;  3S1R H;  4B3R L;  3MXN B;  3I55 A;  3J81 i;  4LF7 L;  4AQY L;  1PH5 A;  1ASY A;  1U5K A;  4LF8 L;  1VQE A;  3T1Y L;  2JA7 G;  4QQB X;  1KXL A;  3E9H A;  1TWC H;  4LF4 Q;  3OYY A;  4MZ9 A;  4QIW E; 
#chains in the Genus database with same CATH topology
 1ESF A;  5DEH A;  2MPM A;  4PMB A;  2J7Z A;  3ZJY C;  1JOK A;  4C3H H;  5IGF A;  4LF5 Q;  3G6J B;  1EQQ A;  2F03 A;  3S14 B;  4UHV A;  3KLS X;  5HY6 A;  1SFO B;  1FD7 D;  1WTP A;  3I4N B;  1MIU A;  2EJG C;  3A54 A;  2V4D A;  3IFD A;  4FNF A;  5IGE A;  2JA8 G;  1N32 Q;  1RD9 D;  3FEW X;  5IT9 E;  2B2V A;  1HNZ L;  2VNU D;  2HT1 A;  2KVM A;  3V05 A;  4ZYS A;  2PZU A;  1Y8P B;  5M5Y B;  1OO9 B;  5IGD A;  1X3P A;  3O13 A;  1YIT A;  1NNX A;  1A63 A;  4JI0 Q;  2SOB A;  3J7A F;  1X3F A;  1LAB A;  2L11 A;  3J7Y W;  5KND A;  4J15 A;  3STB C;  3HOZ H;  3A74 A;  3HRZ C;  4G57 A;  1EOV A;  2EOT A;  5IP9 H;  4YIJ A;  1EEI D;  4GNX B;  3BYT B;  2B63 G;  2JK8 A;  3VYS A;  3UDF A;  1E0B A;  5LL6 X;  3BDC A;  1PRT C;  4C3J G;  1TXY A;  2O2L D;  5COY A;  1CSQ A;  2G5D A;  4C2M H;  5C3W A;  1FVI A;  4JI6 L;  4MTK A;  3NTH A;  2F3W A;  3T16 A;  1HNZ Q;  1I3Q H;  1TWH B;  1QOH A;  1Z47 A;  3SGI A;  2UUB Q;  1U4R A;  3OTO L;  2VXW A;  2Q8R E;  3K7A B;  1O7L A;  3LET A;  4KK7 A;  3PO2 G;  3IAY A;  2HQL A;  1LTS D;  4A3G H;  2JEB I;  1SAP A;  1IHZ A;  2X69 A;  5J39 A;  3VA7 A;  2K33 A;  1B9M A;  3ONA B;  5CKL A;  4UAI A;  5IE8 A;  3IL8 A;  3NQI A;  3SHL A;  3EJI A;  2DJG C;  2HDL A;  3EQL C;  2JXM B;  2L4N A;  4H7B A;  2LXJ A;  2PZT A;  4DV4 L;  1K28 A;  2N78 A;  1MJE A;  1S5C D;  5IWA Q;  2EVB A;  3S16 B;  1EWC A;  4MIU A;  3TRZ A;  2E2H B;  2OEO A;  2CH4 W;  1CKN A;  4GKK L;  2F0E A;  1G29 1;  4DV5 L;  2BA0 A;  4BBS G;  2GVB A;  1AN8 A;  1I4Q A;  4N8X 1;  2E5L L;  4KHP Q;  2F0M A;  4C56 C;  4PNY A;  3OMG A;  2O4X A;  1BVS A;  1LLR D;  5ELC A;  1STB A;  1Y1W G;  4OL7 A;  2NVX B;  3I2Z A;  2K32 A;  3BU2 A;  1KL9 A;  4JK1 C;  1SND A;  2CKZ B;  4K0K Q;  4ZAI A;  3SK6 A;  3MZ5 A;  3J81 E;  3PSI A;  4A3L H;  2F0W A;  3VYT A;  2VUM G;  4QJF A;  4HSP A;  4FF2 A;  4EX5 A;  2CW0 D;  1QNU A;  1G2T A;  3E3X A;  3H0G B;  3G48 A;  3J80 L;  3M3Y B;  4ME5 A;  3D4W A;  2EE1 A;  1CZG A;  4BY1 B;  3JC6 6;  3BJU A;  4JVZ A;  4P75 A;  4X2D A;  3SE5 A;  1Q1E A;  4L6T B;  1EYC A;  2ALY B;  3QOL A;  5C5L A;  2WV6 D;  5EPJ A;  1GUT A;  4KHP L;  2AHO B;  2E5L Q;  1S5E D;  1VQB A;  2UU9 Q;  4RHR A;  4H44 C;  4Q0F A;  3CU7 A;  1U0L A;  1UNS A;  1C4Q A;  3FHW A;  1EY8 A;  4BBS H;  1IYV A;  3KUP A;  2O5J C;  4TVA B;  2AQ3 B;  3EFX D;  5C44 H;  2JQO A;  2F4V L;  1O7Z A;  2EY5 A;  5ELN A;  3JAM c;  4C3J H;  3I7F A;  5CMT A;  1SMY D;  4Z9C B;  1HZ9 A;  4K14 A;  2K50 A;  2EXZ A;  3ULP A;  5C44 G;  4IPH A;  2K14 A;  5M5Y H;  5AJ3 L;  1C7Y A;  1V1P B;  4ME3 A;  5GQO A;  1B8A A;  2A73 B;  1CKM A;  5JFF A;  2PNR C;  2R7Z B;  5M5W B;  2C5C A;  4KY5 A;  4LF9 L;  3WWV A;  1HA5 A;  1X6O A;  5C4J B;  2Z6K A;  4R4C A;  3MXN A;  2F0Q A;  2F0N A;  3NHH A;  2PQA B;  2DNC A;  4Y7N B;  4C3I G;  4C3H B;  4A3I G;  1TWA H;  1HTP A;  3A8J E;  1JR0 D;  5JPM C;  4Q5V A;  4OWT B;  4KN4 C;  4DR6 L;  3MTS A;  1PTO F;  4KJO A;  4K6L A;  4GLA C;  4AQY Q;  3OHX C;  1VQJ A;  3DXJ C;  3UDI A;  2N49 A;  3E0E A;  3V96 A;  4S3S A;  3R3O A;  3KF8 B;  3GV6 A;  1TKW B;  3KOJ A;  5CC4 A;  1MHW C;  5KRU A;  3G6E A;  4B3M L;  1B53 A;  3NEN A;  2A6H D;  4YHH L;  4OX9 L;  1KLG D;  4R4Q A;  1EYA A;  2ZTE A;  3I4M H;  5IT9 L;  4A3J B;  1HZA A;  4MN3 A;  1Y1V H;  1R9T B;  1PFB A;  1XWE A;  4CKB A;  4K6D A;  4BY1 G;  4ZQ3 A;  3P20 A;  1KHI A;  1JB3 A;  3HOX G;  4RA8 A;  5CBE E;  4DV5 Q;  2ATW A;  1PYW D;  4DR5 Q;  4DV0 L;  4A3D G;  1VQM A;  4QUF A;  1CSP A;  2B2W A;  1VQA A;  4DUY Q;  2R61 A;  2H4O A;  2NZO A;  4R8N A;  2WB1 E;  5T1G A;  2FHT A;  5CR3 A;  2LKV A;  1QE6 A;  1QVC A;  1XJV A;  5LMU L;  1VQN A;  1WCM H;  1RHP A;  3KF6 A;  1BF4 A;  3QB3 A;  4N9P A;  2EY2 A;  1N33 Q;  1SNO A;  3DWA A;  1VQC A;  4O42 A;  3NSW A;  4ID6 A;  4F88 A;  1HH2 P;  3S2H H;  5LMN L;  4HJA A;  5I2X A;  3GTM H;  1XMQ Q;  1XPU A;  2VB2 X;  5CV8 A;  4K5W A;  4A3B B;  1SNP A;  2E76 C;  2JA8 B;  3DM3 A;  4IPC A;  3NTK A;  4NXM L;  4YWL A;  4JI3 L;  3DM1 A;  2QF7 A;  2R93 H;  3FPU B;  1HUN A;  3QIA A;  1YNN D;  1KQS A;  1HXY D;  1UAP A;  1UE6 A;  3TP6 A;  2L0C A;  2ZJP A;  3H91 A;  4JV5 Q;  2VW9 A;  1WD1 A;  3MEF A;  1J5E Q;  4DUZ L;  4NB3 A;  2GN5 A;  2K52 A;  3S2D H;  1LTR D;  2F0H A;  2SNS A;  2X6G A;  2L5T A;  4X2E A;  2R7D A;  1A3U A;  1EQV A;  4J6H A;  4DK1 A;  4L5S A;  1RKN A;  2EIF A;  2J4X A;  2PNH A;  1NE3 A;  1A62 A;  5LMN Q;  3RN2 A;  5IP7 H;  2VB3 X;  5CV4 A;  1I50 B;  2VQF L;  1QB5 D;  5DM6 3;  5EGT A;  1HQR D;  3X3N A;  1D1K A;  4LK1 C;  1PYS B;  4N9T A;  1ENA A;  5M3M G;  3ERS X;  4RGM A;  2R92 B;  1WTV A;  5IP7 G;  1STN A;  2PPB C;  3TSS A;  1PH3 A;  2XNA C;  3TDQ A;  2KQ3 A;  2I5L X;  1IKM A;  1E1T A;  1STE A;  4HJ9 A;  1VQK A;  4KKT A;  3EBE A;  3CHB D;  2PI2 A;  1FGB D;  3NBH A;  4IAL A;  1GHJ A;  1EFW A;  4LU4 A;  1X65 A;  3PIO 3;  3PCO B;  1B4O A;  1QIL A;  1G8Z D;  2VS1 A;  1GOZ A;  4X6A H;  3V2T A;  1DD2 A;  1A2U A;  3HOZ B;  4DR4 L;  1PH1 A;  3ZCB A;  3QWN A;  1HZC A;  4U07 A;  1TY2 A;  3IRB A;  4BBR H;  2A8V A;  3J7Z C;  4A3I B;  3E0J A;  3A5Z B;  5C0X I;  3AEV A;  1STY A;  3I70 A;  3FP9 A;  4NPS A;  4OEM B;  2ZXO A;  5C3E H;  4BXX G;  3S1M B;  2I0Q A;  3VDY A;  4RWS C;  5EQ0 A;  3I4M B;  4PG3 A;  4A3M B;  5I2Y A;  4CDE C;  3S15 B;  5K36 G;  4UPA A;  2R6G A;  3BZD B;  2E2D C;  2KED A;  4LF6 Q;  1CHP D;  5IYD G;  1JOO A;  1YHQ A;  3S1M H;  5JPN C;  3FKI B;  4L8J A;  2M00 A;  5E1F A;  4KV6 A;  1V8Q A;  1VQD A;  1CT1 D;  2Z1C A;  1ESR A;  3ER0 A;  1SN8 A;  1AE2 A;  1EQT A;  1TWF B;  3UI2 A;  5L37 A;  1MBY A;  3H0G G;  1HFN A;  1HQM C;  3NEM A;  4C2M B;  4GZY C;  1I50 H;  2KCC A;  2G9H D;  3KJP A;  4KMU C;  3S15 H;  4ITR A;  4PMW A;  4A3C H;  3R2T A;  3J80 E;  4LF5 L;  1YI2 A;  1B50 A;  3HOX B;  3CME A;  1S4Z A;  1UE5 A;  4R4T A;  1ML0 D;  2KOL A;  1PYB A;  4JI4 Q;  3TS2 A;  2DY7 A;  4A3D B;  1DOK A;  1VQ4 A;  2FJ2 A;  4IUP A;  2QEJ C;  4LNQ A;  1SXT A;  2RDG A;  4AIM A;  3HOW B;  3RZD H;  1R4P B;  5EAY A;  3A8I E;  3SK4 A;  3KYH C;  1HNW Q;  4GKK Q;  1EUJ A;  1D5M C;  1WOC A;  4B3R L;  2JA7 G;  1U5K A;  1VQE A;  3E9H A;  5C5M A;  3OYY A;  2D9U A;  2B2Y C;  2F0D A;  1BBW A;  4TRD A;  1PXU A;  1UEB A;  3D4R A;  2A5H A;  2K03 A;  4K2L A;  5CV9 A;  2LFN A;  3SVM A;  1VQ6 A;  1B44 D;  4TSS A;  3T51 B;  3KFU A;  1MGS A;  5EBC A;  3HEJ A;  2IW3 A;  1NMF A;  4NKL A;  4HTH A;  4JI6 Q;  3PV0 A;  2BH2 A;  2Z6K C;  5FOB B;  2K7V A;  2MUY A;  3BZK A;  1QCB D;  1KNE A;  5F2D A;  1XMO Q;  1YHA A;  4A3K B;  4X2C A;  2NN6 I;  4KHV A;  4KTA A;  1CQV A;  1CA5 A;  2AWN A;  1IBL L;  1ZKO A;  2EYO A;  3W1B A;  2AMC B;  2YU9 B;  1YNJ C;  5CV6 A;  2F0J A;  1O7Y A;  2F52 A;  2BE5 D;  4NMZ A;  1C0A A;  3HKS A;  4U04 A;  4XQN A;  2P5Z X;  1XPO A;  1A15 A;  3W2D A;  4DF7 A;  1H9K A;  2SEB D;  4LW1 A;  4XXE A;  5K36 H;  1N32 L;  4DR6 Q;  2WIN B;  3CPF A;  4HSV A;  4M1U B;  3GTK B;  1IXR A;  4A93 H;  1O7I A;  4L63 B;  3MVV A;  3BVM A;  5ELF A;  5IP9 G;  2JJQ A;  3H3V H;  2YV5 A;  4DV7 L;  1F9R A;  3HOW H;  1OXU A;  2B63 H;  1TWG B;  1P8L A;  3M85 A;  2UUC Q;  4U0U A;  3A56 A;  2K05 A;  1A2T A;  3HP3 A;  3MXU A;  4F8M A;  5EPL A;  4L5Q A;  5M3M H;  3Q23 A;  1KD1 C;  2JP1 A;  3H94 A;  5C4X G;  1EY4 A;  3MEH A;  3HKZ B;  4XYQ A;  2IX1 A;  5CMD A;  4GOP B;  4JCV E;  1SE8 A;  1HR0 Q;  4QUC A;  4GOP A;  4JI1 L;  3HOU B;  2B3G A;  2B2W C;  2QW7 A;  3T1H Q;  3HOX H;  4A93 B;  1BXT A;  3TBI B;  4MHE A;  1BOS A;  1J5E L;  4BY1 H;  2QKI C;  1Y14 B;  2A69 D;  1IZ6 A;  1AH9 A;  1OXT A;  1SE4 A;  1E2W A;  2Q2H A;  1NUC A;  3A5U A;  3J7A 5;  3LX0 A;  3MFG A;  1XPR A;  2WAQ B;  3AQQ A;  1Q8I A;  1G51 A;  2SNM A;  1N34 L;  5E4W C;  1PHJ A;  3FKI H;  4FDB A;  4DAY B;  2BOS A;  2JA7 H;  4XI8 A;  4HID A;  4AYB B;  4A3B G;  1FJG L;  1GUN A;  1Q46 A;  1II3 A;  1X3Q A;  4P74 A;  3URY A;  4U68 A;  5GAD C;  3T1Y Q;  3HOU H;  3C3L A;  1PVO A;  1LTG D;  4GNX A;  1HJP A;  4DV7 Q;  4IUU A;  4DR4 Q;  3I72 A;  4F87 A;  3F8T A;  1C8C A;  2CCZ A;  3S24 A;  5AJ3 Q;  3I8Z A;  4POF A;  1XTC D;  2F4I A;  2MNA A;  5IOD A;  1LT4 D;  5FKA C;  3VA5 A;  1M1K C;  3N3U A;  1E1O A;  1X56 A;  1ZYR D;  4BBR G;  3I56 A;  1SNM A;  2A69 C;  4O1N A;  4X64 L;  2G03 A;  1JWM D;  1EY9 A;  2FIN B;  1KDC A;  1XNQ L;  1GUW A;  5C3E G;  4BXX H;  3K5M A;  4DR2 Q;  4DR1 L;  4M8A A;  2CH4 A;  2K5Q A;  3I4L A;  5KNB A;  5JVG 3;  2KCN A;  1I6H H;  3C1E A;  3HOV B;  3OMC A;  1RCV D;  3K7A H;  5FO7 B;  2MO0 A;  5C4J H;  5JJI A;  1IYU A;  1QUQ B;  1TQO A;  1B9N A;  1E2Z A;  2NN6 G;  4NDX A;  1F9S A;  1NMG A;  1VQG A;  1SNQ A;  1RDP D;  5JOB A;  3TP8 A;  2F0S A;  2UXC Q;  4G7Z C;  4LF6 L;  1G2S A;  2UU9 L;  3VR6 A;  3PO3 B;  5A2Q L;  4HIK A;  1S3O A;  4RKB A;  4B9W A;  1ET9 A;  2N55 A;  2TSS A;  4PV1 C;  3F2U A;  4B3M Q;  3VR3 A;  1LT5 D;  4HAE A;  1Q7Y C;  4A4I A;  2DGY A;  5FLX L;  4HMJ A;  2ZXP A;  1MSH A;  4OO1 I;  1H9J A;  1EWI A;  2K4K A;  4DUZ Q;  5C4Z A;  2EYJ A;  3W5O A;  1EOT A;  4KI0 A;  3S1N B;  1E3P A;  4A3G G;  2I07 B;  4OX9 Q;  1HPC A;  2K04 A;  1X3G A;  4HJ8 A;  3GP7 A;  3FDT A;  3OWF A;  4BBS B;  2XSC A;  2F0L A;  3L0O A;  1UE7 A;  2IWH A;  2EY6 A;  2WKC A;  2Y0S G;  3KK7 A;  3TN2 A;  1Y1W B;  5M5X B;  1GUO A;  5IT9 c;  2HCI A;  3C1F A;  5BR8 L;  3STB D;  4GKJ L;  1C9O A;  3PIO A;  4DV0 Q;  3RR5 A;  1PTO H;  3M9B A;  1Q82 C;  2RKS A;  1ILP A;  5I4D A;  4KY6 A;  4LUO A;  3SK8 A;  1LYL A;  1LTB D;  5IGB A;  2ID0 A;  2NWG A;  1EL0 A;  1KC8 C;  5E4X A;  3CCM A;  1G6Z A;  5J1Z A;  1Q8K A;  2BDN A;  5M3F B;  1EIY B;  1HUM A;  4LF9 Q;  4L5T A;  4PZ8 A;  1YJN A;  3PUY A;  2NTS A;  3PUV A;  3CUC A;  2K5V A;  2I5M X;  2RHQ B;  3CW2 C;  1B3A A;  4TQU S;  5C0X H;  4POG A;  4DGZ A;  2VUM H;  2IHE A;  3CC7 A;  2DN8 A;  2D0P A;  3RD4 A;  1TWC B;  3R8B A;  2VY3 A;  4IUQ A;  1I5F A;  3I3C A;  3QJY A;  1LTT D;  1PRT D;  5C4X H;  5FLX E;  3FRP B;  2OF1 A;  3K80 C;  1LM0 A;  4GKJ Q;  1EEF D;  4KY7 A;  3M4O H;  3CXC A;  4RKL A;  3ITP A;  1CM9 A;  1JE5 A;  2AUK A;  2WAQ E;  3IFT A;  1SDF A;  1LV9 A;  5IYB G;  2IT1 A;  1WD0 A;  2QEX A;  4WRD A;  3DEP A;  1WTH A;  4XT1 B;  1WTR A;  3H09 A;  2JA8 H;  1FNV A;  1GXD C;  2B2Y A;  2Z4I A;  2XN9 C;  4A3M G;  5JJ7 A;  2GVA A;  4CKC A;  2EYP A;  2WB1 G;  1PLF A;  4ZLT F;  1QVG A;  4UY8 C;  2E2J H;  3OOC A;  5CGL A;  4HR7 B;  3A8K E;  1I3Q B;  1TWH H;  4P71 A;  4H0L C;  1XXG A;  3FKI G;  2WII B;  3S6A A;  3HKZ E;  2F6S A;  3VR5 A;  3H3V C;  2B2V C;  4KN7 C;  2J0T D;  4C3H G;  5A2Q E;  1F2M A;  1UWV A;  1V1Q A;  2CHB D;  3NK9 A;  1S40 A;  1QZH A;  3MA2 B;  2EYM A;  4IPG A;  2ZTC A;  2EQS A;  2KUM A;  3GO5 A;  3UE1 A;  3UE0 A;  4RH6 A;  4JBJ A;  1IL8 A;  3HS0 C;  3S1Q H;  1ZXT A;  2JA9 A;  1Z6H A;  1EU3 A;  4JI7 Q;  1CK1 A;  1L0W A;  4LF8 Q;  2A74 C;  2JE6 I;  2NUC A;  3TQY A;  5JJ6 A;  5M9O A;  1AEX A;  2L12 A;  2KCT A;  2F0U A;  4LMQ D;  2B39 A;  1L0X B;  3RUZ A;  2RF4 A;  2AQ1 B;  2RSN A;  3W3A A;  1PH8 A;  1LT3 D;  1EFI D;  3ZLM A;  4IUT A;  1TII D;  3I4N H;  4CHT B;  2VQE Q;  3BG3 A;  2JA7 B;  3KLS A;  1VDZ A;  4EQ5 A;  5C44 B;  4FO2 A;  4C1N K;  4UP9 A;  3S1N H;  2BA1 A;  2EYH A;  1DYQ A;  5BR8 Q;  4V19 0;  4WOR A;  2NUD A;  2JSO A;  3CAM A;  5ELB A;  4R9W A;  4OEL B;  1KAW A;  1Z9F A;  3J81 L;  1WCM B;  3E9I A;  1UEA B;  4A3K H;  4JG2 A;  2ENB A;  2PZW A;  1VMP A;  3JAM E;  4A93 G;  3FPP A;  4DV1 L;  1SE3 A;  3B6Y A;  4X66 Q;  4JYA Q;  1PA6 A;  5JAV A;  2LSS A;  1F2Y A;  4ZCK A;  3A0J A;  4A3K G;  1PRT B;  3S2H B;  4OON A;  1PRT F;  1S5F D;  1BBU A;  3JAM i;  4DK3 C;  2UUA Q;  5DLQ E;  5EKI A;  1SRU A;  1GM5 A;  3CCV A;  1E22 A;  1M90 C;  2Z9H A;  3OIP A;  2B29 A;  4X62 L;  2AKW B;  4NXN L;  4PY3 A;  1D6E C;  1R9T H;  2JEA I;  1V9P A;  5C6A A;  4AYB G;  2H5X A;  1QWY A;  4G4K A;  4RGN A;  4C3J B;  1RF2 D;  1HNW L;  3QG1 A;  4HJ7 A;  1A8V A;  1VQF A;  4JI1 Q;  4OWW B;  1WI5 A;  2FMM A;  4WFN 3;  5FJ8 G;  2RSO A;  4XTC S;  2JA6 B;  5T1I A;  4DFA A;  1IBK L;  1EZ6 A;  1I94 L;  1KRT A;  4P72 A;  4PZ6 A;  5KGU A;  1I4P A;  1SJH D;  4DXF A;  4ZKC B;  1ICF B;  1IL2 A;  1BKB A;  2OQK A;  2CFM A;  3M4O B;  4JOI A;  2D62 A;  1KDB A;  4QB4 A;  3Q0A A;  1PV4 A;  2EJM A;  3D31 A;  3U9O A;  1PFS A;  1Y1V G;  1NY4 A;  2M9V A;  2V1C C;  1N36 L;  2PCF B;  5J3B A;  3D6C A;  1HNX Q;  1K0R A;  3OWE B;  5DM7 3;  4YCW A;  2F0F A;  1BQQ T;  5K5P A;  1WJJ A;  1PH9 A;  1X3E A;  3I91 A;  4IO9 A;  3MXN B;  3J81 i;  2R92 G;  2L1B A;  1PH5 A;  1KXL A;  4J1M A;  3T1Y L;  4QQB X;  1TWC H;  4XQJ A;  2A6E D;  4QIW E;  4RGO S;  3GQB A;  1EIF A;  3HG9 A;  3U4Z A;  1D5Z C;  2F0K A;  2LXK A;  1QUQ A;  2C35 B;  3BVG A;  2E2I B;  1RJT A;  2RCF A;  4B3T Q;  4DV3 L;  1JC7 A;  3SDZ A;  2XTI A;  4DNR B;  3GTQ H;  2K6A A;  4C3I B;  1K3B C;  3Q24 A;  4IZ8 A;  5JEA H;  1VQL A;  2FMC A;  4L5R C;  4K2K A;  1ZEQ X;  4GS3 A;  2K5N A;  3VR2 A;  2UXC L;  1WTX A;  3D4D A;  4K8I A;  5I6W A;  2Z6B A;  4IFD H;  3F1Z A;  4PMC A;  1WTO A;  1FR3 A;  4EGV A;  1SYE A;  1HA6 A;  1RL2 A;  1GUS A;  3Q8D A;  1D8L A;  4R4I A;  3HFZ B;  2Y0S B;  3KLW A;  4YY3 L;  3TS0 A;  3T1H L;  4C1N I;  3S9W A;  1DJR D;  3PUW A;  4DR3 Q;  4RCN A;  3GTL B;  4DV3 Q;  3M3Y H;  3D0F A;  5C3E B;  1S5B D;  5ELE A;  3OPO A;  2QCP X;  4DK0 A;  5EU0 A;  1H9M A;  1YEZ A;  3GTJ B;  2NZH A;  4OGQ C;  1B7Y B;  4MTN A;  2CVR A;  1JOQ A;  5M5X H;  3MWY W;  1SLJ A;  4HIM A;  4FXG C;  4JBK A;  2PMZ E;  4IUV A;  4RCO A;  3OIQ A;  2F0T A;  3R2I A;  2QIL A;  1JCK B;  3I90 A;  3AMU A;  2EDG A;  4JC0 A;  1M4V A;  3P1H A;  4X3T A;  1FNU A;  1JQY D;  4DA2 A;  4ULL A;  1W6J A;  1J6Q A;  2MGS A;  1STH A;  3DWQ A;  2JA5 G;  1VQH A;  2RVL A;  1B1Z A;  1FJG Q;  1X54 A;  4G7O C;  2UXD L;  2PW5 A;  3OSO A;  2XIW A;  1AFP A;  4B3S L;  1VQ8 A;  3T4A C;  4CDF C;  5JVH 3;  3GTL H;  2CWA A;  1IBM Q;  2YTV A;  4HN7 A;  3S17 H;  2JA5 H;  1H95 A;  5I9O A;  4KD4 A;  4XT3 B;  4JI2 L;  1MSG A;  4LFC L;  5GRO A;  3CMA A;  2C9O A;  3LWU A;  2XWJ B;  1TVX A;  2K5W A;  3HGB A;  2HQE A;  2KJX A;  2BE5 C;  3RZD B;  2WB1 B;  3DUZ A;  2R92 H;  1U9R A;  1XNR Q;  4O0A A;  2A68 C;  4MNO A;  1BCP C;  1CUK A;  1TS4 A;  3MXP A;  1X55 A;  1PMR A;  2VQE L;  4GNX C;  4DUY L;  5HGQ A;  4KKU A;  4WJW A;  2E2I H;  3ERO A;  3H15 A;  1CHQ D;  2VZA A;  3K58 A;  4UP8 A;  2JA6 G;  2ZTD A;  5IOC A;  2OT2 A;  4JYA L;  2I5H A;  4FP5 D;  2F0G A;  4B08 A;  2NYZ D;  5IWA L;  4RFB A;  1HFG A;  4P2C B;  1RTO A;  3GTJ H;  2SDF A;  1J9O A;  1TY0 A;  3I4O A;  2HUG A;  3U50 C;  1PFN A;  1Y1V B;  2HHH Q;  3RN5 A;  3KDF B;  1SE2 A;  2MJ8 A;  5KIX A;  1AZP A;  1L1O A;  3CD6 A;  3GTG B;  1EY6 A;  2HIX A;  1YNN C;  2KBN A;  5M3M B;  3L9A X;  1PZJ D;  2DY8 A;  3GTM B;  3D8G A;  1Y8N B;  3D6W A;  2WFW A;  1ICW A;  2NTT A;  2QDB A;  1EQR A;  1NSN S;  4IOC A;  4C3I H;  2EY1 A;  4CDD C;  5IIF A;  3BDL A;  2X6L A;  1MI2 A;  2XRS D;  3JAM L;  3SR1 A;  4WJ4 A;  3DLL A;  3K81 C;  1O78 A;  4QL5 A;  4YY3 Q;  1CTM A;  4U67 3;  1VQO A;  2Z8L A;  2HHH L;  1GVP A;  2NB0 A;  1AW7 A;  3A7L A;  1LAC A;  3K5N A;  2B2T A;  3P75 A;  3RLF A;  5GAE C;  4X65 Q;  2KHJ A;  4HJ5 A;  1YIJ A;  2YYZ A;  4CBV A;  1D7Q A;  4ZUJ A;  2GA4 B;  2OXP A;  1HR0 L;  3I4M G;  4U0S A;  4RAU C;  1N33 L;  3NWS A;  3AB9 A;  3GV3 A;  3CQZ H;  1VQ5 A;  2K01 A;  3J80 c;  2ASB A;  2UXB L;  2I46 A;  1DOM A;  5ELO A;  1W2B A;  1EWH A;  2L55 A;  2YTX A;  3MAQ A;  2A68 D;  4PQX A;  3AU7 A;  1FL0 A;  4R4O A;  3PF5 A;  5FO8 B;  1I4H A;  1K8G A;  3PO2 B;  4A3F G;  2ICI A;  1SYF A;  5FO9 B;  1CKO A;  4FF3 A;  2A19 A;  4UDU C;  2UUA L;  4CJ2 C;  3SEB A;  3H3V I;  3N52 A;  3EIV A;  1IYJ B;  3HOU G;  4KKS A;  4YHH Q;  3RZO H;  1XNR L;  3CQZ B;  3W1G A;  3K5L A;  3M4P A;  3HOV G;  3D3R A;  3ULL A;  3L2P A;  1XMO L;  3HOW G;  2WAC A;  3L3O C;  2IX3 A;  3GTP B;  3CCR A;  3M7G A;  2NVT B;  4DAV A;  2K1B A;  4IOA A;  5KYL A;  3CCL A;  4A3D H;  3HOV H;  4I7A A;  4OIK A;  4P73 A;  3R93 A;  5D65 A;  1BCP B;  2AWO A;  1ENF A;  3ND9 A;  3NUC A;  4RHS A;  4WJ3 M;  4NW2 A;  1KNA A;  3LGJ A;  4BWG B;  5J22 A;  1EIH A;  1NJI C;  4O2D A;  3MFY A;  4OHJ A;  2M2L A;  5IYC G;  1Y1W H;  1K73 C;  3E5S A;  3RLO A;  2E2J B;  2PMZ B;  4ALP A;  1T5E A;  1XX8 A;  5M5W H;  4F7X A;  2PO4 A;  2F0I A;  2K75 A;  3TZU A;  3KJO A;  2H1E A;  4R8I A;  2LS0 1;  1SBB B;  1JJC B;  1L0Y B;  5LHY 1;  5HGT A;  3GTO B;  5CGK A;  3CCQ A;  4K8J A;  1DCZ A;  1GO3 E;  3QO2 A;  3C2P A;  4GLX A;  3LWE A;  3HZX A;  1PZK D;  2QDL A;  1KRS A;  1NR2 A;  3OW7 A;  4JI8 L;  4HMI A;  3PUX A;  3ULJ A;  3EN2 A;  2CQO A;  3T56 B;  1JT8 A;  2ICE C;  4B3S Q;  1JIC A;  4X66 L;  4LF7 Q;  1WTW A;  5A35 A;  1LUZ A;  4DV2 Q;  1K3R A;  1MD2 D;  3G4S A;  4X65 L;  5I6Y A;  4JI2 Q;  2IL8 A;  3S1Q B;  1SYG A;  1FNW A;  2RQX A;  1GJX A;  2FFK B;  4AH6 A;  3CCS A;  4A3F B;  3KLR A;  5GAH C;  1Q81 C;  3I73 A;  3PUZ A;  1B3Q A;  3GTP H;  4LWC A;  4U0Z A;  1YHB A;  3TZD A;  4CJ0 B;  4X3S A;  1PTO C;  2Q2T A;  4Y52 H;  4GOP C;  4DR7 L;  5AFW A;  2JA5 B;  2QGQ A;  5EKL A;  4JI8 Q;  5G3L D;  3VYR A;  4LFB L;  4ZUI A;  1HCZ A;  2CW0 C;  3Q22 A;  4ZKB B;  4OO1 H;  1F9Q A;  4QF4 A;  4ZK9 B;  2B2T C;  3VR4 A;  4H02 A;  5C0X G;  4DV2 L;  3RNU A;  4DR3 L;  2XWB B;  3FMC A;  1DM0 B;  3RLN A;  2NVQ H;  1Q90 A;  4LFA L;  1DON A;  2JN4 A;  4UP7 A;  1EY5 A;  1TS5 A;  1HNX L;  2UUC L;  1N36 Q;  5BN4 A;  1SYC A;  2XGT A;  5ISR A;  3CKI B;  3S1R B;  4A3E G;  2Z0S A;  5GAG C;  4DV6 L;  2F0P A;  2PQA A;  5M3F H;  4BA2 I;  1SYB A;  1VQ9 A;  3DHQ A;  3CCU A;  1WYD A;  4PZ7 A;  4WGJ A;  1T9H A;  3ND8 A;  1CI3 M;  3E6Z X;  5EKK A;  3ZYY X;  1KTK A;  4A3B H;  4RMF A;  2CQA A;  4NXN Q;  2B2U A;  3KF8 A;  4JV5 L;  1G6P A;  5CV7 A;  1TU2 B;  2RA4 A;  1I6H B;  1CKN B;  4QCL A;  1FGU A;  2QA4 A;  1KLU D;  4GN5 A;  2TMP A;  3F2D A;  3TEH B;  4NP5 A;  1PFM A;  1JWU D;  1BUV T;  1Q86 C;  1LTL A;  1PDQ A;  1VCI A;  1SRO A;  3AFP A;  4A75 A;  2R7F A;  4IJL A;  4A3C G;  4TKO B;  5JJZ A;  2F3I A;  1S72 A;  4KD3 A;  1VS0 A;  4LFC Q;  3KDF A;  4X3U A;  2KHS A;  5IY0 A;  2ZM6 L;  3PQI A;  3I55 A;  4I65 A;  4AQY L;  4LF7 L;  1SSO A;  3N6R A;  4CGY B;  3BVZ A;  4LF4 Q;  4MZ9 A;  1JOR A;  1BR9 A;  2N3S A;  4A3E H;  1U4M A;  4LJZ C;  4A3I H;  4RGT A;  4BS9 A;  3PO3 G;  1ZYR C;  1H9S A;  2B8F A;  4IFD J;  1AE3 A;  1JJG A;  2RBM A;  1AZQ A;  3RMH A;  2IPK D;  1B70 B;  1Y69 U;  3MC0 B;  4LAA A;  2AQ2 B;  1PH7 A;  3BDO A;  1A3V A;  3CPW A;  1GD7 A;  4K5V A;  4A3F H;  2NVY H;  2KEN A;  2A6H C;  2N8N A;  2NBF A;  1NH1 A;  1EZ8 A;  2Q2I A;  2ZT9 C;  3K0Y A;  1SFO H;  4A3G B;  1OXS C;  1E2V A;  3MXG A;  5LMU Q;  3KF6 B;  4E6I A;  2HD3 A;  4DV4 Q;  5IYC H;  1PTO B;  3ZC7 A;  1ILQ A;  1U4P A;  2NVY B;  1BDO A;  1KAB A;  1QJO A;  2L9H A;  5JEA G;  3SN9 A;  3BYY B;  4FVM A;  4DR5 L;  4JI5 L;  1XYI A;  5DAU A;  5EPK A;  5KYI A;  3SXH A;  1R4Q B;  3K59 A;  1GHK A;  1XTD A;  5C3X A;  2CWP A;  2RHS B;  3PO2 H;  3TRE A;  1B2T A;  1OXV A;  4XQQ A;  2L15 A;  4A3E B;  2ZM6 Q;  3PMF A;  1RIP A;  1NR4 A;  2DUD A;  3AYH B;  1YNX A;  4FYD A;  5FLX c;  1WTQ A;  4A3J G;  1YZ6 A;  4EQP A;  5ELD A;  3K6O A;  4DU9 A;  2ZXR A;  3NQT A;  3GTG H;  4N8F A;  1TS3 A;  1I4R A;  2E75 C;  3WOF A;  1CA6 A;  4IFD I;  5D3I B;  1Q12 A;  3HOY G;  2K5D A;  4B3T L;  2R93 B;  5TSS A;  1SJE D;  1A0I A;  1JJ2 A;  5E7N A;  1TWA B;  1W3S A;  4DPG A;  4G7H C;  5CBA E;  2BCO A;  1GUG A;  4CKE A;  1F2L A;  4OWX B;  4X3K A;  1LT6 D;  2YTY A;  5D3D A;  2XRQ D;  1V1P A;  1STA A;  3NEL A;  2FXQ A;  3NPP A;  1IKL A;  2PQE A;  1D1I A;  1JWS D;  4OXP A;  2Q8I B;  2HIV A;  4DV6 Q;  4A3L G;  2F0V A;  1LO5 D;  5JFZ A;  1HTL D;  1U4L A;  3RZO B;  2ZJR A;  3OTO Q;  2UUB L;  3NXW A;  1WFQ A;  1DGS A;  4M16 A;  2PYK A;  3SK5 A;  2RCN A;  2VQF Q;  2EJF C;  4LUV A;  3GD7 A;  1NCV A;  3TME A;  2ES2 A;  3K8A A;  2NVQ B;  5IGC A;  2OQ0 A;  4LUZ A;  4KJN A;  2NVX H;  4JPB W;  4A3M H;  1PH6 A;  2R7Z H;  3A55 A;  5IYD H;  2B8G A;  2JYO A;  4LFB Q;  4YWK A;  1ONL A;  2EPB A;  3UDG A;  1Q3L A;  1BCP D;  1SR3 A;  2MFI A;  3CCE A;  3PF4 A;  3NTI A;  4YCV A;  4EQO A;  1X32 A;  2MHV A;  1STG A;  2IJ0 A;  1TR5 A;  4QGU A;  4ZRZ A;  1IBL Q;  3EVQ A;  3UDX A;  1N34 Q;  4JI3 Q;  4KLK A;  4DAY A;  5I9P A;  2PI2 E;  4IFD G;  1UE1 A;  1YBY A;  1ET6 A;  3X3M A;  4BY7 G;  3AFQ A;  1OTC A;  3BS1 A;  4RG1 A;  1JE4 A;  1X9N A;  4YWM A;  2MP1 A;  2AUJ D;  4FXK C;  1XMQ L;  2RDF A;  1PH4 A;  2OTL A;  1YNJ D;  2Q2U A;  1EU4 A;  3K5O A;  1K83 B;  3PIP A;  1SMX A;  1W6K A;  2E2H H;  3S16 H;  1CZW A;  4DKA C;  5FLM G;  5NUC A;  5IYB H;  5COR A;  3M4Q A;  3I4N G;  1OXX K;  4IN3 A;  4JBM A;  2IY5 B;  4DAP A;  5JEA J;  1FYC A;  3IKJ A;  1I4G A;  1L2F A;  5E3F A;  1VF5 C;  3GTO H;  3F2C A;  1NTG A;  3HOY H;  3OW2 A;  4IUR A;  1I94 Q;  4GLV B;  3NWT A;  1Z7T A;  2K28 A;  1IW7 C;  2Q8T A;  2F3V A;  4H13 C;  2IX0 A;  5EJW A;  4BA1 I;  3FVQ A;  4JI7 L;  3F2B A;  5EBD A;  5BN5 A;  4A76 A;  4DN4 M;  2O5I C;  5CV5 A;  2A6E C;  4HIO A;  3CP0 A;  3GTQ B;  1SNC A;  1O80 A;  1IBM L;  1NAP A;  1K8M A;  2KCM A;  1E24 A;  1VMC A;  1PZI D;  4ABN A;  4IQZ A;  4HCS A;  5JJK A;  4BY7 H;  3L7Z C;  4EVO A;  3CF5 A;  1SEB D;  5LL6 S;  1EIG A;  1EY0 A;  5IGG A;  1BNZ A;  4DXG A;  3ICE A;  1BBX C;  1JB7 A;  3S17 B;  3NE5 B;  2VUM B;  3K57 A;  3K7U C;  1GKH A;  3DWP A;  1I4X A;  3J81 c;  4JBW A;  4CJ1 B;  3CRL C;  5H1S E;  2UXD Q;  2BH8 A;  1H9R A;  4Y7N H;  3G71 A;  1VQ7 A;  5C0X J;  3CRK C;  4R1J A;  4JI0 L;  1T5X D;  1YJW A;  4QY7 A;  4DNT B;  5HUR A;  2E74 C;  1BO0 A;  2OCE A;  2HDM A;  2MQH A;  2A1A A;  2IHF A;  4CDC C;  4AYB E;  1WCM G;  3NBI A;  2ZJQ A;  1I6V C;  2RDH A;  3HOZ G;  3J7A V;  3CC4 A;  2NZ1 D;  1G91 A;  3S2D B;  2PW7 A;  1PH2 A;  3M7N A;  1CQF A;  4BY7 B;  1F77 A;  3S14 H;  1PTO D;  3A7A B;  3TP7 A;  2NUN A;  3NP8 A;  3WDN A;  1K83 H;  2D5D A;  2WAQ G;  3PGZ A;  4J8Q A;  4JW0 A;  3MHB A;  4JI4 L;  2OWO A;  1Y8O B;  2UXB Q;  1BCP F;  1D5X C;  4HCE A;  2MO1 A;  3G7L A;  4B9X A;  1V1O A;  1N9W A;  5BN3 A;  5KNC A;  2DNE A;  1H9S B;  1CFM A;  4X64 Q;  1L1O B;  3WOE A;  1LTA D;  4I7Z C;  3T53 B;  1ENC A;  3PO3 H;  1YVC A;  5FLM H;  4DR7 Q;  1SYD A;  5G3L F;  4QIW B;  3DMU A;  4IPD A;  2HCC A;  1E7Z A;  4V0B A;  2DJF C;  1A6X A;  4DNI A;  3ERQ A;  1YJ9 A;  2OTJ A;  1HRJ A;  4NXM Q;  3CC2 A;  1J8I A;  4X62 Q;  4XIG S;  1MKH A;  3J80 i;  3PIP 3;  3U9S A;  1KIX A;  2WKD A;  3BZC A;  2BDO A;  1L1O C;  1TS2 A;  5D14 A;  1TWG H;  2K5H A;  4YCU A;  1N8R C;  4OIJ A;  1K8A C;  1K8O A;  4IUN A;  4FF1 A;  4APV A;  1KAA A;  4HED A;  4DV1 Q;  4FXD A;  2E8G A;  4JI5 Q;  2D2C C;  3K0X A;  1LTI D;  5M3F G;  1VQP A;  4KHZ A;  1RTN A;  5C4H A;  4K0K L;  5CYU A;  4XDX A;  1A3T A;  4A3J H;  1VQI A;  2XVS A;  3HOY B;  2R93 G;  2R7Z G;  2NN6 H;  3LNN A;  4DAM A;  1QVF A;  2WP8 J;  1D2B A;  1UUP A;  2EYF A;  1XNQ Q;  2KEE A;  1F9P A;  1NBW A;  3CCJ A;  3P7J A;  4DR2 L;  1K0S A;  4GN3 B;  1S5D D;  2Y0S E;  1KDA A;  3QR8 A;  4ODG A;  2KHI A;  3Q6S A;  2LMC B;  2F4V Q;  5DNF A;  4OO1 G;  1QZG A;  3M4Y A;  4XYO A;  4B3R Q;  3U4V A;  3H0G H;  5FJ8 H;  1TWF H;  1MJC A;  1AP0 A;  4DR1 Q;  2VL6 A;  4EQN A;  1IW7 D;  2NVT H;  2N88 A;  4IJH A;  2JA6 H;  5LMN W;  1DZ1 A;  3VYU A;  1EYG A;  1M8A A;  3SE0 A;  2B63 B;  1EY7 A;  4QMG A;  3H6M A;  3DEO A;  3SHG A;  2F0O A;  3J81 j;  3QOJ A;  3NBH B;  1QNK A;  2Z4H A;  5FK9 C;  3U58 A;  1P16 A;  4FF4 A;  3KBG A;  1HZB A;  4N67 A;  2F1M A;  4DK6 C;  3GDE A;  4LF4 L;  1V43 A;  2EZV A;  1Q1B A;  2KEC A;  1QG7 A;  4GN4 B;  1DXM A;  2B2U C;  2G9D A;  1ASZ A;  3GTK H;  3T13 A;  1EYD A;  1C48 A;  5C4X B;  2LY7 A;  3TP5 A;  4BBR B;  3HKZ G;  2EYL A;  4JOI C;  1ROD A;  2D0O A;  1DOL A;  1SMY C;  4LFA Q;  1K9M C;  1HR0 W;  2EXD A;  3KBX A;  2R3Z A;  2KA7 A;  1HHV A;  3EA6 A;  4K5X A;  1WVL A;  2YU9 H;  1IBK Q;  5JJL A;  1JMC A;  1F2Z A;  3S1R H;  1VF7 A;  1ASY A;  4LF8 L;  1TT2 A;  4ILW A;  3C46 A;  5KEE A; 
#chains in the Genus database with same CATH homology
 1BBW A;  2N3S A;  4A3E H;  1UEB A;  3ZJY C;  4C3H H;  4A3I H;  1EIF A;  3U4Z A;  1VQ6 A;  4LF5 Q;  3KFU A;  3PO3 G;  1EQQ A;  1AE3 A;  4IFD J;  2LXK A;  1JJG A;  1QUQ A;  2C35 B;  5HY6 A;  1B70 B;  1NMF A;  1MIU A;  2JA8 G;  4JI6 Q;  4B3T Q;  3PV0 A;  4DV3 L;  1PH7 A;  1N32 Q;  2BH2 A;  3CPW A;  1GD7 A;  4A3F H;  2Z6K C;  2NVY H;  2XTI A;  2KEN A;  2VNU D;  1HNZ L;  3GTQ H;  2HT1 A;  2N8N A;  3BZK A;  2Q2I A;  1SFO H;  1VQL A;  1OXS C;  4L5R C;  5LMU Q;  1YHA A;  3KF6 B;  1YIT A;  1XMO Q;  4GS3 A;  2K5N A;  2UXC L;  1A63 A;  4JI0 Q;  2NN6 I;  4X2C A;  1X3F A;  4DV4 Q;  5IYC H;  3F1Z A;  3ZC7 A;  2AWN A;  1RL2 A;  3Q8D A;  4J15 A;  1D8L A;  3STB C;  5JEA G;  1IBL L;  4R4I A;  3HOZ H;  3SN9 A;  3W1B A;  3A74 A;  4DR5 L;  2AMC B;  3HFZ B;  4JI5 L;  3KLW A;  1EOV A;  4YY3 L;  3T1H L;  3TS0 A;  5IP9 H;  3PUW A;  4DR3 Q;  2F52 A;  4DV3 Q;  1C0A A;  4GNX B;  3HKS A;  3M3Y H;  3D0F A;  1XTD A;  4U04 A;  2CWP A;  2RHS B;  2B63 G;  3PO2 H;  2JK8 A;  3UDF A;  3TRE A;  1OXV A;  1TXY A;  1XPO A;  2L15 A;  1CSQ A;  2ZM6 Q;  4C2M H;  1RIP A;  4LW1 A;  1FVI A;  4JI6 L;  1N32 L;  5EU0 A;  1YEZ A;  2R92 G;  2DUD A;  4DR6 Q;  2NZH A;  3AYH B;  3CPF A;  1YNX A;  1HNZ Q;  1I3Q H;  5FLX c;  1B7Y B;  1IXR A;  4MTN A;  4A93 H;  1O7I A;  3SGI A;  1YZ6 A;  1Z47 A;  4A3J G;  5M5X H;  5IP9 G;  2UUB Q;  2JJQ A;  3H3V H;  1SLJ A;  3OTO L;  4HIM A;  4JBK A;  2PMZ E;  2YV5 A;  3GTG H;  3LET A;  4DV7 L;  3HOW H;  1OXU A;  2B63 H;  3PO2 G;  1P8L A;  2HQL A;  3M85 A;  2UUC Q;  2JEB I;  4IFD I;  4U0U A;  4A3G H;  5M3M H;  1KD1 C;  4L5Q A;  5C4X G;  1Q12 A;  2IX1 A;  4JC0 A;  4GOP B;  4B3T L;  3HOY G;  4JCV E;  1A0I A;  1JJ2 A;  5E7N A;  1SE8 A;  1HR0 Q;  4GOP A;  1W3S A;  5CKL A;  4JI1 L;  1J6Q A;  2B3G A;  4DPG A;  5IE8 A;  3T1H Q;  2JA5 G;  3HOX H;  1VQH A;  1FJG Q;  1X54 A;  4OWX B;  2UXD L;  2YTY A;  1J5E L;  2LXJ A;  4DV4 L;  4BY1 H;  2N78 A;  4B3S L;  1VQ8 A;  1MJE A;  3NEL A;  1Y14 B;  2FXQ A;  3GTL H;  4OXP A;  1IZ6 A;  2CWA A;  1OXT A;  5IWA Q;  1IBM Q;  2YTV A;  1AH9 A;  2HIV A;  2Q2H A;  4DV6 Q;  3TRZ A;  4A3L G;  3S17 H;  3A5U A;  3J7A 5;  2JA5 H;  1H95 A;  5JFZ A;  4JI2 L;  1CKN A;  4LFC L;  1XPR A;  1G29 1;  3AQQ A;  4DV5 L;  4GKK L;  2BA0 A;  4BBS G;  2GVB A;  1G51 A;  1N34 L;  2E5L L;  5GRO A;  3CMA A;  3OTO Q;  2ZJR A;  4KHP Q;  1PHJ A;  2UUB L;  3FKI H;  4FDB A;  1WFQ A;  1BVS A;  4DAY B;  1Y1W G;  1DGS A;  2JA7 H;  3I2Z A;  4XI8 A;  4M16 A;  3BU2 A;  2R92 H;  1KL9 A;  4HID A;  1XNR Q;  2RCN A;  2VQF Q;  2CKZ B;  4K0K Q;  4O0A A;  4A3B G;  4MNO A;  1FJG L;  4LUV A;  1Q46 A;  3GD7 A;  3PSI A;  1CUK A;  4P74 A;  2ES2 A;  3K8A A;  4A3L H;  2OQ0 A;  2VUM G;  4QJF A;  4LUZ A;  1X55 A;  4EX5 A;  5GAD C;  2VQE L;  4GNX C;  4DUY L;  3T1Y Q;  3HOU H;  5HGQ A;  2NVX H;  2E2I H;  1PVO A;  4GNX A;  1HJP A;  4A3M H;  3H15 A;  4DV7 Q;  2VZA A;  1PH6 A;  2R7Z H;  4DR4 Q;  3G48 A;  4UP8 A;  2JA6 G;  5IYD H;  3F8T A;  2CCZ A;  2ZTD A;  4YWK A;  3S24 A;  5AJ3 Q;  3UDG A;  4LFB Q;  4POF A;  1SR3 A;  2MFI A;  2MNA A;  3JC6 6;  3BJU A;  4JYA L;  2I5H A;  1M1K C;  3CCE A;  4P75 A;  5IWA L;  4X2D A;  3N3U A;  1E1O A;  4YCV A;  3PF4 A;  1X56 A;  3GTJ H;  3SE5 A;  4BBR G;  1Q1E A;  3I56 A;  3I4O A;  2ALY B;  4QGU A;  4X64 L;  4KHP L;  2G03 A;  3U50 C;  2AHO B;  1IBL Q;  3UDX A;  1N34 Q;  2E5L Q;  1VQB A;  2UU9 Q;  4KLK A;  4JI3 Q;  1XNQ L;  5C3E G;  4BXX H;  1U0L A;  4DR2 Q;  4DR1 L;  2HHH Q;  3FHW A;  4BBS H;  2PI2 E;  1I6H H;  4TVA B;  3RN5 A;  3KDF B;  5C44 H;  2JQO A;  4IFD G;  1L1O A;  2F4V L;  3K7A H;  3CD6 A;  1UE1 A;  1YBY A;  2HIX A;  2MO0 A;  5C4J H;  5JJI A;  1QUQ B;  5ELN A;  2KBN A;  4BY7 G;  3AFQ A;  3JAM c;  1OTC A;  2NN6 G;  4C3J H;  4RG1 A;  1NMG A;  1X9N A;  1VQG A;  5CMT A;  2WFW A;  3I7F A;  1HZ9 A;  4YWM A;  2K50 A;  3ULP A;  5C44 G;  1XMQ L;  1EQR A;  4IPH A;  4IOC A;  1PH4 A;  2OTL A;  2UXC Q;  4LF6 L;  2K14 A;  4C3I H;  5M5Y H;  2Q2U A;  5AJ3 L;  1C7Y A;  4ME3 A;  2UU9 L;  5GQO A;  1B8A A;  3PIP A;  1CKM A;  1SMX A;  5JFF A;  2E2H H;  4HIK A;  1S3O A;  3S16 H;  4WJ4 A;  3DLL A;  4DKA C;  5FLM G;  5IYB H;  4B3M Q;  3K81 C;  4LF9 L;  4QL5 A;  3M4Q A;  3I4N G;  3WWV A;  1OXX K;  4JBM A;  4YY3 Q;  2IY5 B;  5JEA J;  1X6O A;  4A4I A;  1Q7Y C;  2DGY A;  2Z6K A;  4R4C A;  1L2F A;  3GTO H;  4OO1 I;  3F2C A;  1NTG A;  1EWI A;  2K4K A;  4DUZ Q;  3HOY H;  2PQA B;  3OW2 A;  3W5O A;  1VQO A;  1I94 Q;  4GLV B;  4KI0 A;  4A3I G;  1TWA H;  2HHH L;  1E3P A;  4A3G G;  1GVP A;  4OX9 Q;  2IX0 A;  4BA1 I;  4JI7 L;  1X3G A;  4OWT B;  3F2B A;  4HJ8 A;  4A76 A;  4DR6 L;  3RLF A;  5GAE C;  4X65 Q;  2KHJ A;  4HIO A;  4HJ5 A;  1YIJ A;  3CP0 A;  4GLA C;  2YYZ A;  1IBM L;  4AQY Q;  3L0O A;  1VQJ A;  1UE7 A;  1D7Q A;  1HR0 L;  2KCM A;  3I4M G;  4U0S A;  1E24 A;  2Y0S G;  3UDI A;  1N33 L;  2N49 A;  3E0E A;  5JJK A;  3CQZ H;  1VQ5 A;  4BY7 H;  3L7Z C;  5IT9 c;  3J80 c;  3CF5 A;  3KF8 B;  2ASB A;  2UXB L;  3KOJ A;  5BR8 L;  3STB D;  4GKJ L;  1C9O A;  3PIO A;  5ELO A;  3G6E A;  1W2B A;  1JB7 A;  4B3M L;  3ICE A;  4DV0 Q;  3K7U C;  1GKH A;  3NEN A;  3RR5 A;  3M9B A;  4YHH L;  1Q82 C;  4OX9 L;  2YTX A;  4R4Q A;  4LUO A;  3J81 c;  4JBW A;  2ZTE A;  3I4M H;  1LYL A;  1FL0 A;  1HZA A;  2ID0 A;  5H1S E;  2UXD Q;  1Y1V H;  2BH8 A;  4R4O A;  4BY1 G;  4Y7N H;  3G71 A;  3PF5 A;  1KC8 C;  1VQ7 A;  5C0X J;  1K8G A;  3CCM A;  4A3F G;  4R1J A;  1Q8K A;  1KHI A;  1EIY B;  4JI0 L;  3HOX G;  4LF9 Q;  1YJW A;  1CKO A;  4L5T A;  4PZ8 A;  3PUY A;  4QY7 A;  1YJN A;  2A19 A;  3PUV A;  3CUC A;  2K5V A;  2I5M X;  2RHQ B;  3CW2 C;  4DV5 Q;  4TQU S;  2UUA L;  2OCE A;  4POG A;  2VUM H;  2IHE A;  2MQH A;  3CC7 A;  2ATW A;  2D0P A;  2A1A A;  2IHF A;  3H3V I;  4DR5 Q;  4DV0 L;  4A3D G;  3EIV A;  1VQM A;  1IYJ B;  2VY3 A;  1CSP A;  1I5F A;  1VQA A;  4AYB E;  3HOU G;  4DUY Q;  1WCM G;  5C4X H;  4YHH Q;  2ZJQ A;  3RZO H;  2NZO A;  2WB1 E;  1XNR L;  3K80 C;  3W1G A;  1LM0 A;  3M4P A;  1QVC A;  3HOZ G;  1XJV A;  3HOV G;  3ULL A;  3L2P A;  5LMU L;  1XMO L;  3HOW G;  3M4O H;  3CC4 A;  4GKJ Q;  3CXC A;  1VQN A;  1WCM H;  1JE5 A;  2WAQ E;  1PH2 A;  3CCR A;  3M7N A;  3KF6 A;  5IYB G;  2IT1 A;  3S14 H;  2QEX A;  4IOA A;  1K83 H;  1N33 Q;  2JA8 H;  3CCL A;  4A3D H;  1VQC A;  2WAQ G;  3PGZ A;  3HOV H;  4P73 A;  4JI4 L;  2OWO A;  2UXB Q;  4A3M G;  5JJ7 A;  2GVA A;  1HH2 P;  2AWO A;  2MO1 A;  5LMN L;  4HJA A;  3S2H H;  2WB1 G;  1QVG A;  4UY8 C;  4WJ3 M;  3GTM H;  2E2J H;  1N9W A;  1XMQ Q;  1XPU A;  5CGL A;  3LGJ A;  1TWH H;  4P71 A;  3DM3 A;  4IPC A;  3FKI G;  4NXM L;  4X64 Q;  1L1O B;  4O2D A;  1NJI C;  3S6A A;  3HKZ E;  4YWL A;  4JI3 L;  2F6S A;  3PO3 H;  2R93 H;  1YVC A;  5IYC G;  1KQS A;  1Y1W H;  1K73 C;  5FLM H;  4DR7 Q;  1UE6 A;  3RLO A;  2ZJP A;  4ALP A;  1UWV A;  5M5W H;  1V1Q A;  4JV5 Q;  2VW9 A;  4IPD A;  1S40 A;  1QZH A;  3MEF A;  2K75 A;  4DUZ L;  1J5E Q;  4NB3 A;  4IPG A;  2ZTC A;  2GN5 A;  3KJO A;  2K52 A;  2EQS A;  3GO5 A;  1JJC B;  1E7Z A;  3UE0 A;  3UE1 A;  3S2D H;  4JBJ A;  3S1Q H;  4DNI A;  1YJ9 A;  2OTJ A;  2JA9 A;  3CCQ A;  4JI7 Q;  4LF8 Q;  4X2E A;  2R7D A;  1L0W A;  1GO3 E;  3U58 A;  4NXM Q;  2JE6 I;  3TQY A;  3CC2 A;  4GLX A;  5JJ6 A;  4L5S A;  2EIF A;  2PNH A;  1NE3 A;  1A62 A;  1KRS A;  4JI8 L;  4X62 Q;  5LMN Q;  3RN2 A;  2KCT A;  3PUX A;  3ULJ A;  3EN2 A;  2CQO A;  1JT8 A;  5IP7 H;  4XIG S;  1MKH A;  3J80 i;  1KIX A;  2RF4 A;  4B3S Q;  2VQF L;  3BZC A;  1PH8 A;  1L1O C;  4X66 L;  4LF7 Q;  1TWG H;  3ZLM A;  1LUZ A;  4DV2 Q;  1K3R A;  2K5H A;  4YCU A;  1N8R C;  3G4S A;  4X65 L;  1K8A C;  4JI2 Q;  1PYS B;  3I4N H;  5M3M G;  3ERS X;  2VQE Q;  4APV A;  4DV1 Q;  5IP7 G;  2E8G A;  4EQ5 A;  1PH3 A;  4JI5 Q;  2I5L X;  4AH6 A;  3CCS A;  3K0X A;  5M3F G;  5GAH C;  1VQP A;  1E1T A;  4UP9 A;  4KHZ A;  4HJ9 A;  1Q81 C;  1VQK A;  3EBE A;  2BA1 A;  3PUZ A;  3S1N H;  3GTP H;  2PI2 A;  5BR8 Q;  4K0K L;  4LWC A;  4A3J H;  1VQI A;  1EFW A;  2R93 G;  2R7Z G;  4LU4 A;  1X65 A;  4U0Z A;  1YHB A;  3PCO B;  4DAM A;  3CAM A;  1KAW A;  1Z9F A;  1HR0 W;  2WP8 J;  1QVF A;  3E9I A;  2Q2T A;  4Y52 H;  4GOP C;  4A3K H;  2VS1 A;  4JG2 A;  4X6A H;  4DR7 L;  2QGQ A;  4A93 G;  4JI8 Q;  4DR4 L;  1XNQ Q;  1PH1 A;  3ZCB A;  4LFB L;  3CCJ A;  4DR2 L;  1NBW A;  1HZC A;  4U07 A;  3IRB A;  4BBR H;  4DV1 L;  2A8V A;  3J7Z C;  3B6Y A;  3A5Z B;  4GN3 B;  4X66 Q;  4JYA Q;  5C0X I;  2Y0S E;  3AEV A;  1PA6 A;  2KHI A;  2LSS A;  4NPS A;  3FP9 A;  2F4V Q;  3A0J A;  4A3K G;  4H02 A;  5C3E H;  5C0X G;  4DV2 L;  4OON A;  4BXX G;  2I0Q A;  4OO1 G;  3JAM i;  1BBU A;  3RNU A;  4DK3 C;  4DR3 L;  1QZG A;  5DLQ E;  3VDY A;  2UUA Q;  1SRU A;  4B3R Q;  1GM5 A;  3RLN A;  3CCV A;  1E22 A;  1M90 C;  2NVQ H;  3U4V A;  2B29 A;  4PG3 A;  3H0G H;  5FJ8 H;  4X62 L;  2AKW B;  4LFA L;  1TWF H;  1MJC A;  4PY3 A;  4NXN L;  4UP7 A;  5K36 G;  4UPA A;  2R6G A;  4DR1 Q;  2VL6 A;  1R9T H;  1HNX L;  2UUC L;  4LF6 Q;  1V9P A;  2JEA I;  2NVT H;  4AYB G;  4IJH A;  1N36 Q;  5IYD G;  5LMN W;  2H5X A;  2JA6 H;  1EYG A;  1YHQ A;  3S1M H;  2XGT A;  1VQD A;  1HNW L;  4A3E G;  2Z0S A;  3SHG A;  3J81 j;  3NBH B;  4HJ7 A;  1A8V A;  3ER0 A;  5GAG C;  1SN8 A;  1AE2 A;  1VQF A;  4JI1 Q;  1P16 A;  4DV6 L;  4OWW B;  2PQA A;  1WI5 A;  4DK6 C;  1HZB A;  4N67 A;  5M3F H;  4BA2 I;  3GDE A;  5FJ8 G;  3CCU A;  3H0G G;  1VQ9 A;  4LF4 L;  1V43 A;  1Q1B A;  1WYD A;  4PZ7 A;  4XTC S;  4WGJ A;  1T9H A;  3NEM A;  1IBK L;  4GN4 B;  1I50 H;  1I94 L;  1KRT A;  4P72 A;  3KJP A;  4PZ6 A;  3S15 H;  4A3B H;  4ITR A;  4RMF A;  4PMW A;  1ASZ A;  4A3C H;  4NXN Q;  3GTK H;  4LF5 L;  1YI2 A;  4JV5 L;  1G6P A;  1IL2 A;  3CME A;  1UE5 A;  1CKN B;  4R4T A;  1FGU A;  2QA4 A;  1BKB A;  2OQK A;  1PYB A;  3HKZ G;  2CFM A;  4GN5 A;  4JOI C;  3F2D A;  3TEH B;  4JI4 Q;  3TS2 A;  2D0O A;  4JOI A;  2D62 A;  1VQ4 A;  1Q86 C;  1LTL A;  1VCI A;  4LFA Q;  1SRO A;  1PV4 A;  3AFP A;  3D31 A;  1PFS A;  1Y1V G;  1NY4 A;  2V1C C;  4A75 A;  2EXD A;  1N36 L;  1K9M C;  2R7F A;  5J3B A;  1HNX Q;  4LNQ A;  4AIM A;  4IJL A;  1K0R A;  4A3C G;  4YCW A;  3RZD H;  2YU9 H;  2F3I A;  5EAY A;  1S72 A;  1IBK Q;  5JJL A;  1WJJ A;  1JMC A;  1VS0 A;  3KYH C;  4LFC Q;  4GKK Q;  1HNW Q;  3KDF A;  1PH9 A;  1EUJ A;  1X3E A;  4IO9 A;  1WOC A;  5IY0 A;  2ZM6 L;  3S1R H;  4B3R L;  3MXN B;  3I55 A;  3J81 i;  4LF7 L;  4AQY L;  1PH5 A;  1ASY A;  1U5K A;  4LF8 L;  1VQE A;  3T1Y L;  2JA7 G;  4QQB X;  1KXL A;  3E9H A;  1TWC H;  4LF4 Q;  3OYY A;  4MZ9 A;  4QIW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...