4NPSA

Crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
281
Chain Sequence
b'QALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLRQEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMIFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRIFCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECINSLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTLKLGDECTITVPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
publication title Crystal Structure of Bep1 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae
molecule tags Cell adhesion
total genus 105
structure length 281
sequence length 295
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4npsA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4npsA02
4X62L 4EQ5A 3UDGA 3F8TA 2UUAQ 4JOIC 1PH5A 1C9OA 2ZTEA 4MNOA 1GO3E 2FXQA 3UDFA 1VQBA 4R4OA 3CMEA 4B3MQ 3J80c 5IWAQ 4C2MH 1I3QH 3W1GA 4JI0Q 1K83H 4N67A 5JEAJ 3UE1A 4X66Q 3G4SA 1QZHA 1TWHH 2JA7G 4DR2L 1E3PA 4BXXH 3KJPA 4DR5Q 1V43A 1B7YB 4YWMA 2PNHA 3CCSA 4NXML 4L5SA 3E0EA 2JJQA 4LUZA 2E5LQ 2ASBA 4A3EG 1A62A 1VQFA 5C44G 1AE2A 1UE7A 4GN5A 1CKOA 3F1ZA 3K7AH 4DUZL 4DV1Q 3UDIA 4HJ8A 4A93H 3I56A 2JA5G 3RLNA 4A3MG 1EOVA 2EQSA 3KDFB 3ICEA 1L1OA 3CUCA 2N3SA 4IPDA 1Y1WH 4DR3Q 4LFAL 1FGUA 3TS2A 1UE6A 5LMNQ 1QVFA 1E1OA 5C0XG 1T9HA 2WAQG 1N34Q 3S1NH 4QJFA 2VUMG 1J5EQ 3L2PA 2R6GA 4JI2Q 4JI3Q 1TWFH 4QGUA 4DR6L 1Q1EA 3RNUA 1M1KC 1NMGA 1IBMQ 1PVOA 3D0FA 2GVAA 4DV3L 2EIFA 1MJCA 2OTLA 4JI5Q 3HKZG 4OX9Q 5IP7H 4RMFA 4UP9A 1XNQL 1YHQA 2D62A 1GD7A 3H3VI 4A3BG 2RHQB 3GDEA 3TEHB 3I2ZA 4YCWA 1OXVA 2LSSA 1XNRL 4DR4Q 4DKAC 4QL5A 5C0XI 3F2CA 2JA6H 2R7ZH 2PI2A 1SRUA 1YHBA 2ZM6L 1K8AC 1C0AA 2R93H 4J15A 5IYCH 3GTJH 3FP9A 2UUAL 5C4JH 2PI2E 4LFCL 2MNAA 4IOCA 1XPOA 2KENA 2ZJQA 2B3GA 1G291 4YCVA 5EU0A 2HT1A 3AFQA 4X6AH 2QA4A 2Y0SE 2ZJRA 4K0KL 2VQFL 4JV5Q 1GKHA 4U04A 3I55A 5BR8Q 1YJWA 1AE3A 3A74A 1VQOA 3J81i 1M90C 2N49A 4X62Q 4DNIA 2F52A 1WCMH 2B29A 4A93G 5C3EH 2I5LX 4KHZA 1VQGA 1LM0A 1Y1WG 3I4MH 5M5XH 2HQLA 2UXDL 1HH2P 3NELA 2I5MX 3AQQA 2Z0SA 4UP8A 3DLLA 4DR2Q 4GKJL 4DR3L 2VNUD 4JI6L 3JC66 1VQ6A 4NXMQ 1K3RA 3ERSX 4IJLA 1YHAA 3K8AA 1K0RA 2BA0A 2Q2TA 1PYSB 1YJ9A 4DUZQ 1Q81C 1N8RC 4JI4L 1EUJA 4LFAQ 4C3HH 3T1HL 4LF6Q 1VQAA 4APVA 2OCEA 3L0OA 2NVQH 2E2JH 1E7ZA 4R4CA 2JA5H 1Q12A 3ULPA 3RZDH 4OX9L 3HOXH 4A3MH 3CD6A 4DAMA 1IBLL 1VQKA 1KHIA 4GLVB 5AJ3L 2OWOA 2R7ZG 4A3KG 3GTOH 1XMOL 3TREA 5M5WH 3FKIH 3VDYA 2R93G 2Q2IA 1VQ9A 3UDXA 3GTGH 4TVAB 3NENA 4H02A 1R9TH 1OTCA 1LYLA 2ZTDA 1EWIA 3KOJA 2VUMH 4DV3Q 1PH9A 2NN6G 1H95A 4XIGS 3L7ZC 2PQAA 5FJ8H 3CCVA 1GM5A 1XNQQ 3S15H 4YWKA 1AH9A 3U50C 5JJKA 1V9PA 3TQYA 4A3JH 1PYBA 1A0IA 4P75A 3STBC 2F6SA 2E8GA 1QZGA 1U5KA 1XNRQ 1OXTA 3CXCA 3PUWA 1WCMG 4JBWA 3CMAA 4PY3A 4XI8A 5C3EG 1D7QA 1N32L 4BY1G 4EX5A 1GVPA 4LF5Q 1NBWA 3CCQA 1OXSC 2AHOB 5J3BA 4JOIA 4GOPA 1YITA 1I50H 1X55A 4LFCQ 3I4MG 1BVSA 2R7FA 2VY3A 3CCLA 1NTGA 1WJJA 1L1OB 2MO1A 2NN6I 3LGJA 3S6AA 1PH8A 4K0KQ 1X9NA 2VQFQ 4IFDG 3RLOA 4LNQA 1L2FA 4JYAL 1WYDA 3STBD 4OWTB 4A3CH 4P74A 3OTOL 1YNXA 2I0QA 4JBMA 2NZOA 4GN4B 2R7DA 2XTIA 3SGIA 2WP8J 2HHHL 4LF8L 4A3BH 3HOWH 5JJLA 2JEAI 2K4KA 4GN3B 2RF4A 4A3LH 4KI0A 4AQYL 1PA6A 3F2BA 2LXJA 2WB1E 4A3GH 3CC7A 1VQJA 1KC8C 1N36L 4HIDA 3HOVG 3SE5A 5JJ6A 3D31A 3J80i 2UXDQ 3HOXG 4A76A 5M3FH 3K0XA 4LF6L 1BKBA 3M4QA 1HNXL 4GKJQ 1YBYA 4JI6Q 4DV2L 1I5FA 2H5XA 2KHJA 3FKIG 2JA8H 2DUDA 3JAMc 4IFDI 4A75A 4WJ4A 1D8LA 1SROA 2ID0A 4YWLA 4AH6A 4DR1L 4A3FH 2JQOA 3CCUA 4R4TA 4NPSA 1BBWA 1MJEA 2Q2UA 2K75A 5ELNA 4IO9A 1VQNA 1JT8A 2KCMA 5FJ8G 1HZBA 4GNXB 4JI4Q 3T1HQ 2UXBL 3U4VA 1IL2A 3EIVA 4A3JG 2ATWA 3GTPH 3S16H 5EAYA 1CSPA 4LUOA 3PIPA 4IJHA 4DV0L 2YU9H 1IBLQ 4LF9L 2D0OA 4JI8L 5AJ3Q 3S1RH 1L1OC 2C35B 2I5HA 3ZC7A 1XMOQ 1K73C 1FVIA 4KLKA 1OXXK 3UE0A 1EFWA 2MQHA 1TWGH 4DV6L 4O2DA 4C3JH 4A3KH 3E9IA 2BH8A 2K52A 4LF5L 3S2HH 1JJCB 3EBEA 5C0XJ 2YTXA 4FDBA 1YEZA 3RR5A 1HZ9A 4B3RQ 2GVBA 4X2EA 4JCVE 1PV4A 2Y0SG 3TRZA 1Q8KA 1JJ2A 1VQ5A 4BA2I 4A3CG 1KXLA 4P72A 4IPGA 1IZ6A 1WI5A 4JG2A 1FJGQ 5M5YH 3HOWG 2NVYH 1K9MC 4ALPA 4LU4A 3PIOA 3N3UA 4X2CA 2UU9L 3K7UC 2JEBI 4A3LG 3G6EA 1N32Q 4HIKA 4L5TA 2BH2A 3KYHC 4A3GG 3H15A 5K36G 3PGZA 4GS3A 2UXCL 1B8AA 2B63H 1CKNA 2Z6KA 3J7ZC 5M3FG 1W3SA 1N9WA 4GLXA 4BY1H 1HJPA 2YYZA 5H1SE 3PO3G 2IHEA 3KLWA 3F2DA 1TWAH 1Z47A 2JA8G 4X2DA 4PZ8A 4JYAQ 1PH3A 4GNXC 3KF6A 2CCZA 1X65A 3ZJYC 4IPHA 1G51A 3OTOQ 2HHHQ 4A3DG 1Y1VG 4A3FG 4LF8Q 2F4VL 4OO1G 2JE6I 4HJ5A 1SE8A 1Z9FA 3PF5A 2IT1A 2VS1A 1HNZL 4DAYB 3PF4A 2AMCB 4AIMA 1Q7YC 4AQYQ 1ASYA 3BU2A 3EN2A 3PUYA 1K8GA 1N36Q 5E7NA 4A4IA 2DGYA 4YY3L 4DK6C 4HIMA 2N8NA 1S72A 4M16A 1I94L 4BBSG 2PQAB 5M3MG 1VQ4A 2NVTH 5GADC 4DV5L 1PH4A 1G6PA 1FL0A 1HNXQ 3HOVH 1XPUA 1IXRA 3ULJA 1N33L 3CCMA 4DV2Q 1Q82C 3BJUA 4DPGA 4LUVA 4LF7L 2F3IA 1NJIC 1YVCA 3S24A 3CCEA 1QVGA 2A8VA 4DR1Q 5JJ7A 2RCNA 4L5QA 4AYBE 4B3TL 4Y52H 5CMTA 2MFIA 4R1JA 1YJNA 4GOPB 3HKSA 4L5RC 4POGA 3HOZH 1NY4A 3GO5A 3G48A 2UXBQ 3CQZH 3ZCBA 1HZAA 1XMQL 1JMCA 5ELOA 5JFFA 3PCOB 1Q1BA 2NZHA 4DV0Q 3U4ZA 1KL9A 4LF9Q 3AFPA 4JI8Q 2IX1A 4LFBL 3CCRA 2CWAA 1P16A 2GN5A 3FHWA 1FJGL 5IP9G 1HR0L 2A1AA 2K5HA 2AWOA 1PH1A 2B63G 3ZLMA 4PMWA 3I4NH 1VQMA 4DV6Q 3IRBA 4ME3A 2LXKA 2KCTA 1RIPA 1UWVA 2K5VA 4OXPA 3AEVA 5DLQE 3T1YL 5FLXc 4UPAA 3TS0A 1HR0W 4C3IH 3CC2A 1WOCA 1CSQA 1J6QA 1QUQA 4U0UA 1Y14B 3AYHB 1S40A 3NEMA 4TQUS 3KFUA 2OQKA 4HJ9A 2CKZB 4MZ9A 5JEAG 5GQOA 4O0AA 4JC0A 1W2BA 3GTQH 4KHPL 1HNWL 4P71A 5HY6A 3GTMH 1NMFA 4DK3C 1KRSA 1O7IA 1JB7A 2UU9Q 1KD1C 3PUVA 5GAHC 3CAMA 1X54A 2UXCQ 1EYGA 3CC4A 2E2HH 2VL6A 4DV4Q 4GKKL 5JJIA 2WB1G 1X6OA 3G71A 4IOAA 4NXNL 2G03A 1NE3A 1KQSA 3OYYA 4UP7A 4DV7L 4GOPC 1X3EA 3PUZA 3SHGA 3W5OA 4X64L 4DUYL 2UUBL 4JI7L 3S1QH 3PO3H 3DM3A 4DR7L 2F4VQ 3W1BA 2PMZE 2QGQA 4BA1I 4YHHL 3WWVA 1VQ8A 1HNZQ 3H0GH 2R92H 3M7NA 1V1QA 2L15A 1ASZA 3HOZG 4A3DH 1Y1VH 2N78A 3MEFA 2YV5A 4JBJA 4IFDJ 2QEXA 2VW9A 1SLJA 4YY3Q 4HJ7A 3CCJA 1EIYB 1I94Q 4HIOA 5C4XH 4IPCA 4HJAA 3HOUG 5FLMH 5CGLA 2AKWB 3S2DH 4X65Q 4DV5Q 5LMUL 4B3RL 2IHFA 2ALYB 1N33Q 1KRTA 3PUXA 4BBSH 5M3MH 4LF7Q 5CKLA 3JAMi 4ITRA 3I4NG 2JK8A 4BBRH 4B3SL 4QQBX 4B3TQ 2K14A 4U07A 2KHIA 3KF8B 4LWCA 1PFSA 3BZCA 1CUKA 3I4OA 1CKNB 3CP0A 2UUCL 1IBKQ 2CWPA 5IE8A 1XMQQ 2WAQE 4UY8C 1SR3A 4U0SA 2KBNA 1YZ6A 3HFZB 1VQCA 4OONA 2WFWA 3M85A 1SFOH 3HOYH 4LFBQ 3KF6B 2EXDA 1P8LA 2OTJA 1VQDA 5IY0A 3RN2A 5GAEC 1HR0Q 3HKZE 3NBHB 3M3YH 3B6YA 2CQOA 3KDFA 5IYDH 1I6HH 1VQ7A 1KAWA 2XGTA 1PHJA 3OW2A 1IYJB 1PH6A 3S1MH 4POFA 5IP9H 3T1YQ 3A5ZB 3CPFA 1XPRA 2VZAA 2VQEQ 2IX0A 4P73A 4DV4L 1EQQA 3A0JA 4LF4L 3J81c 4WJ3M 3E9HA 4BY7H 1HNWQ 4KHPQ 1XTDA 1VQPA 2NVXH 1JJGA 4GNXA 3S14H 3ULLA 1X56A 3H0GG 4PZ7A 3CPWA 2R92G 3M4OH 4YCUA 2E2IH 3RLFA 4A3IH 1UEBA 3BZKA 4B3ML 4BXXG 5IWAL 2JA9A 2IY5B 3PO2H 5C4XG 1VQIA 4GKKQ 4JI0L 5FLMG 1VQEA 4X66L 4LW1A 3SN9A 1E24A 3PV0A 3K81C 1A8VA 4MTNA 4NXNQ 3GTLH 4JI1Q 4DR5L 5IYBH 4NB3A 4DV7Q 1C7YA 2MO0A 2UUBQ 1X3FA 4X64Q 4DUYQ 1YI2A 2E5LL 1X3GA 5GAGC 4R4IA 2Z6KC 3I7FA 4X65L 4JI7Q 4DR7Q 4JV5L 4PG3A 1A63A 2BA1A 2YTVA 3J7A5 4BBRG 3K80C 4YHHQ 3J81j 2Q2HA 4DV1L 1Q86C 1VQHA 1S3OA 1LUZA 4AYBG 2A19A 4QY7A 3LETA 1Q46A 1RL2A 4JBKA 5HGQA 2JA7H 3GTKH 3HOYG 1CKMA 5GROA 5LMNL 5LMUQ 1MKHA 1QUQB 1OXUA 2YTYA 1DGSA 3A5UA 1YIJA 1N34L 1IBKL 1J5EL 1VS0A 4OWWB 4JI2L 3RN5A 4JI3L 3HOUH 3RZOH 3GD7A 1HZCA 3U58A 5IP7G 4A3EH 2AWNA 1XJVA 2CFMA 5JFZA 5C44H 4XTCS 4U0ZA 5LMNW 5IYDG 1PH7A 1IBML 5IT9c 4B3SQ 4WGJA 1LTLA 4JI5L 2OQ0A 1VCIA 1TWCH 4GLAC 1L0WA 1TXYA 3MXNB 2UUCQ 2JA6G 3H3VH 2V1CC 1QVCA 4RG1A 5IYCG 4BY7G 1B70B 1WFQA 3Q8DA 1MIUA 2VQEL 4DR6Q 4DR4L 2HIVA 3CF5A 4Y7NH 1VQLA 2RHSB 1BBUA 1UE5A 4A3IG 3S17H 2ZTCA 1EQRA 3KJOA 4OO1I 2D0PA 1U0LA 3PSIA 1SN8A 4OWXB 3PO2G 3M4PA 2HIXA 1E1TA 2ZJPA 1JE5A 5IYBG 1KIXA 4LF4Q 2K50A 4QIWE 1PH2A 4R4QA 1UE1A 1SMXA 1E22A 5BR8L 3M9BA 2K5NA 1EIFA 2ZM6Q 4PZ6A 3CW2C 3ER0A 2ES2A 4JI1L
chains in the Genus database with same CATH superfamily
5CR3A 4I7ZC 2K05A 1C9OA 5E1FA 1VQBA 3R2TA 5EKKA 4B3MQ 5IWAQ 4PV1C 1B9NA 3UE1A 2JA7G 1QZHA 1E3PA 4J1MA 3KJPA 1SYDA 1B7YB 4A3EG 1D1KA 1F9RA 1R4PB 4GN5A 4Q0FA 1TIID 4C3HG 3F1ZA 3J81L 3OIQA 4HN7A 2RCFA 3K6OA 1BBXC 5EBCA 4KV6A 2Z8LA 1X3QA 2XNAC 1J8IA 1IKMA 1CQVA 1GUTA 2EYJA 5LMNQ 1N34Q 3S1NH 2WAQG 2LS01 1J5EQ 2R6GA 4JI3Q 4FNFA 3E5SA 1CHPD 5D65A 2DJFC 2RDGA 3HOWB 4QUFA 2OTLA 5IP7H 1XNQL 1YHQA 3BZDB 3Q22A 1AW7A 4F7XA 1EU4A 4A3BG 3TEHB 1XNRL 1WTPA 1Y1WB 3QR8A 3NHHA 1SRUA 5G3LD 3H09A 2R93H 5IYCH 3GTJH 1CK1A 2UUAL 2NUCA 2PI2E 2MNAA 1XPOA 4G7ZC 2F0PA 4X6AH 4O42A 2ZJRA 1STGA 2RDHA 3I55A 1Y8OB 1YJWA 1VQOA 3HGBA 2IJ0A 2YU9B 3S1RB 2EXZA 5M5XH 2UXDL 1PYWD 1WVLA 3NELA 3IAYA 4A3KB 2Z0SA 2RSOA 1TT2A 4IFDH 5CV4A 3JC66 3VR6A 3K8AA 4C56C 2Q2TA 1A3TA 1YJ9A 1JR0D 4KD4A 4LF6Q 2Q8RE 3DXJC 3IFTA 4QB4A 1H9SB 2E2JH 2JA5H 2NWGA 5C3EB 4DAMA 1IBLL 1A15A 2NUNA 3GTOH 1QG7A 1W6JA 1VQ9A 2R93G 4ILWA 4GZYC 3NENA 2XN9C 4X3TA 1EY6A 2KQ3A 1LYLA 2VB3X 3TDQA 1IKLA 3TBIB 2L0CA 1H95A 3D4RA 5FJ8H 5ELBA 1GM5A 4DU9A 5AFWA 2J7ZA 5CORA 3TQYA 1H9MA 3D6CA 1G2TA 2E8GA 3PUWA 1UAPA 1SNPA 2ZT9C 1JOQA 1GVPA 2PZWA 1OXSC 4G4KA 3HOXB 4LFCQ 3R2IA 2Q8IB 3OWEB 2R7FA 3CCLA 4PQXA 2ZXOA 4LJZC 3WOEA 3S6AA 1PH8A 1X9NA 3IFDA 4IFDG 4H44C 3RLOA 1L2FA 1WYDA 4OWTB 1C4QA 4GN4B 3HOWH 1RJTA 2JEAI 5JJLA 3QWNA 4X3UA 4A3JB 3NBIA 2WB1E 1V1PB 1DXMA 2NTSA 1BKBA 1HNXL 1B3QA 4KKSA 4JI6Q 2DUDA 5HURA 2BDOA 3JAMc 4NDXA 2ID0A 4XYOA 4DR1L 1PXUA 1RF2D 4A3FH 1SAPA 2LFNA 4R4TA 4NPSA 1I4QA 1TS2A 2KCMA 1HZBA 5FJ8G 4JI4Q 3T1HQ 1GUSA 1RODA 3EIVA 3BDOA 1CSPA 4LUOA 1CA6A 3W2DA 3PIPA 2YU9H 3A8KE 2DNCA 3S1RH 5AJ3Q 1BCPC 4A3GB 2I5HA 4KLKA 4KY7A 4A3KH 1QWYA 1YNNC 4O2DA 4RAUC 1NSNS 5KNCA 1S5CD 5JJZA 1YEZA 1B9MA 4HAEA 1SYEA 2G5DA 1PV4A 2WKDA 1VQ5A 2NN6H 1LT3D 4P72A 1IZ6A 4FF1A 3HOWG 4ALPA 4LU4A 1JE4A 1N32Q 3GTPB 2V4DA 4ZKCB 3KYHC 3H15A 1AZQA 2PYKA 2B63H 1CKNA 2Z6KA 3WDNA 3VA5A 2NBFA 1HJPA 4OELB 5I6YA 5E3FA 1Z47A 2F03A 4GNXC 1TY2A 2KJXA 2HD3A 4IQZA 1B2TA 4A3FG 1AP0A 1ZXTA 2WACA 2VXWA 3MXPA 4ZCKA 4AQYQ 3BU2A 1K8GA 1N36Q 2K33A 1S5FD 5E7NA 2DGYA 4DK6C 2N8NA 5CC4A 3H94A 5M3MG 1I6HB 5I9PA 4DV5L 1L0YB 1PH4A 1XPUA 4K6LA 5KNDA 3ULJA 1N33L 3CCMA 4DPGA 2E76C 4LF7L 2F3IA 1I4GA 3CCEA 1QVGA 1QB5D 1K28A 1TWAB 4B3TL 4R1JA 1YJNA 4GOPB 4POGA 4CKBA 3GO5A 5ELOA 3MFGA 4ZRZA 1Q1BA 2OEOA 4DV0Q 4K5WA 4EQPA 3AFPA 2F0SA 2KHSA 1F9QA 2SEBD 1P16A 3FHWA 5IP9G 2WB1B 2B63G 4PMWA 4CDCC 1VQMA 2WKCA 1RIPA 3A7AB 2F0OA 3X3MA 4NP5A 1WOCA 1CSQA 4BWGB 4K5VA 2D9UA 3OPOA 4HJ9A 4RWSC 2FINB 4JC0A 3N6RA 1W2BA 4ZYSA 1KTKA 1NMFA 2K28A 3I8ZA 3CQZB 3E3XA 4CJ1B 1AFPA 1EU3A 1SNCA 1EYGA 2E2HH 4WRDA 1RKNA 5C44B 4GKKL 1X6OA 4NXNL 1STHA 3MFYA 3TSSA 4UP7A 1TWCB 5DNFA 3W5OA 4JI7L 3SR1A 1KDAA 3VR4A 2WINB 3VR5A 3W1BA 4BA1I 3SVMA 1SDFA 1T5EA 3H0GH 2O5JC 4Y7NB 3M7NA 2N78A 3MEFA 2YV5A 3TP5A 2QEXA 3PIP3 1STNA 3HOUG 4N9PA 3GTMB 2QCPX 5FLMH 2MPMA 4B08A 3HKZB 1RTNA 3I4LA 3PUXA 4QUCA 3JAMi 4OHJA 2CH4A 3GTQB 4BBRH 4B3SL 1BUVT 1EEID 2AQ1B 2KHIA 2MJ8A 3KF8B 3TZUA 4U68A 1STEA 3CP0A 1SYFA 4R8NA 2WAQE 3AU7A 1I3QB 2EYMA 1LV9A 2SOBA 3RMHA 1VQDA 5IY0A 5EGTA 5G3LF 2Q8TA 5GAEC 2K32A 3M3YH 3B6YA 1SYCA 3ZYYX 4K2LA 4KHVA 1I6HH 2XGTA 1PHJA 1S5DD 1IYJB 3T1YQ 1XPRA 1IL8A 1F2YA 1LLRD 2IX0A 4C1NK 3JAME 1EQVA 3E9HA 1I4PA 4BY7H 3H0GG 1BNZA 1XTCD 4YCUA 1VMPA 4B3ML 5IWAL 2K1BA 3PO2H 1VQIA 5FLMG 4LW1A 3SN9A 4S3SA 2F3WA 1CI3M 5JVH3 4DV7Q 1C7YA 2MO0A 3MWYW 1X3FA 3NWSA 1YI2A 5GAGC 2Z6KC 1EY8A 4K5XA 4DR7Q 1A63A 4PG3A 3KUPA 1TVXA 1LO5D 2BA1A 3J7A5 4BBRG 3K80C 4IUQA 4YHHQ 2Q2HA 1EY0A 4CBVA 1G8ZD 2R7ZB 1LUZA 1GOZA 4FXDA 4AYBG 2ZXRA 1Q46A 3S14B 3GTKH 5LMNL 1MKHA 1SE2A 1N34L 1IBKL 1J5EL 1VS0A 4JI3L 1HZCA 5K36G 5C44H 2SNMA 1U4RA 2A74C 1VCIA 1TWCH 4GLAC 1L0WA 1TXYA 2JA6G 3HEJA 3SK6A 5KEEA 4BY7G 1WFQA 2VQEL 3CF5A 4Y7NH 1VQLA 3HP3A 1BBUA 1UE5A 3KLSX 1U0LA 4DA2A 1SN8A 3PO2G 4WORA 1SBBB 1Y8NB 2A6ED 1H9SA 3RZOB 5C3XA 1ICWA 4UHVA 1IYUA 4LF4Q 1PH2A 4C3HB 4DFAA 1UE1A 1SMXA 1E22A 2EYOA 2ZM6Q 2K5NA 5DM63 4TQUS 3CW2C 3GTQH 1CQFA 3RZDB 5JVG3 3F8TA 4JOIC 4DF7A 1S5BD 1GO3E 2FXQA 3UDFA 3CMEA 1I3QH 2DN8A 2G9DA 3W1GA 1R9TB 1PZKD 5JEAJ 2EYPA 2F0LA 3A56A 2PNHA 4LUZA 1AEXA 5C44G 1AE2A 2M9VA 2WIIB 3K7AH 4HJ8A 4DV1Q 1CTMA 3R8BA 4IUTA 2QDBA 3SXHA 3BYYB 3RLNA 3K0YA 1F77A 4A3MG 3SK8A 3KDFB 2N3SA 3CUCA 1EOTA 4IPDA 1JICA 1I50B 1GUWA 1QVFA 1E1OA 1LTSD 5C0XG 1T9HA 4NW2A 4QJFA 5DAUA 1MHWC 1DOMA 4XQNA 4DR6L 2Z9HA 5FO9B 3RNUA 1M1KC 1NMGA 1PVOA 1V1PA 3D0FA 1PMRA 3D6WA 4FVMA 4OX9Q 3HKZG 4RMFA 4UP9A 4JVZA 1T5XD 1GD7A 2D62A 3H3VC 4G7OC 3H3VI 4I7AA 1OXVA 3U9OA 5JPMC 2EJMA 3F2CA 2R7ZH 1ONLA 2PI2A 1C0AA 4R9WA 4J15A 2KUMA 3QOJA 4LFCL 2KENA 3NUCA 3F2UA 2B3GA 3S1NB 4DNRB 2HT1A 4IUPA 1JOOA 1II3A 4JV5Q 1EEFD 1EQTA 3TP7A 3SHLA 3C2PA 3S16B 2EZVA 2N49A 4X62Q 4DNIA 5FLXL 2I5LX 1G6ZA 2BE5D 2TSSA 1SEBD 1STBA 2I5MX 3AQQA 4UP8A 4DR2Q 2NZ1D 2R93B 4DR3L 2VNUD 3GTJB 4JI6L 4OGQC 1VQ6A 1YHAA 3C46A 1QOHA 3OMCA 4DUZQ 5M5YB 1Q81C 1N8RC 4JI4L 4LFAQ 4C3HH 3T1HL 2K03A 4APVA 3J80L 3ULPA 4EGVA 3RZDH 4IUUA 2OWOA 1KHIA 5AJ3L 1I4XA 2R7ZG 2HCCA 4HSPA 4M8AA 3UDXA 5BN5A 3G7LA 1R9TH 1OTCA 4MHEA 1EWIA 3T16A 3H6MA 1QNKA 4YWKA 3DM1A 1V9PA 1HA5A 3DHQA 4O1NA 1PYBA 3C3LA 1KNAA 1A0IA 2F1MA 4V190 3STBC 2J0TD 4RKBA 3L9AX 1QZGA 1U5KA 1OXTA 1H9RA 1D7QA 1N32L 2IW3A 4LF5Q 1DYQA 4GOPA 5J3BA 1I50H 1X55A 2EE1A 5EPKA 1NTGA 1WJJA 2ENBA 2F0DA 3GTOB 2NN6I 3LGJA 3SK4A 4K0KQ 4OEMB 2FMMA 4A3CH 4P74A 1GJXA 4JBMA 2B2UA 4HMIA 4GN3B 4ZQ3A 4A3LH 3RD4A 4AQYL 1I6VC 2FJ2A 2LXJA 1PA6A 1LTID 3CC7A 1ENCA 1N36L 3HOVG 4HIDA 5JJ6A 3D31A 4MIUA 2OF1A 4A76A 2B39A 2K6AA 2F0UA 3K0XA 4GKJQ 2RQXA 3AB9A 2JA8H 1I5FA 2H5XA 2KHJA 4KY5A 4KMUC 4WJ4A 3HRZC 1SROA 3EFXD 4YWLA 1O7LA 5I2YA 4FF2A 2E75C 1BBWA 2HDLA 1MJEA 2Q2UA 5ELNA 1JT8A 1IYVA 3NWTA 3U4VA 1NH1A 4DXFA 3S16H 5EAYA 4R8IA 4DV0L 1TKWB 4ULLA 2KEDA 5LL6S 1D5XC 2C35B 3GQBA 3L3OC 4YIJA 1XMOQ 1FVIA 2NUDA 2PW5A 4C3IG 2MQHA 1TWGH 1M4VA 4C3JH 4ABNA 5CMDA 2BH8A 2EPBA 4RGMA 1HQRD 1JQYD 4V0BA 3RR5A 4A3FB 2Y0SG 4A3CG 1E2VA 5IT9L 1PFNA 1FJGQ 4JG2A 5M5YH 3OW7A 3N3UA 3CRLC 4A3LG 3G6EA 4HIKA 1F9SA 3KF8A 5M3MB 4GS3A 1JC7A 2R3ZA 5ELFA 3PO3G 3F2DA 2DY7A 2JA8G 4PZ8A 2GA4B 1PH3A 1A2UA 4N8X1 4IPHA 1G51A 3OTOQ 1WTRA 4A3DG 2L5TA 2JE6I 2VS1A 4DAYB 1BF4A 2AMCB 4RH6A 2L55A 1F2ZA 1RTOA 4BBSG 4NMZA 1TU2B 1ZYRD 1C48A 1IXRA 4J6HA 4DV2Q 1Q82C 3BJUA 2B63B 3SK5A 4MTKA 3S24A 1V1OA 3FMCA 1DZ1A 5TSSA 4RHSA 1KABA 4C3JG 2RCNA 4L5QA 1B1ZA 4AYBE 2MFIA 3QG1A 4F8MA 3HKSA 4BS9A 3M4OB 4KN7C 3HOZH 1DD2A 1YNJC 2UXBQ 3ZCBA 1B44D 4KKUA 2Z6BA 5JFFA 4K8IA 2NZHA 1LTBD 4LF9Q 1TR5A 2IX1A 4JI8Q 3P75A 3BDLA 2PW7A 2GN5A 4HCSA 2AWOA 3I4NH 4IALA 4DV6Q 2LXKA 2F0HA 4OXPA 4WFN3 3AEVA 3T1YL 5FLXc 3TS0A 1DONA 1RD9D 1PRTD 3OSOA 5IGEA 1J6QA 3AYHB 3KFUA 1MGSA 3NEMA 2DY8A 2CKZB 4DNTB 5GQOA 3K58A 1K8MA 2BCOA 2CW0D 5IGDA 4CJ2C 1QE6A 1O7IA 2UU9Q 2E2DC 3HOUB 1PFBA 5IGCA 1VDZA 2VL6A 4DV4Q 2G9HD 5JJIA 2ZXPA 2QF7A 3G71A 4IOAA 4L63B 2G03A 3I72A 5CBEE 4DV7L 4GOPC 1X3EA 1GXDC 2MUYA 3BDCA 3DM3A 4DR7L 2F4VQ 4YHHL 3WWVA 1HNZQ 1K3BC 1V1QA 3HOZG 1ASZA 2B2YA 3S17B 2VW9A 1SLJA 4HJ7A 4ID6A 2B2UC 1I94Q 1R4QB 2AKWB 1HTPA 1F9PA 4X65Q 1LTTD 1EL0A 1PDQA 2EY5A 5FK9C 3Q0AA 2E2HB 5M3MH 1W6KA 2O4XA 2XRSD 2ICIA 3DEPA 3I4NG 3OWFA 1O7ZA 4LWCA 3CHBD 2FMCA 3BZCA 3I4OA 1ILQA 1XMQQ 5IE8A 2MHVA 1XWEA 2DNEA 3HS0C 4C2MB 3H0GB 4U0SA 1K83B 1YZ6A 3HFZB 1VQCA 4OONA 2WFWA 1TWHB 2EXDA 4XQJA 4OIKA 3RN2A 3TP6A 3HKZE 3NBHB 3NXWA 3KDFA 1WD0A 4CDEC 2QEJC 3S1MH 4POFA 5IP9H 4CJ0B 4LF4L 1EQQA 3MXUA 2B2VA 3J81c 4BBRB 4FO2A 1HNWQ 5C4ZA 3ULLA 1X56A 3M4OH 1LT5D 4AYBB 2E2IH 3NTKA 3BZKA 4BXXG 2IY5B 3FPUB 3VYTA 1U9RA 1DOKA 5C4HA 1VQEA 3NE5B 3PV0A 3TMEA 4FF4A 2JN4A 2F0NA 4JI1Q 1ESFA 5IYBH 3M3YB 1RHPA 4X64Q 4DUYQ 1X3GA 1F2LA 2F0IA 2M2LA 3J81j 4K14A 4DV1L 2JP1A 5IGGA 2JA6B 1SMYC 4BY7B 1X3PA 1EZ8A 1BDOA 5HGQA 2AQ3B 2HUGA 3MHBA 4Y52H 5LMUQ 5GROA 4B3RQ 5M9OA 1OXUA 2YTYA 4OWWB 4KTAA 1TY0A 3HOUH 3PO2B 2TMPA 2FHTA 3P20A 4RGOS 1KLUD 4N9TA 5JFZA 4OO1G 3DWQA 4U0ZA 2OXPA 1NAPA 1HCZA 5IT9c 2A6HC 3BVMA 1J9OA 3C1FA 1SYBA 4IN3A 1WTOA 2F0WA 3MXNB 2UUCQ 1EY7A 3I4MB 1ICFB 2V1CC 1MSGA 2A69C 1EY4A 2N88A 3M4YA 2HIVA 1TQOA 2RHSB 2KVMA 5CV7A 3S17H 2EJGC 1B53A 2EYHA 2D0PA 4OWXB 3GTKB 2QILA 3I3CA 2HIXA 2WV6D 5EJWA 3S9WA 1HUNA 5IYBG 4QIWE 2LY7A 4R4QA 3M9BA 1EIFA 4PZ6A 3ER0A 1CM9A 2F0QA 5KYIA 4X62L 4EQ5A 3UDGA 2ES2A 4A3MB 2UUAQ 2ZTEA 2HDMA 4EQOA 2H4OA 5M5WB 3X3NA 1EIHA 4C2MH 4K8JA 1TS4A 1K83H 4N67A 1TWHH 4DR2L 4K2KA 2B8GA 4YWMA 1FD7D 1A2TA 4L5SA 3E0EA 2F0MA 2ASBA 1NR2A 1DM0B 1G91A 1CKOA 4CKCA 5KNBA 2B2TA 4ZUIA 4DUZL 4A93H 3UDIA 4X3KA 4K6DA 2EQSA 5FLXE 3ICEA 4LFAL 1FGUA 4Q5VA 3I90A 3CU7A 3TS2A 1HFGA 4KK7A 5JPNC 2B2YC 2VUMG 4JI2Q 2EVBA 2BDNA 1TWFH 5FOBB 3NTHA 5K5PA 2A5HA 4QGUA 1Q1EA 1B4OA 1IBMQ 5T1IA 2EIFA 5E4XA 5EPJA 1D5MC 5K36H 2AQ2B 1VF5C 1A6XA 3BG3A 5BN3A 4FP5D 3K7AB 3GDEA 5I4DA 1WTXA 2LSSA 5M3FB 1O7YA 4QL5A 4DKAC 2JA6H 5EBDA 1YHBA 1F2MA 1K8AC 1SNDA 5C4JH 3OMGA 2RA4A 2HQEA 2ZJQA 4YCVA 3BS1A 2Y0SE 5F2DA 1NNXA 4K0KL 3A8JE 4U04A 5BR8Q 1AE3A 2EY1A 3J81i 3LX0A 1M90C 4I65A 1WCMH 2B29A 4A93G 2F3VA 4KHZA 4XDXA 1VQGA 3T13A 3I4MH 4UAIA 3CRKC 4GKJL 4RA8A 1RCVD 3J7YW 4NXMQ 1K3RA 2VB2X 1K0RA 2A73B 2BA0A 1PYSB 4CGYB 1BQQT 3FRPB 1EUJA 3T53B 1PZID 2EYFA 1VQAA 3L0OA 4QIWB 2NVQH 3J81E 4R4CA 1I4RA 5C5LA 5EPLA 4A3MH 2KOLA 3DEOA 5IOCA 2F4IA 2BOSA 3ND9A 4KKTA 3TREA 3FKIH 5M5WH 3VDYA 1XMOL 2Q2IA 2L12A 4DAYA 1BR9A 5C0XH 4DV3Q 3LNNA 1PH9A 2XSCA 3L7ZC 2F0GA 3DWPA 5A2QL 4EVOA 1DJRD 5JJKA 1PRTF 2K04A 1EYAA 1HUMA 2NVTB 3CMAA 1WCMG 4PY3A 4XI8A 1E2WA 1FNVA 3HOVB 5IGFA 4BY1G 1NR4A 4H0LC 1NBWA 3CCQA 2AHOB 3I4MG 2L4NA 1BVSA 1L1OB 3KLRA 2MO1A 2VQFQ 5IIFA 4WJWA 1SE4A 1STAA 1E2ZA 2KCCA 3OTOL 2I0QA 2NZOA 2XTIA 3SGIA 3GP7A 4DK0A 2K5QA 5IT9E 2K4KA 5DM73 5I6WA 4LK1C 3NK9A 3F2BA 1VQJA 2L1BA 1KC8C 1EZ6A 1WTWA 1B3AA 1UUPA 3A55A 5M3FH 4CDDC 5CBAE 4LF6L 1HRJA 1VMCA 4DV2L 4IFDI 3FKIG 4C3IB 4A75A 3I70A 1H9KA 4ODGA 1VQNA 1HHVA 4HTHA 2AUJD 2Y0SB 4IUVA 2SDFA 2UXBL 1JWSD 4KY6A 3UI2A 4RHRA 4LF9L 3MEHA 1KDCA 3DMUA 4L8JA 4JI8L 5CV5A 3ZC7A 3MVVA 3K57A 5C5MA 1S5ED 3S1QB 1OXXK 2C5CA 1EFWA 3PO3B 4DV6L 3K5OA 3E9IA 2JA8B 3S2HH 1JJCB 5CV9A 1UEAB 2YTXA 4FDBA 4A3DB 2RSNA 2GVBA 4X2EA 1Q8KA 1JJ2A 1BCPD 3KBGA 4FXKC 4IPGA 2XWBB 2IPKD 2UU9L 2JEBI 4BBSB 4L5TA 2BH2A 1PRTB 1YNND 2E74C 3PGZA 3J7ZC 5M3FG 1KDBA 1W3SA 1EIGA 4GLXA 2YYZA 2IHEA 4JYAQ 3Q6SA 2CCZA 1TWGB 3ZJYC 4C3JB 1XYIA 2HHHQ 1Y1VG 1D5ZC 4LF8Q 2P5ZX 3DUZA 2F4VL 3R93A 4HJ5A 3LWUA 1Z9FA 3PF5A 5FO8B 3NBHA 1HNZL 3PF4A 4PMBA 1Q7YC 1ASYA 3MA2B 3EN2A 2CVRA 4A4IA 1S72A 1I94L 5L37A 2MP1A 1MBYA 2A68D 2PQAB 2NVTH 5GADC 1G6PA 1FL0A 1SYGA 3HOVH 2XIWA 5LHY1 4LUVA 1NJIC 3NPPA 1YVCA 4H13C 4LMQD 5JJ7A 1IHZA 3E6ZX 5CMTA 2NVXB 4JW0A 1DCZA 4L5RC 3RUZA 3G48A 1HZAA 1XMQL 1LT6D 4QMGA 1ILPA 3PCOB 3D3RA 1PTOB 3QIAA 3GTLB 2X6LA 2EOTA 1NCVA 5C3WA 1EWCA 2K5HA 1PH1A 1KNEA 5CV6A 3ZLMA 5ISRA 4ME3A 2KCTA 1K8OA 1AZPA 4F88A 1HR0W 4UPAA 1GUOA 4C3IH 1S40A 1Y14B 1QJOA 3EVQA 2K7VA 5JEAG 4CDFC 4O0AA 3K5NA 1HNWL 4P71A 4TRDA 3HOZB 1JB7A 1KRSA 3PUVA 5KIXA 2KECA 2UXCQ 2EY2A 3CC4A 4X3SA 3OIPA 3MXNA 4XQQA 1KQSA 1PLFA 3OYYA 3I4NB 3S1QH 4X64L 4DUYL 3PO3H 4HR7B 2QGQA 2D5DA 2OT2A 2R92H 4A3DH 4IFDJ 1ET6A 4YY3Q 3CCJA 3QJYA 1JB3A 5CGLA 1GHJA 2KEEA 5LMUL 2H1EA 4TKOB 2IHFA 4B3RL 1SNOA 4BBSH 4FXGC 5CKLA 4ITRA 1XXGA 2JK8A 3K5MA 2EDGA 1RDPD 4IZ8A 4U07A 5D3DA 1PFSA 4OL7A 1CUKA 2UUCL 1IBKQ 4UY8C 1SR3A 2KBNA 1SFOH 4LFBQ 3KF6B 1P8LA 2Z4IA 1HR0Q 2I07B 4ZKBB 5IYDH 3A8IE 1WTHA 1OO9B 5CGKA 1PH6A 3A5ZB 2VZAA 2QKIC 2VQEQ 4JPBW 2FFKB 4P73A 3VYRA 4WJ3M 4KHPQ 1XTDA 2NVXH 2F0TA 4GNXA 3CPWA 2R92G 5FKAC 3DWAA 1UEBA 2JA9A 2EJFC 1CHQD 1PTOH 2SNSA 3BVGA 3K81C 3GTLH 3ITPA 1EYCA 2UUBQ 2Z4HA 2B2WA 2QDLA 3I7FA 1Y69U 2NYZD 3S1MB 4PMCA 1JWUD 2YTVA 3IKJA 5ELEA 1VQHA 1O80A 5LL6X 1S3OA 2A19A 4QY7A 4ZLTF 3A7LA 5D3IB 3LETA 4JBKA 2E2IB 1QUQB 3A5UA 1DGSA 4HSVA 4DAVA 2K5DA 5I2XA 4JI2L 1XX8A 3GD7A 3U58A 5COYA 5IP7G 2AWNA 4DGZA 1PH7A 5IYDG 4HEDA 1LTAD 1IBML 4WGJA 2OQ0A 2A6EC 3AMUA 2ICEC 2PO4A 3H3VH 5D14A 4EQNA 3U9SA 1SJHD 4OIJA 5IYCG 1B70B 3Q8DA 1MIUA 4DR6Q 4XT3B 4E6IA 5BN4A 4KJNA 2PPBC 1HPCA 2ZTCA 1EQRA 4PNYA 3D4DA 3M4PA 1GHKA 2ZJPA 4IURA 5DEHA 2RBMA 5BR8L 1Z6HA 3Q23A 4TSSA 1PH5A 2K5WA 1HXYD 1ENAA 4MNOA 4R4OA 3J80c 3GTGB 2KA7A 3C1EA 5EKIA 4JI0Q 3G4SA 4B9WA 3FEWX 4X66Q 1X32A 2VUMB 3H91A 4BXXH 4DR5Q 1V43A 1MI2A 1BO0A 1HQMC 3S15B 3CCSA 3T56B 4NXML 2JJQA 2E5LQ 3MC0B 1ZKOA 1A62A 1VQFA 1UE7A 3CKIB 2LMCB 2M00A 2I46A 3I56A 2JA5G 1TS3A 2B8FA 1EOVA 1L1OA 1Y1WH 3ERQA 1PTOD 4ZAIA 2IWHA 5A35A 4DR3Q 3OHXC 3TP8A 2PZUA 1UE6A 2C9OA 4L6TB 3L2PA 5CV8A 2IL8A 1IW7D 3HZXA 2Z1CA 2GVAA 3IL8A 1QILA 4DV3L 1MJCA 4JI5Q 4OO1H 3P1HA 4DK1A 4XT1B 2RHQB 4A93B 1Z7TA 3I2ZA 4YCWA 2CHBD 1BCPF 1K0SA 4DR4Q 5C0XI 1PZJD 2ZM6L 1FNWA 3FP9A 1LT4D 4IOCA 2LKVA 2MGSA 2BE5C 1G291 5EU0A 3AFQA 2QA4A 1ET9A 1TWFB 2VQFL 1MSHA 3I91A 1GKHA 3HG9A 5A2QE 3KBXA 3A74A 3T51B 2EYLA 2F52A 1Q8IA 5CYUA 5C3EH 1LM0A 1EFID 2F0KA 1Y1WG 2A68C 2HQLA 3LWEA 4ZUJA 1HH2P 3T4AC 3DLLA 4IUNA 2CH4W 2L11A 1D6EC 5C4JB 3MZ5A 3D8GA 3QB3A 3ERSX 4IJLA 4HCEA 1FYCA 1QCBD 2X69A 1ZEQX 3VYSA 2NVYB 3EA6A 3FVQA 2B2WC 2OCEA 2QW7A 1E7ZA 4OX9L 1WCMB 1Q12A 3VA7A 4CHTB 3HOXH 3CD6A 1VQKA 4BY1B 4GLVB 4A3KG 1HA6A 4P2CB 3D4WA 3KLSA 3MAQA 3GTGH 4FYDA 4TVAB 4G57A 5KRUA 3W3AA 4H02A 5FO7B 1EY9A 2ZTDA 3KOJA 4HMJA 2VUMH 2NN6G 4XIGS 2PQAA 3R3OA 3CCVA 1XNQQ 3S15H 1AH9A 3U50C 1CT1D 4A3JH 3I73A 4UDUC 3NTIA 4P75A 2F6SA 2JXMB 5J22A 1XNRQ 4JV5L 3CXCA 4JBWA 5C3EG 3J7AV 2NVQB 2NTTA 4EX5A 4RKLA 4H7BA 4JOIA 5J39A 1YITA 2JSOA 4U673 2VY3A 1BCPB 4RFBA 2PCFB 3FKIB 1FNUA 3TN2A 1U4MA 1GUGA 4LNQA 4JYAL 3STBD 1WTVA 3NQIA 1YNXA 5ELDA 4N8FA 2HHHL 2R7DA 2WP8J 4LF8L 1B50A 3NP8A 1MD2D 2RF4A 4KI0A 5EKLA 3URYA 4A3GH 3EJIA 3SE5A 1BXTA 2UXDQ 3J80i 2PQEA 1NUCA 3HOXG 3M4QA 1YBYA 3EROA 1JOKA 3M7GA 1D8LA 4AH6A 2JQOA 3CCUA 1KAAA 1Y8PB 2K75A 4IO9A 2J4XA 4GNXB 4CKEA 1IL2A 4A3JG 2ATWA 3GTPH 5T1GA 4IJHA 1IBLQ 2D0OA 1L1OC 1K73C 1SNQA 1HFNA 4FF3A 3J80E 3UE0A 3N52A 1FGBD 2K52A 4LF5L 3EBEA 5C0XJ 3G6JB 1LTGD 1LACA 1HZ9A 1Y1VB 4M1UB 4JCVE 4BA2I 3TRZA 1C8CA 1KXLA 5C4XB 1M8AA 1WI5A 2NVYH 1K9MC 3S2DB 3J7AF 3PIOA 5JOBA 4X2CA 3K7UC 1A3UA 5J1ZA 1E0BA 1ESRA 4A3GG 1KLGD 3MTSA 3K5LA 2UXCL 4KD3A 1B8AA 3P7JA 2B2VC 4BY1H 1N9WA 5H1SE 2X6GA 2IX3A 3KLWA 1TWAH 4X2DA 2PZTA 1ZYRC 2DJGC 3KF6A 1X65A 1EYDA 3S2HB 2CQAA 1SE8A 1SJED 1D1IA 2IT1A 3HOYB 2R61A 4AIMA 4KN4C 3PUYA 4C1NI 4YY3L 4HIMA 4B9XA 4M16A 3A54A 1VQ4A 1HNXQ 2D2CC 3ONAB 3VYUA 4RGTA 1JWMD 2A8VA 4DR1Q 3NSWA 1VF7A 1I4HA 1NY4A 3CQZH 4A3IB 1JMCA 1PRTC 1D2BA 1S4ZA 3U4ZA 1KL9A 1G2SA 4LFBL 3CCRA 2CWAA 2CW0C 5I9OA 3GV3A 1FJGL 1HR0L 2A1AA 2NB0A 2K01A 3PMFA 3IRBA 1YNJD 1UWVA 2K5VA 5DLQE 3CC2A 2F0EA 1QUQA 4U0UA 1SSOA 2OQKA 2RKSA 4MZ9A 4KHPL 5HY6A 3GTMH 3V05A 2JA7B 4DK3C 1KD1C 5GAHC 3GV6A 3CAMA 2F0FA 1X54A 4A3EB 3QOLA 1TS5A 2RDFA 3WOFA 2EY6A 5IODA 2WB1G 4RCNA 3FDTA 1NE3A 3PUZA 3SHGA 4J8QA 2UUBL 2O5IC 1O78A 1SXTA 3TZDA 4KJOA 2PMZE 4DXGA 1VQ8A 1QNUA 4QCLA 1FR3A 1PTOC 2WAQB 1JORA 2L15A 1Y1VH 4JBJA 1DOLA 1EIYB 4RCOA 1GUNA 4HIOA 1PTOF 4IPCA 5C4XH 4HJAA 4DN4M 3S2DH 4DV5Q 1STYA 2ALYB 1N33Q 4Z9CB 1KRTA 1U4LA 2B2TC 2RVLA 2XWJB 1H9JA 4LF7Q 1IW7C 1EY5A 1CZWA 5NUCA 4A3BB 3ND8A 4QQBX 4B3TQ 2K14A 4JK1C 5HGTA 5E4WC 1CKNB 2CWPA 3PIO3 2R92B 2N55A 3M85A 3HOYH 2OTJA 2F0JA 3EQLC 2CQOA 3MXGA 1KAWA 1VQ7A 1U4PA 1SNMA 3OW2A 5EQ0A 3CPFA 4DV4L 5C6AA 3A0JA 3K59A 1CFMA 3VR2A 4MN3A 2XVSA 1ENFA 2L9HA 1VQPA 1JJGA 3S14H 4G7HC 3PQIA 4PZ7A 1ML0D 3RLFA 5JEAH 4A3IH 2JYOA 1WTQA 3V96A 1SFOB 1A3VA 2HCIA 1SE3A 4GKKQ 4JI0L 5C4XG 1LTRD 3NQTA 1UNSA 4X66L 1E24A 1A8VA 4MTNA 3SE0A 4NXNQ 4DR5L 4NB3A 1V8QA 2E5LL 4JI7Q 4X65L 3Q24A 4R4IA 2F0VA 1Q86C 3FPPA 2AUKA 5JAVA 2PNRC 3SDZA 1Q90A 1LABA 1RL2A 2JA7H 3HOYG 1CKMA 4XYQA 5KYLA 1YIJA 1EWHA 4ME5A 3RZOH 3RN5A 5IGBA 4QF4A 3OOCA 1XJVA 4A3EH 3BYTB 2CFMA 1Q3LA 4XTCS 1HTLD 5LMNW 1AN8A 4B3SQ 4F87A 5KGUA 1LTLA 1SMYD 4JI5L 1WD1A 3JAML 3VR3A 1CZGA 4DAPA 3O13A 5ELCA 2O2LD 5M5XB 1QVCA 4RG1A 1PFMA 4NKLA 4DR4L 2PMZB 4LAAA 3SEBA 3KK7A 4A3IG 3KJOA 2A6HD 4OO1I 1L0XB 3PSIA 1BOSA 3BVZA 3E0JA 2KCNA 1E1TA 1JE5A 4ZK9B 1KIXA 4RGNA 2XRQD 1JCKB 2A69D 2K50A 3V2TA 1CA5A 4A3BH 4XXEA 2E2JB 3QO2A 2JA5B 4JI1L
chains in the Genus database with same CATH topology
4X62L 4EQ5A 3UDGA 3F8TA 2UUAQ 4JOIC 1PH5A 1C9OA 2ZTEA 4MNOA 1GO3E 2FXQA 3UDFA 1VQBA 4R4OA 3CMEA 4B3MQ 3J80c 5IWAQ 4C2MH 1I3QH 3W1GA 4JI0Q 1K83H 4N67A 5JEAJ 3UE1A 4X66Q 3G4SA 1QZHA 1TWHH 2JA7G 4DR2L 1E3PA 4BXXH 3KJPA 4DR5Q 1V43A 1B7YB 4YWMA 2PNHA 3CCSA 4NXML 4L5SA 3E0EA 2JJQA 4LUZA 2E5LQ 2ASBA 4A3EG 1A62A 1VQFA 5C44G 1AE2A 1UE7A 4GN5A 1CKOA 3F1ZA 3K7AH 4DUZL 4DV1Q 3UDIA 4HJ8A 4A93H 3I56A 2JA5G 3RLNA 4A3MG 1EOVA 2EQSA 3KDFB 3ICEA 1L1OA 3CUCA 2N3SA 4IPDA 1Y1WH 4DR3Q 4LFAL 1FGUA 3TS2A 1UE6A 5LMNQ 1QVFA 1E1OA 5C0XG 1T9HA 2WAQG 1N34Q 3S1NH 4QJFA 2VUMG 1J5EQ 3L2PA 2R6GA 4JI2Q 4JI3Q 1TWFH 4QGUA 4DR6L 1Q1EA 3RNUA 1M1KC 1NMGA 1IBMQ 1PVOA 3D0FA 2GVAA 4DV3L 2EIFA 1MJCA 2OTLA 4JI5Q 3HKZG 4OX9Q 5IP7H 4RMFA 4UP9A 1XNQL 1YHQA 2D62A 1GD7A 3H3VI 4A3BG 2RHQB 3GDEA 3TEHB 3I2ZA 4YCWA 1OXVA 2LSSA 1XNRL 4DR4Q 4DKAC 4QL5A 5C0XI 3F2CA 2JA6H 2R7ZH 2PI2A 1SRUA 1YHBA 2ZM6L 1K8AC 1C0AA 2R93H 4J15A 5IYCH 3GTJH 3FP9A 2UUAL 5C4JH 2PI2E 4LFCL 2MNAA 4IOCA 1XPOA 2KENA 2ZJQA 2B3GA 1G291 4YCVA 5EU0A 2HT1A 3AFQA 4X6AH 2QA4A 2Y0SE 2ZJRA 4K0KL 2VQFL 4JV5Q 1GKHA 4U04A 3I55A 5BR8Q 1YJWA 1AE3A 3A74A 1VQOA 3J81i 1M90C 2N49A 4X62Q 4DNIA 2F52A 1WCMH 2B29A 4A93G 5C3EH 2I5LX 4KHZA 1VQGA 1LM0A 1Y1WG 3I4MH 5M5XH 2HQLA 2UXDL 1HH2P 3NELA 2I5MX 3AQQA 2Z0SA 4UP8A 3DLLA 4DR2Q 4GKJL 4DR3L 2VNUD 4JI6L 3JC66 1VQ6A 4NXMQ 1K3RA 3ERSX 4IJLA 1YHAA 3K8AA 1K0RA 2BA0A 2Q2TA 1PYSB 1YJ9A 4DUZQ 1Q81C 1N8RC 4JI4L 1EUJA 4LFAQ 4C3HH 3T1HL 4LF6Q 1VQAA 4APVA 2OCEA 3L0OA 2NVQH 2E2JH 1E7ZA 4R4CA 2JA5H 1Q12A 3ULPA 3RZDH 4OX9L 3HOXH 4A3MH 3CD6A 4DAMA 1IBLL 1VQKA 1KHIA 4GLVB 5AJ3L 2OWOA 2R7ZG 4A3KG 3GTOH 1XMOL 3TREA 5M5WH 3FKIH 3VDYA 2R93G 2Q2IA 1VQ9A 3UDXA 3GTGH 4TVAB 3NENA 4H02A 1R9TH 1OTCA 1LYLA 2ZTDA 1EWIA 3KOJA 2VUMH 4DV3Q 1PH9A 2NN6G 1H95A 4XIGS 3L7ZC 2PQAA 5FJ8H 3CCVA 1GM5A 1XNQQ 3S15H 4YWKA 1AH9A 3U50C 5JJKA 1V9PA 3TQYA 4A3JH 1PYBA 1A0IA 4P75A 3STBC 2F6SA 2E8GA 1QZGA 1U5KA 1XNRQ 1OXTA 3CXCA 3PUWA 1WCMG 4JBWA 3CMAA 4PY3A 4XI8A 5C3EG 1D7QA 1N32L 4BY1G 4EX5A 1GVPA 4LF5Q 1NBWA 3CCQA 1OXSC 2AHOB 5J3BA 4JOIA 4GOPA 1YITA 1I50H 1X55A 4LFCQ 3I4MG 1BVSA 2R7FA 2VY3A 3CCLA 1NTGA 1WJJA 1L1OB 2MO1A 2NN6I 3LGJA 3S6AA 1PH8A 4K0KQ 1X9NA 2VQFQ 4IFDG 3RLOA 4LNQA 1L2FA 4JYAL 1WYDA 3STBD 4OWTB 4A3CH 4P74A 3OTOL 1YNXA 2I0QA 4JBMA 2NZOA 4GN4B 2R7DA 2XTIA 3SGIA 2WP8J 2HHHL 4LF8L 4A3BH 3HOWH 5JJLA 2JEAI 2K4KA 4GN3B 2RF4A 4A3LH 4KI0A 4AQYL 1PA6A 3F2BA 2LXJA 2WB1E 4A3GH 3CC7A 1VQJA 1KC8C 1N36L 4HIDA 3HOVG 3SE5A 5JJ6A 3D31A 3J80i 2UXDQ 3HOXG 4A76A 5M3FH 3K0XA 4LF6L 1BKBA 3M4QA 1HNXL 4GKJQ 1YBYA 4JI6Q 4DV2L 1I5FA 2H5XA 2KHJA 3FKIG 2JA8H 2DUDA 3JAMc 4IFDI 4A75A 4WJ4A 1D8LA 1SROA 2ID0A 4YWLA 4AH6A 4DR1L 4A3FH 2JQOA 3CCUA 4R4TA 4NPSA 1BBWA 1MJEA 2Q2UA 2K75A 5ELNA 4IO9A 1VQNA 1JT8A 2KCMA 5FJ8G 1HZBA 4GNXB 4JI4Q 3T1HQ 2UXBL 3U4VA 1IL2A 3EIVA 4A3JG 2ATWA 3GTPH 3S16H 5EAYA 1CSPA 4LUOA 3PIPA 4IJHA 4DV0L 2YU9H 1IBLQ 4LF9L 2D0OA 4JI8L 5AJ3Q 3S1RH 1L1OC 2C35B 2I5HA 3ZC7A 1XMOQ 1K73C 1FVIA 4KLKA 1OXXK 3UE0A 1EFWA 2MQHA 1TWGH 4DV6L 4O2DA 4C3JH 4A3KH 3E9IA 2BH8A 2K52A 4LF5L 3S2HH 1JJCB 3EBEA 5C0XJ 2YTXA 4FDBA 1YEZA 3RR5A 1HZ9A 4B3RQ 2GVBA 4X2EA 4JCVE 1PV4A 2Y0SG 3TRZA 1Q8KA 1JJ2A 1VQ5A 4BA2I 4A3CG 1KXLA 4P72A 4IPGA 1IZ6A 1WI5A 4JG2A 1FJGQ 5M5YH 3HOWG 2NVYH 1K9MC 4ALPA 4LU4A 3PIOA 3N3UA 4X2CA 2UU9L 3K7UC 2JEBI 4A3LG 3G6EA 1N32Q 4HIKA 4L5TA 2BH2A 3KYHC 4A3GG 3H15A 5K36G 3PGZA 4GS3A 2UXCL 1B8AA 2B63H 1CKNA 2Z6KA 3J7ZC 5M3FG 1W3SA 1N9WA 4GLXA 4BY1H 1HJPA 2YYZA 5H1SE 3PO3G 2IHEA 3KLWA 3F2DA 1TWAH 1Z47A 2JA8G 4X2DA 4PZ8A 4JYAQ 1PH3A 4GNXC 3KF6A 2CCZA 1X65A 3ZJYC 4IPHA 1G51A 3OTOQ 2HHHQ 4A3DG 1Y1VG 4A3FG 4LF8Q 2F4VL 4OO1G 2JE6I 4HJ5A 1SE8A 1Z9FA 3PF5A 2IT1A 2VS1A 1HNZL 4DAYB 3PF4A 2AMCB 4AIMA 1Q7YC 4AQYQ 1ASYA 3BU2A 3EN2A 3PUYA 1K8GA 1N36Q 5E7NA 4A4IA 2DGYA 4YY3L 4DK6C 4HIMA 2N8NA 1S72A 4M16A 1I94L 4BBSG 2PQAB 5M3MG 1VQ4A 2NVTH 5GADC 4DV5L 1PH4A 1G6PA 1FL0A 1HNXQ 3HOVH 1XPUA 1IXRA 3ULJA 1N33L 3CCMA 4DV2Q 1Q82C 3BJUA 4DPGA 4LUVA 4LF7L 2F3IA 1NJIC 1YVCA 3S24A 3CCEA 1QVGA 2A8VA 4DR1Q 5JJ7A 2RCNA 4L5QA 4AYBE 4B3TL 4Y52H 5CMTA 2MFIA 4R1JA 1YJNA 4GOPB 3HKSA 4L5RC 4POGA 3HOZH 1NY4A 3GO5A 3G48A 2UXBQ 3CQZH 3ZCBA 1HZAA 1XMQL 1JMCA 5ELOA 5JFFA 3PCOB 1Q1BA 2NZHA 4DV0Q 3U4ZA 1KL9A 4LF9Q 3AFPA 4JI8Q 2IX1A 4LFBL 3CCRA 2CWAA 1P16A 2GN5A 3FHWA 1FJGL 5IP9G 1HR0L 2A1AA 2K5HA 2AWOA 1PH1A 2B63G 3ZLMA 4PMWA 3I4NH 1VQMA 4DV6Q 3IRBA 4ME3A 2LXKA 2KCTA 1RIPA 1UWVA 2K5VA 4OXPA 3AEVA 5DLQE 3T1YL 5FLXc 4UPAA 3TS0A 1HR0W 4C3IH 3CC2A 1WOCA 1CSQA 1J6QA 1QUQA 4U0UA 1Y14B 3AYHB 1S40A 3NEMA 4TQUS 3KFUA 2OQKA 4HJ9A 2CKZB 4MZ9A 5JEAG 5GQOA 4O0AA 4JC0A 1W2BA 3GTQH 4KHPL 1HNWL 4P71A 5HY6A 3GTMH 1NMFA 4DK3C 1KRSA 1O7IA 1JB7A 2UU9Q 1KD1C 3PUVA 5GAHC 3CAMA 1X54A 2UXCQ 1EYGA 3CC4A 2E2HH 2VL6A 4DV4Q 4GKKL 5JJIA 2WB1G 1X6OA 3G71A 4IOAA 4NXNL 2G03A 1NE3A 1KQSA 3OYYA 4UP7A 4DV7L 4GOPC 1X3EA 3PUZA 3SHGA 3W5OA 4X64L 4DUYL 2UUBL 4JI7L 3S1QH 3PO3H 3DM3A 4DR7L 2F4VQ 3W1BA 2PMZE 2QGQA 4BA1I 4YHHL 3WWVA 1VQ8A 1HNZQ 3H0GH 2R92H 3M7NA 1V1QA 2L15A 1ASZA 3HOZG 4A3DH 1Y1VH 2N78A 3MEFA 2YV5A 4JBJA 4IFDJ 2QEXA 2VW9A 1SLJA 4YY3Q 4HJ7A 3CCJA 1EIYB 1I94Q 4HIOA 5C4XH 4IPCA 4HJAA 3HOUG 5FLMH 5CGLA 2AKWB 3S2DH 4X65Q 4DV5Q 5LMUL 4B3RL 2IHFA 2ALYB 1N33Q 1KRTA 3PUXA 4BBSH 5M3MH 4LF7Q 5CKLA 3JAMi 4ITRA 3I4NG 2JK8A 4BBRH 4B3SL 4QQBX 4B3TQ 2K14A 4U07A 2KHIA 3KF8B 4LWCA 1PFSA 3BZCA 1CUKA 3I4OA 1CKNB 3CP0A 2UUCL 1IBKQ 2CWPA 5IE8A 1XMQQ 2WAQE 4UY8C 1SR3A 4U0SA 2KBNA 1YZ6A 3HFZB 1VQCA 4OONA 2WFWA 3M85A 1SFOH 3HOYH 4LFBQ 3KF6B 2EXDA 1P8LA 2OTJA 1VQDA 5IY0A 3RN2A 5GAEC 1HR0Q 3HKZE 3NBHB 3M3YH 3B6YA 2CQOA 3KDFA 5IYDH 1I6HH 1VQ7A 1KAWA 2XGTA 1PHJA 3OW2A 1IYJB 1PH6A 3S1MH 4POFA 5IP9H 3T1YQ 3A5ZB 3CPFA 1XPRA 2VZAA 2VQEQ 2IX0A 4P73A 4DV4L 1EQQA 3A0JA 4LF4L 3J81c 4WJ3M 3E9HA 4BY7H 1HNWQ 4KHPQ 1XTDA 1VQPA 2NVXH 1JJGA 4GNXA 3S14H 3ULLA 1X56A 3H0GG 4PZ7A 3CPWA 2R92G 3M4OH 4YCUA 2E2IH 3RLFA 4A3IH 1UEBA 3BZKA 4B3ML 4BXXG 5IWAL 2JA9A 2IY5B 3PO2H 5C4XG 1VQIA 4GKKQ 4JI0L 5FLMG 1VQEA 4X66L 4LW1A 3SN9A 1E24A 3PV0A 3K81C 1A8VA 4MTNA 4NXNQ 3GTLH 4JI1Q 4DR5L 5IYBH 4NB3A 4DV7Q 1C7YA 2MO0A 2UUBQ 1X3FA 4X64Q 4DUYQ 1YI2A 2E5LL 1X3GA 5GAGC 4R4IA 2Z6KC 3I7FA 4X65L 4JI7Q 4DR7Q 4JV5L 4PG3A 1A63A 2BA1A 2YTVA 3J7A5 4BBRG 3K80C 4YHHQ 3J81j 2Q2HA 4DV1L 1Q86C 1VQHA 1S3OA 1LUZA 4AYBG 2A19A 4QY7A 3LETA 1Q46A 1RL2A 4JBKA 5HGQA 2JA7H 3GTKH 3HOYG 1CKMA 5GROA 5LMNL 5LMUQ 1MKHA 1QUQB 1OXUA 2YTYA 1DGSA 3A5UA 1YIJA 1N34L 1IBKL 1J5EL 1VS0A 4OWWB 4JI2L 3RN5A 4JI3L 3HOUH 3RZOH 3GD7A 1HZCA 3U58A 5IP7G 4A3EH 2AWNA 1XJVA 2CFMA 5JFZA 5C44H 4XTCS 4U0ZA 5LMNW 5IYDG 1PH7A 1IBML 5IT9c 4B3SQ 4WGJA 1LTLA 4JI5L 2OQ0A 1VCIA 1TWCH 4GLAC 1L0WA 1TXYA 3MXNB 2UUCQ 2JA6G 3H3VH 2V1CC 1QVCA 4RG1A 5IYCG 4BY7G 1B70B 1WFQA 3Q8DA 1MIUA 2VQEL 4DR6Q 4DR4L 2HIVA 3CF5A 4Y7NH 1VQLA 2RHSB 1BBUA 1UE5A 4A3IG 3S17H 2ZTCA 1EQRA 3KJOA 4OO1I 2D0PA 1U0LA 3PSIA 1SN8A 4OWXB 3PO2G 3M4PA 2HIXA 1E1TA 2ZJPA 1JE5A 5IYBG 1KIXA 4LF4Q 2K50A 4QIWE 1PH2A 4R4QA 1UE1A 1SMXA 1E22A 5BR8L 3M9BA 2K5NA 1EIFA 2ZM6Q 4PZ6A 3CW2C 3ER0A 2ES2A 4JI1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 L;  4EQ5 A;  3UDG A;  3F8T A;  2UUA Q;  4JOI C;  1PH5 A;  1C9O A;  2ZTE A;  4MNO A;  1GO3 E;  2FXQ A;  3UDF A;  1VQB A;  4R4O A;  3CME A;  4B3M Q;  3J80 c;  5IWA Q;  4C2M H;  1I3Q H;  3W1G A;  4JI0 Q;  1K83 H;  4N67 A;  5JEA J;  3UE1 A;  4X66 Q;  3G4S A;  1QZH A;  1TWH H;  2JA7 G;  4DR2 L;  1E3P A;  4BXX H;  3KJP A;  4DR5 Q;  1V43 A;  1B7Y B;  4YWM A;  2PNH A;  3CCS A;  4NXM L;  4L5S A;  3E0E A;  2JJQ A;  4LUZ A;  2E5L Q;  2ASB A;  4A3E G;  1A62 A;  1VQF A;  5C44 G;  1AE2 A;  1UE7 A;  4GN5 A;  1CKO A;  3F1Z A;  3K7A H;  4DUZ L;  4DV1 Q;  3UDI A;  4HJ8 A;  4A93 H;  3I56 A;  2JA5 G;  3RLN A;  4A3M G;  1EOV A;  2EQS A;  3KDF B;  3ICE A;  1L1O A;  3CUC A;  2N3S A;  4IPD A;  1Y1W H;  4DR3 Q;  4LFA L;  1FGU A;  3TS2 A;  1UE6 A;  5LMN Q;  1QVF A;  1E1O A;  5C0X G;  1T9H A;  2WAQ G;  1N34 Q;  3S1N H;  4QJF A;  2VUM G;  1J5E Q;  3L2P A;  2R6G A;  4JI2 Q;  4JI3 Q;  1TWF H;  4QGU A;  4DR6 L;  1Q1E A;  3RNU A;  1M1K C;  1NMG A;  1IBM Q;  1PVO A;  3D0F A;  2GVA A;  4DV3 L;  2EIF A;  1MJC A;  2OTL A;  4JI5 Q;  3HKZ G;  4OX9 Q;  5IP7 H;  4RMF A;  4UP9 A;  1XNQ L;  1YHQ A;  2D62 A;  1GD7 A;  3H3V I;  4A3B G;  2RHQ B;  3GDE A;  3TEH B;  3I2Z A;  4YCW A;  1OXV A;  2LSS A;  1XNR L;  4DR4 Q;  4DKA C;  4QL5 A;  5C0X I;  3F2C A;  2JA6 H;  2R7Z H;  2PI2 A;  1SRU A;  1YHB A;  2ZM6 L;  1K8A C;  1C0A A;  2R93 H;  4J15 A;  5IYC H;  3GTJ H;  3FP9 A;  2UUA L;  5C4J H;  2PI2 E;  4LFC L;  2MNA A;  4IOC A;  1XPO A;  2KEN A;  2ZJQ A;  2B3G A;  1G29 1;  4YCV A;  5EU0 A;  2HT1 A;  3AFQ A;  4X6A H;  2QA4 A;  2Y0S E;  2ZJR A;  4K0K L;  2VQF L;  4JV5 Q;  1GKH A;  4U04 A;  3I55 A;  5BR8 Q;  1YJW A;  1AE3 A;  3A74 A;  1VQO A;  3J81 i;  1M90 C;  2N49 A;  4X62 Q;  4DNI A;  2F52 A;  1WCM H;  2B29 A;  4A93 G;  5C3E H;  2I5L X;  4KHZ A;  1VQG A;  1LM0 A;  1Y1W G;  3I4M H;  5M5X H;  2HQL A;  2UXD L;  1HH2 P;  3NEL A;  2I5M X;  3AQQ A;  2Z0S A;  4UP8 A;  3DLL A;  4DR2 Q;  4GKJ L;  4DR3 L;  2VNU D;  4JI6 L;  3JC6 6;  1VQ6 A;  4NXM Q;  1K3R A;  3ERS X;  4IJL A;  1YHA A;  3K8A A;  1K0R A;  2BA0 A;  2Q2T A;  1PYS B;  1YJ9 A;  4DUZ Q;  1Q81 C;  1N8R C;  4JI4 L;  1EUJ A;  4LFA Q;  4C3H H;  3T1H L;  4LF6 Q;  1VQA A;  4APV A;  2OCE A;  3L0O A;  2NVQ H;  2E2J H;  1E7Z A;  4R4C A;  2JA5 H;  1Q12 A;  3ULP A;  3RZD H;  4OX9 L;  3HOX H;  4A3M H;  3CD6 A;  4DAM A;  1IBL L;  1VQK A;  1KHI A;  4GLV B;  5AJ3 L;  2OWO A;  2R7Z G;  4A3K G;  3GTO H;  1XMO L;  3TRE A;  5M5W H;  3FKI H;  3VDY A;  2R93 G;  2Q2I A;  1VQ9 A;  3UDX A;  3GTG H;  4TVA B;  3NEN A;  4H02 A;  1R9T H;  1OTC A;  1LYL A;  2ZTD A;  1EWI A;  3KOJ A;  2VUM H;  4DV3 Q;  1PH9 A;  2NN6 G;  1H95 A;  4XIG S;  3L7Z C;  2PQA A;  5FJ8 H;  3CCV A;  1GM5 A;  1XNQ Q;  3S15 H;  4YWK A;  1AH9 A;  3U50 C;  5JJK A;  1V9P A;  3TQY A;  4A3J H;  1PYB A;  1A0I A;  4P75 A;  3STB C;  2F6S A;  2E8G A;  1QZG A;  1U5K A;  1XNR Q;  1OXT A;  3CXC A;  3PUW A;  1WCM G;  4JBW A;  3CMA A;  4PY3 A;  4XI8 A;  5C3E G;  1D7Q A;  1N32 L;  4BY1 G;  4EX5 A;  1GVP A;  4LF5 Q;  1NBW A;  3CCQ A;  1OXS C;  2AHO B;  5J3B A;  4JOI A;  4GOP A;  1YIT A;  1I50 H;  1X55 A;  4LFC Q;  3I4M G;  1BVS A;  2R7F A;  2VY3 A;  3CCL A;  1NTG A;  1WJJ A;  1L1O B;  2MO1 A;  2NN6 I;  3LGJ A;  3S6A A;  1PH8 A;  4K0K Q;  1X9N A;  2VQF Q;  4IFD G;  3RLO A;  4LNQ A;  1L2F A;  4JYA L;  1WYD A;  3STB D;  4OWT B;  4A3C H;  4P74 A;  3OTO L;  1YNX A;  2I0Q A;  4JBM A;  2NZO A;  4GN4 B;  2R7D A;  2XTI A;  3SGI A;  2WP8 J;  2HHH L;  4LF8 L;  4A3B H;  3HOW H;  5JJL A;  2JEA I;  2K4K A;  4GN3 B;  2RF4 A;  4A3L H;  4KI0 A;  4AQY L;  1PA6 A;  3F2B A;  2LXJ A;  2WB1 E;  4A3G H;  3CC7 A;  1VQJ A;  1KC8 C;  1N36 L;  4HID A;  3HOV G;  3SE5 A;  5JJ6 A;  3D31 A;  3J80 i;  2UXD Q;  3HOX G;  4A76 A;  5M3F H;  3K0X A;  4LF6 L;  1BKB A;  3M4Q A;  1HNX L;  4GKJ Q;  1YBY A;  4JI6 Q;  4DV2 L;  1I5F A;  2H5X A;  2KHJ A;  3FKI G;  2JA8 H;  2DUD A;  3JAM c;  4IFD I;  4A75 A;  4WJ4 A;  1D8L A;  1SRO A;  2ID0 A;  4YWL A;  4AH6 A;  4DR1 L;  4A3F H;  2JQO A;  3CCU A;  4R4T A;  4NPS A;  1BBW A;  1MJE A;  2Q2U A;  2K75 A;  5ELN A;  4IO9 A;  1VQN A;  1JT8 A;  2KCM A;  5FJ8 G;  1HZB A;  4GNX B;  4JI4 Q;  3T1H Q;  2UXB L;  3U4V A;  1IL2 A;  3EIV A;  4A3J G;  2ATW A;  3GTP H;  3S16 H;  5EAY A;  1CSP A;  4LUO A;  3PIP A;  4IJH A;  4DV0 L;  2YU9 H;  1IBL Q;  4LF9 L;  2D0O A;  4JI8 L;  5AJ3 Q;  3S1R H;  1L1O C;  2C35 B;  2I5H A;  3ZC7 A;  1XMO Q;  1K73 C;  1FVI A;  4KLK A;  1OXX K;  3UE0 A;  1EFW A;  2MQH A;  1TWG H;  4DV6 L;  4O2D A;  4C3J H;  4A3K H;  3E9I A;  2BH8 A;  2K52 A;  4LF5 L;  3S2H H;  1JJC B;  3EBE A;  5C0X J;  2YTX A;  4FDB A;  1YEZ A;  3RR5 A;  1HZ9 A;  4B3R Q;  2GVB A;  4X2E A;  4JCV E;  1PV4 A;  2Y0S G;  3TRZ A;  1Q8K A;  1JJ2 A;  1VQ5 A;  4BA2 I;  4A3C G;  1KXL A;  4P72 A;  4IPG A;  1IZ6 A;  1WI5 A;  4JG2 A;  1FJG Q;  5M5Y H;  3HOW G;  2NVY H;  1K9M C;  4ALP A;  4LU4 A;  3PIO A;  3N3U A;  4X2C A;  2UU9 L;  3K7U C;  2JEB I;  4A3L G;  3G6E A;  1N32 Q;  4HIK A;  4L5T A;  2BH2 A;  3KYH C;  4A3G G;  3H15 A;  5K36 G;  3PGZ A;  4GS3 A;  2UXC L;  1B8A A;  2B63 H;  1CKN A;  2Z6K A;  3J7Z C;  5M3F G;  1W3S A;  1N9W A;  4GLX A;  4BY1 H;  1HJP A;  2YYZ A;  5H1S E;  3PO3 G;  2IHE A;  3KLW A;  3F2D A;  1TWA H;  1Z47 A;  2JA8 G;  4X2D A;  4PZ8 A;  4JYA Q;  1PH3 A;  4GNX C;  3KF6 A;  2CCZ A;  1X65 A;  3ZJY C;  4IPH A;  1G51 A;  3OTO Q;  2HHH Q;  4A3D G;  1Y1V G;  4A3F G;  4LF8 Q;  2F4V L;  4OO1 G;  2JE6 I;  4HJ5 A;  1SE8 A;  1Z9F A;  3PF5 A;  2IT1 A;  2VS1 A;  1HNZ L;  4DAY B;  3PF4 A;  2AMC B;  4AIM A;  1Q7Y C;  4AQY Q;  1ASY A;  3BU2 A;  3EN2 A;  3PUY A;  1K8G A;  1N36 Q;  5E7N A;  4A4I A;  2DGY A;  4YY3 L;  4DK6 C;  4HIM A;  2N8N A;  1S72 A;  4M16 A;  1I94 L;  4BBS G;  2PQA B;  5M3M G;  1VQ4 A;  2NVT H;  5GAD C;  4DV5 L;  1PH4 A;  1G6P A;  1FL0 A;  1HNX Q;  3HOV H;  1XPU A;  1IXR A;  3ULJ A;  1N33 L;  3CCM A;  4DV2 Q;  1Q82 C;  3BJU A;  4DPG A;  4LUV A;  4LF7 L;  2F3I A;  1NJI C;  1YVC A;  3S24 A;  3CCE A;  1QVG A;  2A8V A;  4DR1 Q;  5JJ7 A;  2RCN A;  4L5Q A;  4AYB E;  4B3T L;  4Y52 H;  5CMT A;  2MFI A;  4R1J A;  1YJN A;  4GOP B;  3HKS A;  4L5R C;  4POG A;  3HOZ H;  1NY4 A;  3GO5 A;  3G48 A;  2UXB Q;  3CQZ H;  3ZCB A;  1HZA A;  1XMQ L;  1JMC A;  5ELO A;  5JFF A;  3PCO B;  1Q1B A;  2NZH A;  4DV0 Q;  3U4Z A;  1KL9 A;  4LF9 Q;  3AFP A;  4JI8 Q;  2IX1 A;  4LFB L;  3CCR A;  2CWA A;  1P16 A;  2GN5 A;  3FHW A;  1FJG L;  5IP9 G;  1HR0 L;  2A1A A;  2K5H A;  2AWO A;  1PH1 A;  2B63 G;  3ZLM A;  4PMW A;  3I4N H;  1VQM A;  4DV6 Q;  3IRB A;  4ME3 A;  2LXK A;  2KCT A;  1RIP A;  1UWV A;  2K5V A;  4OXP A;  3AEV A;  5DLQ E;  3T1Y L;  5FLX c;  4UPA A;  3TS0 A;  1HR0 W;  4C3I H;  3CC2 A;  1WOC A;  1CSQ A;  1J6Q A;  1QUQ A;  4U0U A;  1Y14 B;  3AYH B;  1S40 A;  3NEM A;  4TQU S;  3KFU A;  2OQK A;  4HJ9 A;  2CKZ B;  4MZ9 A;  5JEA G;  5GQO A;  4O0A A;  4JC0 A;  1W2B A;  3GTQ H;  4KHP L;  1HNW L;  4P71 A;  5HY6 A;  3GTM H;  1NMF A;  4DK3 C;  1KRS A;  1O7I A;  1JB7 A;  2UU9 Q;  1KD1 C;  3PUV A;  5GAH C;  3CAM A;  1X54 A;  2UXC Q;  1EYG A;  3CC4 A;  2E2H H;  2VL6 A;  4DV4 Q;  4GKK L;  5JJI A;  2WB1 G;  1X6O A;  3G71 A;  4IOA A;  4NXN L;  2G03 A;  1NE3 A;  1KQS A;  3OYY A;  4UP7 A;  4DV7 L;  4GOP C;  1X3E A;  3PUZ A;  3SHG A;  3W5O A;  4X64 L;  4DUY L;  2UUB L;  4JI7 L;  3S1Q H;  3PO3 H;  3DM3 A;  4DR7 L;  2F4V Q;  3W1B A;  2PMZ E;  2QGQ A;  4BA1 I;  4YHH L;  3WWV A;  1VQ8 A;  1HNZ Q;  3H0G H;  2R92 H;  3M7N A;  1V1Q A;  2L15 A;  1ASZ A;  3HOZ G;  4A3D H;  1Y1V H;  2N78 A;  3MEF A;  2YV5 A;  4JBJ A;  4IFD J;  2QEX A;  2VW9 A;  1SLJ A;  4YY3 Q;  4HJ7 A;  3CCJ A;  1EIY B;  1I94 Q;  4HIO A;  5C4X H;  4IPC A;  4HJA A;  3HOU G;  5FLM H;  5CGL A;  2AKW B;  3S2D H;  4X65 Q;  4DV5 Q;  5LMU L;  4B3R L;  2IHF A;  2ALY B;  1N33 Q;  1KRT A;  3PUX A;  4BBS H;  5M3M H;  4LF7 Q;  5CKL A;  3JAM i;  4ITR A;  3I4N G;  2JK8 A;  4BBR H;  4B3S L;  4QQB X;  4B3T Q;  2K14 A;  4U07 A;  2KHI A;  3KF8 B;  4LWC A;  1PFS A;  3BZC A;  1CUK A;  3I4O A;  1CKN B;  3CP0 A;  2UUC L;  1IBK Q;  2CWP A;  5IE8 A;  1XMQ Q;  2WAQ E;  4UY8 C;  1SR3 A;  4U0S A;  2KBN A;  1YZ6 A;  3HFZ B;  1VQC A;  4OON A;  2WFW A;  3M85 A;  1SFO H;  3HOY H;  4LFB Q;  3KF6 B;  2EXD A;  1P8L A;  2OTJ A;  1VQD A;  5IY0 A;  3RN2 A;  5GAE C;  1HR0 Q;  3HKZ E;  3NBH B;  3M3Y H;  3B6Y A;  2CQO A;  3KDF A;  5IYD H;  1I6H H;  1VQ7 A;  1KAW A;  2XGT A;  1PHJ A;  3OW2 A;  1IYJ B;  1PH6 A;  3S1M H;  4POF A;  5IP9 H;  3T1Y Q;  3A5Z B;  3CPF A;  1XPR A;  2VZA A;  2VQE Q;  2IX0 A;  4P73 A;  4DV4 L;  1EQQ A;  3A0J A;  4LF4 L;  3J81 c;  4WJ3 M;  3E9H A;  4BY7 H;  1HNW Q;  4KHP Q;  1XTD A;  1VQP A;  2NVX H;  1JJG A;  4GNX A;  3S14 H;  3ULL A;  1X56 A;  3H0G G;  4PZ7 A;  3CPW A;  2R92 G;  3M4O H;  4YCU A;  2E2I H;  3RLF A;  4A3I H;  1UEB A;  3BZK A;  4B3M L;  4BXX G;  5IWA L;  2JA9 A;  2IY5 B;  3PO2 H;  5C4X G;  1VQI A;  4GKK Q;  4JI0 L;  5FLM G;  1VQE A;  4X66 L;  4LW1 A;  3SN9 A;  1E24 A;  3PV0 A;  3K81 C;  1A8V A;  4MTN A;  4NXN Q;  3GTL H;  4JI1 Q;  4DR5 L;  5IYB H;  4NB3 A;  4DV7 Q;  1C7Y A;  2MO0 A;  2UUB Q;  1X3F A;  4X64 Q;  4DUY Q;  1YI2 A;  2E5L L;  1X3G A;  5GAG C;  4R4I A;  2Z6K C;  3I7F A;  4X65 L;  4JI7 Q;  4DR7 Q;  4JV5 L;  4PG3 A;  1A63 A;  2BA1 A;  2YTV A;  3J7A 5;  4BBR G;  3K80 C;  4YHH Q;  3J81 j;  2Q2H A;  4DV1 L;  1Q86 C;  1VQH A;  1S3O A;  1LUZ A;  4AYB G;  2A19 A;  4QY7 A;  3LET A;  1Q46 A;  1RL2 A;  4JBK A;  5HGQ A;  2JA7 H;  3GTK H;  3HOY G;  1CKM A;  5GRO A;  5LMN L;  5LMU Q;  1MKH A;  1QUQ B;  1OXU A;  2YTY A;  1DGS A;  3A5U A;  1YIJ A;  1N34 L;  1IBK L;  1J5E L;  1VS0 A;  4OWW B;  4JI2 L;  3RN5 A;  4JI3 L;  3HOU H;  3RZO H;  3GD7 A;  1HZC A;  3U58 A;  5IP7 G;  4A3E H;  2AWN A;  1XJV A;  2CFM A;  5JFZ A;  5C44 H;  4XTC S;  4U0Z A;  5LMN W;  5IYD G;  1PH7 A;  1IBM L;  5IT9 c;  4B3S Q;  4WGJ A;  1LTL A;  4JI5 L;  2OQ0 A;  1VCI A;  1TWC H;  4GLA C;  1L0W A;  1TXY A;  3MXN B;  2UUC Q;  2JA6 G;  3H3V H;  2V1C C;  1QVC A;  4RG1 A;  5IYC G;  4BY7 G;  1B70 B;  1WFQ A;  3Q8D A;  1MIU A;  2VQE L;  4DR6 Q;  4DR4 L;  2HIV A;  3CF5 A;  4Y7N H;  1VQL A;  2RHS B;  1BBU A;  1UE5 A;  4A3I G;  3S17 H;  2ZTC A;  1EQR A;  3KJO A;  4OO1 I;  2D0P A;  1U0L A;  3PSI A;  1SN8 A;  4OWX B;  3PO2 G;  3M4P A;  2HIX A;  1E1T A;  2ZJP A;  1JE5 A;  5IYB G;  1KIX A;  4LF4 Q;  2K50 A;  4QIW E;  1PH2 A;  4R4Q A;  1UE1 A;  1SMX A;  1E22 A;  5BR8 L;  3M9B A;  2K5N A;  1EIF A;  2ZM6 Q;  4PZ6 A;  3CW2 C;  3ER0 A;  2ES2 A;  4JI1 L; 
#chains in the Genus database with same CATH topology
 5CR3 A;  4I7Z C;  2K05 A;  1C9O A;  5E1F A;  1VQB A;  3R2T A;  5EKK A;  4B3M Q;  5IWA Q;  4PV1 C;  1B9N A;  3UE1 A;  2JA7 G;  1QZH A;  1E3P A;  4J1M A;  3KJP A;  1SYD A;  1B7Y B;  4A3E G;  1D1K A;  1F9R A;  1R4P B;  4GN5 A;  4Q0F A;  1TII D;  4C3H G;  3F1Z A;  3J81 L;  3OIQ A;  4HN7 A;  2RCF A;  3K6O A;  1BBX C;  5EBC A;  4KV6 A;  2Z8L A;  1X3Q A;  2XNA C;  1J8I A;  1IKM A;  1CQV A;  1GUT A;  2EYJ A;  5LMN Q;  1N34 Q;  3S1N H;  2WAQ G;  2LS0 1;  1J5E Q;  2R6G A;  4JI3 Q;  4FNF A;  3E5S A;  1CHP D;  5D65 A;  2DJF C;  2RDG A;  3HOW B;  4QUF A;  2OTL A;  5IP7 H;  1XNQ L;  1YHQ A;  3BZD B;  3Q22 A;  1AW7 A;  4F7X A;  1EU4 A;  4A3B G;  3TEH B;  1XNR L;  1WTP A;  1Y1W B;  3QR8 A;  3NHH A;  1SRU A;  5G3L D;  3H09 A;  2R93 H;  5IYC H;  3GTJ H;  1CK1 A;  2UUA L;  2NUC A;  2PI2 E;  2MNA A;  1XPO A;  4G7Z C;  2F0P A;  4X6A H;  4O42 A;  2ZJR A;  1STG A;  2RDH A;  3I55 A;  1Y8O B;  1YJW A;  1VQO A;  3HGB A;  2IJ0 A;  2YU9 B;  3S1R B;  2EXZ A;  5M5X H;  2UXD L;  1PYW D;  1WVL A;  3NEL A;  3IAY A;  4A3K B;  2Z0S A;  2RSO A;  1TT2 A;  4IFD H;  5CV4 A;  3JC6 6;  3VR6 A;  3K8A A;  4C56 C;  2Q2T A;  1A3T A;  1YJ9 A;  1JR0 D;  4KD4 A;  4LF6 Q;  2Q8R E;  3DXJ C;  3IFT A;  4QB4 A;  1H9S B;  2E2J H;  2JA5 H;  2NWG A;  5C3E B;  4DAM A;  1IBL L;  1A15 A;  2NUN A;  3GTO H;  1QG7 A;  1W6J A;  1VQ9 A;  2R93 G;  4ILW A;  4GZY C;  3NEN A;  2XN9 C;  4X3T A;  1EY6 A;  2KQ3 A;  1LYL A;  2VB3 X;  3TDQ A;  1IKL A;  3TBI B;  2L0C A;  1H95 A;  3D4R A;  5FJ8 H;  5ELB A;  1GM5 A;  4DU9 A;  5AFW A;  2J7Z A;  5COR A;  3TQY A;  1H9M A;  3D6C A;  1G2T A;  2E8G A;  3PUW A;  1UAP A;  1SNP A;  2ZT9 C;  1JOQ A;  1GVP A;  2PZW A;  1OXS C;  4G4K A;  3HOX B;  4LFC Q;  3R2I A;  2Q8I B;  3OWE B;  2R7F A;  3CCL A;  4PQX A;  2ZXO A;  4LJZ C;  3WOE A;  3S6A A;  1PH8 A;  1X9N A;  3IFD A;  4IFD G;  4H44 C;  3RLO A;  1L2F A;  1WYD A;  4OWT B;  1C4Q A;  4GN4 B;  3HOW H;  1RJT A;  2JEA I;  5JJL A;  3QWN A;  4X3U A;  4A3J B;  3NBI A;  2WB1 E;  1V1P B;  1DXM A;  2NTS A;  1BKB A;  1HNX L;  1B3Q A;  4KKS A;  4JI6 Q;  2DUD A;  5HUR A;  2BDO A;  3JAM c;  4NDX A;  2ID0 A;  4XYO A;  4DR1 L;  1PXU A;  1RF2 D;  4A3F H;  1SAP A;  2LFN A;  4R4T A;  4NPS A;  1I4Q A;  1TS2 A;  2KCM A;  1HZB A;  5FJ8 G;  4JI4 Q;  3T1H Q;  1GUS A;  1ROD A;  3EIV A;  3BDO A;  1CSP A;  4LUO A;  1CA6 A;  3W2D A;  3PIP A;  2YU9 H;  3A8K E;  2DNC A;  3S1R H;  5AJ3 Q;  1BCP C;  4A3G B;  2I5H A;  4KLK A;  4KY7 A;  4A3K H;  1QWY A;  1YNN C;  4O2D A;  4RAU C;  1NSN S;  5KNC A;  1S5C D;  5JJZ A;  1YEZ A;  1B9M A;  4HAE A;  1SYE A;  2G5D A;  1PV4 A;  2WKD A;  1VQ5 A;  2NN6 H;  1LT3 D;  4P72 A;  1IZ6 A;  4FF1 A;  3HOW G;  4ALP A;  4LU4 A;  1JE4 A;  1N32 Q;  3GTP B;  2V4D A;  4ZKC B;  3KYH C;  3H15 A;  1AZQ A;  2PYK A;  2B63 H;  1CKN A;  2Z6K A;  3WDN A;  3VA5 A;  2NBF A;  1HJP A;  4OEL B;  5I6Y A;  5E3F A;  1Z47 A;  2F03 A;  4GNX C;  1TY2 A;  2KJX A;  2HD3 A;  4IQZ A;  1B2T A;  4A3F G;  1AP0 A;  1ZXT A;  2WAC A;  2VXW A;  3MXP A;  4ZCK A;  4AQY Q;  3BU2 A;  1K8G A;  1N36 Q;  2K33 A;  1S5F D;  5E7N A;  2DGY A;  4DK6 C;  2N8N A;  5CC4 A;  3H94 A;  5M3M G;  1I6H B;  5I9P A;  4DV5 L;  1L0Y B;  1PH4 A;  1XPU A;  4K6L A;  5KND A;  3ULJ A;  1N33 L;  3CCM A;  4DPG A;  2E76 C;  4LF7 L;  2F3I A;  1I4G A;  3CCE A;  1QVG A;  1QB5 D;  1K28 A;  1TWA B;  4B3T L;  4R1J A;  1YJN A;  4GOP B;  4POG A;  4CKB A;  3GO5 A;  5ELO A;  3MFG A;  4ZRZ A;  1Q1B A;  2OEO A;  4DV0 Q;  4K5W A;  4EQP A;  3AFP A;  2F0S A;  2KHS A;  1F9Q A;  2SEB D;  1P16 A;  3FHW A;  5IP9 G;  2WB1 B;  2B63 G;  4PMW A;  4CDC C;  1VQM A;  2WKC A;  1RIP A;  3A7A B;  2F0O A;  3X3M A;  4NP5 A;  1WOC A;  1CSQ A;  4BWG B;  4K5V A;  2D9U A;  3OPO A;  4HJ9 A;  4RWS C;  2FIN B;  4JC0 A;  3N6R A;  1W2B A;  4ZYS A;  1KTK A;  1NMF A;  2K28 A;  3I8Z A;  3CQZ B;  3E3X A;  4CJ1 B;  1AFP A;  1EU3 A;  1SNC A;  1EYG A;  2E2H H;  4WRD A;  1RKN A;  5C44 B;  4GKK L;  1X6O A;  4NXN L;  1STH A;  3MFY A;  3TSS A;  4UP7 A;  1TWC B;  5DNF A;  3W5O A;  4JI7 L;  3SR1 A;  1KDA A;  3VR4 A;  2WIN B;  3VR5 A;  3W1B A;  4BA1 I;  3SVM A;  1SDF A;  1T5E A;  3H0G H;  2O5J C;  4Y7N B;  3M7N A;  2N78 A;  3MEF A;  2YV5 A;  3TP5 A;  2QEX A;  3PIP 3;  1STN A;  3HOU G;  4N9P A;  3GTM B;  2QCP X;  5FLM H;  2MPM A;  4B08 A;  3HKZ B;  1RTN A;  3I4L A;  3PUX A;  4QUC A;  3JAM i;  4OHJ A;  2CH4 A;  3GTQ B;  4BBR H;  4B3S L;  1BUV T;  1EEI D;  2AQ1 B;  2KHI A;  2MJ8 A;  3KF8 B;  3TZU A;  4U68 A;  1STE A;  3CP0 A;  1SYF A;  4R8N A;  2WAQ E;  3AU7 A;  1I3Q B;  2EYM A;  1LV9 A;  2SOB A;  3RMH A;  1VQD A;  5IY0 A;  5EGT A;  5G3L F;  2Q8T A;  5GAE C;  2K32 A;  3M3Y H;  3B6Y A;  1SYC A;  3ZYY X;  4K2L A;  4KHV A;  1I6H H;  2XGT A;  1PHJ A;  1S5D D;  1IYJ B;  3T1Y Q;  1XPR A;  1IL8 A;  1F2Y A;  1LLR D;  2IX0 A;  4C1N K;  3JAM E;  1EQV A;  3E9H A;  1I4P A;  4BY7 H;  3H0G G;  1BNZ A;  1XTC D;  4YCU A;  1VMP A;  4B3M L;  5IWA L;  2K1B A;  3PO2 H;  1VQI A;  5FLM G;  4LW1 A;  3SN9 A;  4S3S A;  2F3W A;  1CI3 M;  5JVH 3;  4DV7 Q;  1C7Y A;  2MO0 A;  3MWY W;  1X3F A;  3NWS A;  1YI2 A;  5GAG C;  2Z6K C;  1EY8 A;  4K5X A;  4DR7 Q;  1A63 A;  4PG3 A;  3KUP A;  1TVX A;  1LO5 D;  2BA1 A;  3J7A 5;  4BBR G;  3K80 C;  4IUQ A;  4YHH Q;  2Q2H A;  1EY0 A;  4CBV A;  1G8Z D;  2R7Z B;  1LUZ A;  1GOZ A;  4FXD A;  4AYB G;  2ZXR A;  1Q46 A;  3S14 B;  3GTK H;  5LMN L;  1MKH A;  1SE2 A;  1N34 L;  1IBK L;  1J5E L;  1VS0 A;  4JI3 L;  1HZC A;  5K36 G;  5C44 H;  2SNM A;  1U4R A;  2A74 C;  1VCI A;  1TWC H;  4GLA C;  1L0W A;  1TXY A;  2JA6 G;  3HEJ A;  3SK6 A;  5KEE A;  4BY7 G;  1WFQ A;  2VQE L;  3CF5 A;  4Y7N H;  1VQL A;  3HP3 A;  1BBU A;  1UE5 A;  3KLS X;  1U0L A;  4DA2 A;  1SN8 A;  3PO2 G;  4WOR A;  1SBB B;  1Y8N B;  2A6E D;  1H9S A;  3RZO B;  5C3X A;  1ICW A;  4UHV A;  1IYU A;  4LF4 Q;  1PH2 A;  4C3H B;  4DFA A;  1UE1 A;  1SMX A;  1E22 A;  2EYO A;  2ZM6 Q;  2K5N A;  5DM6 3;  4TQU S;  3CW2 C;  3GTQ H;  1CQF A;  3RZD B;  5JVG 3;  3F8T A;  4JOI C;  4DF7 A;  1S5B D;  1GO3 E;  2FXQ A;  3UDF A;  3CME A;  1I3Q H;  2DN8 A;  2G9D A;  3W1G A;  1R9T B;  1PZK D;  5JEA J;  2EYP A;  2F0L A;  3A56 A;  2PNH A;  4LUZ A;  1AEX A;  5C44 G;  1AE2 A;  2M9V A;  2WII B;  3K7A H;  4HJ8 A;  4DV1 Q;  1CTM A;  3R8B A;  4IUT A;  2QDB A;  3SXH A;  3BYY B;  3RLN A;  3K0Y A;  1F77 A;  4A3M G;  3SK8 A;  3KDF B;  2N3S A;  3CUC A;  1EOT A;  4IPD A;  1JIC A;  1I50 B;  1GUW A;  1QVF A;  1E1O A;  1LTS D;  5C0X G;  1T9H A;  4NW2 A;  4QJF A;  5DAU A;  1MHW C;  1DOM A;  4XQN A;  4DR6 L;  2Z9H A;  5FO9 B;  3RNU A;  1M1K C;  1NMG A;  1PVO A;  1V1P A;  3D0F A;  1PMR A;  3D6W A;  4FVM A;  4OX9 Q;  3HKZ G;  4RMF A;  4UP9 A;  4JVZ A;  1T5X D;  1GD7 A;  2D62 A;  3H3V C;  4G7O C;  3H3V I;  4I7A A;  1OXV A;  3U9O A;  5JPM C;  2EJM A;  3F2C A;  2R7Z H;  1ONL A;  2PI2 A;  1C0A A;  4R9W A;  4J15 A;  2KUM A;  3QOJ A;  4LFC L;  2KEN A;  3NUC A;  3F2U A;  2B3G A;  3S1N B;  4DNR B;  2HT1 A;  4IUP A;  1JOO A;  1II3 A;  4JV5 Q;  1EEF D;  1EQT A;  3TP7 A;  3SHL A;  3C2P A;  3S16 B;  2EZV A;  2N49 A;  4X62 Q;  4DNI A;  5FLX L;  2I5L X;  1G6Z A;  2BE5 D;  2TSS A;  1SEB D;  1STB A;  2I5M X;  3AQQ A;  4UP8 A;  4DR2 Q;  2NZ1 D;  2R93 B;  4DR3 L;  2VNU D;  3GTJ B;  4JI6 L;  4OGQ C;  1VQ6 A;  1YHA A;  3C46 A;  1QOH A;  3OMC A;  4DUZ Q;  5M5Y B;  1Q81 C;  1N8R C;  4JI4 L;  4LFA Q;  4C3H H;  3T1H L;  2K03 A;  4APV A;  3J80 L;  3ULP A;  4EGV A;  3RZD H;  4IUU A;  2OWO A;  1KHI A;  5AJ3 L;  1I4X A;  2R7Z G;  2HCC A;  4HSP A;  4M8A A;  3UDX A;  5BN5 A;  3G7L A;  1R9T H;  1OTC A;  4MHE A;  1EWI A;  3T16 A;  3H6M A;  1QNK A;  4YWK A;  3DM1 A;  1V9P A;  1HA5 A;  3DHQ A;  4O1N A;  1PYB A;  3C3L A;  1KNA A;  1A0I A;  2F1M A;  4V19 0;  3STB C;  2J0T D;  4RKB A;  3L9A X;  1QZG A;  1U5K A;  1OXT A;  1H9R A;  1D7Q A;  1N32 L;  2IW3 A;  4LF5 Q;  1DYQ A;  4GOP A;  5J3B A;  1I50 H;  1X55 A;  2EE1 A;  5EPK A;  1NTG A;  1WJJ A;  2ENB A;  2F0D A;  3GTO B;  2NN6 I;  3LGJ A;  3SK4 A;  4K0K Q;  4OEM B;  2FMM A;  4A3C H;  4P74 A;  1GJX A;  4JBM A;  2B2U A;  4HMI A;  4GN3 B;  4ZQ3 A;  4A3L H;  3RD4 A;  4AQY L;  1I6V C;  2FJ2 A;  2LXJ A;  1PA6 A;  1LTI D;  3CC7 A;  1ENC A;  1N36 L;  3HOV G;  4HID A;  5JJ6 A;  3D31 A;  4MIU A;  2OF1 A;  4A76 A;  2B39 A;  2K6A A;  2F0U A;  3K0X A;  4GKJ Q;  2RQX A;  3AB9 A;  2JA8 H;  1I5F A;  2H5X A;  2KHJ A;  4KY5 A;  4KMU C;  4WJ4 A;  3HRZ C;  1SRO A;  3EFX D;  4YWL A;  1O7L A;  5I2Y A;  4FF2 A;  2E75 C;  1BBW A;  2HDL A;  1MJE A;  2Q2U A;  5ELN A;  1JT8 A;  1IYV A;  3NWT A;  3U4V A;  1NH1 A;  4DXF A;  3S16 H;  5EAY A;  4R8I A;  4DV0 L;  1TKW B;  4ULL A;  2KED A;  5LL6 S;  1D5X C;  2C35 B;  3GQB A;  3L3O C;  4YIJ A;  1XMO Q;  1FVI A;  2NUD A;  2PW5 A;  4C3I G;  2MQH A;  1TWG H;  1M4V A;  4C3J H;  4ABN A;  5CMD A;  2BH8 A;  2EPB A;  4RGM A;  1HQR D;  1JQY D;  4V0B A;  3RR5 A;  4A3F B;  2Y0S G;  4A3C G;  1E2V A;  5IT9 L;  1PFN A;  1FJG Q;  4JG2 A;  5M5Y H;  3OW7 A;  3N3U A;  3CRL C;  4A3L G;  3G6E A;  4HIK A;  1F9S A;  3KF8 A;  5M3M B;  4GS3 A;  1JC7 A;  2R3Z A;  5ELF A;  3PO3 G;  3F2D A;  2DY7 A;  2JA8 G;  4PZ8 A;  2GA4 B;  1PH3 A;  1A2U A;  4N8X 1;  4IPH A;  1G51 A;  3OTO Q;  1WTR A;  4A3D G;  2L5T A;  2JE6 I;  2VS1 A;  4DAY B;  1BF4 A;  2AMC B;  4RH6 A;  2L55 A;  1F2Z A;  1RTO A;  4BBS G;  4NMZ A;  1TU2 B;  1ZYR D;  1C48 A;  1IXR A;  4J6H A;  4DV2 Q;  1Q82 C;  3BJU A;  2B63 B;  3SK5 A;  4MTK A;  3S24 A;  1V1O A;  3FMC A;  1DZ1 A;  5TSS A;  4RHS A;  1KAB A;  4C3J G;  2RCN A;  4L5Q A;  1B1Z A;  4AYB E;  2MFI A;  3QG1 A;  4F8M A;  3HKS A;  4BS9 A;  3M4O B;  4KN7 C;  3HOZ H;  1DD2 A;  1YNJ C;  2UXB Q;  3ZCB A;  1B44 D;  4KKU A;  2Z6B A;  5JFF A;  4K8I A;  2NZH A;  1LTB D;  4LF9 Q;  1TR5 A;  2IX1 A;  4JI8 Q;  3P75 A;  3BDL A;  2PW7 A;  2GN5 A;  4HCS A;  2AWO A;  3I4N H;  4IAL A;  4DV6 Q;  2LXK A;  2F0H A;  4OXP A;  4WFN 3;  3AEV A;  3T1Y L;  5FLX c;  3TS0 A;  1DON A;  1RD9 D;  1PRT D;  3OSO A;  5IGE A;  1J6Q A;  3AYH B;  3KFU A;  1MGS A;  3NEM A;  2DY8 A;  2CKZ B;  4DNT B;  5GQO A;  3K58 A;  1K8M A;  2BCO A;  2CW0 D;  5IGD A;  4CJ2 C;  1QE6 A;  1O7I A;  2UU9 Q;  2E2D C;  3HOU B;  1PFB A;  5IGC A;  1VDZ A;  2VL6 A;  4DV4 Q;  2G9H D;  5JJI A;  2ZXP A;  2QF7 A;  3G71 A;  4IOA A;  4L63 B;  2G03 A;  3I72 A;  5CBE E;  4DV7 L;  4GOP C;  1X3E A;  1GXD C;  2MUY A;  3BDC A;  3DM3 A;  4DR7 L;  2F4V Q;  4YHH L;  3WWV A;  1HNZ Q;  1K3B C;  1V1Q A;  3HOZ G;  1ASZ A;  2B2Y A;  3S17 B;  2VW9 A;  1SLJ A;  4HJ7 A;  4ID6 A;  2B2U C;  1I94 Q;  1R4Q B;  2AKW B;  1HTP A;  1F9P A;  4X65 Q;  1LTT D;  1EL0 A;  1PDQ A;  2EY5 A;  5FK9 C;  3Q0A A;  2E2H B;  5M3M H;  1W6K A;  2O4X A;  2XRS D;  2ICI A;  3DEP A;  3I4N G;  3OWF A;  1O7Z A;  4LWC A;  3CHB D;  2FMC A;  3BZC A;  3I4O A;  1ILQ A;  1XMQ Q;  5IE8 A;  2MHV A;  1XWE A;  2DNE A;  3HS0 C;  4C2M B;  3H0G B;  4U0S A;  1K83 B;  1YZ6 A;  3HFZ B;  1VQC A;  4OON A;  2WFW A;  1TWH B;  2EXD A;  4XQJ A;  4OIK A;  3RN2 A;  3TP6 A;  3HKZ E;  3NBH B;  3NXW A;  3KDF A;  1WD0 A;  4CDE C;  2QEJ C;  3S1M H;  4POF A;  5IP9 H;  4CJ0 B;  4LF4 L;  1EQQ A;  3MXU A;  2B2V A;  3J81 c;  4BBR B;  4FO2 A;  1HNW Q;  5C4Z A;  3ULL A;  1X56 A;  3M4O H;  1LT5 D;  4AYB B;  2E2I H;  3NTK A;  3BZK A;  4BXX G;  2IY5 B;  3FPU B;  3VYT A;  1U9R A;  1DOK A;  5C4H A;  1VQE A;  3NE5 B;  3PV0 A;  3TME A;  4FF4 A;  2JN4 A;  2F0N A;  4JI1 Q;  1ESF A;  5IYB H;  3M3Y B;  1RHP A;  4X64 Q;  4DUY Q;  1X3G A;  1F2L A;  2F0I A;  2M2L A;  3J81 j;  4K14 A;  4DV1 L;  2JP1 A;  5IGG A;  2JA6 B;  1SMY C;  4BY7 B;  1X3P A;  1EZ8 A;  1BDO A;  5HGQ A;  2AQ3 B;  2HUG A;  3MHB A;  4Y52 H;  5LMU Q;  5GRO A;  4B3R Q;  5M9O A;  1OXU A;  2YTY A;  4OWW B;  4KTA A;  1TY0 A;  3HOU H;  3PO2 B;  2TMP A;  2FHT A;  3P20 A;  4RGO S;  1KLU D;  4N9T A;  5JFZ A;  4OO1 G;  3DWQ A;  4U0Z A;  2OXP A;  1NAP A;  1HCZ A;  5IT9 c;  2A6H C;  3BVM A;  1J9O A;  3C1F A;  1SYB A;  4IN3 A;  1WTO A;  2F0W A;  3MXN B;  2UUC Q;  1EY7 A;  3I4M B;  1ICF B;  2V1C C;  1MSG A;  2A69 C;  1EY4 A;  2N88 A;  3M4Y A;  2HIV A;  1TQO A;  2RHS B;  2KVM A;  5CV7 A;  3S17 H;  2EJG C;  1B53 A;  2EYH A;  2D0P A;  4OWX B;  3GTK B;  2QIL A;  3I3C A;  2HIX A;  2WV6 D;  5EJW A;  3S9W A;  1HUN A;  5IYB G;  4QIW E;  2LY7 A;  4R4Q A;  3M9B A;  1EIF A;  4PZ6 A;  3ER0 A;  1CM9 A;  2F0Q A;  5KYI A;  4X62 L;  4EQ5 A;  3UDG A;  2ES2 A;  4A3M B;  2UUA Q;  2ZTE A;  2HDM A;  4EQO A;  2H4O A;  5M5W B;  3X3N A;  1EIH A;  4C2M H;  4K8J A;  1TS4 A;  1K83 H;  4N67 A;  1TWH H;  4DR2 L;  4K2K A;  2B8G A;  4YWM A;  1FD7 D;  1A2T A;  4L5S A;  3E0E A;  2F0M A;  2ASB A;  1NR2 A;  1DM0 B;  1G91 A;  1CKO A;  4CKC A;  5KNB A;  2B2T A;  4ZUI A;  4DUZ L;  4A93 H;  3UDI A;  4X3K A;  4K6D A;  2EQS A;  5FLX E;  3ICE A;  4LFA L;  1FGU A;  4Q5V A;  3I90 A;  3CU7 A;  3TS2 A;  1HFG A;  4KK7 A;  5JPN C;  2B2Y C;  2VUM G;  4JI2 Q;  2EVB A;  2BDN A;  1TWF H;  5FOB B;  3NTH A;  5K5P A;  2A5H A;  4QGU A;  1Q1E A;  1B4O A;  1IBM Q;  5T1I A;  2EIF A;  5E4X A;  5EPJ A;  1D5M C;  5K36 H;  2AQ2 B;  1VF5 C;  1A6X A;  3BG3 A;  5BN3 A;  4FP5 D;  3K7A B;  3GDE A;  5I4D A;  1WTX A;  2LSS A;  5M3F B;  1O7Y A;  4QL5 A;  4DKA C;  2JA6 H;  5EBD A;  1YHB A;  1F2M A;  1K8A C;  1SND A;  5C4J H;  3OMG A;  2RA4 A;  2HQE A;  2ZJQ A;  4YCV A;  3BS1 A;  2Y0S E;  5F2D A;  1NNX A;  4K0K L;  3A8J E;  4U04 A;  5BR8 Q;  1AE3 A;  2EY1 A;  3J81 i;  3LX0 A;  1M90 C;  4I65 A;  1WCM H;  2B29 A;  4A93 G;  2F3V A;  4KHZ A;  4XDX A;  1VQG A;  3T13 A;  3I4M H;  4UAI A;  3CRK C;  4GKJ L;  4RA8 A;  1RCV D;  3J7Y W;  4NXM Q;  1K3R A;  2VB2 X;  1K0R A;  2A73 B;  2BA0 A;  1PYS B;  4CGY B;  1BQQ T;  3FRP B;  1EUJ A;  3T53 B;  1PZI D;  2EYF A;  1VQA A;  3L0O A;  4QIW B;  2NVQ H;  3J81 E;  4R4C A;  1I4R A;  5C5L A;  5EPL A;  4A3M H;  2KOL A;  3DEO A;  5IOC A;  2F4I A;  2BOS A;  3ND9 A;  4KKT A;  3TRE A;  3FKI H;  5M5W H;  3VDY A;  1XMO L;  2Q2I A;  2L12 A;  4DAY A;  1BR9 A;  5C0X H;  4DV3 Q;  3LNN A;  1PH9 A;  2XSC A;  3L7Z C;  2F0G A;  3DWP A;  5A2Q L;  4EVO A;  1DJR D;  5JJK A;  1PRT F;  2K04 A;  1EYA A;  1HUM A;  2NVT B;  3CMA A;  1WCM G;  4PY3 A;  4XI8 A;  1E2W A;  1FNV A;  3HOV B;  5IGF A;  4BY1 G;  1NR4 A;  4H0L C;  1NBW A;  3CCQ A;  2AHO B;  3I4M G;  2L4N A;  1BVS A;  1L1O B;  3KLR A;  2MO1 A;  2VQF Q;  5IIF A;  4WJW A;  1SE4 A;  1STA A;  1E2Z A;  2KCC A;  3OTO L;  2I0Q A;  2NZO A;  2XTI A;  3SGI A;  3GP7 A;  4DK0 A;  2K5Q A;  5IT9 E;  2K4K A;  5DM7 3;  5I6W A;  4LK1 C;  3NK9 A;  3F2B A;  1VQJ A;  2L1B A;  1KC8 C;  1EZ6 A;  1WTW A;  1B3A A;  1UUP A;  3A55 A;  5M3F H;  4CDD C;  5CBA E;  4LF6 L;  1HRJ A;  1VMC A;  4DV2 L;  4IFD I;  3FKI G;  4C3I B;  4A75 A;  3I70 A;  1H9K A;  4ODG A;  1VQN A;  1HHV A;  4HTH A;  2AUJ D;  2Y0S B;  4IUV A;  2SDF A;  2UXB L;  1JWS D;  4KY6 A;  3UI2 A;  4RHR A;  4LF9 L;  3MEH A;  1KDC A;  3DMU A;  4L8J A;  4JI8 L;  5CV5 A;  3ZC7 A;  3MVV A;  3K57 A;  5C5M A;  1S5E D;  3S1Q B;  1OXX K;  2C5C A;  1EFW A;  3PO3 B;  4DV6 L;  3K5O A;  3E9I A;  2JA8 B;  3S2H H;  1JJC B;  5CV9 A;  1UEA B;  2YTX A;  4FDB A;  4A3D B;  2RSN A;  2GVB A;  4X2E A;  1Q8K A;  1JJ2 A;  1BCP D;  3KBG A;  4FXK C;  4IPG A;  2XWB B;  2IPK D;  2UU9 L;  2JEB I;  4BBS B;  4L5T A;  2BH2 A;  1PRT B;  1YNN D;  2E74 C;  3PGZ A;  3J7Z C;  5M3F G;  1KDB A;  1W3S A;  1EIG A;  4GLX A;  2YYZ A;  2IHE A;  4JYA Q;  3Q6S A;  2CCZ A;  1TWG B;  3ZJY C;  4C3J B;  1XYI A;  2HHH Q;  1Y1V G;  1D5Z C;  4LF8 Q;  2P5Z X;  3DUZ A;  2F4V L;  3R93 A;  4HJ5 A;  3LWU A;  1Z9F A;  3PF5 A;  5FO8 B;  3NBH A;  1HNZ L;  3PF4 A;  4PMB A;  1Q7Y C;  1ASY A;  3MA2 B;  3EN2 A;  2CVR A;  4A4I A;  1S72 A;  1I94 L;  5L37 A;  2MP1 A;  1MBY A;  2A68 D;  2PQA B;  2NVT H;  5GAD C;  1G6P A;  1FL0 A;  1SYG A;  3HOV H;  2XIW A;  5LHY 1;  4LUV A;  1NJI C;  3NPP A;  1YVC A;  4H13 C;  4LMQ D;  5JJ7 A;  1IHZ A;  3E6Z X;  5CMT A;  2NVX B;  4JW0 A;  1DCZ A;  4L5R C;  3RUZ A;  3G48 A;  1HZA A;  1XMQ L;  1LT6 D;  4QMG A;  1ILP A;  3PCO B;  3D3R A;  1PTO B;  3QIA A;  3GTL B;  2X6L A;  2EOT A;  1NCV A;  5C3W A;  1EWC A;  2K5H A;  1PH1 A;  1KNE A;  5CV6 A;  3ZLM A;  5ISR A;  4ME3 A;  2KCT A;  1K8O A;  1AZP A;  4F88 A;  1HR0 W;  4UPA A;  1GUO A;  4C3I H;  1S40 A;  1Y14 B;  1QJO A;  3EVQ A;  2K7V A;  5JEA G;  4CDF C;  4O0A A;  3K5N A;  1HNW L;  4P71 A;  4TRD A;  3HOZ B;  1JB7 A;  1KRS A;  3PUV A;  5KIX A;  2KEC A;  2UXC Q;  2EY2 A;  3CC4 A;  4X3S A;  3OIP A;  3MXN A;  4XQQ A;  1KQS A;  1PLF A;  3OYY A;  3I4N B;  3S1Q H;  4X64 L;  4DUY L;  3PO3 H;  4HR7 B;  2QGQ A;  2D5D A;  2OT2 A;  2R92 H;  4A3D H;  4IFD J;  1ET6 A;  4YY3 Q;  3CCJ A;  3QJY A;  1JB3 A;  5CGL A;  1GHJ A;  2KEE A;  5LMU L;  2H1E A;  4TKO B;  2IHF A;  4B3R L;  1SNO A;  4BBS H;  4FXG C;  5CKL A;  4ITR A;  1XXG A;  2JK8 A;  3K5M A;  2EDG A;  1RDP D;  4IZ8 A;  4U07 A;  5D3D A;  1PFS A;  4OL7 A;  1CUK A;  2UUC L;  1IBK Q;  4UY8 C;  1SR3 A;  2KBN A;  1SFO H;  4LFB Q;  3KF6 B;  1P8L A;  2Z4I A;  1HR0 Q;  2I07 B;  4ZKB B;  5IYD H;  3A8I E;  1WTH A;  1OO9 B;  5CGK A;  1PH6 A;  3A5Z B;  2VZA A;  2QKI C;  2VQE Q;  4JPB W;  2FFK B;  4P73 A;  3VYR A;  4WJ3 M;  4KHP Q;  1XTD A;  2NVX H;  2F0T A;  4GNX A;  3CPW A;  2R92 G;  5FKA C;  3DWA A;  1UEB A;  2JA9 A;  2EJF C;  1CHQ D;  1PTO H;  2SNS A;  3BVG A;  3K81 C;  3GTL H;  3ITP A;  1EYC A;  2UUB Q;  2Z4H A;  2B2W A;  2QDL A;  3I7F A;  1Y69 U;  2NYZ D;  3S1M B;  4PMC A;  1JWU D;  2YTV A;  3IKJ A;  5ELE A;  1VQH A;  1O80 A;  5LL6 X;  1S3O A;  2A19 A;  4QY7 A;  4ZLT F;  3A7L A;  5D3I B;  3LET A;  4JBK A;  2E2I B;  1QUQ B;  3A5U A;  1DGS A;  4HSV A;  4DAV A;  2K5D A;  5I2X A;  4JI2 L;  1XX8 A;  3GD7 A;  3U58 A;  5COY A;  5IP7 G;  2AWN A;  4DGZ A;  1PH7 A;  5IYD G;  4HED A;  1LTA D;  1IBM L;  4WGJ A;  2OQ0 A;  2A6E C;  3AMU A;  2ICE C;  2PO4 A;  3H3V H;  5D14 A;  4EQN A;  3U9S A;  1SJH D;  4OIJ A;  5IYC G;  1B70 B;  3Q8D A;  1MIU A;  4DR6 Q;  4XT3 B;  4E6I A;  5BN4 A;  4KJN A;  2PPB C;  1HPC A;  2ZTC A;  1EQR A;  4PNY A;  3D4D A;  3M4P A;  1GHK A;  2ZJP A;  4IUR A;  5DEH A;  2RBM A;  5BR8 L;  1Z6H A;  3Q23 A;  4TSS A;  1PH5 A;  2K5W A;  1HXY D;  1ENA A;  4MNO A;  4R4O A;  3J80 c;  3GTG B;  2KA7 A;  3C1E A;  5EKI A;  4JI0 Q;  3G4S A;  4B9W A;  3FEW X;  4X66 Q;  1X32 A;  2VUM B;  3H91 A;  4BXX H;  4DR5 Q;  1V43 A;  1MI2 A;  1BO0 A;  1HQM C;  3S15 B;  3CCS A;  3T56 B;  4NXM L;  2JJQ A;  2E5L Q;  3MC0 B;  1ZKO A;  1A62 A;  1VQF A;  1UE7 A;  3CKI B;  2LMC B;  2M00 A;  2I46 A;  3I56 A;  2JA5 G;  1TS3 A;  2B8F A;  1EOV A;  1L1O A;  1Y1W H;  3ERQ A;  1PTO D;  4ZAI A;  2IWH A;  5A35 A;  4DR3 Q;  3OHX C;  3TP8 A;  2PZU A;  1UE6 A;  2C9O A;  4L6T B;  3L2P A;  5CV8 A;  2IL8 A;  1IW7 D;  3HZX A;  2Z1C A;  2GVA A;  3IL8 A;  1QIL A;  4DV3 L;  1MJC A;  4JI5 Q;  4OO1 H;  3P1H A;  4DK1 A;  4XT1 B;  2RHQ B;  4A93 B;  1Z7T A;  3I2Z A;  4YCW A;  2CHB D;  1BCP F;  1K0S A;  4DR4 Q;  5C0X I;  1PZJ D;  2ZM6 L;  1FNW A;  3FP9 A;  1LT4 D;  4IOC A;  2LKV A;  2MGS A;  2BE5 C;  1G29 1;  5EU0 A;  3AFQ A;  2QA4 A;  1ET9 A;  1TWF B;  2VQF L;  1MSH A;  3I91 A;  1GKH A;  3HG9 A;  5A2Q E;  3KBX A;  3A74 A;  3T51 B;  2EYL A;  2F52 A;  1Q8I A;  5CYU A;  5C3E H;  1LM0 A;  1EFI D;  2F0K A;  1Y1W G;  2A68 C;  2HQL A;  3LWE A;  4ZUJ A;  1HH2 P;  3T4A C;  3DLL A;  4IUN A;  2CH4 W;  2L11 A;  1D6E C;  5C4J B;  3MZ5 A;  3D8G A;  3QB3 A;  3ERS X;  4IJL A;  4HCE A;  1FYC A;  1QCB D;  2X69 A;  1ZEQ X;  3VYS A;  2NVY B;  3EA6 A;  3FVQ A;  2B2W C;  2OCE A;  2QW7 A;  1E7Z A;  4OX9 L;  1WCM B;  1Q12 A;  3VA7 A;  4CHT B;  3HOX H;  3CD6 A;  1VQK A;  4BY1 B;  4GLV B;  4A3K G;  1HA6 A;  4P2C B;  3D4W A;  3KLS A;  3MAQ A;  3GTG H;  4FYD A;  4TVA B;  4G57 A;  5KRU A;  3W3A A;  4H02 A;  5FO7 B;  1EY9 A;  2ZTD A;  3KOJ A;  4HMJ A;  2VUM H;  2NN6 G;  4XIG S;  2PQA A;  3R3O A;  3CCV A;  1XNQ Q;  3S15 H;  1AH9 A;  3U50 C;  1CT1 D;  4A3J H;  3I73 A;  4UDU C;  3NTI A;  4P75 A;  2F6S A;  2JXM B;  5J22 A;  1XNR Q;  4JV5 L;  3CXC A;  4JBW A;  5C3E G;  3J7A V;  2NVQ B;  2NTT A;  4EX5 A;  4RKL A;  4H7B A;  4JOI A;  5J39 A;  1YIT A;  2JSO A;  4U67 3;  2VY3 A;  1BCP B;  4RFB A;  2PCF B;  3FKI B;  1FNU A;  3TN2 A;  1U4M A;  1GUG A;  4LNQ A;  4JYA L;  3STB D;  1WTV A;  3NQI A;  1YNX A;  5ELD A;  4N8F A;  2HHH L;  2R7D A;  2WP8 J;  4LF8 L;  1B50 A;  3NP8 A;  1MD2 D;  2RF4 A;  4KI0 A;  5EKL A;  3URY A;  4A3G H;  3EJI A;  3SE5 A;  1BXT A;  2UXD Q;  3J80 i;  2PQE A;  1NUC A;  3HOX G;  3M4Q A;  1YBY A;  3ERO A;  1JOK A;  3M7G A;  1D8L A;  4AH6 A;  2JQO A;  3CCU A;  1KAA A;  1Y8P B;  2K75 A;  4IO9 A;  2J4X A;  4GNX B;  4CKE A;  1IL2 A;  4A3J G;  2ATW A;  3GTP H;  5T1G A;  4IJH A;  1IBL Q;  2D0O A;  1L1O C;  1K73 C;  1SNQ A;  1HFN A;  4FF3 A;  3J80 E;  3UE0 A;  3N52 A;  1FGB D;  2K52 A;  4LF5 L;  3EBE A;  5C0X J;  3G6J B;  1LTG D;  1LAC A;  1HZ9 A;  1Y1V B;  4M1U B;  4JCV E;  4BA2 I;  3TRZ A;  1C8C A;  1KXL A;  5C4X B;  1M8A A;  1WI5 A;  2NVY H;  1K9M C;  3S2D B;  3J7A F;  3PIO A;  5JOB A;  4X2C A;  3K7U C;  1A3U A;  5J1Z A;  1E0B A;  1ESR A;  4A3G G;  1KLG D;  3MTS A;  3K5L A;  2UXC L;  4KD3 A;  1B8A A;  3P7J A;  2B2V C;  4BY1 H;  1N9W A;  5H1S E;  2X6G A;  2IX3 A;  3KLW A;  1TWA H;  4X2D A;  2PZT A;  1ZYR C;  2DJG C;  3KF6 A;  1X65 A;  1EYD A;  3S2H B;  2CQA A;  1SE8 A;  1SJE D;  1D1I A;  2IT1 A;  3HOY B;  2R61 A;  4AIM A;  4KN4 C;  3PUY A;  4C1N I;  4YY3 L;  4HIM A;  4B9X A;  4M16 A;  3A54 A;  1VQ4 A;  1HNX Q;  2D2C C;  3ONA B;  3VYU A;  4RGT A;  1JWM D;  2A8V A;  4DR1 Q;  3NSW A;  1VF7 A;  1I4H A;  1NY4 A;  3CQZ H;  4A3I B;  1JMC A;  1PRT C;  1D2B A;  1S4Z A;  3U4Z A;  1KL9 A;  1G2S A;  4LFB L;  3CCR A;  2CWA A;  2CW0 C;  5I9O A;  3GV3 A;  1FJG L;  1HR0 L;  2A1A A;  2NB0 A;  2K01 A;  3PMF A;  3IRB A;  1YNJ D;  1UWV A;  2K5V A;  5DLQ E;  3CC2 A;  2F0E A;  1QUQ A;  4U0U A;  1SSO A;  2OQK A;  2RKS A;  4MZ9 A;  4KHP L;  5HY6 A;  3GTM H;  3V05 A;  2JA7 B;  4DK3 C;  1KD1 C;  5GAH C;  3GV6 A;  3CAM A;  2F0F A;  1X54 A;  4A3E B;  3QOL A;  1TS5 A;  2RDF A;  3WOF A;  2EY6 A;  5IOD A;  2WB1 G;  4RCN A;  3FDT A;  1NE3 A;  3PUZ A;  3SHG A;  4J8Q A;  2UUB L;  2O5I C;  1O78 A;  1SXT A;  3TZD A;  4KJO A;  2PMZ E;  4DXG A;  1VQ8 A;  1QNU A;  4QCL A;  1FR3 A;  1PTO C;  2WAQ B;  1JOR A;  2L15 A;  1Y1V H;  4JBJ A;  1DOL A;  1EIY B;  4RCO A;  1GUN A;  4HIO A;  1PTO F;  4IPC A;  5C4X H;  4HJA A;  4DN4 M;  3S2D H;  4DV5 Q;  1STY A;  2ALY B;  1N33 Q;  4Z9C B;  1KRT A;  1U4L A;  2B2T C;  2RVL A;  2XWJ B;  1H9J A;  4LF7 Q;  1IW7 C;  1EY5 A;  1CZW A;  5NUC A;  4A3B B;  3ND8 A;  4QQB X;  4B3T Q;  2K14 A;  4JK1 C;  5HGT A;  5E4W C;  1CKN B;  2CWP A;  3PIO 3;  2R92 B;  2N55 A;  3M85 A;  3HOY H;  2OTJ A;  2F0J A;  3EQL C;  2CQO A;  3MXG A;  1KAW A;  1VQ7 A;  1U4P A;  1SNM A;  3OW2 A;  5EQ0 A;  3CPF A;  4DV4 L;  5C6A A;  3A0J A;  3K59 A;  1CFM A;  3VR2 A;  4MN3 A;  2XVS A;  1ENF A;  2L9H A;  1VQP A;  1JJG A;  3S14 H;  4G7H C;  3PQI A;  4PZ7 A;  1ML0 D;  3RLF A;  5JEA H;  4A3I H;  2JYO A;  1WTQ A;  3V96 A;  1SFO B;  1A3V A;  2HCI A;  1SE3 A;  4GKK Q;  4JI0 L;  5C4X G;  1LTR D;  3NQT A;  1UNS A;  4X66 L;  1E24 A;  1A8V A;  4MTN A;  3SE0 A;  4NXN Q;  4DR5 L;  4NB3 A;  1V8Q A;  2E5L L;  4JI7 Q;  4X65 L;  3Q24 A;  4R4I A;  2F0V A;  1Q86 C;  3FPP A;  2AUK A;  5JAV A;  2PNR C;  3SDZ A;  1Q90 A;  1LAB A;  1RL2 A;  2JA7 H;  3HOY G;  1CKM A;  4XYQ A;  5KYL A;  1YIJ A;  1EWH A;  4ME5 A;  3RZO H;  3RN5 A;  5IGB A;  4QF4 A;  3OOC A;  1XJV A;  4A3E H;  3BYT B;  2CFM A;  1Q3L A;  4XTC S;  1HTL D;  5LMN W;  1AN8 A;  4B3S Q;  4F87 A;  5KGU A;  1LTL A;  1SMY D;  4JI5 L;  1WD1 A;  3JAM L;  3VR3 A;  1CZG A;  4DAP A;  3O13 A;  5ELC A;  2O2L D;  5M5X B;  1QVC A;  4RG1 A;  1PFM A;  4NKL A;  4DR4 L;  2PMZ B;  4LAA A;  3SEB A;  3KK7 A;  4A3I G;  3KJO A;  2A6H D;  4OO1 I;  1L0X B;  3PSI A;  1BOS A;  3BVZ A;  3E0J A;  2KCN A;  1E1T A;  1JE5 A;  4ZK9 B;  1KIX A;  4RGN A;  2XRQ D;  1JCK B;  2A69 D;  2K50 A;  3V2T A;  1CA5 A;  4A3B H;  4XXE A;  2E2J B;  3QO2 A;  2JA5 B;  4JI1 L; 
#chains in the Genus database with same CATH homology
 4X62 L;  4EQ5 A;  3UDG A;  3F8T A;  2UUA Q;  4JOI C;  1PH5 A;  1C9O A;  2ZTE A;  4MNO A;  1GO3 E;  2FXQ A;  3UDF A;  1VQB A;  4R4O A;  3CME A;  4B3M Q;  3J80 c;  5IWA Q;  4C2M H;  1I3Q H;  3W1G A;  4JI0 Q;  1K83 H;  4N67 A;  5JEA J;  3UE1 A;  4X66 Q;  3G4S A;  1QZH A;  1TWH H;  2JA7 G;  4DR2 L;  1E3P A;  4BXX H;  3KJP A;  4DR5 Q;  1V43 A;  1B7Y B;  4YWM A;  2PNH A;  3CCS A;  4NXM L;  4L5S A;  3E0E A;  2JJQ A;  4LUZ A;  2E5L Q;  2ASB A;  4A3E G;  1A62 A;  1VQF A;  5C44 G;  1AE2 A;  1UE7 A;  4GN5 A;  1CKO A;  3F1Z A;  3K7A H;  4DUZ L;  4DV1 Q;  3UDI A;  4HJ8 A;  4A93 H;  3I56 A;  2JA5 G;  3RLN A;  4A3M G;  1EOV A;  2EQS A;  3KDF B;  3ICE A;  1L1O A;  3CUC A;  2N3S A;  4IPD A;  1Y1W H;  4DR3 Q;  4LFA L;  1FGU A;  3TS2 A;  1UE6 A;  5LMN Q;  1QVF A;  1E1O A;  5C0X G;  1T9H A;  2WAQ G;  1N34 Q;  3S1N H;  4QJF A;  2VUM G;  1J5E Q;  3L2P A;  2R6G A;  4JI2 Q;  4JI3 Q;  1TWF H;  4QGU A;  4DR6 L;  1Q1E A;  3RNU A;  1M1K C;  1NMG A;  1IBM Q;  1PVO A;  3D0F A;  2GVA A;  4DV3 L;  2EIF A;  1MJC A;  2OTL A;  4JI5 Q;  3HKZ G;  4OX9 Q;  5IP7 H;  4RMF A;  4UP9 A;  1XNQ L;  1YHQ A;  2D62 A;  1GD7 A;  3H3V I;  4A3B G;  2RHQ B;  3GDE A;  3TEH B;  3I2Z A;  4YCW A;  1OXV A;  2LSS A;  1XNR L;  4DR4 Q;  4DKA C;  4QL5 A;  5C0X I;  3F2C A;  2JA6 H;  2R7Z H;  2PI2 A;  1SRU A;  1YHB A;  2ZM6 L;  1K8A C;  1C0A A;  2R93 H;  4J15 A;  5IYC H;  3GTJ H;  3FP9 A;  2UUA L;  5C4J H;  2PI2 E;  4LFC L;  2MNA A;  4IOC A;  1XPO A;  2KEN A;  2ZJQ A;  2B3G A;  1G29 1;  4YCV A;  5EU0 A;  2HT1 A;  3AFQ A;  4X6A H;  2QA4 A;  2Y0S E;  2ZJR A;  4K0K L;  2VQF L;  4JV5 Q;  1GKH A;  4U04 A;  3I55 A;  5BR8 Q;  1YJW A;  1AE3 A;  3A74 A;  1VQO A;  3J81 i;  1M90 C;  2N49 A;  4X62 Q;  4DNI A;  2F52 A;  1WCM H;  2B29 A;  4A93 G;  5C3E H;  2I5L X;  4KHZ A;  1VQG A;  1LM0 A;  1Y1W G;  3I4M H;  5M5X H;  2HQL A;  2UXD L;  1HH2 P;  3NEL A;  2I5M X;  3AQQ A;  2Z0S A;  4UP8 A;  3DLL A;  4DR2 Q;  4GKJ L;  4DR3 L;  2VNU D;  4JI6 L;  3JC6 6;  1VQ6 A;  4NXM Q;  1K3R A;  3ERS X;  4IJL A;  1YHA A;  3K8A A;  1K0R A;  2BA0 A;  2Q2T A;  1PYS B;  1YJ9 A;  4DUZ Q;  1Q81 C;  1N8R C;  4JI4 L;  1EUJ A;  4LFA Q;  4C3H H;  3T1H L;  4LF6 Q;  1VQA A;  4APV A;  2OCE A;  3L0O A;  2NVQ H;  2E2J H;  1E7Z A;  4R4C A;  2JA5 H;  1Q12 A;  3ULP A;  3RZD H;  4OX9 L;  3HOX H;  4A3M H;  3CD6 A;  4DAM A;  1IBL L;  1VQK A;  1KHI A;  4GLV B;  5AJ3 L;  2OWO A;  2R7Z G;  4A3K G;  3GTO H;  1XMO L;  3TRE A;  5M5W H;  3FKI H;  3VDY A;  2R93 G;  2Q2I A;  1VQ9 A;  3UDX A;  3GTG H;  4TVA B;  3NEN A;  4H02 A;  1R9T H;  1OTC A;  1LYL A;  2ZTD A;  1EWI A;  3KOJ A;  2VUM H;  4DV3 Q;  1PH9 A;  2NN6 G;  1H95 A;  4XIG S;  3L7Z C;  2PQA A;  5FJ8 H;  3CCV A;  1GM5 A;  1XNQ Q;  3S15 H;  4YWK A;  1AH9 A;  3U50 C;  5JJK A;  1V9P A;  3TQY A;  4A3J H;  1PYB A;  1A0I A;  4P75 A;  3STB C;  2F6S A;  2E8G A;  1QZG A;  1U5K A;  1XNR Q;  1OXT A;  3CXC A;  3PUW A;  1WCM G;  4JBW A;  3CMA A;  4PY3 A;  4XI8 A;  5C3E G;  1D7Q A;  1N32 L;  4BY1 G;  4EX5 A;  1GVP A;  4LF5 Q;  1NBW A;  3CCQ A;  1OXS C;  2AHO B;  5J3B A;  4JOI A;  4GOP A;  1YIT A;  1I50 H;  1X55 A;  4LFC Q;  3I4M G;  1BVS A;  2R7F A;  2VY3 A;  3CCL A;  1NTG A;  1WJJ A;  1L1O B;  2MO1 A;  2NN6 I;  3LGJ A;  3S6A A;  1PH8 A;  4K0K Q;  1X9N A;  2VQF Q;  4IFD G;  3RLO A;  4LNQ A;  1L2F A;  4JYA L;  1WYD A;  3STB D;  4OWT B;  4A3C H;  4P74 A;  3OTO L;  1YNX A;  2I0Q A;  4JBM A;  2NZO A;  4GN4 B;  2R7D A;  2XTI A;  3SGI A;  2WP8 J;  2HHH L;  4LF8 L;  4A3B H;  3HOW H;  5JJL A;  2JEA I;  2K4K A;  4GN3 B;  2RF4 A;  4A3L H;  4KI0 A;  4AQY L;  1PA6 A;  3F2B A;  2LXJ A;  2WB1 E;  4A3G H;  3CC7 A;  1VQJ A;  1KC8 C;  1N36 L;  4HID A;  3HOV G;  3SE5 A;  5JJ6 A;  3D31 A;  3J80 i;  2UXD Q;  3HOX G;  4A76 A;  5M3F H;  3K0X A;  4LF6 L;  1BKB A;  3M4Q A;  1HNX L;  4GKJ Q;  1YBY A;  4JI6 Q;  4DV2 L;  1I5F A;  2H5X A;  2KHJ A;  3FKI G;  2JA8 H;  2DUD A;  3JAM c;  4IFD I;  4A75 A;  4WJ4 A;  1D8L A;  1SRO A;  2ID0 A;  4YWL A;  4AH6 A;  4DR1 L;  4A3F H;  2JQO A;  3CCU A;  4R4T A;  4NPS A;  1BBW A;  1MJE A;  2Q2U A;  2K75 A;  5ELN A;  4IO9 A;  1VQN A;  1JT8 A;  2KCM A;  5FJ8 G;  1HZB A;  4GNX B;  4JI4 Q;  3T1H Q;  2UXB L;  3U4V A;  1IL2 A;  3EIV A;  4A3J G;  2ATW A;  3GTP H;  3S16 H;  5EAY A;  1CSP A;  4LUO A;  3PIP A;  4IJH A;  4DV0 L;  2YU9 H;  1IBL Q;  4LF9 L;  2D0O A;  4JI8 L;  5AJ3 Q;  3S1R H;  1L1O C;  2C35 B;  2I5H A;  3ZC7 A;  1XMO Q;  1K73 C;  1FVI A;  4KLK A;  1OXX K;  3UE0 A;  1EFW A;  2MQH A;  1TWG H;  4DV6 L;  4O2D A;  4C3J H;  4A3K H;  3E9I A;  2BH8 A;  2K52 A;  4LF5 L;  3S2H H;  1JJC B;  3EBE A;  5C0X J;  2YTX A;  4FDB A;  1YEZ A;  3RR5 A;  1HZ9 A;  4B3R Q;  2GVB A;  4X2E A;  4JCV E;  1PV4 A;  2Y0S G;  3TRZ A;  1Q8K A;  1JJ2 A;  1VQ5 A;  4BA2 I;  4A3C G;  1KXL A;  4P72 A;  4IPG A;  1IZ6 A;  1WI5 A;  4JG2 A;  1FJG Q;  5M5Y H;  3HOW G;  2NVY H;  1K9M C;  4ALP A;  4LU4 A;  3PIO A;  3N3U A;  4X2C A;  2UU9 L;  3K7U C;  2JEB I;  4A3L G;  3G6E A;  1N32 Q;  4HIK A;  4L5T A;  2BH2 A;  3KYH C;  4A3G G;  3H15 A;  5K36 G;  3PGZ A;  4GS3 A;  2UXC L;  1B8A A;  2B63 H;  1CKN A;  2Z6K A;  3J7Z C;  5M3F G;  1W3S A;  1N9W A;  4GLX A;  4BY1 H;  1HJP A;  2YYZ A;  5H1S E;  3PO3 G;  2IHE A;  3KLW A;  3F2D A;  1TWA H;  1Z47 A;  2JA8 G;  4X2D A;  4PZ8 A;  4JYA Q;  1PH3 A;  4GNX C;  3KF6 A;  2CCZ A;  1X65 A;  3ZJY C;  4IPH A;  1G51 A;  3OTO Q;  2HHH Q;  4A3D G;  1Y1V G;  4A3F G;  4LF8 Q;  2F4V L;  4OO1 G;  2JE6 I;  4HJ5 A;  1SE8 A;  1Z9F A;  3PF5 A;  2IT1 A;  2VS1 A;  1HNZ L;  4DAY B;  3PF4 A;  2AMC B;  4AIM A;  1Q7Y C;  4AQY Q;  1ASY A;  3BU2 A;  3EN2 A;  3PUY A;  1K8G A;  1N36 Q;  5E7N A;  4A4I A;  2DGY A;  4YY3 L;  4DK6 C;  4HIM A;  2N8N A;  1S72 A;  4M16 A;  1I94 L;  4BBS G;  2PQA B;  5M3M G;  1VQ4 A;  2NVT H;  5GAD C;  4DV5 L;  1PH4 A;  1G6P A;  1FL0 A;  1HNX Q;  3HOV H;  1XPU A;  1IXR A;  3ULJ A;  1N33 L;  3CCM A;  4DV2 Q;  1Q82 C;  3BJU A;  4DPG A;  4LUV A;  4LF7 L;  2F3I A;  1NJI C;  1YVC A;  3S24 A;  3CCE A;  1QVG A;  2A8V A;  4DR1 Q;  5JJ7 A;  2RCN A;  4L5Q A;  4AYB E;  4B3T L;  4Y52 H;  5CMT A;  2MFI A;  4R1J A;  1YJN A;  4GOP B;  3HKS A;  4L5R C;  4POG A;  3HOZ H;  1NY4 A;  3GO5 A;  3G48 A;  2UXB Q;  3CQZ H;  3ZCB A;  1HZA A;  1XMQ L;  1JMC A;  5ELO A;  5JFF A;  3PCO B;  1Q1B A;  2NZH A;  4DV0 Q;  3U4Z A;  1KL9 A;  4LF9 Q;  3AFP A;  4JI8 Q;  2IX1 A;  4LFB L;  3CCR A;  2CWA A;  1P16 A;  2GN5 A;  3FHW A;  1FJG L;  5IP9 G;  1HR0 L;  2A1A A;  2K5H A;  2AWO A;  1PH1 A;  2B63 G;  3ZLM A;  4PMW A;  3I4N H;  1VQM A;  4DV6 Q;  3IRB A;  4ME3 A;  2LXK A;  2KCT A;  1RIP A;  1UWV A;  2K5V A;  4OXP A;  3AEV A;  5DLQ E;  3T1Y L;  5FLX c;  4UPA A;  3TS0 A;  1HR0 W;  4C3I H;  3CC2 A;  1WOC A;  1CSQ A;  1J6Q A;  1QUQ A;  4U0U A;  1Y14 B;  3AYH B;  1S40 A;  3NEM A;  4TQU S;  3KFU A;  2OQK A;  4HJ9 A;  2CKZ B;  4MZ9 A;  5JEA G;  5GQO A;  4O0A A;  4JC0 A;  1W2B A;  3GTQ H;  4KHP L;  1HNW L;  4P71 A;  5HY6 A;  3GTM H;  1NMF A;  4DK3 C;  1KRS A;  1O7I A;  1JB7 A;  2UU9 Q;  1KD1 C;  3PUV A;  5GAH C;  3CAM A;  1X54 A;  2UXC Q;  1EYG A;  3CC4 A;  2E2H H;  2VL6 A;  4DV4 Q;  4GKK L;  5JJI A;  2WB1 G;  1X6O A;  3G71 A;  4IOA A;  4NXN L;  2G03 A;  1NE3 A;  1KQS A;  3OYY A;  4UP7 A;  4DV7 L;  4GOP C;  1X3E A;  3PUZ A;  3SHG A;  3W5O A;  4X64 L;  4DUY L;  2UUB L;  4JI7 L;  3S1Q H;  3PO3 H;  3DM3 A;  4DR7 L;  2F4V Q;  3W1B A;  2PMZ E;  2QGQ A;  4BA1 I;  4YHH L;  3WWV A;  1VQ8 A;  1HNZ Q;  3H0G H;  2R92 H;  3M7N A;  1V1Q A;  2L15 A;  1ASZ A;  3HOZ G;  4A3D H;  1Y1V H;  2N78 A;  3MEF A;  2YV5 A;  4JBJ A;  4IFD J;  2QEX A;  2VW9 A;  1SLJ A;  4YY3 Q;  4HJ7 A;  3CCJ A;  1EIY B;  1I94 Q;  4HIO A;  5C4X H;  4IPC A;  4HJA A;  3HOU G;  5FLM H;  5CGL A;  2AKW B;  3S2D H;  4X65 Q;  4DV5 Q;  5LMU L;  4B3R L;  2IHF A;  2ALY B;  1N33 Q;  1KRT A;  3PUX A;  4BBS H;  5M3M H;  4LF7 Q;  5CKL A;  3JAM i;  4ITR A;  3I4N G;  2JK8 A;  4BBR H;  4B3S L;  4QQB X;  4B3T Q;  2K14 A;  4U07 A;  2KHI A;  3KF8 B;  4LWC A;  1PFS A;  3BZC A;  1CUK A;  3I4O A;  1CKN B;  3CP0 A;  2UUC L;  1IBK Q;  2CWP A;  5IE8 A;  1XMQ Q;  2WAQ E;  4UY8 C;  1SR3 A;  4U0S A;  2KBN A;  1YZ6 A;  3HFZ B;  1VQC A;  4OON A;  2WFW A;  3M85 A;  1SFO H;  3HOY H;  4LFB Q;  3KF6 B;  2EXD A;  1P8L A;  2OTJ A;  1VQD A;  5IY0 A;  3RN2 A;  5GAE C;  1HR0 Q;  3HKZ E;  3NBH B;  3M3Y H;  3B6Y A;  2CQO A;  3KDF A;  5IYD H;  1I6H H;  1VQ7 A;  1KAW A;  2XGT A;  1PHJ A;  3OW2 A;  1IYJ B;  1PH6 A;  3S1M H;  4POF A;  5IP9 H;  3T1Y Q;  3A5Z B;  3CPF A;  1XPR A;  2VZA A;  2VQE Q;  2IX0 A;  4P73 A;  4DV4 L;  1EQQ A;  3A0J A;  4LF4 L;  3J81 c;  4WJ3 M;  3E9H A;  4BY7 H;  1HNW Q;  4KHP Q;  1XTD A;  1VQP A;  2NVX H;  1JJG A;  4GNX A;  3S14 H;  3ULL A;  1X56 A;  3H0G G;  4PZ7 A;  3CPW A;  2R92 G;  3M4O H;  4YCU A;  2E2I H;  3RLF A;  4A3I H;  1UEB A;  3BZK A;  4B3M L;  4BXX G;  5IWA L;  2JA9 A;  2IY5 B;  3PO2 H;  5C4X G;  1VQI A;  4GKK Q;  4JI0 L;  5FLM G;  1VQE A;  4X66 L;  4LW1 A;  3SN9 A;  1E24 A;  3PV0 A;  3K81 C;  1A8V A;  4MTN A;  4NXN Q;  3GTL H;  4JI1 Q;  4DR5 L;  5IYB H;  4NB3 A;  4DV7 Q;  1C7Y A;  2MO0 A;  2UUB Q;  1X3F A;  4X64 Q;  4DUY Q;  1YI2 A;  2E5L L;  1X3G A;  5GAG C;  4R4I A;  2Z6K C;  3I7F A;  4X65 L;  4JI7 Q;  4DR7 Q;  4JV5 L;  4PG3 A;  1A63 A;  2BA1 A;  2YTV A;  3J7A 5;  4BBR G;  3K80 C;  4YHH Q;  3J81 j;  2Q2H A;  4DV1 L;  1Q86 C;  1VQH A;  1S3O A;  1LUZ A;  4AYB G;  2A19 A;  4QY7 A;  3LET A;  1Q46 A;  1RL2 A;  4JBK A;  5HGQ A;  2JA7 H;  3GTK H;  3HOY G;  1CKM A;  5GRO A;  5LMN L;  5LMU Q;  1MKH A;  1QUQ B;  1OXU A;  2YTY A;  1DGS A;  3A5U A;  1YIJ A;  1N34 L;  1IBK L;  1J5E L;  1VS0 A;  4OWW B;  4JI2 L;  3RN5 A;  4JI3 L;  3HOU H;  3RZO H;  3GD7 A;  1HZC A;  3U58 A;  5IP7 G;  4A3E H;  2AWN A;  1XJV A;  2CFM A;  5JFZ A;  5C44 H;  4XTC S;  4U0Z A;  5LMN W;  5IYD G;  1PH7 A;  1IBM L;  5IT9 c;  4B3S Q;  4WGJ A;  1LTL A;  4JI5 L;  2OQ0 A;  1VCI A;  1TWC H;  4GLA C;  1L0W A;  1TXY A;  3MXN B;  2UUC Q;  2JA6 G;  3H3V H;  2V1C C;  1QVC A;  4RG1 A;  5IYC G;  4BY7 G;  1B70 B;  1WFQ A;  3Q8D A;  1MIU A;  2VQE L;  4DR6 Q;  4DR4 L;  2HIV A;  3CF5 A;  4Y7N H;  1VQL A;  2RHS B;  1BBU A;  1UE5 A;  4A3I G;  3S17 H;  2ZTC A;  1EQR A;  3KJO A;  4OO1 I;  2D0P A;  1U0L A;  3PSI A;  1SN8 A;  4OWX B;  3PO2 G;  3M4P A;  2HIX A;  1E1T A;  2ZJP A;  1JE5 A;  5IYB G;  1KIX A;  4LF4 Q;  2K50 A;  4QIW E;  1PH2 A;  4R4Q A;  1UE1 A;  1SMX A;  1E22 A;  5BR8 L;  3M9B A;  2K5N A;  1EIF A;  2ZM6 Q;  4PZ6 A;  3CW2 C;  3ER0 A;  2ES2 A;  4JI1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...